3MVDB

Crystal structure of the chromatin factor rcc1 in complex with the nucleosome core particle
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
82
structure length
82
Chain Sequence
KVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein/structural protein/dna
molecule keywords Histone H3.2
publication title Structure of RCC1 chromatin factor bound to the nucleosome core particle.
pubmed doi rcsb
source organism Xenopus laevis
total genus 25
structure length 82
sequence length 82
chains with identical sequence F
ec nomenclature
pdb deposition date 2010-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3mvdB00
1P34A 3UTAB 1ID3D 5CPIB 3AYWD 3MGQA 3AZHD 1EQZD 3AZFA 2F8ND 5AV8B 1M18C 1P3OB 4KGCC 2JSSA 3X1UC 3WA9D 3REIA 1JFIA 5AV5D 4CAYB 5JA4A 3X1TD 1KX3C 5B0ZB 2PYOD 1TZYD 3RELD 1U35D 1P3BD 3AZEB 5GT3D 3MGSD 5BT1C 5GXQD 4QLCD 5B31G 4J8WA 5JRGC 3LJAC 4KHAA 3B6FB 4WNNA 4AWLC 2FJ7A 3KUYA 3TU4B 3AYWC 3O62D 1F66C 3W99A 4YS3B 3AZJD 1KX4D 4HGAB 4UUZA 1BH9B 5CP6B 5AV5C 2NZDB 5AV9C 5AV6A 3X1TC 5B2IA 4J8UA 4Z66D 1M19C 3UT9B 5B32A 3B0DC 5B1MA 5GT3C 3MGSC 5GXQC 5AY8C 4LD9C 1P3FC 3B0CW 5B1LD 5CHLB 2BYKA 5B0YC 3X1VA 5BS7C 3AV1A 3MNNB 4JJNA 1P3GB 5E5AA 3REHC 1P3MB 2HUEB 3AZJC 3MGPA 5DNMC 3C1BB 1F1EA 3NQJB 3W96C 4X23A 4Z66C 3AZMD 4EO5C 5B31D 3KXBD 3AZFC 4H9OA 3KSYA 4WU9D 3B0BA 4Z5TD 3B6GD 1P3IB 1N1JA 5DNNA 3UTBA 3C1CB 4ZUXD 4R8PD 2YFVB 3W98A 3REJB 3AZID 3W97B 5CPKB 3LELA 4ZBJB 1ZLAD 5B24D 2L5AA 5B31C 1P3PD 5AVCD 4YM6D 3W99C 5B40C 2IO5B 4Z5TC 5GT0B 3UTAD 5CPID 1AOIB 3AN2B 5B2JA 5AV6C 1P3LC 4M6BA 4J8UC 4H9NA 1S32B 5JRGA 1P3OD 5KDMB 2F8NG 3AZIC 1ID3A 3AYWA 3AZHA 1P34B 1EQZA 5BO0A 5B0ZD 2CV5B 1F66A 3X1VC 5B24C 3MGQB 4J8VC 3REKB 3B0CT 3MGRB 3AZED 1P3PC 3WA9A 2BYMA 5AV5A 5C3IC 5AVCC 5AV9A 3X1TA 5CPJC 3REIB 4CSRA 5JA4B 1M19A 3B6FD 2NQBC 1U35A 2AROC 3TU4D 1HTAA 5GT3A 3MGSA 1P3BA 5GXQA 4X23C 1M1AB 5GSUB 4YS3D 3LZ0D 3NQUA 4J8XB 5CP6D 4J8WB 5B33C 2NZDD 4KHAB 3REHA 3O62A 4WNNB 3KUYB 3KWQB 3AZJA 1HQ3B 3UT9D 5DNMA 3W96A 3AZEC 3A6NB 4XUJB 4KUDC 3MVDB 4Z66A 3WTPC 3AZGC 5B2IB 3LELC 1P3AC 1P3GD 5F99C 3WKJC 3X1SB 3R45B 3WTPE 4XZQC 5B32B 3AZNC 3LZ0C 4HGAC 3C1BD 5CP6C 2BYKB 3VH5T 5AVBC 3WAAC 3AV1B 4JJNB 5E5AB 2YFWB 5B2JC 3UT9C 3LZ1C 4G91B 3MGPB 1ID3C 1P3ID 5B31A 3AZHC 1P3GC 3KXBA 1EQZC 3C1CD 3AFAB 1P3KB 5B40A 4Z5TA 3REJD 3B6GA 3WA9C 3W97D 5CPKD 1P3LA 2PYOC 1TZYC 1N1JB 5DNNB 5FUGA 3RELC 3UTBB 1U35C 3W98B 3VH6W 1P3BC 3AZIA 1BH8A 3V9RA 4QLCC 1TAFB 5B24A 3AV2B 4J8VA 1KX5D 1M18B 1AOID 1P3PA 3AN2D 4KGCB 3O62C 5AVCA 5CPJA 4G92C 3X1UB 1S32D 1KX4C 3AZLB 4WU8B 3REJC 1KX3B 2NQBA 2AROA 5CPIA 3W97C 4DRAA 1P34D 2CV5D 3MGQD 3REKD 3MGRD 5B33A 5JRGB 3LJAB 2HIOB 5B0ZA 4AWLB 5B1LC 3REID 5BNXA 3AYWB 2IO5C 2RVQD 5BO0B 1F66B 1KX5C 3AZEA 1M1AD 4KUDA 4H9RA 4WV4B 5GSUD 2BYMB 3WTPA 5AV9B 3AZGA 3X1TB 4J8XD 4J8WD 1P3AA 5F99A 3WKJA 4CSRB 1M19B 4XZQA 1B6WA 3B0DB 4NE5A 3VH6A 3KWQD 5GT3B 3MGSB 3AZMC 3AZNA 5GXQB 1HQ3D 3LZ0A 5AY8B 4LD9B 4NFTA 3KXBC 1P3FB 4NE6A 3A6ND 4XUJD 5CP6A 3AZKB 5B0YB 4WU9C 5AVBA 3WAAA 3MVDD 3B6GC 3REHB 5B2ID 3UT9A 3LZ1A 4ZUXC 4R8PC 5AV8D 3X1SD 3AZJB 5G49A 5B32D 5DNMB 3W96B 1P3GA 4Z66B 2F8NA 4EO5B 1A7WA 1ZLAC 3VH6T 3AV1D 4JJND 3AZFB 5E5AD 4NE3A 4YM6C 2PYOA 1TZYA 3RELA 1JFIB 4H9QA 3MVDC 3UTAC 5CPIC 4QLCA 5AV8C 3AFAD 1P3KD 1P3OC 5B0ZC 2FJ7B 5DNND 1H3OA 1KX4A 3REJA 3W99B 5B40B 3W97A 4UUZB 4Z5TB 5AV6B 1P3LB 3AV2D 3MNND 4H9PA 3B6FC 4J8UB 1M18D 3TU4C 4KGCD 1P3MD 5B1MB 3X1UD 4YS3C 3AZIB 1BH8B 5B1LA 3V9RB 3AZLD 4WU8D 1KX3D 1KX5A 1WWSA 3X1VB 5B24B 2NZDC 3AN2A 4J8VB 1P3PB 1S32A 5AVCB 5C3IB 5CPJB 5JRGD 3LJAD 2HIOD 2NQBB 2CV5A 3AZMA 4E44A 2AROB 4X23B 3AV2C 3MNNC 1F66D 3REKA 3MGRA 2LY8A 4WU9A 1P3MC 2HUEC 4H9OB 5B33B 5AV9D 3C1BC 3AZLC 4WU8C 4ZUXA 4R8PA 5BNXB 1M19D 1M1AA 5GSUA 4KUDB 4H9RB 1ULYA 5AY8D 2CWEA 4LD9D 1P3FD 4J8XA 5BNVA 3AZKD 3WTPB 5B0YD 2HIOC 3AZGB 1ZLAA 3LELB 5GT0D 1P3AB 5F99B 3KWQA 3WKJB 1P3IC 3REHD 1HQ3A 4XZQB 3C1CC 4YM6A 3A6NA 4XUJA 3AZNB 3LZ0B 2F8NK 5DNMD 3W96D 1Q9CA 3MVDA 3UTAA 5AVBB 5B32G 5CPKC 3WAAB 4ZBJC 5AV8A 3X1SA 1BFMA 3R45A 5B2JB 3AZFD 1P3OA 3LZ1B 4H9NB 4H9SC 5G49B 4CAYA 3AZKC 1ID3B 3AZHB 5GT0C 1EQZB 2F8NB 2YFWA 1AOIC 3AN2C 3WA9B 1S32C 5AV5B 3B6FA 2PYOB 1TZYB 3RELB 3TU4A 4H9QB 1P34C 1U35B 2CV5C 2FJ7D 3KUYD 4WZSB 3AFAA 4YS3A 1P3KA 3MGQC 1P3BB 1WWIA 4QLCB 3REKC 1BH9A 3W99D 3MGRC 5B40D 2NZDA 3NQUB 1B67A 3REIC 2RVQC 5AV6D 1P3LD 3O62B 2F8NH 4J8UD 3W98C 4G92B 1H3OB 1M1AC 1KX4B 5B1MD 1TAFA 5GSUC 3AV2A 3MNNA 4J8XC 4J8WC 1M18A 3X1VD 4KGCA 1P3MA 4J8VD 4H9PB 3VH5W 2FJ7C 3KUYC 3KWQC 3X1UA 1HQ3C 1R4VA 3C1BA 5CPJD 3NQJA 4WU8A 3A6NC 4XUJC 3AZLA 5B1LB 1KX3A 3MGPD 2NQBD 1KX5B 2AROD 4X23D 5B2IC 3X1SC 3LJAA 2HIOA 5B32C 4E45A 5B1MC 5B33D 1P3IA 4Z2MH 3C1CA 3AZMB 2YFVA 5B31B 3UTBD 3AV1C 4JJNC 3KXBB 1KU5A 3W98D 5E5AC 4KUDD 4WU9B 5CPKA 4G91C 3B6GB 3MGPC 3WTPD 3AZGD 3LELD 1P3AD 5F99D 3WKJD 4ZUXB 4R8PB 5FUGB 4H9SA 5AY8A 4XZQD 4LD9A 1P3FA 3AZND 3AZKA 3AFAC 1P3KC 5B0YA 5BS7A 5GT0A 4DRBA 5BNVB 1ZLAB 5AVBD 1AOIA 3WAAD 3VH5A 5DNNC 3UTBC 5BT1D 4Z2MG 5B2JD 3LZ1D 5KDMA 4YM6B
