1F1EA

Crystal structure of the histone from methanopyrus kandleri
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
151
structure length
151
Chain Sequence
b'ELPKAAIERIFRQGIGERRLSQDAKDTIYDFVPTMAEYVANAAKSVLDASGKKTLMEEHLKALADVLMVEGVEDYDGELFGRATVRRILKRAGIERASSDAVDLYNKLICRATEELGEKAAEYADEDGRKTVQGEDVEKAITYSMPKGGEL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HISTONE FOLD PROTEIN
publication title An ancestral nuclear protein assembly: crystal structure of the Methanopyrus kandleri histone.
pubmed doi rcsb
source organism Methanopyrus kandleri
molecule tags Dna binding protein
total genus 58
structure length 151
sequence length 151
ec nomenclature
pdb deposition date 2000-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00808 CBFD_NFYB_HMF Histone-like transcription factor (CBF/NF-Y) and archaeal histone
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1f1eA00
5JRGC 3AV1D 1M1AD 3MGQC 5DNMC 5B0YA 1P3KB 5GSUC 3VH6A 3AZGA 5KDMA 3AV1B 1M1AB 3RELA 2FJ7C 1U35A 5GXQD 2IO5C 4HGAB 3B6GA 5DNNC 5CPIA 5AV9C 5GXQB 3WTPC 1AOIA 1P3PA 3MGSD 2CV5A 5CP6C 2NZDA 4KGCA 3WAAC 3AZFA 3MGSB 4H9SC 5B24A 4JJND 5AVBD 3AV1A 4YS3D 3W97C 1Q9CA 5BT1D 3RELC 4E45A 5AV5A 5AVBB 4JJNB 5B1LC 3B0CW 1ZLAC 4YS3B 5AVCD 3LZ1D 3REHD 4CSRB 3MGRA 3AFAC 3C1CC 5AVCB 3LZ1B 3REHB 3WA9D 5AV6A 2BYKB 4CAYB 1F1EA 5BS7A 4J8WD 1EQZA 4H9QB 1F66D 1JFIB 1KX4A 3C1BD 3WA9B 5B2JD 1P3AD 4Z5TA 3AZID 4J8WB 4KGCC 3AZKA 1F66B 5E5AD 3C1BB 3AV1C 1M1AC 5B2JB 1P3AB 3AZIB 3WTPE 1BFMA 2PYOD 5E5AB 3MNNA 4J8VA 4Z2MG 5B0ZA 1P3OA 4HGAC 5G49A 3AZHA 2PYOB 1P34A 5GXQC 5B1MA 5CPJD 4CAYA 5GT3A 1TAFB 3KSYA 5BS7C 1JFIA 3AZED 4H9NA 3X1TA 5CPJB 4Z66D 5B31G 3NQJA 5F99A 4XUJD 3AZEB 3W99D 4YM6A 3X1SA 4Z66B 3KWQA 3AYWD 5AY8D 4JJNC 4XUJB 3W99B 4YS3C 4UUZB 2AROA 1P3MA 4X23A 2F8NA 3AYWB 3KXBD 5BT1C 5AY8B 4G92B 5AVCC 3LZ1C 3REHC 3REID 3KXBB 1P3IA 3REIB 3KUYA 5B31D 4J8WC 3UT9A 4EO5B 2JSSA 1F66C 3REJA 3C1BC 5B2JC 1P3AC 2YFWB 5B31B 3X1UA 3KWQC 5E5AC 5JRGA 3X1VA 3MGQA 5B40A 3W96D 4LD9D 5DNMA 5GSUA 1H3OB 4R8PD 2PYOC 3VH5W 1P3GD 5BNXA 3W96B 4LD9B 2FJ7A 3B0BA 3UTBA 4R8PB 