3MVDB

Crystal structure of the chromatin factor rcc1 in complex with the nucleosome core particle
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
82
structure length
82
Chain Sequence
KVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.2
publication title Structure of RCC1 chromatin factor bound to the nucleosome core particle.
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Signaling protein/structural protein/dna
total genus 25
structure length 82
sequence length 82
chains with identical sequence F
ec nomenclature
pdb deposition date 2010-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3mvdB00
5CPKD 3AZFA 3B0CW 1BH9A 5AV5A 3AZIC 2FJ7B 3B6FB 4G91C 5B24D 1AOIB 4J8VC 4X23A 1P3PB 3RELB 1ZLAA 1AOID 4KGCB 3LELB 5B31C 4KUDB 2HIOA 1F66B 4KGCD 5BT1C 3X1SA 4KUDD 5B32A 1P3GA 4H9QB 4WV4B 5F99B 1KX4B 4J8XB 3LZ1C 3UT9B 1KX4D 4J8WB 3AV2C 4J8UC 4WNNA 4ZUXA 2CV5A 5B2IB 3WAAB 4LD9A 1M19B 3C1BA 3O62B 5AV9A 1HQ3A 3X1VC 3WKJB 1M19D 3LZ0C 3WTPE 4JJNB 3KXBC 1P3KC 5B1LB 1P34C 5CPJA 4Z5TC 4JJND 4H9RB 1P3MA 5B33B 3UTBD 1M18C 5B33D 3NQUA 4H9OB 3WTPC 3KUYD 4KHAA 3X1TC 3MGRC 3A6ND 1P3FD 3REKA 5GT3A 3W99B 4XZQA 3R45A 1P3LA 3UTAB 1P3BA 1EQZC 4Z2MH 5AV6B 5GT0A 3AV1A 1F1EA 1ID3A 5AV6D 1KX5B 2NZDD 5B24C 3AZJB 3NQJA 1AOIC 2YFWA 4QLCA 4KGCC 1P3AC 5DNNA 3AZHB 4R8PB 2YFVB 5KDMB 5B2JB 2BYMB 5FUGB 5AY8A 3AZEC 4H9SC 4YM6A 1KX4C 4CAYA 3AFAC 1KX3A 1KU5A 3V9RB 3AYWA 4WU8B 4NE3A 4DRAA 4WU8D 4J8VB 2F8NB 5B0YA 5BS7A 4JJNC 5B31B 4X23D 1M1AA 4Z66A 3UTBC 2AROA 5B31D 3VH6W 3KUYC 5B32D 3LZ1B 4WU9C 3AV2B 3A6NC 5G49B 4J8UB 1P3FC 5B0ZB 3AV2D 5GSUA 5B0ZD 3AN2A 3MNNA 4Z2MG 3X1UA 3C1BD 3LZ0B 3KXBB 5AV6C 1P3KB 1P34B 2NZDC 1BH8B 4Z5TB 3KWQA 1M18B 5CPJD 1P3MD 4XUJA 4DRBA 2BYKA 1H3OB 5BNVA 3MGSC 3KSYA 3REIA 3VH5T 4ZBJC 3MVDB 3MGRB 4CSRB 3AZGA 3MVDD 3MGRD 5E5AA 3REKD 5GT3D 1EQZB 1P3BD 1EQZD 3AZFC 2IO5C 3W98A 2CWEA 3WA9A 4WU8C 5B24B 5DNMB 1ID3D 3B6GB 5DNMD 3REHA 2HUEC 4X23C 3B6GD 1P3AB 1BFMA 4QLCD 3REJA 1P3IA 1P3AD 5B32C 5JRGB 3AZEB 5B40A 3W96A 4HGAB 3AFAB 1TZYA 5JRGD 3AZED 5AY8D 1U35A 4M6BA 3AFAD 5B0ZC 3AZKB 5BO0B 3MGPB 2CV5C 1KX3D 3AZIA 1N1JB 4LD9C 3AZKD 3MGPD 5BNXA 3C1BC 3AZLA 1HQ3C 3LJAB 4G92B 2PYOA 3LJAD 4UUZA 5B0YD 3UTBB 5CPJC 4H9NA 1P3MC 1JFIA 5AVBB 4Z66D 3KUYB 5AVBD 4WU9B 3A6NB 1P3FB 3AZMB 3W97A 4WU9D 5AV8B 3MVDC 5CPIA 4AWLB 5GT3C 3REKC 3AZMD 5AV8D 4YS3B 3X1VA 1P3LC 4YS3D 1P3BC 5AVCA 3C1CA 3AN2D 5B1MA 3MNND 2NZDB 1WWSA 3AV1C 3AZNA 3MGQA 1ID3C 1P3OB 5JA4B 3TU4B 5DNMC 1S32A 1TAFB 3VH5W 1P3OD 3TU4D 3KWQD 3MGSB 3WTPA 3B6GC 3X1TA 5CP6A 4ZBJB 3MGSD 5C3IB 2NQBA 4QLCC 2F8NH 1Q9CA 5GXQB 3VH6A 4H9PA 5GXQD 5E5AD 5JRGC 5AY8C 5CPKA 4YM6C 4HGAC 1ULYA 1KX3C 3AZFB 2IO5B 1BH9B 3MGPC 3AZKC 5AV5B 3AZFD 3AYWC 2FJ7A 3W98D 3B6FA 5AV5D 3B0CT 3LJAC 1AOIA 4G92C 2HUEB 4X23B 1P3PA 5B0YC 3RELA 1ZLAB 4KGCA 3LELA 5BS7C 4KUDA 1M1AC 2HIOB 4Z66C 1F66A 1ZLAD 3X1SB 5AVBC 5B32B 1WWIA 2HIOD 4E44A 1KX4A 4H9QA 5F99A 4H9SA 1P3GB 3REJD 3X1SD 1P3ID 4J8XA 3UT9A 1P3GD 4J8WA 3B0BA 5B40D 3W96D 4WNNB 5B2IA 4ZUXB 1TZYD 3AZMC 5AV8C 2CV5B 3WAAA 1U35D 4ZUXD 4AWLC 2CV5D 4LD9B 1M19A 4YS3C 3O62A 3C1BB 5AV9B 1HQ3B 4LD9D 3WKJA 1R4VA 3AN2C 3MNNC 5AV9D 3X1UC 1HQ3D 3AZLD 4JJNA 3B0DC 5B1LA 5CPJB 4H9RA 1P3MB 5B33A 1P3OC 3TU4C 3KWQC 3NQUB 4H9OA 4NE5A 4KHAB 3REIC 2F8NG 4NE6A 5C3IC 2JSSA 4EO5C 5CHLB 3W99A 5B31G 5GT3B 3REKB 3AZGC 2RVQD 3W97D 4XZQB 5E5AC 5GXQC 3R45B 1P3LB 3UTAA 5CPID 4XZQD 1P3BB 1P3LD 5AV6A 5AVCD 3AV1B 3C1CD 3W98C 1ID3B 1KX5A 5B1MD 5AV5C 5GT0D 3WA9C 3AV1D 4WZSB 3AZND 3MGQD 3AZJA 3NQJB 1S32D 2YFWB 1ZLAC 4QLCB 3AZHA 5DNNB 2HIOC 4E45A 4R8PA 2NQBD 3REJC 3X1SC 2YFVA 5DNND 1P3IC 5KDMA 5B2JA 2BYMA 5FUGA 1P3GC 5AY8B 4YM6B 5B40C 3W96C 4CAYB 1TZYC 1KX3B 4YM6D 1U35C 4ZUXC 3V9RA 1B67A 4WU8A 3AYWB 3AYWD 5AV9C 3AZLC 4J8VA 2FJ7D 2F8NA 3B6FD 5B0YB 2PYOC 5B31A 1P3PD 1M1AB 4Z66B 3RELD 2AROB 3LELD 1M1AD 2LY8A 1F66D 2AROD 3VH5A 3LZ1A 3VH6T 5F99D 3AV2A 4J8UA 5G49A 4J8XD 5B0ZA 2RVQC 3UT9D 3W97C 4J8WD 5CPIC 5GSUB 5B2ID 4XZQC 3WAAD 5GSUD 3AN2B 3MNNB 3O62D 3X1UB 5AVCC 3LZ0A 3C1CC 3B0DB 3KXBA 3WKJD 5B1MC 3X1UD 5GT0C 1P34A 1P3KA 1BH8A 4Z5TA 3AZNC 3MGQC 5B1LD 1M18A 3KWQB 4XUJB 1S32C 2BYKB 1H3OA 5BNVB 4XUJD 3REIB 3MVDA 5CP6C 3MGRA 4CSRA 2NQBC 4EO5B 3REID 5DNNC 3AZGB 5E5AB 3AZGD 3W99D 1EQZA 5CPKC 3UTAD 3W98B 2F8NK 3WA9B 5B24A 5DNMA 2FJ7C 1KX5D 3B6FC 3WA9D 3B6GA 3AZJD 3REHB 1P3PC 3RELC 1P3AA 3LELC 3REHD 4KUDC 1F66C 2AROC 3REJB 1P3IB 3AZHD 5JRGA 4R8PD 5F99C 3AZEA 5B40B 3W96B 4J8XC 3AFAA 5B2JD 1TZYB 3UT9C 4J8WC 1U35B 3AZKA 5BO0A 5B2IC 3MGPA 3WAAC 3AZIB 1N1JA 5GSUC 1M19C 5BNXB 3O62C 3AZID 3LJAA 3AZLB 4G91B 3WKJC 2L5AA 2PYOB 4NFTA 4UUZB 4J8VD 2F8ND 1B6WA 2PYOD 5B1LC 3UTBA 4H9NB 1JFIB 5B33C 1A7WA 5AVBA 3KUYA 5BT1D 4XUJC 4WU9A 3A6NA 1P3FA 3LZ1D 3AZMA 5AV8A 1HTAA 3W97B 4J8UD 3W99C 5CPIB 4YS3A 3X1VB 3UTAC 5B32G 5AVCB 3X1VD 3C1CB 5B1MB 5GT0B 2NZDA 3LZ0D 3KXBD 3AZNB 3MGQB 1P3OA 5JA4A 1KX5C 1P3KD 3TU4A 1P34D 4Z5TD 1TAFA 1S32B 3AZJC 3MGSA 1M18D 3WTPB 3REHC 3X1TB 5CP6B 3WTPD 2NQBB 3AZHC 3X1TD 5CP6D 5GXQA 4R8PC 4H9PB 5B2JC 5CPKB