chains in the Genus database with same CATH superfamily
1P34A 3UTAB 1ID3D 5CPIB 3AYWD 3MGQA 3AZHD 2FFFB 1EQZD 3AZFA 2F8ND 5AV8B 1M18C 1P3OB 4KGCC 2JSSA 3X1UC 4DQYB 3WA9D 3REIA 1JFIA 5AV5D 4CAYB 5JA4A 3X1TD 1KX3C 5B0ZB 2PYOD 1TZYD 3RELD 1U35D 1P3BD 3AZEB 5GT3D 3MGSD 5BT1C 5GXQD 4QLCD 5B31G 4J8WA 5JRGC 3LJAC 4KHAA 3B6FB 4WNNA 4AWLC 2FJ7A 3KUYA 3TU4B 3AYWC 3O62D 1F66C 2DF4C 3W99A 4YS3B 3AZJD 1KX4D 3A1KA 4HGAB 4UUZA 1BH9B 5CP6B 5AV5C 2NZDB 5AV9C 5AV6A 3X1TC 5B2IA 3FDDA 4J8UA 4Z66D 1PZRA 1M19C 2UWXA 3UT9B 5B32A 3B0DC 5B1MA 5GT3C 3MGSC 3KFUG 5GXQC 5AY8C 4LD9C 1P3FC 3B0CW 5B1LD 5CHLB 2BYKA 5B0YC 3X1VA 5BS7C 3AV1A 3MNNB 4JJNA 1P3GB 5E5AA 3REHC 1P3MB 3EPHA 2HUEB 2VQRA 3AZJC 2Y2IA 3MGPA 5DNMC 3EPKA 3C1BB 1F1EA 3NQJB 3W96C 4X23A 4Z66C 3AZMD 4EO5C 5B31D 3KXBD 3AZFC 4H9OA 3KSYA 4WU9D 3B0BA 4Z5TD 3P5JB 3B6GD 1P3IB 1N1JA 5DNNA 3UTBA 3C1CB 4ZUXD 4R8PD 2YFVB 3W98A 2Y2OA 3REJB 3AZID 3W97B 5CPKB 3LELA 4ZBJB 1ZLAD 3H0RC 5B24D 2L5AA 5B31C 1P3PD 2F2AC 5AVCD 4YM6D 3W99C 2XD1A 2Y2NA 5B40C 2IO5B 4Z5TC 3A1IA 5GT0B 3UTAD 5CPID 1AOIB 3AN2B 5B2JA 5AV6C 1P3LC 4M6BA 4J8UC 4H9NA 1S32B 5JRGA 1P3OD 5KDMB 2F8NG 3AZIC 1ID3A 3AYWA 3AZHA 1P34B 1EQZA 5BO0A 5B0ZD 2CV5B 1F66A 3X1VC 5B24C 3MGQB 4J8VC 3REKB 3B0CT 3MGRB 3AZED 1P3PC 3WA9A 2BYMA 5AV5A 5C3IC 5AVCC 5AV9A 3X1TA 5CPJC 3REIB 3F6TA 4CSRA 2JCHA 5JA4B 1M19A 3B6FD 1U35A 2NQBC 2AROC 3TU4D 1HTAA 5GT3A 3MGSA 1P3BA 5GXQA 4X23C 1M1AB 5GSUB 4YS3D 3LZ0D 3NQUA 4J8XB 5CP6D 4J8WB 5B33C 2NZDD 4KHAB 3REHA 3O62A 4WNNB 3KUYB 3KWQB 3AZJA 1HQ3B 3UT9D 5DNMA 3W96A 3AZEC 3A6NB 4XUJB 4KUDC 3MVDB 4Z66A 3WTPC 3AL0C 3AZGC 5B2IB 3LELC 1P3AC 1P3GD 5F99C 3WKJC 3X1SB 3R45B 3WTPE 4XZQC 5B32B 3AZNC 3LZ0C 4HGAC 3EPJA 3C1BD 4UPKA 5CP6C 3EG5B 2BYKB 3VH5T 5AVBC 3WAAC 3AV1B 2Y2MA 4JJNB 5E5AB 2YFWB 5B2JC 3UT9C 3LZ1C 4G91B 3MGPB 1ID3C 1P3ID 5B31A 3AZHC 1P3GC 3KXBA 1EQZC 3C1CD 3AFAB 1P3KB 5B40A 4Z5TA 3REJD 3B6GA 2RIQA 3WA9C 3W97D 5CPKD 1P3LA 2PYOC 1TZYC 1N1JB 5DNNB 5FUGA 3RELC 3UTBB 1U35C 3W98B 3VH6W 1P3BC 3AZIA 1BH8A 3V9RA 4QLCC 1TAFB 5B24A 2J8PA 3AV2B 4J8VA 1KX5D 1M18B 1AOID 1P3PA 3AN2D 4KGCB 3O62C 5AVCA 5CPJA 4G92C 3X1UB 1S32D 1KX4C 3AZLB 4WU8B 3REJC 1KX3B 2NQBA 2AROA 5CPIA 3W97C 4DRAA 1P34D 2CV5D 3EPLA 3MGQD 3REKD 3MGRD 5B33A 5JRGB 3LJAB 2HIOB 5B0ZA 4AWLB 2Y2LA 5B1LC 3REID 5BNXA 3AYWB 2IO5C 2RVQD 5BO0B 1F66B 1KX5C 3AZEA 1M1AD 4KUDA 4H9RA 4WV4B 5GSUD 2BYMB 3WTPA 5AV9B 3AZGA 3X1TB 4J8XD 4J8WD 1P3AA 5F99A 3WKJA 4CSRB 2Y2JA 1M19B 4XZQA 1B6WA 3B0DB 4NE5A 3VH6A 3KWQD 5GT3B 3MGSB 3AZMC 3AZNA 5GXQB 1HQ3D 3LZ0A 5AY8B 4LD9B 4NFTA 3KXBC 1P3FB 4NE6A 3A6ND 4XUJD 5CP6A 3AZKB 5B0YB 4WU9C 5AVBA 3WAAA 3MVDD 1Z2CB 3B6GC 3REHB 5B2ID 3UT9A 3LZ1A 4ZUXC 4R8PC 5AV8D 3X1SD 3AZJB 2W8SA 5G49A 5B32D 5DNMB 3W96B 1P3GA 4Z66B 2F8NA 4EO5B 1A7WA 1ZLAC 3VH6T 3AV1D 4JJND 3AZFB 5E5AD 4NE3A 4YM6C 2PYOA 1TZYA 3RELA 1JFIB 4H9QA 3MVDC 2Y2PA 3UTAC 5CPIC 2ZY5A 4QLCA 5AV8C 3AFAD 1P3KD 1P3OC 3H0LC 5B0ZC 2FJ7B 2ZY4A 5DNND 1H3OA 1KX4A 3REJA 3W99B 2Y2GA 5B40B 3W97A 4UUZB 4Z5TB 2XD5A 5AV6B 1P3LB 3AV2D 3MNND 4H9PA 3B6FC 4J8UB 1M18D 3TU4C 4KGCD 1P3MD 2ZY3A 5B1MB 3X1UD 4YS3C 3AZIB 1BH8B 2G5HC 5B1LA 3V9RB 3AZLD 4WU8D 1KX3D 2BG1A 1KX5A 1WWSA 3X1VB 5B24B 2NZDC 3AN2A 4J8VB 2DQNC 1P3PB 1S32A 5AVCB 5C3IB 5CPJB 4WJ3C 5JRGD 3LJAD 2HIOD 2NQBB 2CV5A 3AZMA 4E44A 2AROB 4X23B 3AV2C 3MNNC 1F66D 3REKA 3MGRA 2LY8A 4WU9A 1P3MC 2HUEC 4H9OB 5B33B 5AV9D 3C1BC 3AZLC 4WU8C 4ZUXA 4R8PA 5BNXB 1M19D 1M1AA 5GSUA 4KUDB 4H9RB 1ULYA 5AY8D 2CWEA 4LD9D 3H0MC 1P3FD 4J8XA 5BNVA 3AZKD 3WTPB 5B0YD 2HIOC 3AZGB 1ZLAA 3LELB 5GT0D 1P3AB 5F99B 3KWQA 3WKJB 1P3IC 3REHD 1HQ3A 4XZQB 3C1CC 4YM6A 3A6NA 4XUJA 3AZNB 3LZ0B 2F8NK 5DNMD 3W96D 1Q9CA 3MVDA 3UTAA 5AVBB 5B32G 5CPKC 3WAAB 4ZBJC 5AV8A 3X1SA 1BFMA 3R45A 5B2JB 3AZFD 1P3OA 3LZ1B 4H9NB 4H9SC 5G49B 4CAYA 3AZKC 1ID3B 3AZHB 5GT0C 1EQZB 2F8NB 2YFWA 1AOIC 1T3UA 3AN2C 