1P3GB 3VH6W 3AZLD 3REIA 1P3IC 3W98A 3MVDD 1M18D 5CPJC 3B0CT 4AWLB 3KUYC 3AZJD 5AV9A 1TZYD 4H9OB 5B2IA 3AZLB 3MVDB 1M18B 4Z66C 4KUDD 4WNNA 4H9RA 3AZJB 1TZYB 3W99C 3B0DB 5CP6A 3LJAD 5JA4B 3X1VC 3A6ND 3AYWC 4KUDB 5B40C 3WAAA 4H9SA 5B32G 3LJAB 4G92C 3W97A 3A6NB 1B6WA 4R8PA 3UTBC 1ZLAA 5B1LA 2NQBD 4NE3A 3REIC 3W98C 3AN2D 4EO5C 2NQBB 3AFAA 3MVDA 3C1CA 4J8UD 5B2IC 5B31C 3AN2B 4J8UB 1P3BD 1P3KA 5B32D 4J8XD 1M1AA 3W96C 3LELD 3MGPD 1P3BB 1M19D 4R8PC 3AV2D 5B32B 4J8XB 3LELB 2F8NK 3MGPB 4AWLC 1M19B 3AV2B 3AZLC 5GXQA 1P3LD 3MVDC 1M18C 1S32D 4G91B 3AZJC 1HQ3D 1TZYC 1P3LB 3B0DC 4KUDC 1S32B 2BYMB 3MGSA 1HQ3B 1P3KC 3LJAC 2YFVB 4WU8D 3WKJD 3A6NC 1ID3D 3AZND 2HUEB 4JJNA 5AVBA 4YS3A 4WU8B 3WKJB 1ID3B 4CSRA 3REKD 3AZNB 4KHAB 4WU9D 1WWSA 2NQBC 5AVCA 3LZ1A 3REHA 2BYKA 3VH5T 3REKB 3AN2C 4WU9B 4H9QA 3LZ0D 4J8UC 3WA9A 2CWEA 4J8WA 3VH6T 4ZBJB 1P3FD 3O62D 1F66A 3MGSC 3LZ0B 3C1BA 1BH9B 3TU4D 5B2JA 1P3AA 3AZIA 1P3BC 1P3FB 3O62B 5E5AA 5B32C 3TU4B 5AVBC 3AZMD 4J8XC 1ID3A 3WKJA 4ZUXD 3LELC 5FUGB 3MGPC 1N1JB 1KX5D 1M19C 5C3IB 2PYOA 3AV2C 3AZMB 4ZUXB 1KX5B 1TAFA 4G91C 1P3LC 1BH8B 5CPJA 3UTAD 3WA9C 1S32C 1HQ3C 5CHLB 3AZEA 4QLCD 3NQUB 5BO0B 4H9PB 3UTAB 4Z66A 3AZIC 5BNVB 2HUEC 4XUJA 3W99A 4QLCB 4UUZA 4NE5A 4WU8C 1KU5A 3AYWA 3WKJC 1ID3C 5AY8A 3AZNC 3AZMA 3B6FD 3KXBA 3R45B 3REKC 3B6FB 4XZQD 2LY8A 3WTPD 5B33D 4ZBJC 4DRAA 5AV8D 4XZQB 3LZ0C 3WTPB 4M6BA 5GT0D 3AZEC 2YFWA 5B31A 5B33B 1P3FC 3O62C 5AV8B 5B0YD 1R4VA 3TU4C 4XUJC 5GT0B 3AZGD 1H3OA 3RELD 5AY8C 5C3IC 5B0YB 1U35D 3AZMC 4NE6A 3W96A 4ZUXC 3AZGB 4LD9A 5KDMB 1KX5C 3KXBC 3RELB 1U35B 1P3GA 3B6GD 5CPID 1AOID 1P3PD 3B6GB 4H9OA 3AZLA 5CPIB 1M18A 3UTAC 2CV5D 1WWIA 1AOIB 2NZDD 4WZSB 3AZJA 1P3PB 4KGCD 1TZYA 3AZFD 4QLCC 5B24D 5JA4A 4KUDA 2CV5B 2NZDB 1HTAA 4KGCB 3LJAA 3AZFB 5B24B 2F8NH 5AV5D 3A6NA 4LD9C 3B6FC 5AV5B 3MGRD 1P3GC 5AV6D 2HIOD 4XZQC 2NQBA 3MGRB 1EQZD 1KX4D 5B33C 3AN2A 5AV8C 2HIOB 4Z5TD 5AV6B 4J8UA 3AZKD 1EQZB 5GT0C 1KX4B 4Z5TB 5B0YC 3AZKB 3MNND 4J8VD 1B67A 3AZGC 3V9RB 1P3BA 5CPKD 2F8NG 4Z2MH 5B0ZD 1P3OD 1U35C 5B32A 3AZHD 4J8XA 3LELA 3MNNB 4J8VB 1P34D 3MGPA 5B1MD 5CPKB 