chains in the Genus database with same CATH superfamily
5CPKD 3AZFA 3B0CW 1BH9A 5AV5A 3AZIC 2FJ7B 3B6FB 4DQYB 2Y2MA 4G91C 5B24D 1AOIB 4J8VC 4X23A 1P3PB 3RELB 1ZLAA 1AOID 4KGCB 3LELB 5B31C 4KUDB 2HIOA 1F66B 4KGCD 5BT1C 3X1SA 2FFFB 4KUDD 5B32A 1P3GA 4H9QB 4WV4B 5F99B 1KX4B 4J8XB 3LZ1C 3UT9B 1KX4D 4J8WB 3AV2C 4J8UC 4WNNA 4ZUXA 2CV5A 5B2IB 3WAAB 4LD9A 1M19B 3C1BA 3O62B 5AV9A 1HQ3A 3X1VC 3WKJB 1M19D 4UPKA 3LZ0C 3WTPE 4JJNB 3KXBC 1P3KC 5B1LB 1P34C 5CPJA 4Z5TC 4JJND 4H9RB 1P3MA 5B33B 3UTBD 1M18C 5B33D 3NQUA 4H9OB 3WTPC 3KUYD 4KHAA 3X1TC 3MGRC 3A6ND 1P3FD 3REKA 5GT3A 3W99B 4XZQA 3R45A 1P3LA 3UTAB 1P3BA 1EQZC 4Z2MH 5AV6B 2Y2HA 5GT0A 3AV1A 1F1EA 1ID3A 5AV6D 1KX5B 2NZDD 3EPLA 5B24C 3AZJB 3NQJA 1AOIC 2YFWA 4QLCA 4KGCC 1P3AC 5DNNA 3AZHB 4R8PB 2YFVB 5KDMB 5B2JB 2BYMB 5FUGB 5AY8A 3AZEC 4H9SC 4YM6A 1KX4C 4CAYA 3AFAC 1KX3A 1KU5A 3V9RB 3FDDA 3AYWA 4WU8B 4NE3A 4DRAA 4WU8D 4J8VB 2F8NB 5B0YA 5BS7A 4JJNC 5B31B 4X23D 1M1AA 4WJ3C 4Z66A 3UTBC 2AROA 5B31D 3VH6W 3H0RC 3H0LC 3KUYC 5B32D 3LZ1B 3H0MC 4WU9C 3AV2B 3A6NC 5G49B 4J8UB 1P3FC 5B0ZB 3AV2D 5GSUA 5B0ZD 3AN2A 3MNNA 4Z2MG 3X1UA 3C1BD 3LZ0B 2G5IC 3KXBB 5AV6C 1P3KB 1P34B 2NZDC 1BH8B 4Z5TB 3KWQA 1M18B 5CPJD 1P3MD 2VQRA 4XUJA 4DRBA 2BYKA 1H3OB 2UWXA 5BNVA 3MGSC 2Y2NA 3KSYA 3REIA 3VH5T 4ZBJC 3MVDB 3MGRB 4CSRB 1W2EA 3AZGA 3MVDD 3MGRD 5E5AA 3REKD 5GT3D 1EQZB 2Y2JA 1P3BD 1EQZD 3AZFC 2IO5C 3W98A 2CWEA 3WA9A 4WU8C 5B24B 5DNMB 1ID3D 3B6GB 5DNMD 3REHA 2HUEC 4X23C 3B6GD 1P3AB 1BFMA 2XD1A 4QLCD 3REJA 1P3IA 1P3AD 5B32C 2DF4C 5JRGB 3AZEB 5B40A 3W96A 4HGAB 3AFAB 1TZYA 5JRGD 3AZED 5AY8D 1U35A 4M6BA 3AFAD 5B0ZC 3AZKB 5BO0B 3MGPB 2CV5C 1KX3D 3AZIA 2Y2OA 1N1JB 4LD9C 3AZKD 3MGPD 5BNXA 3C1BC 3AZLA 1HQ3C 3LJAB 4G92B 2PYOA 3EPHA 3LJAD 4UUZA 5B0YD 3UTBB 5CPJC 4H9NA 1P3MC 1JFIA 5AVBB 4Z66D 3KUYB 5AVBD 4WU9B 3A6NB 1P3FB 3AZMB 3A1IA 3W97A 5AV8B 4WU9D 3MVDC 2ZY2A 5CPIA 4AWLB 5GT3C 3REKC 3AZMD 5AV8D 4YS3B 3X1VA 1P3LC 4YS3D 1P3BC 5AVCA 3C1CA 3AN2D 5B1MA 3MNND 2NZDB 1WWSA 3AV1C 3EPJA 3MGQA 3AZNA 1ID3C 1P3OB 5JA4B 3EPKA 3TU4B 5DNMC 1S32A 1TAFB 3VH5W 1P3OD 3TU4D 3KWQD 3MGSB 3WTPA 3B6GC 3X1TA 5CP6A 4ZBJB 3MGSD 5C3IB 2NQBA 4QLCC 2F8NH 1Q9CA 5GXQB 3VH6A 2Y2GA 4H9PA 5GXQD 5E5AD 5JRGC 5AY8C 5CPKA 4YM6C 4HGAC 1ULYA 1KX3C 3AZFB 2IO5B 1BH9B 3MGPC 3AZKC 5AV5B 3AZFD 3AYWC 2FJ7A 3W98D 3B6FA 5AV5D 3B0CT 3LJAC 1AOIA 4G92C 2HUEB 4X23B 1P3PA 5B0YC 3RELA 1ZLAB 4KGCA 3LELA 5BS7C 4KUDA 1M1AC 2HIOB 4Z66C 1F66A 1ZLAD 2Y2QA 3X1SB 5AVBC 5B32B 1WWIA 2HIOD 4E44A 1KX4A 4H9QA 5F99A 4H9SA 1P3GB 3REJD 3X1SD 1P3ID 4J8XA 3UT9A 1P3GD 4J8WA 3B0BA 5B40D 3W96D 4WNNB 5B2IA 2JE5A 1TZYD 4ZUXB 5AV8C 3AZMC 2CV5B 3WAAA 1U35D 4ZUXD 4AWLC 2CV5D 4LD9B 1M19A 4YS3C 3O62A 3C1BB 5AV9B 3AL0C 1HQ3B 4LD9D 2DQNC 1R4VA 3AN2C 3WKJA 3MNNC 5AV9D 3X1UC 1HQ3D 3AZLD 4JJNA 3B0DC 5B1LA 5CPJB 4H9RA 1P3MB 5B33A 1P3OC 3TU4C 3KWQC 3NQUB 4H9OA 2G5HC 4NE5A 4KHAB 3REIC 2F8NG 4NE6A 5C3IC 1PZRA 2ZY4A 2JSSA 4EO5C 5CHLB 3W99A 5B31G 5GT3B 3REKB 3AZGC 2RVQD 3W97D 4XZQB 5E5AC 5GXQC 3R45B 1P3LB 3UTAA 1Z2CB 5CPID 4XZQD 1P3BB 3IP4C 1P3LD 5AV6A 5AVCD 3AV1B 3C1CD 3W98C 1ID3B 1KX5A 5B1MD 5AV5C 5GT0D 3WA9C 3AV1D 4WZSB 3AZND 3MGQD 3AZJA 3NQJB 1S32D 2YFWB 1ZLAC 1T3UA 4QLCB 3AZHA 2J8PA 5DNNB 2HIOC 4E45A 4R8PA 2NQBD 3REJC 3X1SC 2YFVA 5DNND 1P3IC 5KDMA 5B2JA 2BYMA 5FUGA 1P3GC 5AY8B 2Y2PA 4YM6B 5B40C 3W96C 4CAYB 1TZYC 1KX3B 4YM6D 1U35C 4ZUXC 3V9RA 1B67A 4WU8A 3AYWB 3AYWD 5AV9C 3AZLC 4J8VA 2FJ7D 2F8NA 2ZM5A 3B6FD 5B0YB 2PYOC 2ZY3A 5B31A 1P3PD 1M1AB 4Z66B 3RELD 2AROB 3LELD 1M1AD 2LY8A 1F66D 2AROD 3VH5A 3LZ1A 3VH6T 5F99D 3AV2A 4J8UA 5G49A 4J8XD 5B0ZA 2RVQC 3UT9D 3W97C 4J8WD 5CPIC 5GSUB 5B2ID 4XZQC 3WAAD 5GSUD 3AN2B 2Y2LA 3MNNB 3O62D 3X1UB 5AVCC 3LZ0A 2F2AC 3C1CC 3B0DB 3KXBA 3WKJD 5B1MC 3X1UD 5GT0C 1P34A 1P3KA 1BH8A 4Z5TA 3AZNC 3MGQC 5B1LD 1M18A 3KWQB 2Y2KA 4XUJB 1S32C 2BYKB 1H3OA 5BNVB 4XUJD 3REIB 3MVDA 