2JE5A 2Y2KA 3WA9B 1S32C 5AV5B 3B6FA 2PYOB 1TZYB 3RELB 3TU4A 4H9QB 1P34C 1U35B 2CV5C 2FJ7D 3KUYD 4WZSB 3AFAA 4YS3A 1P3KA 3MGQC 1P3BB 1WWIA 4QLCB 3REKC 1BH9A 3W99D 3MGRC 5B40D 2NZDA 3NQUB 1B67A 3REIC 2RVQC 1W2EA 5AV6D 3O62B 1P3LD 2F8NH 4J8UD 3W98C 4G92B 1H3OB 1M1AC 1KX4B 5B1MD 1TAFA 5GSUC 3AV2A 3MNNA 4J8XC 4J8WC 1M18A 3X1VD 4KGCA 1P3MA 4J8VD 4H9PB 3VH5W 2FJ7C 3KUYC 3KWQC 3X1UA 1HQ3C 1R4VA 3C1BA 5CPJD 3NQJA 4WU8A 3A6NC 4XUJC 3AZLA 5B1LB 1KX3A 2ZY2A 3MGPD 2NQBD 1KX5B 2AROD 4X23D 5B2IC 2ZM5A 3X1SC 3LJAA 2HIOA 5B32C 4E45A 5B1MC 5B33D 1P3IA 4Z2MH 3C1CA 3AZMB 2YFVA 5B31B 2Y2QA 3UTBD 3AV1C 4JJNC 3KXBB 1KU5A 3W98D 5E5AC 4KUDD 4WU9B 2G5IC 5CPKA 4G91C 3B6GB 3MGPC 3WTPD 3AZGD 3LELD 1P3AD 5F99D 2Y2HA 4ZUXB 4R8PB 3WKJD 5FUGB 4H9SA 5AY8A 4XZQD 4LD9A 1P3FA 3AZND 3AZKA 3AFAC 1P3KC 5B0YA 5BS7A 5GT0A 4DRBA 5BNVB 1ZLAB 3IP4C 5AVBD 1AOIA 3WAAD 3VH5A 5DNNC 3UTBC 5BT1D 4Z2MG 5B2JD 3LZ1D 5KDMA 4YM6B
chains in the Genus database with same CATH topology
1P34A 3UTAB 1ID3D 5CPIB 3AYWD 3MGQA 3AZHD 2FFFB 1EQZD 3AZFA 2F8ND 5AV8B 1M18C 1P3OB 4KGCC 2JSSA 3X1UC 4DQYB 3WA9D 3REIA 1JFIA 5AV5D 4CAYB 5JA4A 3X1TD 1KX3C 5B0ZB 2PYOD 1TZYD 3RELD 1U35D 1P3BD 3AZEB 5GT3D 3MGSD 5BT1C 5GXQD 4QLCD 5B31G 4J8WA 5JRGC 3LJAC 4KHAA 3B6FB 4WNNA 4AWLC 2FJ7A 3KUYA 3TU4B 3AYWC 3O62D 1F66C 2DF4C 3W99A 4YS3B 3AZJD 1KX4D 3A1KA 4HGAB 4UUZA 1BH9B 5CP6B 5AV5C 2NZDB 5AV9C 5AV6A 3X1TC 5B2IA 3FDDA 4J8UA 4Z66D 1PZRA 1M19C 2UWXA 3UT9B 5B32A 3B0DC 5B1MA 5GT3C 3MGSC 3KFUG 5GXQC 5AY8C 4LD9C 1P3FC 3B0CW 5B1LD 5CHLB 2BYKA 5B0YC 3X1VA 5BS7C 3AV1A 3MNNB 4JJNA 1P3GB 5E5AA 3REHC 1P3MB 3EPHA 2HUEB 2VQRA 3AZJC 2Y2IA 3MGPA 5DNMC 3EPKA 3C1BB 1F1EA 3NQJB 3W96C 4X23A 4Z66C 3AZMD 4EO5C 5B31D 3KXBD 3AZFC 4H9OA 3KSYA 4WU9D 3B0BA 4Z5TD 3P5JB 3B6GD 1P3IB 1N1JA 5DNNA 3UTBA 3C1CB 4ZUXD 4R8PD 2YFVB 3W98A 2Y2OA 3REJB 3AZID 3W97B 5CPKB 3LELA 4ZBJB 1ZLAD 3H0RC 5B24D 2L5AA 5B31C 1P3PD 2F2AC 5AVCD 4YM6D 3W99C 2XD1A 2Y2NA 5B40C 2IO5B 4Z5TC 3A1IA 5GT0B 3UTAD 5CPID 1AOIB 3AN2B 5B2JA 5AV6C 1P3LC 4M6BA 4J8UC 4H9NA 1S32B 5JRGA 1P3OD 5KDMB 2F8NG 3AZIC 1ID3A 3AYWA 3AZHA 1P34B 1EQZA 5BO0A 5B0ZD 2CV5B 1F66A 3X1VC 5B24C 3MGQB 4J8VC 3REKB 3B0CT 3MGRB 3AZED 1P3PC 3WA9A 2BYMA 5AV5A 5C3IC 5AVCC 5AV9A 3X1TA 5CPJC 3REIB 3F6TA 4CSRA 2JCHA 5JA4B 1M19A 3B6FD 1U35A 2NQBC 2AROC 3TU4D 1HTAA 5GT3A 3MGSA 1P3BA 5GXQA 4X23C 1M1AB 5GSUB 4YS3D 3LZ0D 3NQUA 4J8XB 5CP6D 4J8WB 5B33C 2NZDD 4KHAB 3REHA 3O62A 4WNNB 3KUYB 3KWQB 3AZJA 1HQ3B 3UT9D 5DNMA 3W96A 3AZEC 3A6NB 4XUJB 4KUDC 3MVDB 4Z66A 3WTPC 3AL0C 3AZGC 5B2IB 3LELC 1P3AC 1P3GD 5F99C 3WKJC 3X1SB 3R45B 3WTPE 4XZQC 5B32B 3AZNC 3LZ0C 4HGAC 3EPJA 3C1BD 4UPKA 5CP6C 3EG5B 2BYKB 3VH5T 5AVBC 3WAAC 3AV1B 2Y2MA 4JJNB 5E5AB 2YFWB 5B2JC 3UT9C 3LZ1C 4G91B 3MGPB 1ID3C 1P3ID 5B31A 3AZHC 1P3GC 3KXBA 1EQZC 3C1CD 3AFAB 1P3KB 5B40A 4Z5TA 3REJD 3B6GA 2RIQA 3WA9C 3W97D 5CPKD 1P3LA 2PYOC 1TZYC 1N1JB 5DNNB 5FUGA 3RELC 3UTBB 1U35C 3W98B 3VH6W 1P3BC 3AZIA 1BH8A 3V9RA 4QLCC 1TAFB 5B24A 2J8PA 3AV2B 4J8VA 1KX5D 1M18B 1AOID 1P3PA 3AN2D 4KGCB 3O62C 5AVCA 5CPJA 4G92C 3X1UB 1S32D 1KX4C 3AZLB 4WU8B 3REJC 1KX3B 2NQBA 2AROA 5CPIA 3W97C 4DRAA 1P34D 2CV5D 3EPLA 3MGQD 3REKD 3MGRD 5B33A 5JRGB 3LJAB 2HIOB 5B0ZA 4AWLB 2Y2LA 5B1LC 3REID 5BNXA 3AYWB 2IO5C 2RVQD 5BO0B 1F66B 1KX5C 3AZEA 1M1AD 4KUDA 4H9RA 4WV4B 5GSUD 2BYMB 3WTPA 5AV9B 3AZGA 3X1TB 4J8XD 4J8WD 1P3AA 5F99A 3WKJA 4CSRB 2Y2JA 1M19B 4XZQA 1B6WA 3B0DB 4NE5A 3VH6A 3KWQD 5GT3B 3MGSB 3AZMC 3AZNA 5GXQB 1HQ3D 3LZ0A 5AY8B 4LD9B 4NFTA 3KXBC 1P3FB 4NE6A 3A6ND 4XUJD 5CP6A 3AZKB 5B0YB 4WU9C 5AVBA 3WAAA 3MVDD 1Z2CB 3B6GC 3REHB 5B2ID 3UT9A 3LZ1A 4ZUXC 4R8PC 5AV8D 3X1SD 3AZJB 2W8SA 5G49A 5B32D 5DNMB 3W96B 1P3GA 4Z66B 2F8NA 4EO5B 1A7WA 1ZLAC 3VH6T 3AV1D 4JJND 3AZFB 5E5AD 4NE3A 4YM6C 2PYOA 1TZYA 3RELA 1JFIB 4H9QA 3MVDC 2Y2PA 3UTAC 5CPIC 2ZY5A 4QLCA 5AV8C 3AFAD 1P3KD 1P3OC 3H0LC 5B0ZC 2FJ7B 2ZY4A 5DNND 1H3OA 1KX4A 3REJA 3W99B 2Y2GA 5B40B 3W97A 4UUZB 4Z5TB 2XD5A 5AV6B 1P3LB 3AV2D 3MNND 4H9PA 3B6FC 4J8UB 1M18D 3TU4C 4KGCD 1P3MD 2ZY3A 5B1MB 3X1UD 4YS3C 3AZIB 1BH8B 2G5HC 5B1LA 3V9RB 3AZLD 4WU8D 1KX3D 2BG1A 1KX5A 1WWSA 3X1VB 5B24B 2NZDC 3AN2A 4J8VB 2DQNC 1P3PB 1S32A 5AVCB 5C3IB 5CPJB 4WJ3C 5JRGD 3LJAD 2HIOD 2NQBB 2CV5A 3AZMA 4E44A 2AROB 4X23B 3AV2C 3MNNC 1F66D 3REKA 3MGRA 2LY8A 4WU9A 1P3MC 2HUEC 4H9OB 5B33B 5AV9D 3C1BC 3AZLC 4WU8C 4ZUXA 4R8PA 5BNXB 1M19D 1M1AA 5GSUA 4KUDB 4H9RB 1ULYA 5AY8D 2CWEA 4LD9D 3H0MC 1P3FD 4J8XA 5BNVA 3AZKD 3WTPB 