5B0ZB 1P3OB 1M19A 5G49B 3AV2A 3B6GC 5GT3D 5CPIC 3AZHB 1P34B 4DRBA 5B1MB 2HIOA 3X1TD 1AOIC 1P3PC 5GT3B 1P3LA 4E44A 5F99D 2CV5C 4H9NB 3X1TB 2NZDC 4WV4B 4YM6D 2BYMA 3X1SD 1S32A 1A7WA 1HQ3A 3KWQD 3AZFC 5B24C 2YFVA 3NQJB 3V9RA 5F99B 4YM6B 2AROD 1P3MD 3X1SB 4X23D 2F8ND 3KWQB 5AV5C 4WU8A 5CPKA 2AROB 1P3MB 4X23B 3AZNA 2F8NB 4KHAA 3MGRC 1P3ID 3REKA 5AV6C 2HIOC 4WU9A 3KUYD 3UT9D 1ULYA 1P3IB 1EQZC 3REJD 1KX4C 4Z5TC 3KUYB 3X1UD 3UT9B 3LZ0A 3AZKC 1BH9A 2RVQD 3REJB 1KX3D 5JRGD 3X1VD 1P3FA 3O62A 3MGQD 5B40D 5DNMD 3X1UB 5GSUD 3TU4A 3MNNC 4J8VC 1KX3B 5FUGA 5JRGB 3X1VB 1N1JA 3MGQB 5B40B 5CPKC 5B0ZC 1P3OC 5DNMB 2FJ7D 3UTBD 5GSUB 3AZHC 4ZUXA 4NFTA 1P34C 5B1MC 5BNXB 1KX5A 3W98D 2FJ7B 3UTBB 5DNND 5GT3C 4WU9C 1BH8A 5AV9D 5B2ID 3W98B 2IO5B 3X1TC 5DNNB 3NQUA 5BO0A 4H9PA 5AV9B 5B2IB 5F99C 2L5AA 5CP6D 3UTAA 4YM6C 3X1SC 5BNVA 4WNNB 3WAAD 4QLCA 4H9RB 1KX3A 5CP6B 2AROC 1P3MC 4X23C 3W97D 3WAAB 1ZLAD 5B1LD 3R45A 3W97B 3B6FA 1ZLAB 5B1LB 3AFAD 3C1CD 5DNNA 4XZQA 3UT9C 3WTPA 3AFAB 3C1CB 3REJC 5B33A 5AV8A 3X1UC 1P3KD 2RVQC 5GT0A 3VH5A 1KX3C
chains in the Genus database with same CATH superfamily
5JRGC 3AV1D 1M1AD 3MGQC 2JE5A 5DNMC 5B0YA 1P3KB 5GSUC 2Y2IA 3VH6A 3AZGA 5KDMA 3AV1B 1M1AB 3RELA 2FJ7C 1U35A 5GXQD 2IO5C 4HGAB 3B6GA 5DNNC 5CPIA 3KFUG 5AV9C 5GXQB 3WTPC 1AOIA 1P3PA 3MGSD 2CV5A 5CP6C 2NZDA 4KGCA 3WAAC 3AZFA 3MGSB 4H9SC 5B24A 4JJND 5AVBD 3AV1A 4YS3D 3W97C 1Q9CA 5BT1D 3RELC 4E45A 5AV5A 5AVBB 4JJNB 5B1LC 3B0CW 1ZLAC 4YS3B 5AVCD 3LZ1D 3REHD 4CSRB 3MGRA 3AFAC 3C1CC 3P5JB 5AVCB 3AL0C 3LZ1B 3REHB 3WA9D 5AV6A 2BYKB 4CAYB 1F1EA 5BS7A 4J8WD 1EQZA 4H9QB 1F66D 1JFIB 1KX4A 3C1BD 3WA9B 5B2JD 1P3AD 4Z5TA 2Y2LA 4J8WB 3AZID 4KGCC 2Y2HA 3AZKA 1F66B 5E5AD 3C1BB 3AV1C 1M1AC 5B2JB 1P3AB 3AZIB 2Y2MA 3WTPE 1BFMA 2PYOD 2Y2QA 5E5AB 3MNNA 4Z2MG 4J8VA 5B0ZA 1P3OA 4HGAC 5G49A 3AZHA 2PYOB 2VQRA 1P34A 5GXQC 5B1MA 5CPJD 4CAYA 5GT3A 1TAFB 3KSYA 5BS7C 1JFIA 3AZED 4H9NA 3X1TA 5CPJB 4Z66D 5B31G 3NQJA 5F99A 4XUJD 3AZEB 3W99D 4YM6A 3X1SA 4Z66B 3KWQA 3AYWD 5AY8D 4JJNC 4XUJB 3W99B 4YS3C 4UUZB 2AROA 1P3MA 4X23A 2F8NA 3AYWB 3KXBD 5BT1C 5AY8B 4G92B 5AVCC 