5CP6C 3MGRA 4CSRA 2NQBC 4EO5B 3REID 5DNNC 3AZGB 5E5AB 3AZGD 3W99D 2XD5A 1EQZA 5CPKC 3UTAD 3W98B 2F8NK 3WA9B 5B24A 5DNMA 2FJ7C 1KX5D 3B6FC 3WA9D 3B6GA 3AZJD 3REHB 1P3PC 3RELC 1P3AA 3LELC 3REHD 4KUDC 1F66C 2AROC 3REJB 1P3IB 3AZHD 5JRGA 4R8PD 5F99C 3AZEA 5B40B 3W96B 4J8XC 3AFAA 5B2JD 3KFUG 1TZYB 3UT9C 4J8WC 1U35B 3AZKA 5BO0A 5B2IC 3MGPA 3EG5B 3WAAC 3AZIB 1N1JA 5GSUC 1M19C 5BNXB 3O62C 3AZID 3LJAA 3AZLB 4G91B 3WKJC 2L5AA 2PYOB 4NFTA 4UUZB 2RIQA 4J8VD 2F8ND 1B6WA 2PYOD 5B1LC 3UTBA 4H9NB 1JFIB 5B33C 1A7WA 5AVBA 3KUYA 5BT1D 4XUJC 4WU9A 3A6NA 1P3FA 2W8SA 3LZ1D 3AZMA 5AV8A 1HTAA 3W97B 4J8UD 3W99C 5CPIB 4YS3A 3X1VB 2JCHA 3UTAC 3F6TA 5B32G 5AVCB 3X1VD 3C1CB 3P5JB 5B1MB 5GT0B 2NZDA 3LZ0D 2Y2IA 3KXBD 3MGQB 3AZNB 5JA4A 1P3OA 1P3KD 1KX5C 3TU4A 1P34D 4Z5TD 1TAFA 1S32B 3AZJC 2BG1A 3MGSA 1M18D 3WTPB 3REHC 3X1TB 5CP6B 3WTPD 2NQBB 3AZHC 3X1TD 2ZY5A 5CP6D 5GXQA 4R8PC 4H9PB 5B2JC 3A1KA 5CPKB
chains in the Genus database with same CATH topology
5CPKD 3AZFA 3B0CW 1BH9A 5AV5A 3AZIC 2FJ7B 3B6FB 4DQYB 2Y2MA 4G91C 5B24D 1AOIB 4J8VC 4X23A 1P3PB 3RELB 1ZLAA 1AOID 4KGCB 3LELB 5B31C 4KUDB 2HIOA 1F66B 4KGCD 5BT1C 3X1SA 2FFFB 4KUDD 5B32A 1P3GA 4H9QB 4WV4B 5F99B 1KX4B 4J8XB 3LZ1C 3UT9B 1KX4D 4J8WB 3AV2C 4J8UC 4WNNA 4ZUXA 2CV5A 5B2IB 3WAAB 4LD9A 1M19B 3C1BA 3O62B 5AV9A 1HQ3A 3X1VC 3WKJB 1M19D 4UPKA 3LZ0C 3WTPE 4JJNB 3KXBC 1P3KC 5B1LB 1P34C 5CPJA 4Z5TC 4JJND 4H9RB 1P3MA 5B33B 3UTBD 1M18C 5B33D 3NQUA 4H9OB 3WTPC 3KUYD 4KHAA 3X1TC 3MGRC 3A6ND 1P3FD 3REKA 5GT3A 3W99B 4XZQA 3R45A 1P3LA 3UTAB 1P3BA 1EQZC 4Z2MH 5AV6B 2Y2HA 5GT0A 3AV1A 1F1EA 1ID3A 5AV6D 1KX5B 2NZDD 3EPLA 5B24C 3AZJB 3NQJA 1AOIC 2YFWA 4QLCA 4KGCC 1P3AC 5DNNA 3AZHB 4R8PB 2YFVB 5KDMB 5B2JB 2BYMB 5FUGB 5AY8A 3AZEC 4H9SC 4YM6A 1KX4C 4CAYA 3AFAC 1KX3A 1KU5A 3V9RB 3FDDA 3AYWA 4WU8B 4NE3A 4DRAA 4WU8D 4J8VB 2F8NB 5B0YA 5BS7A 4JJNC 5B31B 4X23D 1M1AA 4WJ3C 4Z66A 3UTBC 2AROA 5B31D 3VH6W 3H0RC 3H0LC 3KUYC 5B32D 3LZ1B 3H0MC 4WU9C 3AV2B 3A6NC 5G49B 4J8UB 1P3FC 5B0ZB 3AV2D 5GSUA 5B0ZD 3AN2A 3MNNA 4Z2MG 3X1UA 3C1BD 3LZ0B 2G5IC 3KXBB 5AV6C 1P3KB 1P34B 2NZDC 1BH8B 4Z5TB 3KWQA 1M18B 5CPJD 1P3MD 2VQRA 4XUJA 4DRBA 2BYKA 1H3OB 2UWXA 5BNVA 3MGSC 2Y2NA 3KSYA 3REIA 3VH5T 4ZBJC 3MVDB 3MGRB 4CSRB 1W2EA 3AZGA 3MVDD 3MGRD 5E5AA 3REKD 5GT3D 1EQZB 2Y2JA 1P3BD 1EQZD 3AZFC 2IO5C 3W98A 2CWEA 3WA9A 4WU8C 5B24B 5DNMB 1ID3D 3B6GB 5DNMD 3REHA 2HUEC 4X23C 3B6GD 1P3AB 1BFMA 2XD1A 4QLCD 3REJA 1P3IA 1P3AD 5B32C 2DF4C 5JRGB 3AZEB 5B40A 3W96A 4HGAB 3AFAB 1TZYA 5JRGD 3AZED 5AY8D 1U35A 4M6BA 3AFAD 5B0ZC 3AZKB 5BO0B 3MGPB 2CV5C 1KX3D 3AZIA 2Y2OA 1N1JB 4LD9C 3AZKD 3MGPD 5BNXA 3C1BC 3AZLA 1HQ3C 3LJAB 4G92B 2PYOA 3EPHA 3LJAD 4UUZA 5B0YD 3UTBB 5CPJC 4H9NA 1P3MC 1JFIA 5AVBB 4Z66D 3KUYB 5AVBD 4WU9B 3A6NB 1P3FB 3AZMB 3A1IA 3W97A 5AV8B 4WU9D 3MVDC 2ZY2A 5CPIA 4AWLB 5GT3C 3REKC 3AZMD 5AV8D 4YS3B 3X1VA 1P3LC 4YS3D 1P3BC 5AVCA 3C1CA 3AN2D 5B1MA 3MNND 2NZDB 1WWSA 3AV1C 3EPJA 3MGQA 3AZNA 1ID3C 1P3OB 5JA4B 3EPKA 3TU4B 5DNMC 1S32A 1TAFB 3VH5W 1P3OD 3TU4D 3KWQD 3MGSB 3WTPA 3B6GC 3X1TA 5CP6A 4ZBJB 3MGSD 5C3IB 2NQBA 4QLCC 2F8NH 1Q9CA 5GXQB 3VH6A 2Y2GA 4H9PA 5GXQD 5E5AD 5JRGC 5AY8C 5CPKA 4YM6C 4HGAC 1ULYA 1KX3C 3AZFB 2IO5B 1BH9B 3MGPC 3AZKC 5AV5B 3AZFD 3AYWC 2FJ7A 3W98D 3B6FA 5AV5D 3B0CT 3LJAC 1AOIA 4G92C 2HUEB 4X23B 1P3PA 5B0YC 3RELA 1ZLAB 4KGCA 3LELA 5BS7C 4KUDA 1M1AC 2HIOB 4Z66C 1F66A 1ZLAD 2Y2QA 3X1SB 5AVBC 5B32B 1WWIA 2HIOD 4E44A 1KX4A 4H9QA 5F99A 4H9SA 1P3GB 3REJD 3X1SD 1P3ID 4J8XA 3UT9A 1P3GD 4J8WA 3B0BA 5B40D 3W96D 4WNNB 5B2IA 2JE5A 1TZYD 4ZUXB 5AV8C 3AZMC 2CV5B 3WAAA 1U35D 4ZUXD 4AWLC 2CV5D 4LD9B 1M19A 4YS3C 3O62A 3C1BB 5AV9B 3AL0C 1HQ3B 4LD9D 2DQNC 1R4VA 3AN2C 3WKJA 3MNNC 5AV9D 3X1UC 1HQ3D 3AZLD 4JJNA 3B0DC 5B1LA 5CPJB 4H9RA 1P3MB 5B33A 1P3OC 3TU4C 3KWQC 3NQUB 4H9OA 2G5HC 4NE5A 4KHAB 3REIC 2F8NG 4NE6A 5C3IC 1PZRA 2ZY4A 2JSSA 4EO5C 5CHLB 3W99A 5B31G 5GT3B 3REKB 3AZGC 2RVQD 3W97D 4XZQB 5E5AC 5GXQC 3R45B 1P3LB 3UTAA 1Z2CB 5CPID 4XZQD 1P3BB 3IP4C 1P3LD 5AV6A 5AVCD 3AV1B 3C1CD 3W98C 1ID3B 1KX5A 5B1MD 5AV5C 5GT0D 3WA9C 3AV1D 4WZSB 3AZND 3MGQD 3AZJA 3NQJB 1S32D 2YFWB 1ZLAC 1T3UA 4QLCB 3AZHA 2J8PA 5DNNB 2HIOC 4E45A 4R8PA 2NQBD 3REJC 3X1SC 2YFVA 5DNND 1P3IC 5KDMA 5B2JA 2BYMA 5FUGA 1P3GC 5AY8B 2Y2PA 4YM6B 5B40C 3W96C 4CAYB 1TZYC 1KX3B 4YM6D 1U35C 4ZUXC 3V9RA 1B67A 4WU8A 3AYWB 3AYWD 5AV9C 3AZLC 4J8VA 2FJ7D 2F8NA 2ZM5A 3B6FD 5B0YB 2PYOC 2ZY3A 5B31A 1P3PD 1M1AB 4Z66B 3RELD 2AROB 3LELD 1M1AD 2LY8A 1F66D 