5B0YD 2HIOC 3AZGB 1ZLAA 3LELB 5GT0D 1P3AB 5F99B 3KWQA 3WKJB 1P3IC 3REHD 1HQ3A 4XZQB 3C1CC 4YM6A 3A6NA 4XUJA 3AZNB 3LZ0B 2F8NK 5DNMD 3W96D 1Q9CA 3MVDA 3UTAA 5AVBB 5B32G 5CPKC 3WAAB 4ZBJC 5AV8A 3X1SA 1BFMA 3R45A 5B2JB 3AZFD 1P3OA 3LZ1B 4H9NB 4H9SC 5G49B 4CAYA 3AZKC 1ID3B 3AZHB 5GT0C 1EQZB 2F8NB 2YFWA 1AOIC 1T3UA 3AN2C 2JE5A 2Y2KA 3WA9B 1S32C 5AV5B 3B6FA 2PYOB 1TZYB 3RELB 3TU4A 4H9QB 1P34C 1U35B 2CV5C 2FJ7D 3KUYD 4WZSB 3AFAA 4YS3A 1P3KA 3MGQC 1P3BB 1WWIA 4QLCB 3REKC 1BH9A 3W99D 3MGRC 5B40D 2NZDA 3NQUB 1B67A 3REIC 2RVQC 1W2EA 5AV6D 3O62B 1P3LD 2F8NH 4J8UD 3W98C 4G92B 1H3OB 1M1AC 1KX4B 5B1MD 1TAFA 5GSUC 3AV2A 3MNNA 4J8XC 4J8WC 1M18A 3X1VD 4KGCA 1P3MA 4J8VD 4H9PB 3VH5W 2FJ7C 3KUYC 3KWQC 3X1UA 1HQ3C 1R4VA 3C1BA 5CPJD 3NQJA 4WU8A 3A6NC 4XUJC 3AZLA 5B1LB 1KX3A 2ZY2A 3MGPD 2NQBD 1KX5B 2AROD 4X23D 5B2IC 2ZM5A 3X1SC 3LJAA 2HIOA 5B32C 4E45A 5B1MC 5B33D 1P3IA 4Z2MH 3C1CA 3AZMB 2YFVA 5B31B 2Y2QA 3UTBD 3AV1C 4JJNC 3KXBB 1KU5A 3W98D 5E5AC 4KUDD 4WU9B 2G5IC 5CPKA 4G91C 3B6GB 3MGPC 3WTPD 3AZGD 3LELD 1P3AD 5F99D 2Y2HA 4ZUXB 4R8PB 3WKJD 5FUGB 4H9SA 5AY8A 4XZQD 4LD9A 1P3FA 3AZND 3AZKA 3AFAC 1P3KC 5B0YA 5BS7A 5GT0A 4DRBA 5BNVB 1ZLAB 3IP4C 5AVBD 1AOIA 3WAAD 3VH5A 5DNNC 3UTBC 5BT1D 4Z2MG 5B2JD 3LZ1D 5KDMA 4YM6B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1P34 A;  3UTA B;  1ID3 D;  5CPI B;  3AYW D;  3MGQ A;  3AZH D;  1EQZ D;  3AZF A;  2F8N D;  5AV8 B;  1M18 C;  1P3O B;  4KGC C;  2JSS A;  3X1U C;  3WA9 D;  3REI A;  1JFI A;  5AV5 D;  4CAY B;  5JA4 A;  3X1T D;  1KX3 C;  5B0Z B;  2PYO D;  1TZY D;  3REL D;  1U35 D;  1P3B D;  3AZE B;  5GT3 D;  3MGS D;  5BT1 C;  5GXQ D;  4QLC D;  5B31 G;  4J8W A;  5JRG C;  3LJA C;  4KHA A;  3B6F B;  4WNN A;  4AWL C;  2FJ7 A;  3KUY A;  3TU4 B;  3AYW C;  3O62 D;  1F66 C;  3W99 A;  4YS3 B;  3AZJ D;  1KX4 D;  4HGA B;  4UUZ A;  1BH9 B;  5CP6 B;  5AV5 C;  2NZD B;  5AV9 C;  5AV6 A;  3X1T C;  5B2I A;  4J8U A;  4Z66 D;  1M19 C;  3UT9 B;  5B32 A;  3B0D C;  5B1M A;  5GT3 C;  3MGS C;  5GXQ C;  5AY8 C;  4LD9 C;  1P3F C;  3B0C W;  5B1L D;  5CHL B;  2BYK A;  5B0Y C;  3X1V A;  5BS7 C;  3AV1 A;  3MNN B;  4JJN A;  1P3G B;  5E5A A;  3REH C;  1P3M B;  2HUE B;  3AZJ C;  3MGP A;  5DNM C;  3C1B B;  1F1E A;  3NQJ B;  3W96 C;  4X23 A;  4Z66 C;  3AZM D;  4EO5 C;  5B31 D;  3KXB D;  3AZF C;  4H9O A;  3KSY A;  4WU9 D;  3B0B A;  4Z5T D;  3B6G D;  1P3I B;  1N1J A;  5DNN A;  3UTB A;  3C1C B;  4ZUX D;  4R8P D;  2YFV B;  3W98 A;  3REJ B;  3AZI D;  3W97 B;  5CPK B;  3LEL A;  4ZBJ B;  1ZLA D;  5B24 D;  2L5A A;  5B31 C;  1P3P D;  5AVC D;  4YM6 D;  3W99 C;  5B40 C;  2IO5 B;  4Z5T C;  5GT0 B;  3UTA D;  5CPI D;  1AOI B;  3AN2 B;  5B2J A;  5AV6 C;  1P3L C;  4M6B A;  4J8U C;  4H9N A;  1S32 B;  5JRG A;  1P3O D;  5KDM B;  2F8N G;  3AZI C;  1ID3 A;  3AYW A;  3AZH A;  1P34 B;  1EQZ A;  5BO0 A;  5B0Z D;  2CV5 B;  1F66 A;  3X1V C;  5B24 C;  3MGQ B;  4J8V C;  3REK B;  3B0C T;  3MGR B;  3AZE D;  1P3P C;  3WA9 A;  2BYM A;  5AV5 A;  5C3I C;  5AVC C;  5AV9 A;  3X1T A;  5CPJ C;  3REI B;  4CSR A;  5JA4 B;  1M19 A;  3B6F D;  2NQB C;  1U35 A;  2ARO C;  3TU4 D;  1HTA A;  5GT3 A;  3MGS A;  1P3B A;  5GXQ A;  4X23 C;  1M1A B;  5GSU B;  4YS3 D;  3LZ0 D;  3NQU A;  4J8X B;  5CP6 D;  4J8W B;  5B33 C;  2NZD D;  4KHA B;  3REH A;  3O62 A;  4WNN B;  3KUY B;  3KWQ B;  3AZJ A;  1HQ3 B;  3UT9 D;  5DNM A;  3W96 A;  3AZE C;  3A6N B;  4XUJ B;  4KUD C;  3MVD B;  4Z66 A;  3WTP C;  3AZG C;  5B2I B;  3LEL C;  1P3A C;  1P3G D;  5F99 C;  3WKJ C;  3X1S B;  3R45 B;  3WTP E;  4XZQ C;  5B32 B;  3AZN C;  3LZ0 C;  4HGA C;  3C1B D;  5CP6 C;  2BYK B;  3VH5 T;  5AVB C;  3WAA C;  3AV1 B;  4JJN B;  5E5A B;  2YFW B;  5B2J C;  3UT9 C;  3LZ1 C;  4G91 B;  3MGP B;  1ID3 C;  1P3I D;  5B31 A;  3AZH C;  1P3G C;  3KXB A;  1EQZ C;  3C1C D;  3AFA B;  1P3K B;  5B40 A;  4Z5T A;  3REJ D;  3B6G A;  3WA9 C;  3W97 D;  5CPK D;  1P3L A;  2PYO C;  1TZY C;  1N1J B;  5DNN B;  5FUG A;  3REL C;  3UTB B;  1U35 C;  3W98 B;  3VH6 W;  1P3B C;  3AZI A;  1BH8 A;  3V9R A;  4QLC C;  1TAF B;  5B24 A;  3AV2 B;  4J8V A;  1KX5 D;  1M18 B;  1AOI D;  1P3P A;  3AN2 D;  4KGC B;  3O62 C;  5AVC A;  5CPJ A;  4G92 C;  3X1U B;  1S32 D;  1KX4 C;  3AZL B;  4WU8 B;  3REJ C;  1KX3 B;  2NQB A;  2ARO A;  5CPI A;  3W97 C;  4DRA A;  1P34 D;  2CV5 D;  3MGQ D;  3REK D;  3MGR D;  5B33 A;  5JRG B;  3LJA B;  2HIO B;  5B0Z A;  4AWL B;  5B1L C;  3REI D;  5BNX A;  3AYW B;  2IO5 C;  2RVQ D;  5BO0 