3LZ1C 3REHC 3REID 3KXBB 1P3IA 2RIQA 3REIB 3KUYA 5B31D 4J8WC 3UT9A 4EO5B 2JSSA 1F66C 3REJA 3C1BC 5B2JC 1P3AC 2YFWB 5B31B 3X1UA 3KWQC 5E5AC 5JRGA 3EPKA 3FDDA 2Y2JA 3MGQA 5B40A 3X1VA 3W96D 4LD9D 5DNMA 2FFFB 1H3OB 5GSUA 4R8PD 2PYOC 3VH5W 1P3GD 2BG1A 5BNXA 3W96B 4LD9B 2FJ7A 3B0BA 3UTBA 4R8PB 1P3GB 3VH6W 3AZLD 3REIA 1P3IC 3W98A 3MVDD 1M18D 5CPJC 3B0CT 4AWLB 3KUYC 3AZJD 5AV9A 1TZYD 4H9OB 5B2IA 3AZLB 3MVDB 1M18B 2Y2GA 4Z66C 4KUDD 2XD5A 4WNNA 4H9RA 3AZJB 1TZYB 3W99C 5CP6A 3B0DB 3LJAD 5JA4B 3X1VC 3A6ND 3AYWC 4KUDB 5B40C 3WAAA 4H9SA 5B32G 3LJAB 4G92C 2XD1A 3W97A 3A6NB 1B6WA 2ZY4A 4R8PA 3UTBC 1ZLAA 5B1LA 2NQBD 4NE3A 3REIC 3H0RC 3W98C 3AN2D 4EO5C 2NQBB 3AFAA 1W2EA 3MVDA 3C1CA 4J8UD 5B2IC 5B31C 3AN2B 4J8UB 1P3BD 1P3KA 5B32D 4J8XD 1M1AA 4WJ3C 3W96C 3LELD 3MGPD 1P3BB 1M19D 4R8PC 3AV2D 5B32B 4J8XB 3LELB 2F8NK 2ZM5A 3MGPB 4AWLC 2ZY5A 1M19B 3AV2B 3AZLC 5GXQA 1P3LD 3MVDC 1M18C 3H0MC 1S32D 4G91B 3AZJC 1HQ3D 4UPKA 1TZYC 1P3LB 3B0DC 4KUDC 1S32B 2BYMB 3MGSA 1HQ3B 1P3KC 3LJAC 2YFVB 4WU8D 3WKJD 3A6NC 1ID3D 2G5HC 3AZND 2HUEB 4JJNA 5AVBA 3A1IA 4YS3A 2W8SA 4WU8B 3WKJB 1ID3B 4CSRA 3REKD 3AZNB 4KHAB 4WU9D 1WWSA 2NQBC 5AVCA 3LZ1A 3REHA 2J8PA 3EPLA 2BYKA 3VH5T 3REKB 3AN2C 4WU9B 2G5IC 4H9QA 3LZ0D 4J8UC 3F6TA 3WA9A 2CWEA 4J8WA 3VH6T 4ZBJB 1P3FD 3O62D 1F66A 3MGSC 3LZ0B 3C1BA 1BH9B 3TU4D 5B2JA 1P3AA 3AZIA 3EPHA 1P3BC 1P3FB 3O62B 5E5AA 5B32C 3TU4B 5AVBC 3AZMD 4J8XC 1ID3A 3WKJA 4ZUXD 3LELC 2JCHA 5FUGB 3MGPC 1N1JB 4DQYB 1KX5D 1M19C 5C3IB 2PYOA 3AV2C 3AZMB 4ZUXB 1KX5B 1TAFA 4G91C 1P3LC 1BH8B 5CPJA 3UTAD 3WA9C 1S32C 1HQ3C 3IP4C 5CHLB 3AZEA 4QLCD 3NQUB 5BO0B 4H9PB 3UTAB 4Z66A 2DQNC 3AZIC 1T3UA 5BNVB 2HUEC 4XUJA 3W99A 4QLCB 4UUZA 4NE5A 4WU8C 1KU5A 3AYWA 3WKJC 1ID3C 5AY8A 3AZNC 3AZMA 3B6FD 2Y2KA 3KXBA 3R45B 3REKC 3B6FB 4XZQD 2LY8A 3WTPD 5B33D 4ZBJC 2F2AC 4DRAA 5AV8D 4XZQB 3LZ0C 3WTPB 4M6BA 5GT0D 3AZEC 2YFWA 5B31A 5B33B 1P3FC 3O62C 5AV8B 5B0YD 1R4VA 3TU4C 4XUJC 5GT0B 3AZGD 1H3OA 3RELD 5AY8C 5C3IC 5B0YB 1U35D 3AZMC 4NE6A 3W96A 4ZUXC 3AZGB 4LD9A 5KDMB 1KX5C 3KXBC 3RELB 1U35B 1P3GA 3B6GD 5CPID 2ZY2A 1AOID 1P3PD 3B6GB 4H9OA 3AZLA 5CPIB 