2AROD 3VH5A 3LZ1A 3VH6T 5F99D 3AV2A 4J8UA 5G49A 4J8XD 5B0ZA 2RVQC 3UT9D 3W97C 4J8WD 5CPIC 5GSUB 5B2ID 4XZQC 3WAAD 5GSUD 3AN2B 2Y2LA 3MNNB 3O62D 3X1UB 5AVCC 3LZ0A 2F2AC 3C1CC 3B0DB 3KXBA 3WKJD 5B1MC 3X1UD 5GT0C 1P34A 1P3KA 1BH8A 4Z5TA 3AZNC 3MGQC 5B1LD 1M18A 3KWQB 2Y2KA 4XUJB 1S32C 2BYKB 1H3OA 5BNVB 4XUJD 3REIB 3MVDA 5CP6C 3MGRA 4CSRA 2NQBC 4EO5B 3REID 5DNNC 3AZGB 5E5AB 3AZGD 3W99D 2XD5A 1EQZA 5CPKC 3UTAD 3W98B 2F8NK 3WA9B 5B24A 5DNMA 2FJ7C 1KX5D 3B6FC 3WA9D 3B6GA 3AZJD 3REHB 1P3PC 3RELC 1P3AA 3LELC 3REHD 4KUDC 1F66C 2AROC 3REJB 1P3IB 3AZHD 5JRGA 4R8PD 5F99C 3AZEA 5B40B 3W96B 4J8XC 3AFAA 5B2JD 3KFUG 1TZYB 3UT9C 4J8WC 1U35B 3AZKA 5BO0A 5B2IC 3MGPA 3EG5B 3WAAC 3AZIB 1N1JA 5GSUC 1M19C 5BNXB 3O62C 3AZID 3LJAA 3AZLB 4G91B 3WKJC 2L5AA 2PYOB 4NFTA 4UUZB 2RIQA 4J8VD 2F8ND 1B6WA 2PYOD 5B1LC 3UTBA 4H9NB 1JFIB 5B33C 1A7WA 5AVBA 3KUYA 5BT1D 4XUJC 4WU9A 3A6NA 1P3FA 2W8SA 3LZ1D 3AZMA 5AV8A 1HTAA 3W97B 4J8UD 3W99C 5CPIB 4YS3A 3X1VB 2JCHA 3UTAC 3F6TA 5B32G 5AVCB 3X1VD 3C1CB 3P5JB 5B1MB 5GT0B 2NZDA 3LZ0D 2Y2IA 3KXBD 3MGQB 3AZNB 5JA4A 1P3OA 1P3KD 1KX5C 3TU4A 1P34D 4Z5TD 1TAFA 1S32B 3AZJC 2BG1A 3MGSA 1M18D 3WTPB 3REHC 3X1TB 5CP6B 3WTPD 2NQBB 3AZHC 3X1TD 2ZY5A 5CP6D 5GXQA 4R8PC 4H9PB 5B2JC 3A1KA 5CPKB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CPK D;  3AZF A;  3B0C W;  1BH9 A;  5AV5 A;  3AZI C;  2FJ7 B;  3B6F B;  4G91 C;  5B24 D;  1AOI B;  4J8V C;  4X23 A;  1P3P B;  3REL B;  1ZLA A;  1AOI D;  4KGC B;  3LEL B;  5B31 C;  4KUD B;  2HIO A;  1F66 B;  4KGC D;  5BT1 C;  3X1S A;  4KUD D;  5B32 A;  1P3G A;  4H9Q B;  4WV4 B;  5F99 B;  1KX4 B;  4J8X B;  3LZ1 C;  3UT9 B;  1KX4 D;  4J8W B;  3AV2 C;  4J8U C;  4WNN A;  4ZUX A;  2CV5 A;  5B2I B;  3WAA B;  4LD9 A;  1M19 B;  3C1B A;  3O62 B;  5AV9 A;  1HQ3 A;  3X1V C;  3WKJ B;  1M19 D;  3LZ0 C;  3WTP E;  4JJN B;  3KXB C;  1P3K C;  5B1L B;  1P34 C;  5CPJ A;  4Z5T C;  4JJN D;  4H9R B;  1P3M A;  5B33 B;  3UTB D;  1M18 C;  5B33 D;  3NQU A;  4H9O B;  3WTP C;  3KUY D;  4KHA A;  3X1T C;  3MGR C;  3A6N D;  1P3F D;  3REK A;  5GT3 A;  3W99 B;  4XZQ A;  3R45 A;  1P3L A;  3UTA B;  1P3B A;  1EQZ C;  4Z2M H;  5AV6 B;  5GT0 A;  3AV1 A;  1F1E A;  1ID3 A;  5AV6 D;  1KX5 B;  2NZD D;  5B24 C;  3AZJ B;  3NQJ A;  1AOI C;  2YFW A;  4QLC A;  4KGC C;  1P3A C;  5DNN A;  3AZH B;  4R8P B;  2YFV B;  5KDM B;  5B2J B;  2BYM B;  5FUG B;  5AY8 A;  3AZE C;  4H9S C;  4YM6 A;  1KX4 C;  4CAY A;  3AFA C;  1KX3 A;  1KU5 A;  3V9R B;  3AYW A;  4WU8 B;  4NE3 A;  4DRA A;  4WU8 D;  4J8V B;  2F8N B;  5B0Y A;  5BS7 A;  4JJN C;  5B31 B;  4X23 D;  1M1A A;  4Z66 A;  3UTB C;  2ARO A;  5B31 D;  3VH6 W;  3KUY C;  5B32 D;  3LZ1 B;  4WU9 C;  3AV2 B;  3A6N C;  5G49 B;  4J8U B;  1P3F C;  5B0Z B;  3AV2 D;  5GSU A;  5B0Z D;  3AN2 A;  3MNN A;  4Z2M G;  3X1U A;  3C1B D;  3LZ0 B;  3KXB B;  5AV6 C;  1P3K B;  1P34 B;  2NZD C;  1BH8 B;  4Z5T B;  3KWQ A;  1M18 B;  5CPJ D;  1P3M D;  4XUJ A;  4DRB A;  2BYK A;  1H3O B;  5BNV A;  3MGS C;  3KSY A;  3REI A;  3VH5 T;  4ZBJ C;  3MVD B;  3MGR B;  4CSR B;  3AZG A;  3MVD D;  3MGR D;  5E5A A;  3REK D;  5GT3 D;  1EQZ B;  1P3B D;  1EQZ D;  3AZF C;  2IO5 C;  3W98 A;  2CWE A;  3WA9 A;  4WU8 C;  5B24 B;  5DNM B;  1ID3 D;  3B6G B;  5DNM D;  3REH A;  2HUE C;  4X23 C;  3B6G D;  1P3A B;  1BFM A;  4QLC D;  3REJ A;  1P3I A;  1P3A D;  5B32 C;  5JRG B;  3AZE B;  5B40 A;  3W96 A;  4HGA B;  3AFA B;  1TZY A;  5JRG D;  3AZE D;  5AY8 D;  1U35 A;  4M6B A;  3AFA D;  5B0Z C;  3AZK B;  5BO0 B;  3MGP B;  2CV5 C;  1KX3 D;  3AZI A;  1N1J B;  4LD9 C;  3AZK D;  3MGP D;  5BNX A;  3C1B C;  3AZL A;  1HQ3 C;  3LJA B;  4G92 B;  2PYO A;  3LJA D;  4UUZ A;  5B0Y D;  3UTB B;  5CPJ C;  4H9N A;  1P3M C;  1JFI A;  5AVB B;  4Z66 D;  3KUY B;  5AVB D;  4WU9 B;  3A6N B;  1P3F B;  3AZM B;  3W97 A;  4WU9 D;  5AV8 B;  3MVD C;  5CPI A;  4AWL B;  5GT3 C;  3REK C;  3AZM D;  5AV8 D;  4YS3 B;  3X1V A;  1P3L C;  4YS3 D;  1P3B C;  5AVC A;  3C1C A;  3AN2 D;  5B1M A;  3MNN D;  2NZD B;  1WWS A;  3AV1 C;  3AZN A;  3MGQ A;  1ID3 C;  1P3O B;  5JA4 B;  3TU4 B;  5DNM C;  1S32 A;  1TAF B;  3VH5 W;  1P3O D;  3TU4 D;  3KWQ D;  3MGS B;  3WTP A;  3B6G C;  3X1T A;  5CP6 A;  4ZBJ B;  3MGS D;  5C3I B;  2NQB A;  4QLC C;  2F8N H;  1Q9C A;  5GXQ B;  3VH6 A;  4H9P A;  5GXQ D;  5E5A D;  5JRG C;  5AY8 C;  5CPK A;  4YM6 C;  4HGA C;  1ULY A;  1KX3 C;  3AZF B;  2IO5 B;  1BH9 B;  3MGP C;  3AZK C;  5AV5 B;  3AZF D;  3AYW C;  2FJ7 A;  3W98 