B;  1F66 B;  1KX5 C;  3AZE A;  1M1A D;  4KUD A;  4H9R A;  4WV4 B;  5GSU D;  2BYM B;  3WTP A;  5AV9 B;  3AZG A;  3X1T B;  4J8X D;  4J8W D;  1P3A A;  5F99 A;  3WKJ A;  4CSR B;  1M19 B;  4XZQ A;  1B6W A;  3B0D B;  4NE5 A;  3VH6 A;  3KWQ D;  5GT3 B;  3MGS B;  3AZM C;  3AZN A;  5GXQ B;  1HQ3 D;  3LZ0 A;  5AY8 B;  4LD9 B;  4NFT A;  3KXB C;  1P3F B;  4NE6 A;  3A6N D;  4XUJ D;  5CP6 A;  3AZK B;  5B0Y B;  4WU9 C;  5AVB A;  3WAA A;  3MVD D;  3B6G C;  3REH B;  5B2I D;  3UT9 A;  3LZ1 A;  4ZUX C;  4R8P C;  5AV8 D;  3X1S D;  3AZJ B;  5G49 A;  5B32 D;  5DNM B;  3W96 B;  1P3G A;  4Z66 B;  2F8N A;  4EO5 B;  1A7W A;  1ZLA C;  3VH6 T;  3AV1 D;  4JJN D;  3AZF B;  5E5A D;  4NE3 A;  4YM6 C;  2PYO A;  1TZY A;  3REL A;  1JFI B;  4H9Q A;  3MVD C;  3UTA C;  5CPI C;  4QLC A;  5AV8 C;  3AFA D;  1P3K D;  1P3O C;  5B0Z C;  2FJ7 B;  5DNN D;  1H3O A;  1KX4 A;  3REJ A;  3W99 B;  5B40 B;  3W97 A;  4UUZ B;  4Z5T B;  5AV6 B;  1P3L B;  3AV2 D;  3MNN D;  4H9P A;  3B6F C;  4J8U B;  1M18 D;  3TU4 C;  4KGC D;  1P3M D;  5B1M B;  3X1U D;  4YS3 C;  3AZI B;  1BH8 B;  5B1L A;  3V9R B;  3AZL D;  4WU8 D;  1KX3 D;  1KX5 A;  1WWS A;  3X1V B;  5B24 B;  2NZD C;  3AN2 A;  4J8V B;  1P3P B;  1S32 A;  5AVC B;  5C3I B;  5CPJ B;  5JRG D;  3LJA D;  2HIO D;  2NQB B;  2CV5 A;  3AZM A;  4E44 A;  2ARO B;  4X23 B;  3AV2 C;  3MNN C;  1F66 D;  3REK A;  3MGR A;  2LY8 A;  4WU9 A;  1P3M C;  2HUE C;  4H9O B;  5B33 B;  5AV9 D;  3C1B C;  3AZL C;  4WU8 C;  4ZUX A;  4R8P A;  5BNX B;  1M19 D;  1M1A A;  5GSU A;  4KUD B;  4H9R B;  1ULY A;  5AY8 D;  2CWE A;  4LD9 D;  1P3F D;  4J8X A;  5BNV A;  3AZK D;  3WTP B;  5B0Y D;  2HIO C;  3AZG B;  1ZLA A;  3LEL B;  5GT0 D;  1P3A B;  5F99 B;  3KWQ A;  3WKJ B;  1P3I C;  3REH D;  1HQ3 A;  4XZQ B;  3C1C C;  4YM6 A;  3A6N A;  4XUJ A;  3AZN B;  3LZ0 B;  2F8N K;  5DNM D;  3W96 D;  1Q9C A;  3MVD A;  3UTA A;  5AVB B;  5B32 G;  5CPK C;  3WAA B;  4ZBJ C;  5AV8 A;  3X1S A;  1BFM A;  3R45 A;  5B2J B;  3AZF D;  1P3O A;  3LZ1 B;  4H9N B;  4H9S C;  5G49 B;  4CAY A;  3AZK C;  1ID3 B;  3AZH B;  5GT0 C;  1EQZ B;  2F8N B;  2YFW A;  1AOI C;  3AN2 C;  3WA9 B;  1S32 C;  5AV5 B;  3B6F A;  2PYO B;  1TZY B;  3REL B;  3TU4 A;  4H9Q B;  1P34 C;  1U35 B;  2CV5 C;  2FJ7 D;  3KUY D;  4WZS B;  3AFA A;  4YS3 A;  1P3K A;  3MGQ C;  1P3B B;  1WWI A;  4QLC B;  3REK C;  1BH9 A;  3W99 D;  3MGR C;  5B40 D;  2NZD A;  3NQU B;  1B67 A;  3REI C;  2RVQ C;  5AV6 D;  1P3L D;  3O62 B;  2F8N H;  4J8U D;  3W98 C;  4G92 B;  1H3O B;  1M1A C;  1KX4 B;  5B1M D;  1TAF A;  5GSU C;  3AV2 A;  3MNN A;  4J8X C;  4J8W C;  1M18 A;  3X1V D;  4KGC A;  1P3M A;  4J8V D;  4H9P B;  3VH5 W;  2FJ7 C;  3KUY C;  3KWQ C;  3X1U A;  1HQ3 C;  1R4V A;  3C1B A;  5CPJ D;  3NQJ A;  4WU8 A;  3A6N C;  4XUJ C;  3AZL A;  5B1L B;  1KX3 A;  3MGP D;  2NQB D;  1KX5 B;  2ARO D;  4X23 D;  5B2I C;  3X1S C;  3LJA A;  2HIO A;  5B32 C;  4E45 A;  5B1M C;  5B33 D;  1P3I A;  4Z2M H;  3C1C A;  3AZM B;  2YFV A;  5B31 B;  3UTB D;  3AV1 C;  4JJN C;  3KXB B;  1KU5 A;  3W98 D;  5E5A C;  4KUD D;  4WU9 B;  5CPK A;  4G91 C;  3B6G B;  3MGP C;  3WTP D;  3AZG D;  3LEL D;  1P3A D;  5F99 D;  3WKJ D;  4ZUX B;  4R8P B;  5FUG B;  4H9S A;  5AY8 A;  4XZQ D;  4LD9 A;  1P3F A;  3AZN D;  3AZK A;  3AFA C;  1P3K C;  5B0Y A;  5BS7 A;  5GT0 A;  4DRB A;  5BNV B;  1ZLA B;  5AVB D;  1AOI A;  3WAA D;  3VH5 A;  5DNN C;  3UTB C;  5BT1 D;  4Z2M G;  5B2J D;  3LZ1 D;  5KDM A;  4YM6 B; 
#chains in the Genus database with same CATH topology
 1P34 A;  3UTA B;  1ID3 D;  5CPI B;  3AYW D;  3MGQ A;  3AZH D;  2FFF B;  1EQZ D;  3AZF A;  2F8N D;  5AV8 B;  1M18 C;  1P3O B;  4KGC C;  2JSS A;  3X1U C;  4DQY B;  3WA9 D;  3REI A;  1JFI A;  5AV5 D;  4CAY B;  5JA4 A;  3X1T D;  1KX3 C;  5B0Z B;  2PYO D;  1TZY D;  3REL D;  1U35 D;  1P3B D;  3AZE B;  5GT3 D;  3MGS D;  5BT1 C;  5GXQ D;  4QLC D;  5B31 G;  4J8W A;  5JRG C;  3LJA C;  4KHA A;  3B6F B;  4WNN A;  4AWL C;  2FJ7 A;  3KUY A;  3TU4 B;  3AYW C;  3O62 D;  1F66 C;  2DF4 C;  3W99 A;  4YS3 B;  3AZJ D;  1KX4 D;  3A1K A;  4HGA B;  4UUZ A;  1BH9 B;  5CP6 B;  5AV5 C;  2NZD B;  5AV9 C;  5AV6 A;  3X1T C;  5B2I A;  3FDD A;  4J8U A;  4Z66 D;  1PZR A;  1M19 C;  2UWX A;  3UT9 B;  5B32 A;  3B0D C;  5B1M A;  5GT3 C;  3MGS C;  3KFU G;  5GXQ C;  5AY8 C;  4LD9 C;  1P3F C;  3B0C W;  5B1L D;  5CHL B;  2BYK A;  5B0Y C;  3X1V A;  5BS7 C;  3AV1 A;  3MNN B;  4JJN A;  1P3G B;  5E5A A;  3REH C;  1P3M B;  3EPH A;  