1M18A 3UTAC 2Y2OA 2CV5D 1WWIA 1AOIB 2NZDD 4WZSB 3AZJA 1P3PB 4KGCD 2ZY3A 1TZYA 2Y2NA 3AZFD 4QLCC 5B24D 5JA4A 4KUDA 2CV5B 2NZDB 1HTAA 4KGCB 3LJAA 3AZFB 5B24B 2F8NH 5AV5D 3A6NA 4LD9C 3B6FC 5AV5B 3MGRD 1P3GC 5AV6D 2HIOD 4XZQC 2NQBA 3MGRB 1EQZD 1KX4D 5B33C 3AN2A 5AV8C 2HIOB 4Z5TD 5AV6B 4J8UA 3AZKD 1EQZB 5GT0C 1KX4B 2DF4C 4Z5TB 5B0YC 3AZKB 3MNND 4J8VD 1B67A 3AZGC 3V9RB 1P3BA 5CPKD 2F8NG 4Z2MH 5B0ZD 3EPJA 1P3OD 1U35C 5B32A 3AZHD 4J8XA 3LELA 3MNNB 4J8VB 1P34D 3MGPA 5B1MD 5CPKB 5B0ZB 1P3OB 1M19A 5G49B 3AV2A 3B6GC 5GT3D 5CPIC 3AZHB 1P34B 2UWXA 4DRBA 3A1KA 5B1MB 2HIOA 3X1TD 1AOIC 3H0LC 1P3PC 5GT3B 1P3LA 4E44A 5F99D 2CV5C 4H9NB 3X1TB 2NZDC 4WV4B 4YM6D 2BYMA 3X1SD 1S32A 1A7WA 1HQ3A 3KWQD 3AZFC 5B24C 2YFVA 3NQJB 3V9RA 5F99B 4YM6B 2AROD 1P3MD 3X1SB 4X23D 2F8ND 3KWQB 5AV5C 4WU8A 5CPKA 2AROB 1P3MB 4X23B 3AZNA 2F8NB 4KHAA 2Y2PA 3MGRC 1P3ID 3REKA 5AV6C 2HIOC 4WU9A 3KUYD 3UT9D 1ULYA 1P3IB 1EQZC 3REJD 1KX4C 4Z5TC 3KUYB 3X1UD 3UT9B 3LZ0A 3AZKC 1BH9A 2RVQD 3EG5B 3REJB 1KX3D 5JRGD 3X1VD 1P3FA 3O62A 3MGQD 5B40D 5DNMD 3X1UB 5GSUD 3TU4A 3MNNC 4J8VC 1KX3B 5FUGA 5JRGB 3X1VB 1N1JA 3MGQB 5B40B 5CPKC 5B0ZC 1P3OC 5DNMB 2FJ7D 3UTBD 5GSUB 3AZHC 4ZUXA 4NFTA 1P34C 5B1MC 5BNXB 1KX5A 3W98D 2FJ7B 3UTBB 5DNND 5GT3C 4WU9C 1BH8A 5AV9D 5B2ID 3W98B 2IO5B 3X1TC 5DNNB 3NQUA 5BO0A 4H9PA 5AV9B 5B2IB 5F99C 2L5AA 5CP6D 3UTAA 4YM6C 3X1SC 1PZRA 5BNVA 4WNNB 3WAAD 4QLCA 4H9RB 1KX3A 5CP6B 2AROC 1P3MC 4X23C 3W97D 3WAAB 1ZLAD 5B1LD 3R45A 3W97B 3B6FA 1ZLAB 5B1LB 3AFAD 3C1CD 1Z2CB 5DNNA 4XZQA 3UT9C 3WTPA 3AFAB 3C1CB 3REJC 5B33A 5AV8A 3X1UC 1P3KD 2RVQC 5GT0A 3VH5A 1KX3C
chains in the Genus database with same CATH topology
5JRGC 3AV1D 1M1AD 3MGQC 2JE5A 5DNMC 5B0YA 1P3KB 5GSUC 2Y2IA 3VH6A 3AZGA 5KDMA 3AV1B 1M1AB 3RELA 2FJ7C 1U35A 5GXQD 2IO5C 4HGAB 3B6GA 5DNNC 5CPIA 3KFUG 5AV9C 5GXQB 3WTPC 1AOIA 1P3PA 3MGSD 2CV5A 5CP6C 2NZDA 4KGCA 3WAAC 3AZFA 3MGSB 4H9SC 5B24A 4JJND 5AVBD 3AV1A 4YS3D 3W97C 1Q9CA 5BT1D 3RELC 4E45A 5AV5A 5AVBB 4JJNB 5B1LC 3B0CW 1ZLAC 4YS3B 5AVCD 3LZ1D 3REHD 4CSRB 3MGRA 3AFAC 3C1CC 3P5JB 5AVCB 3AL0C 3LZ1B 3REHB 3WA9D 5AV6A 2BYKB 4CAYB 