D;  3B6F A;  5AV5 D;  3B0C T;  3LJA C;  1AOI A;  4G92 C;  2HUE B;  4X23 B;  1P3P A;  5B0Y C;  3REL A;  1ZLA B;  4KGC A;  3LEL A;  5BS7 C;  4KUD A;  1M1A C;  2HIO B;  4Z66 C;  1F66 A;  1ZLA D;  3X1S B;  5AVB C;  5B32 B;  1WWI A;  2HIO D;  4E44 A;  1KX4 A;  4H9Q A;  5F99 A;  4H9S A;  1P3G B;  3REJ D;  3X1S D;  1P3I D;  4J8X A;  3UT9 A;  1P3G D;  4J8W A;  3B0B A;  5B40 D;  3W96 D;  4WNN B;  5B2I A;  4ZUX B;  1TZY D;  3AZM C;  5AV8 C;  2CV5 B;  3WAA A;  1U35 D;  4ZUX D;  4AWL C;  2CV5 D;  4LD9 B;  1M19 A;  4YS3 C;  3O62 A;  3C1B B;  5AV9 B;  1HQ3 B;  4LD9 D;  3WKJ A;  1R4V A;  3AN2 C;  3MNN C;  5AV9 D;  3X1U C;  1HQ3 D;  3AZL D;  4JJN A;  3B0D C;  5B1L A;  5CPJ B;  4H9R A;  1P3M B;  5B33 A;  1P3O C;  3TU4 C;  3KWQ C;  3NQU B;  4H9O A;  4NE5 A;  4KHA B;  3REI C;  2F8N G;  4NE6 A;  5C3I C;  2JSS A;  4EO5 C;  5CHL B;  3W99 A;  5B31 G;  5GT3 B;  3REK B;  3AZG C;  2RVQ D;  3W97 D;  4XZQ B;  5E5A C;  5GXQ C;  3R45 B;  1P3L B;  3UTA A;  5CPI D;  4XZQ D;  1P3B B;  1P3L D;  5AV6 A;  5AVC D;  3AV1 B;  3C1C D;  3W98 C;  1ID3 B;  1KX5 A;  5B1M D;  5AV5 C;  5GT0 D;  3WA9 C;  3AV1 D;  4WZS B;  3AZN D;  3MGQ D;  3AZJ A;  3NQJ B;  1S32 D;  2YFW B;  1ZLA C;  4QLC B;  3AZH A;  5DNN B;  2HIO C;  4E45 A;  4R8P A;  2NQB D;  3REJ C;  3X1S C;  2YFV A;  5DNN D;  1P3I C;  5KDM A;  5B2J A;  2BYM A;  5FUG A;  1P3G C;  5AY8 B;  4YM6 B;  5B40 C;  3W96 C;  4CAY B;  1TZY C;  1KX3 B;  4YM6 D;  1U35 C;  4ZUX C;  3V9R A;  1B67 A;  4WU8 A;  3AYW B;  3AYW D;  5AV9 C;  3AZL C;  4J8V A;  2FJ7 D;  2F8N A;  3B6F D;  5B0Y B;  2PYO C;  5B31 A;  1P3P D;  1M1A B;  4Z66 B;  3REL D;  2ARO B;  3LEL D;  1M1A D;  2LY8 A;  1F66 D;  2ARO D;  3VH5 A;  3LZ1 A;  3VH6 T;  5F99 D;  3AV2 A;  4J8U A;  5G49 A;  4J8X D;  5B0Z A;  2RVQ C;  3UT9 D;  3W97 C;  4J8W D;  5CPI C;  5GSU B;  5B2I D;  4XZQ C;  3WAA D;  5GSU D;  3AN2 B;  3MNN B;  3O62 D;  3X1U B;  5AVC C;  3LZ0 A;  3C1C C;  3B0D B;  3KXB A;  3WKJ D;  5B1M C;  3X1U D;  5GT0 C;  1P34 A;  1P3K A;  1BH8 A;  4Z5T A;  3AZN C;  3MGQ C;  5B1L D;  1M18 A;  3KWQ B;  4XUJ B;  1S32 C;  2BYK B;  1H3O A;  5BNV B;  4XUJ D;  3REI B;  3MVD A;  5CP6 C;  3MGR A;  4CSR A;  2NQB C;  4EO5 B;  3REI D;  5DNN C;  3AZG B;  5E5A B;  3AZG D;  3W99 D;  1EQZ A;  5CPK C;  3UTA D;  3W98 B;  2F8N K;  3WA9 B;  5B24 A;  5DNM A;  2FJ7 C;  1KX5 D;  3B6F C;  3WA9 D;  3B6G A;  3AZJ D;  3REH B;  1P3P C;  3REL C;  1P3A A;  3LEL C;  3REH D;  4KUD C;  1F66 C;  2ARO C;  3REJ B;  1P3I B;  3AZH D;  5JRG A;  4R8P D;  5F99 C;  3AZE A;  5B40 B;  3W96 B;  4J8X C;  3AFA A;  5B2J D;  1TZY B;  3UT9 C;  4J8W C;  1U35 B;  3AZK A;  5BO0 A;  5B2I C;  3MGP A;  3WAA C;  3AZI B;  1N1J A;  5GSU C;  1M19 C;  5BNX B;  3O62 C;  3AZI D;  3LJA A;  3AZL B;  4G91 B;  3WKJ C;  2L5A A;  2PYO B;  4NFT A;  4UUZ B;  4J8V D;  2F8N D;  1B6W A;  2PYO D;  5B1L C;  3UTB A;  4H9N B;  1JFI B;  5B33 C;  1A7W A;  5AVB A;  3KUY A;  5BT1 D;  4XUJ C;  4WU9 A;  3A6N A;  1P3F A;  3LZ1 D;  3AZM A;  5AV8 A;  1HTA A;  3W97 B;  4J8U D;  3W99 C;  5CPI B;  4YS3 A;  3X1V B;  3UTA C;  5B32 G;  5AVC B;  3X1V D;  3C1C B;  5B1M B;  5GT0 B;  2NZD A;  3LZ0 D;  3KXB D;  3AZN B;  3MGQ B;  1P3O A;  5JA4 A;  1KX5 C;  1P3K D;  3TU4 A;  1P34 D;  4Z5T D;  1TAF A;  1S32 B;  3AZJ C;  3MGS A;  1M18 D;  3WTP B;  3REH C;  3X1T B;  5CP6 B;  3WTP D;  2NQB B;  3AZH C;  3X1T D;  5CP6 D;  5GXQ A;  4R8P C;  4H9P B;  5B2J C;  5CPK B; 
#chains in the Genus database with same CATH topology
 5CPK D;  3AZF A;  3B0C W;  1BH9 A;  5AV5 A;  3AZI C;  2FJ7 B;  3B6F B;  4DQY B;  2Y2M A;  4G91 C;  5B24 D;  1AOI B;  4J8V C;  4X23 A;  1P3P B;  3REL B;  1ZLA A;  1AOI D;  4KGC B;  3LEL B;  5B31 C;  4KUD B;  2HIO A;  1F66 B;  4KGC D;  5BT1 C;  3X1S A;  2FFF B;  4KUD D;  5B32 A;  1P3G A;  4H9Q B;  4WV4 B;  5F99 B;  1KX4 B;  4J8X B;  3LZ1 C;  3UT9 B;  1KX4 D;  4J8W B;  3AV2 C;  4J8U C;  4WNN A;  4ZUX A;  2CV5 A;  5B2I B;  3WAA B;  4LD9 A;  1M19 B;  3C1B A;  3O62 B;  5AV9 A;  1HQ3 A;  3X1V C;  3WKJ B;  1M19 D;  4UPK A;  3LZ0 C;  3WTP E;  4JJN B;  3KXB C;  1P3K C;  5B1L B;  1P34 C;  5CPJ A;  4Z5T C;  4JJN D;  4H9R B;  1P3M A;  5B33 B;  3UTB D;  1M18 C;  5B33 D;  3NQU A;  4H9O B;  3WTP C;  3KUY D;  4KHA A;  3X1T C;  3MGR C;  3A6N D;  1P3F D;  3REK A;  5GT3 A;  3W99 B;  4XZQ A;  3R45 A;  1P3L A;  3UTA B;  1P3B A;  1EQZ C;  4Z2M H;  5AV6 B;  2Y2H A;  5GT0 A;  3AV1 A;  1F1E A;  1ID3 A;  5AV6 D;  1KX5 