2HUE B;  2VQR A;  3AZJ C;  2Y2I A;  3MGP A;  5DNM C;  3EPK A;  3C1B B;  1F1E A;  3NQJ B;  3W96 C;  4X23 A;  4Z66 C;  3AZM D;  4EO5 C;  5B31 D;  3KXB D;  3AZF C;  4H9O A;  3KSY A;  4WU9 D;  3B0B A;  4Z5T D;  3P5J B;  3B6G D;  1P3I B;  1N1J A;  5DNN A;  3UTB A;  3C1C B;  4ZUX D;  4R8P D;  2YFV B;  3W98 A;  2Y2O A;  3REJ B;  3AZI D;  3W97 B;  5CPK B;  3LEL A;  4ZBJ B;  1ZLA D;  3H0R C;  5B24 D;  2L5A A;  5B31 C;  1P3P D;  2F2A C;  5AVC D;  4YM6 D;  3W99 C;  2XD1 A;  2Y2N A;  5B40 C;  2IO5 B;  4Z5T C;  3A1I A;  5GT0 B;  3UTA D;  5CPI D;  1AOI B;  3AN2 B;  5B2J A;  5AV6 C;  1P3L C;  4M6B A;  4J8U C;  4H9N A;  1S32 B;  5JRG A;  1P3O D;  5KDM B;  2F8N G;  3AZI C;  1ID3 A;  3AYW A;  3AZH A;  1P34 B;  1EQZ A;  5BO0 A;  5B0Z D;  2CV5 B;  1F66 A;  3X1V C;  5B24 C;  3MGQ B;  4J8V C;  3REK B;  3B0C T;  3MGR B;  3AZE D;  1P3P C;  3WA9 A;  2BYM A;  5AV5 A;  5C3I C;  5AVC C;  5AV9 A;  3X1T A;  5CPJ C;  3REI B;  3F6T A;  4CSR A;  2JCH A;  5JA4 B;  1M19 A;  3B6F D;  1U35 A;  2NQB C;  2ARO C;  3TU4 D;  1HTA A;  5GT3 A;  3MGS A;  1P3B A;  5GXQ A;  4X23 C;  1M1A B;  5GSU B;  4YS3 D;  3LZ0 D;  3NQU A;  4J8X B;  5CP6 D;  4J8W B;  5B33 C;  2NZD D;  4KHA B;  3REH A;  3O62 A;  4WNN B;  3KUY B;  3KWQ B;  3AZJ A;  1HQ3 B;  3UT9 D;  5DNM A;  3W96 A;  3AZE C;  3A6N B;  4XUJ B;  4KUD C;  3MVD B;  4Z66 A;  3WTP C;  3AL0 C;  3AZG C;  5B2I B;  3LEL C;  1P3A C;  1P3G D;  5F99 C;  3WKJ C;  3X1S B;  3R45 B;  3WTP E;  4XZQ C;  5B32 B;  3AZN C;  3LZ0 C;  4HGA C;  3EPJ A;  3C1B D;  4UPK A;  5CP6 C;  3EG5 B;  2BYK B;  3VH5 T;  5AVB C;  3WAA C;  3AV1 B;  2Y2M A;  4JJN B;  5E5A B;  2YFW B;  5B2J C;  3UT9 C;  3LZ1 C;  4G91 B;  3MGP B;  1ID3 C;  1P3I D;  5B31 A;  3AZH C;  1P3G C;  3KXB A;  1EQZ C;  3C1C D;  3AFA B;  1P3K B;  5B40 A;  4Z5T A;  3REJ D;  3B6G A;  2RIQ A;  3WA9 C;  3W97 D;  5CPK D;  1P3L A;  2PYO C;  1TZY C;  1N1J B;  5DNN B;  5FUG A;  3REL C;  3UTB B;  1U35 C;  3W98 B;  3VH6 W;  1P3B C;  3AZI A;  1BH8 A;  3V9R A;  4QLC C;  1TAF B;  5B24 A;  2J8P A;  3AV2 B;  4J8V A;  1KX5 D;  1M18 B;  1AOI D;  1P3P A;  3AN2 D;  4KGC B;  3O62 C;  5AVC A;  5CPJ A;  4G92 C;  3X1U B;  1S32 D;  1KX4 C;  3AZL B;  4WU8 B;  3REJ C;  1KX3 B;  2NQB A;  2ARO A;  5CPI A;  3W97 C;  4DRA A;  1P34 D;  2CV5 D;  3EPL A;  3MGQ D;  3REK D;  3MGR D;  5B33 A;  5JRG B;  3LJA B;  2HIO B;  5B0Z A;  4AWL B;  2Y2L A;  5B1L C;  3REI D;  5BNX A;  3AYW B;  2IO5 C;  2RVQ D;  5BO0 B;  1F66 B;  1KX5 C;  3AZE A;  1M1A D;  4KUD A;  4H9R A;  4WV4 B;  5GSU D;  2BYM B;  3WTP A;  5AV9 B;  3AZG A;  3X1T B;  4J8X D;  4J8W D;  1P3A A;  5F99 A;  3WKJ A;  4CSR B;  2Y2J A;  1M19 B;  4XZQ A;  1B6W A;  3B0D B;  4NE5 A;  3VH6 A;  3KWQ D;  5GT3 B;  3MGS B;  3AZM C;  3AZN A;  5GXQ B;  1HQ3 D;  3LZ0 A;  5AY8 B;  4LD9 B;  4NFT A;  3KXB C;  1P3F B;  4NE6 A;  3A6N D;  4XUJ D;  5CP6 A;  3AZK B;  5B0Y B;  4WU9 C;  5AVB A;  3WAA A;  3MVD D;  1Z2C B;  3B6G C;  3REH B;  5B2I D;  3UT9 A;  3LZ1 A;  4ZUX C;  4R8P C;  5AV8 D;  3X1S D;  3AZJ B;  2W8S A;  5G49 A;  5B32 D;  5DNM B;  3W96 B;  1P3G A;  4Z66 B;  2F8N A;  4EO5 B;  1A7W A;  1ZLA C;  3VH6 T;  3AV1 D;  4JJN D;  3AZF B;  5E5A D;  4NE3 A;  4YM6 C;  2PYO A;  1TZY A;  3REL A;  1JFI B;  4H9Q A;  3MVD C;  2Y2P A;  3UTA C;  5CPI C;  2ZY5 A;  4QLC A;  5AV8 C;  3AFA D;  1P3K D;  1P3O C;  3H0L C;  5B0Z C;  2FJ7 B;  2ZY4 A;  5DNN D;  1H3O A;  1KX4 A;  3REJ A;  3W99 B;  2Y2G A;  5B40 B;  3W97 A;  4UUZ B;  4Z5T B;  2XD5 A;  5AV6 B;  1P3L B;  3AV2 D;  3MNN D;  4H9P A;  3B6F C;  4J8U B;  1M18 D;  3TU4 C;  4KGC D;  1P3M D;  2ZY3 A;  5B1M B;  3X1U D;  4YS3 C;  3AZI B;  1BH8 B;  2G5H C;  5B1L A;  3V9R B;  3AZL D;  4WU8 D;  1KX3 D;  2BG1 A;  1KX5 A;  1WWS A;  3X1V B;  5B24 B;  2NZD C;  3AN2 A;  4J8V B;  2DQN C;  1P3P B;  1S32 A;  5AVC B;  5C3I B;  5CPJ B;  4WJ3 C;  5JRG D;  3LJA D;  2HIO D;  2NQB B;  2CV5 A;  3AZM A;  4E44 A;  2ARO B;  4X23 B;  3AV2 C;  3MNN C;  1F66 D;  3REK A;  3MGR A;  2LY8 A;  4WU9 A;  1P3M C;  2HUE C;  4H9O B;  5B33 B;  5AV9 D;  3C1B C;  3AZL C;  4WU8 C;  4ZUX A;  4R8P A;  5BNX B;  1M19 D;  1M1A A;  5GSU A;  4KUD B;  4H9R B;  1ULY A;  5AY8 D;  2CWE A;  4LD9 D;  3H0M C;  1P3F D;  4J8X A;  5BNV A;  3AZK D;  3WTP B;  5B0Y D;  2HIO C;  3AZG B;  1ZLA A;  3LEL B;  5GT0 D;  1P3A B;  5F99 B;  3KWQ A;  3WKJ B;  1P3I C;  3REH D;  1HQ3 A;  4XZQ B;  3C1C C;  4YM6 A;  3A6N A;  4XUJ A;  3AZN B;  3LZ0 B;  2F8N K;  5DNM