1F1EA 5BS7A 4J8WD 1EQZA 4H9QB 1F66D 1JFIB 1KX4A 3C1BD 3WA9B 5B2JD 1P3AD 4Z5TA 2Y2LA 4J8WB 3AZID 4KGCC 2Y2HA 3AZKA 1F66B 5E5AD 3C1BB 3AV1C 1M1AC 5B2JB 1P3AB 3AZIB 2Y2MA 3WTPE 1BFMA 2PYOD 2Y2QA 5E5AB 3MNNA 4Z2MG 4J8VA 5B0ZA 1P3OA 4HGAC 5G49A 3AZHA 2PYOB 2VQRA 1P34A 5GXQC 5B1MA 5CPJD 4CAYA 5GT3A 1TAFB 3KSYA 5BS7C 1JFIA 3AZED 4H9NA 3X1TA 5CPJB 4Z66D 5B31G 3NQJA 5F99A 4XUJD 3AZEB 3W99D 4YM6A 3X1SA 4Z66B 3KWQA 3AYWD 5AY8D 4JJNC 4XUJB 3W99B 4YS3C 4UUZB 2AROA 1P3MA 4X23A 2F8NA 3AYWB 3KXBD 5BT1C 5AY8B 4G92B 5AVCC 3LZ1C 3REHC 3REID 3KXBB 1P3IA 2RIQA 3REIB 3KUYA 5B31D 4J8WC 3UT9A 4EO5B 2JSSA 1F66C 3REJA 3C1BC 5B2JC 1P3AC 2YFWB 5B31B 3X1UA 3KWQC 5E5AC 5JRGA 3EPKA 3FDDA 2Y2JA 3MGQA 5B40A 3X1VA 3W96D 4LD9D 5DNMA 2FFFB 1H3OB 5GSUA 4R8PD 2PYOC 3VH5W 1P3GD 2BG1A 5BNXA 3W96B 4LD9B 2FJ7A 3B0BA 3UTBA 4R8PB 1P3GB 3VH6W 3AZLD 3REIA 1P3IC 3W98A 3MVDD 1M18D 5CPJC 3B0CT 4AWLB 3KUYC 3AZJD 5AV9A 1TZYD 4H9OB 5B2IA 3AZLB 3MVDB 1M18B 2Y2GA 4Z66C 4KUDD 2XD5A 4WNNA 4H9RA 3AZJB 1TZYB 3W99C 5CP6A 3B0DB 3LJAD 5JA4B 3X1VC 3A6ND 3AYWC 4KUDB 5B40C 3WAAA 4H9SA 5B32G 3LJAB 4G92C 2XD1A 3W97A 3A6NB 1B6WA 2ZY4A 4R8PA 3UTBC 1ZLAA 5B1LA 2NQBD 4NE3A 3REIC 3H0RC 3W98C 3AN2D 4EO5C 2NQBB 3AFAA 1W2EA 3MVDA 3C1CA 4J8UD 5B2IC 5B31C 3AN2B 4J8UB 1P3BD 1P3KA 5B32D 4J8XD 1M1AA 4WJ3C 3W96C 3LELD 3MGPD 1P3BB 1M19D 4R8PC 3AV2D 5B32B 4J8XB 3LELB 2F8NK 2ZM5A 3MGPB 4AWLC 2ZY5A 1M19B 3AV2B 3AZLC 5GXQA 1P3LD 3MVDC 1M18C 3H0MC 1S32D 4G91B 3AZJC 1HQ3D 4UPKA 1TZYC 1P3LB 3B0DC 4KUDC 1S32B 2BYMB 3MGSA 1HQ3B 1P3KC 3LJAC 2YFVB 4WU8D 3WKJD 3A6NC 1ID3D 2G5HC 3AZND 2HUEB 4JJNA 5AVBA 3A1IA 4YS3A 2W8SA 4WU8B 3WKJB 1ID3B 4CSRA 3REKD 3AZNB 4KHAB 4WU9D 1WWSA 2NQBC 5AVCA 3LZ1A 3REHA 2J8PA 3EPLA 2BYKA 3VH5T 3REKB 3AN2C 4WU9B 2G5IC 4H9QA 3LZ0D 4J8UC 3F6TA 3WA9A 2CWEA 4J8WA 3VH6T 4ZBJB 1P3FD 3O62D 1F66A 3MGSC 3LZ0B 3C1BA 1BH9B 3TU4D 5B2JA 1P3AA 3AZIA 3EPHA 1P3BC 1P3FB 3O62B 5E5AA 5B32C 3TU4B 5AVBC 3AZMD 4J8XC 1ID3A 3WKJA 4ZUXD 3LELC 2JCHA 5FUGB 3MGPC 1N1JB 4DQYB 1KX5D 1M19C 5C3IB 2PYOA 3AV2C 3AZMB 4ZUXB 1KX5B 1TAFA 4G91C 1P3LC 1BH8B 5CPJA 3UTAD 3WA9C 1S32C 1HQ3C 