B;  2NZD D;  3EPL A;  5B24 C;  3AZJ B;  3NQJ A;  1AOI C;  2YFW A;  4QLC A;  4KGC C;  1P3A C;  5DNN A;  3AZH B;  4R8P B;  2YFV B;  5KDM B;  5B2J B;  2BYM B;  5FUG B;  5AY8 A;  3AZE C;  4H9S C;  4YM6 A;  1KX4 C;  4CAY A;  3AFA C;  1KX3 A;  1KU5 A;  3V9R B;  3FDD A;  3AYW A;  4WU8 B;  4NE3 A;  4DRA A;  4WU8 D;  4J8V B;  2F8N B;  5B0Y A;  5BS7 A;  4JJN C;  5B31 B;  4X23 D;  1M1A A;  4WJ3 C;  4Z66 A;  3UTB C;  2ARO A;  5B31 D;  3VH6 W;  3H0R C;  3H0L C;  3KUY C;  5B32 D;  3LZ1 B;  3H0M C;  4WU9 C;  3AV2 B;  3A6N C;  5G49 B;  4J8U B;  1P3F C;  5B0Z B;  3AV2 D;  5GSU A;  5B0Z D;  3AN2 A;  3MNN A;  4Z2M G;  3X1U A;  3C1B D;  3LZ0 B;  2G5I C;  3KXB B;  5AV6 C;  1P3K B;  1P34 B;  2NZD C;  1BH8 B;  4Z5T B;  3KWQ A;  1M18 B;  5CPJ D;  1P3M D;  2VQR A;  4XUJ A;  4DRB A;  2BYK A;  1H3O B;  2UWX A;  5BNV A;  3MGS C;  2Y2N A;  3KSY A;  3REI A;  3VH5 T;  4ZBJ C;  3MVD B;  3MGR B;  4CSR B;  1W2E A;  3AZG A;  3MVD D;  3MGR D;  5E5A A;  3REK D;  5GT3 D;  1EQZ B;  2Y2J A;  1P3B D;  1EQZ D;  3AZF C;  2IO5 C;  3W98 A;  2CWE A;  3WA9 A;  4WU8 C;  5B24 B;  5DNM B;  1ID3 D;  3B6G B;  5DNM D;  3REH A;  2HUE C;  4X23 C;  3B6G D;  1P3A B;  1BFM A;  2XD1 A;  4QLC D;  3REJ A;  1P3I A;  1P3A D;  5B32 C;  2DF4 C;  5JRG B;  3AZE B;  5B40 A;  3W96 A;  4HGA B;  3AFA B;  1TZY A;  5JRG D;  3AZE D;  5AY8 D;  1U35 A;  4M6B A;  3AFA D;  5B0Z C;  3AZK B;  5BO0 B;  3MGP B;  2CV5 C;  1KX3 D;  3AZI A;  2Y2O A;  1N1J B;  4LD9 C;  3AZK D;  3MGP D;  5BNX A;  3C1B C;  3AZL A;  1HQ3 C;  3LJA B;  4G92 B;  2PYO A;  3EPH A;  3LJA D;  4UUZ A;  5B0Y D;  3UTB B;  5CPJ C;  4H9N A;  1P3M C;  1JFI A;  5AVB B;  4Z66 D;  3KUY B;  5AVB D;  4WU9 B;  3A6N B;  1P3F B;  3AZM B;  3A1I A;  3W97 A;  5AV8 B;  4WU9 D;  3MVD C;  2ZY2 A;  5CPI A;  4AWL B;  5GT3 C;  3REK C;  3AZM D;  5AV8 D;  4YS3 B;  3X1V A;  1P3L C;  4YS3 D;  1P3B C;  5AVC A;  3C1C A;  3AN2 D;  5B1M A;  3MNN D;  2NZD B;  1WWS A;  3AV1 C;  3EPJ A;  3MGQ A;  3AZN A;  1ID3 C;  1P3O B;  5JA4 B;  3EPK A;  3TU4 B;  5DNM C;  1S32 A;  1TAF B;  3VH5 W;  1P3O D;  3TU4 D;  3KWQ D;  3MGS B;  3WTP A;  3B6G C;  3X1T A;  5CP6 A;  4ZBJ B;  3MGS D;  5C3I B;  2NQB A;  4QLC C;  2F8N H;  1Q9C A;  5GXQ B;  3VH6 A;  2Y2G A;  4H9P A;  5GXQ D;  5E5A D;  5JRG C;  5AY8 C;  5CPK A;  4YM6 C;  4HGA C;  1ULY A;  1KX3 C;  3AZF B;  2IO5 B;  1BH9 B;  3MGP C;  3AZK C;  5AV5 B;  3AZF D;  3AYW C;  2FJ7 A;  3W98 D;  3B6F A;  5AV5 D;  3B0C T;  3LJA C;  1AOI A;  4G92 C;  2HUE B;  4X23 B;  1P3P A;  5B0Y C;  3REL A;  1ZLA B;  4KGC A;  3LEL A;  5BS7 C;  4KUD A;  1M1A C;  2HIO B;  4Z66 C;  1F66 A;  1ZLA D;  2Y2Q A;  3X1S B;  5AVB C;  5B32 B;  1WWI A;  2HIO D;  4E44 A;  1KX4 A;  4H9Q A;  5F99 A;  4H9S A;  1P3G B;  3REJ D;  3X1S D;  1P3I D;  4J8X A;  3UT9 A;  1P3G D;  4J8W A;  3B0B A;  5B40 D;  3W96 D;  4WNN B;  5B2I A;  2JE5 A;  1TZY D;  4ZUX B;  5AV8 C;  3AZM C;  2CV5 B;  3WAA A;  1U35 D;  4ZUX D;  4AWL C;  2CV5 D;  4LD9 B;  1M19 A;  4YS3 C;  3O62 A;  3C1B B;  5AV9 B;  3AL0 C;  1HQ3 B;  4LD9 D;  2DQN C;  1R4V A;  3AN2 C;  3WKJ A;  3MNN C;  5AV9 D;  3X1U C;  1HQ3 D;  3AZL D;  4JJN A;  3B0D C;  5B1L A;  5CPJ B;  4H9R A;  1P3M B;  5B33 A;  1P3O C;  3TU4 C;  3KWQ C;  3NQU B;  4H9O A;  2G5H C;  4NE5 A;  4KHA B;  3REI C;  2F8N G;  4NE6 A;  5C3I C;  1PZR A;  2ZY4 A;  2JSS A;  4EO5 C;  5CHL B;  3W99 A;  5B31 G;  5GT3 B;  3REK B;  3AZG C;  2RVQ D;  3W97 D;  4XZQ B;  5E5A C;  5GXQ C;  3R45 B;  1P3L B;  3UTA A;  1Z2C B;  5CPI D;  4XZQ D;  1P3B B;  3IP4 C;  1P3L D;  5AV6 A;  5AVC D;  3AV1 B;  3C1C D;  3W98 C;  1ID3 B;  1KX5 A;  5B1M D;  5AV5 C;  5GT0 D;  3WA9 C;  3AV1 D;  4WZS B;  3AZN D;  3MGQ D;  3AZJ A;  3NQJ B;  1S32 D;  2YFW B;  1ZLA C;  1T3U A;  4QLC B;  3AZH A;  2J8P A;  5DNN B;  2HIO C;  4E45 A;  4R8P A;  2NQB D;  3REJ C;  3X1S C;  2YFV A;  5DNN D;  1P3I C;  5KDM A;  5B2J A;  2BYM A;  5FUG A;  1P3G C;  5AY8 B;  2Y2P A;  4YM6 B;  5B40 C;  3W96 C;  4CAY B;  1TZY C;  1KX3 B;  4YM6 D;  1U35 C;  4ZUX C;  3V9R A;  1B67 A;  4WU8 A;  3AYW B;  3AYW D;  5AV9 C;  3AZL C;  4J8V A;  2FJ7 D;  2F8N A;  2ZM5 A;  3B6F D;  5B0Y B;  2PYO C;  2ZY3 A;  5B31 A;  1P3P D;  1M1A B;  4Z66 B;  3REL D;  2ARO B;  3LEL D;  1M1A D;  2LY8 A;  1F66 D;  2ARO D;  3VH5 A;  3LZ1 A;  3VH6 T;  5F99 D;  3AV2 A;  4J8U A;  5G49 A;  4J8X D;  5B0Z A;  2RVQ C;  3UT9 D;  3W97 C;  4J8W D;  5CPI C;  5GSU B;  5B2I D;  4XZQ C;  3WAA D;  5GSU D;  3AN2 B;  