D;  3W96 D;  1Q9C A;  3MVD A;  3UTA A;  5AVB B;  5B32 G;  5CPK C;  3WAA B;  4ZBJ C;  5AV8 A;  3X1S A;  1BFM A;  3R45 A;  5B2J B;  3AZF D;  1P3O A;  3LZ1 B;  4H9N B;  4H9S C;  5G49 B;  4CAY A;  3AZK C;  1ID3 B;  3AZH B;  5GT0 C;  1EQZ B;  2F8N B;  2YFW A;  1AOI C;  1T3U A;  3AN2 C;  2JE5 A;  2Y2K A;  3WA9 B;  1S32 C;  5AV5 B;  3B6F A;  2PYO B;  1TZY B;  3REL B;  3TU4 A;  4H9Q B;  1P34 C;  1U35 B;  2CV5 C;  2FJ7 D;  3KUY D;  4WZS B;  3AFA A;  4YS3 A;  1P3K A;  3MGQ C;  1P3B B;  1WWI A;  4QLC B;  3REK C;  1BH9 A;  3W99 D;  3MGR C;  5B40 D;  2NZD A;  3NQU B;  1B67 A;  3REI C;  2RVQ C;  1W2E A;  5AV6 D;  3O62 B;  1P3L D;  2F8N H;  4J8U D;  3W98 C;  4G92 B;  1H3O B;  1M1A C;  1KX4 B;  5B1M D;  1TAF A;  5GSU C;  3AV2 A;  3MNN A;  4J8X C;  4J8W C;  1M18 A;  3X1V D;  4KGC A;  1P3M A;  4J8V D;  4H9P B;  3VH5 W;  2FJ7 C;  3KUY C;  3KWQ C;  3X1U A;  1HQ3 C;  1R4V A;  3C1B A;  5CPJ D;  3NQJ A;  4WU8 A;  3A6N C;  4XUJ C;  3AZL A;  5B1L B;  1KX3 A;  2ZY2 A;  3MGP D;  2NQB D;  1KX5 B;  2ARO D;  4X23 D;  5B2I C;  2ZM5 A;  3X1S C;  3LJA A;  2HIO A;  5B32 C;  4E45 A;  5B1M C;  5B33 D;  1P3I A;  4Z2M H;  3C1C A;  3AZM B;  2YFV A;  5B31 B;  2Y2Q A;  3UTB D;  3AV1 C;  4JJN C;  3KXB B;  1KU5 A;  3W98 D;  5E5A C;  4KUD D;  4WU9 B;  2G5I C;  5CPK A;  4G91 C;  3B6G B;  3MGP C;  3WTP D;  3AZG D;  3LEL D;  1P3A D;  5F99 D;  2Y2H A;  4ZUX B;  4R8P B;  3WKJ D;  5FUG B;  4H9S A;  5AY8 A;  4XZQ D;  4LD9 A;  1P3F A;  3AZN D;  3AZK A;  3AFA C;  1P3K C;  5B0Y A;  5BS7 A;  5GT0 A;  4DRB A;  5BNV B;  1ZLA B;  3IP4 C;  5AVB D;  1AOI A;  3WAA D;  3VH5 A;  5DNN C;  3UTB C;  5BT1 D;  4Z2M G;  5B2J D;  3LZ1 D;  5KDM A;  4YM6 B; 
#chains in the Genus database with same CATH homology
 1P34 A;  3UTA B;  1ID3 D;  5CPI B;  3AYW D;  3MGQ A;  3AZH D;  2FFF B;  1EQZ D;  3AZF A;  2F8N D;  5AV8 B;  1M18 C;  1P3O B;  4KGC C;  2JSS A;  3X1U C;  4DQY B;  3WA9 D;  3REI A;  1JFI A;  5AV5 D;  4CAY B;  5JA4 A;  3X1T D;  1KX3 C;  5B0Z B;  2PYO D;  1TZY D;  3REL D;  1U35 D;  1P3B D;  3AZE B;  5GT3 D;  3MGS D;  5BT1 C;  5GXQ D;  4QLC D;  5B31 G;  4J8W A;  5JRG C;  3LJA C;  4KHA A;  3B6F B;  4WNN A;  4AWL C;  2FJ7 A;  3KUY A;  3TU4 B;  3AYW C;  3O62 D;  1F66 C;  2DF4 C;  3W99 A;  4YS3 B;  3AZJ D;  1KX4 D;  3A1K A;  4HGA B;  4UUZ A;  1BH9 B;  5CP6 B;  5AV5 C;  2NZD B;  5AV9 C;  5AV6 A;  3X1T C;  5B2I A;  3FDD A;  4J8U A;  4Z66 D;  1PZR A;  1M19 C;  2UWX A;  3UT9 B;  5B32 A;  3B0D C;  5B1M A;  5GT3 C;  3MGS C;  3KFU G;  5GXQ C;  5AY8 C;  4LD9 C;  1P3F C;  3B0C W;  5B1L D;  5CHL B;  2BYK A;  5B0Y C;  3X1V A;  5BS7 C;  3AV1 A;  3MNN B;  4JJN A;  1P3G B;  5E5A A;  3REH C;  1P3M B;  3EPH A;  2HUE B;  2VQR A;  3AZJ C;  2Y2I A;  3MGP A;  5DNM C;  3EPK A;  3C1B B;  1F1E A;  3NQJ B;  3W96 C;  4X23 A;  4Z66 C;  3AZM D;  4EO5 C;  5B31 D;  3KXB D;  3AZF C;  4H9O A;  3KSY A;  4WU9 D;  3B0B A;  4Z5T D;  3P5J B;  3B6G D;  1P3I B;  1N1J A;  5DNN A;  3UTB A;  3C1C B;  4ZUX D;  4R8P D;  2YFV B;  3W98 A;  2Y2O A;  3REJ B;  3AZI D;  3W97 B;  5CPK B;  3LEL A;  4ZBJ B;  1ZLA D;  3H0R C;  5B24 D;  2L5A A;  5B31 C;  1P3P D;  2F2A C;  5AVC D;  4YM6 D;  3W99 C;  2XD1 A;  2Y2N A;  5B40 C;  2IO5 B;  4Z5T C;  3A1I A;  5GT0 B;  3UTA D;  5CPI D;  1AOI B;  3AN2 B;  5B2J A;  5AV6 C;  1P3L C;  4M6B A;  4J8U C;  4H9N A;  1S32 B;  5JRG A;  1P3O D;  5KDM B;  2F8N G;  3AZI C;  1ID3 A;  3AYW A;  3AZH A;  1P34 B;  1EQZ A;  5BO0 A;  5B0Z D;  2CV5 B;  1F66 A;  3X1V C;  5B24 C;  3MGQ B;  4J8V C;  3REK B;  3B0C T;  3MGR B;  3AZE D;  1P3P C;  3WA9 A;  2BYM A;  5AV5 A;  5C3I C;  5AVC C;  5AV9 A;  3X1T A;  5CPJ C;  3REI B;  3F6T A;  4CSR A;  2JCH A;  5JA4 B;  1M19 A;  3B6F D;  1U35 A;  2NQB C;  2ARO C;  3TU4 D;  1HTA A;  5GT3 A;  3MGS A;  1P3B A;  5GXQ A;  4X23 C;  1M1A B;  5GSU B;  4YS3 D;  3LZ0 D;  3NQU A;  4J8X B;  5CP6 D;  4J8W B;  5B33 C;  2NZD D;  4KHA B;  3REH A;  3O62 A;  4WNN B;  3KUY B;  3KWQ B;  3AZJ A;  1HQ3 B;  3UT9 D;  5DNM A;  3W96 A;  3AZE C;  3A6N B;  4XUJ B;  4KUD C;  3MVD B;  4Z66 A;  3WTP C;  3AL0 C;  3AZG C;  5B2I B;  3LEL C;  1P3A C;  1P3G D;  5F99 C;  3WKJ C;  3X1S B;  3R45 B;  3WTP E;  4XZQ C;  5B32 B;  3AZN C;  3LZ0 C;  4HGA C;  3EPJ A;  3C1B D;  4UPK A;  5CP6 C;  3EG5 B;  2BYK B;  3VH5 T;  5AVB C;  3WAA C;  3AV1 B;  2Y2M A;  4JJN B;  5E5A B;  2YFW B;  5B2J C;  3UT9 C;  3LZ1 C;  4G91 B;  3MGP B;  1ID3 C;  1P3I D;  5B31 A;  3AZH C;  1P3G C;  