3IP4C 5CHLB 3AZEA 4QLCD 3NQUB 5BO0B 4H9PB 3UTAB 4Z66A 2DQNC 3AZIC 1T3UA 5BNVB 2HUEC 4XUJA 3W99A 4QLCB 4UUZA 4NE5A 4WU8C 1KU5A 3AYWA 3WKJC 1ID3C 5AY8A 3AZNC 3AZMA 3B6FD 2Y2KA 3KXBA 3R45B 3REKC 3B6FB 4XZQD 2LY8A 3WTPD 5B33D 4ZBJC 2F2AC 4DRAA 5AV8D 4XZQB 3LZ0C 3WTPB 4M6BA 5GT0D 3AZEC 2YFWA 5B31A 5B33B 1P3FC 3O62C 5AV8B 5B0YD 1R4VA 3TU4C 4XUJC 5GT0B 3AZGD 1H3OA 3RELD 5AY8C 5C3IC 5B0YB 1U35D 3AZMC 4NE6A 3W96A 4ZUXC 3AZGB 4LD9A 5KDMB 1KX5C 3KXBC 3RELB 1U35B 1P3GA 3B6GD 5CPID 2ZY2A 1AOID 1P3PD 3B6GB 4H9OA 3AZLA 5CPIB 1M18A 3UTAC 2Y2OA 2CV5D 1WWIA 1AOIB 2NZDD 4WZSB 3AZJA 1P3PB 4KGCD 2ZY3A 1TZYA 2Y2NA 3AZFD 4QLCC 5B24D 5JA4A 4KUDA 2CV5B 2NZDB 1HTAA 4KGCB 3LJAA 3AZFB 5B24B 2F8NH 5AV5D 3A6NA 4LD9C 3B6FC 5AV5B 3MGRD 1P3GC 5AV6D 2HIOD 4XZQC 2NQBA 3MGRB 1EQZD 1KX4D 5B33C 3AN2A 5AV8C 2HIOB 4Z5TD 5AV6B 4J8UA 3AZKD 1EQZB 5GT0C 1KX4B 2DF4C 4Z5TB 5B0YC 3AZKB 3MNND 4J8VD 1B67A 3AZGC 3V9RB 1P3BA 5CPKD 2F8NG 4Z2MH 5B0ZD 3EPJA 1P3OD 1U35C 5B32A 3AZHD 4J8XA 3LELA 3MNNB 4J8VB 1P34D 3MGPA 5B1MD 5CPKB 5B0ZB 1P3OB 1M19A 5G49B 3AV2A 3B6GC 5GT3D 5CPIC 3AZHB 1P34B 2UWXA 4DRBA 3A1KA 5B1MB 2HIOA 3X1TD 1AOIC 3H0LC 1P3PC 5GT3B 1P3LA 4E44A 5F99D 2CV5C 4H9NB 3X1TB 2NZDC 4WV4B 4YM6D 2BYMA 3X1SD 1S32A 1A7WA 1HQ3A 3KWQD 3AZFC 5B24C 2YFVA 3NQJB 3V9RA 5F99B 4YM6B 2AROD 1P3MD 3X1SB 4X23D 2F8ND 3KWQB 5AV5C 4WU8A 5CPKA 2AROB 1P3MB 4X23B 3AZNA 2F8NB 4KHAA 2Y2PA 3MGRC 1P3ID 3REKA 5AV6C 2HIOC 4WU9A 3KUYD 3UT9D 1ULYA 1P3IB 1EQZC 3REJD 1KX4C 4Z5TC 3KUYB 3X1UD 3UT9B 3LZ0A 3AZKC 1BH9A 2RVQD 3EG5B 3REJB 1KX3D 5JRGD 3X1VD 1P3FA 3O62A 3MGQD 5B40D 5DNMD 3X1UB 5GSUD 3TU4A 3MNNC 4J8VC 1KX3B 5FUGA 5JRGB 3X1VB 1N1JA 3MGQB 5B40B 5CPKC 5B0ZC 1P3OC 5DNMB 2FJ7D 3UTBD 5GSUB 3AZHC 4ZUXA 4NFTA 1P34C 5B1MC 5BNXB 1KX5A 3W98D 2FJ7B 3UTBB 5DNND 5GT3C 4WU9C 1BH8A 5AV9D 5B2ID 3W98B 2IO5B 3X1TC 5DNNB 3NQUA 5BO0A 4H9PA 5AV9B 5B2IB 5F99C 2L5AA 5CP6D 3UTAA 4YM6C 3X1SC 1PZRA 5BNVA 4WNNB 3WAAD 4QLCA 4H9RB 1KX3A 5CP6B 2AROC 1P3MC 4X23C 3W97D 3WAAB 1ZLAD 5B1LD 3R45A 3W97B 3B6FA 1ZLAB 5B1LB 3AFAD 3C1CD 1Z2CB 5DNNA 4XZQA 3UT9C 3WTPA 3AFAB 3C1CB 3REJC 5B33A 5AV8A 3X1UC 