2Y2L A;  3MNN B;  3O62 D;  3X1U B;  5AVC C;  3LZ0 A;  2F2A C;  3C1C C;  3B0D B;  3KXB A;  3WKJ D;  5B1M C;  3X1U D;  5GT0 C;  1P34 A;  1P3K A;  1BH8 A;  4Z5T A;  3AZN C;  3MGQ C;  5B1L D;  1M18 A;  3KWQ B;  2Y2K A;  4XUJ B;  1S32 C;  2BYK B;  1H3O A;  5BNV B;  4XUJ D;  3REI B;  3MVD A;  5CP6 C;  3MGR A;  4CSR A;  2NQB C;  4EO5 B;  3REI D;  5DNN C;  3AZG B;  5E5A B;  3AZG D;  3W99 D;  2XD5 A;  1EQZ A;  5CPK C;  3UTA D;  3W98 B;  2F8N K;  3WA9 B;  5B24 A;  5DNM A;  2FJ7 C;  1KX5 D;  3B6F C;  3WA9 D;  3B6G A;  3AZJ D;  3REH B;  1P3P C;  3REL C;  1P3A A;  3LEL C;  3REH D;  4KUD C;  1F66 C;  2ARO C;  3REJ B;  1P3I B;  3AZH D;  5JRG A;  4R8P D;  5F99 C;  3AZE A;  5B40 B;  3W96 B;  4J8X C;  3AFA A;  5B2J D;  3KFU G;  1TZY B;  3UT9 C;  4J8W C;  1U35 B;  3AZK A;  5BO0 A;  5B2I C;  3MGP A;  3EG5 B;  3WAA C;  3AZI B;  1N1J A;  5GSU C;  1M19 C;  5BNX B;  3O62 C;  3AZI D;  3LJA A;  3AZL B;  4G91 B;  3WKJ C;  2L5A A;  2PYO B;  4NFT A;  4UUZ B;  2RIQ A;  4J8V D;  2F8N D;  1B6W A;  2PYO D;  5B1L C;  3UTB A;  4H9N B;  1JFI B;  5B33 C;  1A7W A;  5AVB A;  3KUY A;  5BT1 D;  4XUJ C;  4WU9 A;  3A6N A;  1P3F A;  2W8S A;  3LZ1 D;  3AZM A;  5AV8 A;  1HTA A;  3W97 B;  4J8U D;  3W99 C;  5CPI B;  4YS3 A;  3X1V B;  2JCH A;  3UTA C;  3F6T A;  5B32 G;  5AVC B;  3X1V D;  3C1C B;  3P5J B;  5B1M B;  5GT0 B;  2NZD A;  3LZ0 D;  2Y2I A;  3KXB D;  3MGQ B;  3AZN B;  5JA4 A;  1P3O A;  1P3K D;  1KX5 C;  3TU4 A;  1P34 D;  4Z5T D;  1TAF A;  1S32 B;  3AZJ C;  2BG1 A;  3MGS A;  1M18 D;  3WTP B;  3REH C;  3X1T B;  5CP6 B;  3WTP D;  2NQB B;  3AZH C;  3X1T D;  2ZY5 A;  5CP6 D;  5GXQ A;  4R8P C;  4H9P B;  5B2J C;  3A1K A;  5CPK B; 
#chains in the Genus database with same CATH homology
 5CPK D;  3AZF A;  3B0C W;  1BH9 A;  5AV5 A;  3AZI C;  2FJ7 B;  3B6F B;  4DQY B;  2Y2M A;  4G91 C;  5B24 D;  1AOI B;  4J8V C;  4X23 A;  1P3P B;  3REL B;  1ZLA A;  1AOI D;  4KGC B;  3LEL B;  5B31 C;  4KUD B;  2HIO A;  1F66 B;  4KGC D;  5BT1 C;  3X1S A;  2FFF B;  4KUD D;  5B32 A;  1P3G A;  4H9Q B;  4WV4 B;  5F99 B;  1KX4 B;  4J8X B;  3LZ1 C;  3UT9 B;  1KX4 D;  4J8W B;  3AV2 C;  4J8U C;  4WNN A;  4ZUX A;  2CV5 A;  5B2I B;  3WAA B;  4LD9 A;  1M19 B;  3C1B A;  3O62 B;  5AV9 A;  1HQ3 A;  3X1V C;  3WKJ B;  1M19 D;  4UPK A;  3LZ0 C;  3WTP E;  4JJN B;  3KXB C;  1P3K C;  5B1L B;  1P34 C;  5CPJ A;  4Z5T C;  4JJN D;  4H9R B;  1P3M A;  5B33 B;  3UTB D;  1M18 C;  5B33 D;  3NQU A;  4H9O B;  3WTP C;  3KUY D;  4KHA A;  3X1T C;  3MGR C;  3A6N D;  1P3F D;  3REK A;  5GT3 A;  3W99 B;  4XZQ A;  3R45 A;  1P3L A;  3UTA B;  1P3B A;  1EQZ C;  4Z2M H;  5AV6 B;  2Y2H A;  5GT0 A;  3AV1 A;  1F1E A;  1ID3 A;  5AV6 D;  1KX5 B;  2NZD D;  3EPL A;  5B24 C;  3AZJ B;  3NQJ A;  1AOI C;  2YFW A;  4QLC A;  4KGC C;  1P3A C;  5DNN A;  3AZH B;  4R8P B;  2YFV B;  5KDM B;  5B2J B;  2BYM B;  5FUG B;  5AY8 A;  3AZE C;  4H9S C;  4YM6 A;  1KX4 C;  4CAY A;  3AFA C;  1KX3 A;  1KU5 A;  3V9R B;  3FDD A;  3AYW A;  4WU8 B;  4NE3 A;  4DRA A;  4WU8 D;  4J8V B;  2F8N B;  5B0Y A;  5BS7 A;  4JJN C;  5B31 B;  4X23 D;  1M1A A;  4WJ3 C;  4Z66 A;  3UTB C;  2ARO A;  5B31 D;  3VH6 W;  3H0R C;  3H0L C;  3KUY C;  5B32 D;  3LZ1 B;  3H0M C;  4WU9 C;  3AV2 B;  3A6N C;  5G49 B;  4J8U B;  1P3F C;  5B0Z B;  3AV2 D;  5GSU A;  5B0Z D;  3AN2 A;  3MNN A;  4Z2M G;  3X1U A;  3C1B D;  3LZ0 B;  2G5I C;  3KXB B;  5AV6 C;  1P3K B;  1P34 B;  2NZD C;  1BH8 B;  4Z5T B;  3KWQ A;  1M18 B;  5CPJ D;  1P3M D;  2VQR A;  4XUJ A;  4DRB A;  2BYK A;  1H3O B;  2UWX A;  5BNV A;  3MGS C;  2Y2N A;  3KSY A;  3REI A;  3VH5 T;  4ZBJ C;  3MVD B;  3MGR B;  4CSR B;  1W2E A;  3AZG A;  3MVD D;  3MGR D;  5E5A A;  3REK D;  5GT3 D;  1EQZ B;  2Y2J A;  1P3B D;  1EQZ D;  3AZF C;  2IO5 C;  3W98 A;  2CWE A;  3WA9 A;  4WU8 C;  5B24 B;  5DNM B;  1ID3 D;  3B6G B;  5DNM D;  3REH A;  2HUE C;  4X23 C;  3B6G D;  1P3A B;  1BFM A;  2XD1 A;  4QLC D;  3REJ A;  1P3I A;  1P3A D;  5B32 C;  2DF4 C;  5JRG B;  3AZE B;  5B40 A;  3W96 A;  4HGA B;  3AFA B;  1TZY A;  5JRG D;  3AZE D;  5AY8 D;  1U35 A;  4M6B A;  3AFA D;  5B0Z C;  3AZK B;  5BO0 B;  3MGP B;  2CV5 C;  1KX3 D;  3AZI A;  2Y2O A;  1N1J B;  4LD9 C;  3AZK D;  3MGP D;  5BNX A;  3C1B C;  3AZL A;  1HQ3 C;  3LJA B;  4G92 B;  2PYO A;  3EPH A;  3LJA D;  4UUZ A;  5B0Y D;  3UTB B;  5CPJ C;  4H9N A;  1P3M C;  1JFI A;  5AVB B;  4Z66 D;  3KUY B;  5AVB D;  4WU9 B;  3A6N B;  1P3F B;  3AZM B;  3A1I A;  3W97 A;  5AV8 