3KXB A;  1EQZ C;  3C1C D;  3AFA B;  1P3K B;  5B40 A;  4Z5T A;  3REJ D;  3B6G A;  2RIQ A;  3WA9 C;  3W97 D;  5CPK D;  1P3L A;  2PYO C;  1TZY C;  1N1J B;  5DNN B;  5FUG A;  3REL C;  3UTB B;  1U35 C;  3W98 B;  3VH6 W;  1P3B C;  3AZI A;  1BH8 A;  3V9R A;  4QLC C;  1TAF B;  5B24 A;  2J8P A;  3AV2 B;  4J8V A;  1KX5 D;  1M18 B;  1AOI D;  1P3P A;  3AN2 D;  4KGC B;  3O62 C;  5AVC A;  5CPJ A;  4G92 C;  3X1U B;  1S32 D;  1KX4 C;  3AZL B;  4WU8 B;  3REJ C;  1KX3 B;  2NQB A;  2ARO A;  5CPI A;  3W97 C;  4DRA A;  1P34 D;  2CV5 D;  3EPL A;  3MGQ D;  3REK D;  3MGR D;  5B33 A;  5JRG B;  3LJA B;  2HIO B;  5B0Z A;  4AWL B;  2Y2L A;  5B1L C;  3REI D;  5BNX A;  3AYW B;  2IO5 C;  2RVQ D;  5BO0 B;  1F66 B;  1KX5 C;  3AZE A;  1M1A D;  4KUD A;  4H9R A;  4WV4 B;  5GSU D;  2BYM B;  3WTP A;  5AV9 B;  3AZG A;  3X1T B;  4J8X D;  4J8W D;  1P3A A;  5F99 A;  3WKJ A;  4CSR B;  2Y2J A;  1M19 B;  4XZQ A;  1B6W A;  3B0D B;  4NE5 A;  3VH6 A;  3KWQ D;  5GT3 B;  3MGS B;  3AZM C;  3AZN A;  5GXQ B;  1HQ3 D;  3LZ0 A;  5AY8 B;  4LD9 B;  4NFT A;  3KXB C;  1P3F B;  4NE6 A;  3A6N D;  4XUJ D;  5CP6 A;  3AZK B;  5B0Y B;  4WU9 C;  5AVB A;  3WAA A;  3MVD D;  1Z2C B;  3B6G C;  3REH B;  5B2I D;  3UT9 A;  3LZ1 A;  4ZUX C;  4R8P C;  5AV8 D;  3X1S D;  3AZJ B;  2W8S A;  5G49 A;  5B32 D;  5DNM B;  3W96 B;  1P3G A;  4Z66 B;  2F8N A;  4EO5 B;  1A7W A;  1ZLA C;  3VH6 T;  3AV1 D;  4JJN D;  3AZF B;  5E5A D;  4NE3 A;  4YM6 C;  2PYO A;  1TZY A;  3REL A;  1JFI B;  4H9Q A;  3MVD C;  2Y2P A;  3UTA C;  5CPI C;  2ZY5 A;  4QLC A;  5AV8 C;  3AFA D;  1P3K D;  1P3O C;  3H0L C;  5B0Z C;  2FJ7 B;  2ZY4 A;  5DNN D;  1H3O A;  1KX4 A;  3REJ A;  3W99 B;  2Y2G A;  5B40 B;  3W97 A;  4UUZ B;  4Z5T B;  2XD5 A;  5AV6 B;  1P3L B;  3AV2 D;  3MNN D;  4H9P A;  3B6F C;  4J8U B;  1M18 D;  3TU4 C;  4KGC D;  1P3M D;  2ZY3 A;  5B1M B;  3X1U D;  4YS3 C;  3AZI B;  1BH8 B;  2G5H C;  5B1L A;  3V9R B;  3AZL D;  4WU8 D;  1KX3 D;  2BG1 A;  1KX5 A;  1WWS A;  3X1V B;  5B24 B;  2NZD C;  3AN2 A;  4J8V B;  2DQN C;  1P3P B;  1S32 A;  5AVC B;  5C3I B;  5CPJ B;  4WJ3 C;  5JRG D;  3LJA D;  2HIO D;  2NQB B;  2CV5 A;  3AZM A;  4E44 A;  2ARO B;  4X23 B;  3AV2 C;  3MNN C;  1F66 D;  3REK A;  3MGR A;  2LY8 A;  4WU9 A;  1P3M C;  2HUE C;  4H9O B;  5B33 B;  5AV9 D;  3C1B C;  3AZL C;  4WU8 C;  4ZUX A;  4R8P A;  5BNX B;  1M19 D;  1M1A A;  5GSU A;  4KUD B;  4H9R B;  1ULY A;  5AY8 D;  2CWE A;  4LD9 D;  3H0M C;  1P3F D;  4J8X A;  5BNV A;  3AZK D;  3WTP B;  5B0Y D;  2HIO C;  3AZG B;  1ZLA A;  3LEL B;  5GT0 D;  1P3A B;  5F99 B;  3KWQ A;  3WKJ B;  1P3I C;  3REH D;  1HQ3 A;  4XZQ B;  3C1C C;  4YM6 A;  3A6N A;  4XUJ A;  3AZN B;  3LZ0 B;  2F8N K;  5DNM D;  3W96 D;  1Q9C A;  3MVD A;  3UTA A;  5AVB B;  5B32 G;  5CPK C;  3WAA B;  4ZBJ C;  5AV8 A;  3X1S A;  1BFM A;  3R45 A;  5B2J B;  3AZF D;  1P3O A;  3LZ1 B;  4H9N B;  4H9S C;  5G49 B;  4CAY A;  3AZK C;  1ID3 B;  3AZH B;  5GT0 C;  1EQZ B;  2F8N B;  2YFW A;  1AOI C;  1T3U A;  3AN2 C;  2JE5 A;  2Y2K A;  3WA9 B;  1S32 C;  5AV5 B;  3B6F A;  2PYO B;  1TZY B;  3REL B;  3TU4 A;  4H9Q B;  1P34 C;  1U35 B;  2CV5 C;  2FJ7 D;  3KUY D;  4WZS B;  3AFA A;  4YS3 A;  1P3K A;  3MGQ C;  1P3B B;  1WWI A;  4QLC B;  3REK C;  1BH9 A;  3W99 D;  3MGR C;  5B40 D;  2NZD A;  3NQU B;  1B67 A;  3REI C;  2RVQ C;  1W2E A;  5AV6 D;  3O62 B;  1P3L D;  2F8N H;  4J8U D;  3W98 C;  4G92 B;  1H3O B;  1M1A C;  1KX4 B;  5B1M D;  1TAF A;  5GSU C;  3AV2 A;  3MNN A;  4J8X C;  4J8W C;  1M18 A;  3X1V D;  4KGC A;  1P3M A;  4J8V D;  4H9P B;  3VH5 W;  2FJ7 C;  3KUY C;  3KWQ C;  3X1U A;  1HQ3 C;  1R4V A;  3C1B A;  5CPJ D;  3NQJ A;  4WU8 A;  3A6N C;  4XUJ C;  3AZL A;  5B1L B;  1KX3 A;  2ZY2 A;  3MGP D;  2NQB D;  1KX5 B;  2ARO D;  4X23 D;  5B2I C;  2ZM5 A;  3X1S C;  3LJA A;  2HIO A;  5B32 C;  4E45 A;  5B1M C;  5B33 D;  1P3I A;  4Z2M H;  3C1C A;  3AZM B;  2YFV A;  5B31 B;  2Y2Q A;  3UTB D;  3AV1 C;  4JJN C;  3KXB B;  1KU5 A;  3W98 D;  5E5A C;  4KUD D;  4WU9 B;  2G5I C;  5CPK A;  4G91 C;  3B6G B;  3MGP C;  3WTP D;  3AZG D;  3LEL D;  1P3A D;  5F99 D;  2Y2H A;  4ZUX B;  4R8P B;  3WKJ D;  5FUG B;  4H9S A;  5AY8 A;  4XZQ D;  4LD9 A;  1P3F A;  3AZN D;  3AZK A;  3AFA C;  1P3K C;  5B0Y A;  5BS7 A;  5GT0 A;  4DRB A;  5BNV B;  1ZLA B;  3IP4 C;  5AVB D;  1AOI A;  3WAA D;  3VH5 A;  5DNN C;  3UTB C;  5BT1 D;  4Z2M G;  5B2J D;  3LZ1 D;  5KDM A;  4YM6 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...