B;  4WU9 D;  3MVD C;  2ZY2 A;  5CPI A;  4AWL B;  5GT3 C;  3REK C;  3AZM D;  5AV8 D;  4YS3 B;  3X1V A;  1P3L C;  4YS3 D;  1P3B C;  5AVC A;  3C1C A;  3AN2 D;  5B1M A;  3MNN D;  2NZD B;  1WWS A;  3AV1 C;  3EPJ A;  3MGQ A;  3AZN A;  1ID3 C;  1P3O B;  5JA4 B;  3EPK A;  3TU4 B;  5DNM C;  1S32 A;  1TAF B;  3VH5 W;  1P3O D;  3TU4 D;  3KWQ D;  3MGS B;  3WTP A;  3B6G C;  3X1T A;  5CP6 A;  4ZBJ B;  3MGS D;  5C3I B;  2NQB A;  4QLC C;  2F8N H;  1Q9C A;  5GXQ B;  3VH6 A;  2Y2G A;  4H9P A;  5GXQ D;  5E5A D;  5JRG C;  5AY8 C;  5CPK A;  4YM6 C;  4HGA C;  1ULY A;  1KX3 C;  3AZF B;  2IO5 B;  1BH9 B;  3MGP C;  3AZK C;  5AV5 B;  3AZF D;  3AYW C;  2FJ7 A;  3W98 D;  3B6F A;  5AV5 D;  3B0C T;  3LJA C;  1AOI A;  4G92 C;  2HUE B;  4X23 B;  1P3P A;  5B0Y C;  3REL A;  1ZLA B;  4KGC A;  3LEL A;  5BS7 C;  4KUD A;  1M1A C;  2HIO B;  4Z66 C;  1F66 A;  1ZLA D;  2Y2Q A;  3X1S B;  5AVB C;  5B32 B;  1WWI A;  2HIO D;  4E44 A;  1KX4 A;  4H9Q A;  5F99 A;  4H9S A;  1P3G B;  3REJ D;  3X1S D;  1P3I D;  4J8X A;  3UT9 A;  1P3G D;  4J8W A;  3B0B A;  5B40 D;  3W96 D;  4WNN B;  5B2I A;  2JE5 A;  1TZY D;  4ZUX B;  5AV8 C;  3AZM C;  2CV5 B;  3WAA A;  1U35 D;  4ZUX D;  4AWL C;  2CV5 D;  4LD9 B;  1M19 A;  4YS3 C;  3O62 A;  3C1B B;  5AV9 B;  3AL0 C;  1HQ3 B;  4LD9 D;  2DQN C;  1R4V A;  3AN2 C;  3WKJ A;  3MNN C;  5AV9 D;  3X1U C;  1HQ3 D;  3AZL D;  4JJN A;  3B0D C;  5B1L A;  5CPJ B;  4H9R A;  1P3M B;  5B33 A;  1P3O C;  3TU4 C;  3KWQ C;  3NQU B;  4H9O A;  2G5H C;  4NE5 A;  4KHA B;  3REI C;  2F8N G;  4NE6 A;  5C3I C;  1PZR A;  2ZY4 A;  2JSS A;  4EO5 C;  5CHL B;  3W99 A;  5B31 G;  5GT3 B;  3REK B;  3AZG C;  2RVQ D;  3W97 D;  4XZQ B;  5E5A C;  5GXQ C;  3R45 B;  1P3L B;  3UTA A;  1Z2C B;  5CPI D;  4XZQ D;  1P3B B;  3IP4 C;  1P3L D;  5AV6 A;  5AVC D;  3AV1 B;  3C1C D;  3W98 C;  1ID3 B;  1KX5 A;  5B1M D;  5AV5 C;  5GT0 D;  3WA9 C;  3AV1 D;  4WZS B;  3AZN D;  3MGQ D;  3AZJ A;  3NQJ B;  1S32 D;  2YFW B;  1ZLA C;  1T3U A;  4QLC B;  3AZH A;  2J8P A;  5DNN B;  2HIO C;  4E45 A;  4R8P A;  2NQB D;  3REJ C;  3X1S C;  2YFV A;  5DNN D;  1P3I C;  5KDM A;  5B2J A;  2BYM A;  5FUG A;  1P3G C;  5AY8 B;  2Y2P A;  4YM6 B;  5B40 C;  3W96 C;  4CAY B;  1TZY C;  1KX3 B;  4YM6 D;  1U35 C;  4ZUX C;  3V9R A;  1B67 A;  4WU8 A;  3AYW B;  3AYW D;  5AV9 C;  3AZL C;  4J8V A;  2FJ7 D;  2F8N A;  2ZM5 A;  3B6F D;  5B0Y B;  2PYO C;  2ZY3 A;  5B31 A;  1P3P D;  1M1A B;  4Z66 B;  3REL D;  2ARO B;  3LEL D;  1M1A D;  2LY8 A;  1F66 D;  2ARO D;  3VH5 A;  3LZ1 A;  3VH6 T;  5F99 D;  3AV2 A;  4J8U A;  5G49 A;  4J8X D;  5B0Z A;  2RVQ C;  3UT9 D;  3W97 C;  4J8W D;  5CPI C;  5GSU B;  5B2I D;  4XZQ C;  3WAA D;  5GSU D;  3AN2 B;  2Y2L A;  3MNN B;  3O62 D;  3X1U B;  5AVC C;  3LZ0 A;  2F2A C;  3C1C C;  3B0D B;  3KXB A;  3WKJ D;  5B1M C;  3X1U D;  5GT0 C;  1P34 A;  1P3K A;  1BH8 A;  4Z5T A;  3AZN C;  3MGQ C;  5B1L D;  1M18 A;  3KWQ B;  2Y2K A;  4XUJ B;  1S32 C;  2BYK B;  1H3O A;  5BNV B;  4XUJ D;  3REI B;  3MVD A;  5CP6 C;  3MGR A;  4CSR A;  2NQB C;  4EO5 B;  3REI D;  5DNN C;  3AZG B;  5E5A B;  3AZG D;  3W99 D;  2XD5 A;  1EQZ A;  5CPK C;  3UTA D;  3W98 B;  2F8N K;  3WA9 B;  5B24 A;  5DNM A;  2FJ7 C;  1KX5 D;  3B6F C;  3WA9 D;  3B6G A;  3AZJ D;  3REH B;  1P3P C;  3REL C;  1P3A A;  3LEL C;  3REH D;  4KUD C;  1F66 C;  2ARO C;  3REJ B;  1P3I B;  3AZH D;  5JRG A;  4R8P D;  5F99 C;  3AZE A;  5B40 B;  3W96 B;  4J8X C;  3AFA A;  5B2J D;  3KFU G;  1TZY B;  3UT9 C;  4J8W C;  1U35 B;  3AZK A;  5BO0 A;  5B2I C;  3MGP A;  3EG5 B;  3WAA C;  3AZI B;  1N1J A;  5GSU C;  1M19 C;  5BNX B;  3O62 C;  3AZI D;  3LJA A;  3AZL B;  4G91 B;  3WKJ C;  2L5A A;  2PYO B;  4NFT A;  4UUZ B;  2RIQ A;  4J8V D;  2F8N D;  1B6W A;  2PYO D;  5B1L C;  3UTB A;  4H9N B;  1JFI B;  5B33 C;  1A7W A;  5AVB A;  3KUY A;  5BT1 D;  4XUJ C;  4WU9 A;  3A6N A;  1P3F A;  2W8S A;  3LZ1 D;  3AZM A;  5AV8 A;  1HTA A;  3W97 B;  4J8U D;  3W99 C;  5CPI B;  4YS3 A;  3X1V B;  2JCH A;  3UTA C;  3F6T A;  5B32 G;  5AVC B;  3X1V D;  3C1C B;  3P5J B;  5B1M B;  5GT0 B;  2NZD A;  3LZ0 D;  2Y2I A;  3KXB D;  3MGQ B;  3AZN B;  5JA4 A;  1P3O A;  1P3K D;  1KX5 C;  3TU4 A;  1P34 D;  4Z5T D;  1TAF A;  1S32 B;  3AZJ C;  2BG1 A;  3MGS A;  1M18 D;  3WTP B;  3REH C;  3X1T B;  5CP6 B;  3WTP D;  2NQB B;  3AZH C;  3X1T D;  2ZY5 A;  5CP6 D;  5GXQ A;  4R8P C;  4H9P B;  5B2J C;  3A1K A;  5CPK B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...