1P3KD 2RVQC 5GT0A 3VH5A 1KX3C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JRG C;  3AV1 D;  1M1A D;  3MGQ C;  5DNM C;  5B0Y A;  1P3K B;  5GSU C;  3VH6 A;  3AZG A;  5KDM A;  3AV1 B;  1M1A B;  3REL A;  2FJ7 C;  1U35 A;  5GXQ D;  2IO5 C;  4HGA B;  3B6G A;  5DNN C;  5CPI A;  5AV9 C;  5GXQ B;  3WTP C;  1AOI A;  1P3P A;  3MGS D;  2CV5 A;  5CP6 C;  2NZD A;  4KGC A;  3WAA C;  3AZF A;  3MGS B;  4H9S C;  5B24 A;  4JJN D;  5AVB D;  3AV1 A;  4YS3 D;  3W97 C;  1Q9C A;  5BT1 D;  3REL C;  4E45 A;  5AV5 A;  5AVB B;  4JJN B;  5B1L C;  3B0C W;  1ZLA C;  4YS3 B;  5AVC D;  3LZ1 D;  3REH D;  4CSR B;  3MGR A;  3AFA C;  3C1C C;  5AVC B;  3LZ1 B;  3REH B;  3WA9 D;  5AV6 A;  2BYK B;  4CAY B;  1F1E A;  5BS7 A;  4J8W D;  1EQZ A;  4H9Q B;  1F66 D;  1JFI B;  1KX4 A;  3C1B D;  3WA9 B;  5B2J D;  1P3A D;  4Z5T A;  3AZI D;  4J8W B;  4KGC C;  3AZK A;  1F66 B;  5E5A D;  3C1B B;  3AV1 C;  1M1A C;  5B2J B;  1P3A B;  3AZI B;  3WTP E;  1BFM A;  2PYO D;  5E5A B;  3MNN A;  4J8V A;  4Z2M G;  5B0Z A;  1P3O A;  4HGA C;  5G49 A;  3AZH A;  2PYO B;  1P34 A;  5GXQ C;  5B1M A;  5CPJ D;  4CAY A;  5GT3 A;  1TAF B;  3KSY A;  5BS7 C;  1JFI A;  3AZE D;  4H9N A;  3X1T A;  5CPJ B;  4Z66 D;  5B31 G;  3NQJ A;  5F99 A;  4XUJ D;  3AZE B;  3W99 D;  4YM6 A;  3X1S A;  4Z66 B;  3KWQ A;  3AYW D;  5AY8 D;  4JJN C;  4XUJ B;  3W99 B;  4YS3 C;  4UUZ B;  2ARO A;  1P3M A;  4X23 A;  2F8N A;  3AYW B;  3KXB D;  5BT1 C;  5AY8 B;  4G92 B;  5AVC C;  3LZ1 C;  3REH C;  3REI D;  3KXB B;  1P3I A;  3REI B;  3KUY A;  5B31 D;  4J8W C;  3UT9 A;  4EO5 B;  2JSS A;  1F66 C;  3REJ A;  3C1B C;  5B2J C;  1P3A C;  2YFW B;  5B31 B;  3X1U A;  3KWQ C;  5E5A C;  5JRG A;  3X1V A;  3MGQ A;  5B40 A;  3W96 D;  4LD9 D;  5DNM A;  5GSU A;  1H3O B;  4R8P D;  2PYO C;  3VH5 W;  1P3G D;  5BNX A;  3W96 B;  4LD9 B;  2FJ7 A;  3B0B A;  3UTB A;  4R8P B;  1P3G B;  3VH6 W;  3AZL D;  3REI A;  1P3I C;  3W98 A;  3MVD D;  1M18 D;  5CPJ C;  3B0C T;  4AWL B;  3KUY C;  3AZJ D;  5AV9 A;  1TZY D;  4H9O B;  5B2I A;  3AZL B;  3MVD B;  1M18 B;  4Z66 C;  4KUD D;  4WNN A;  4H9R A;  3AZJ B;  1TZY B;  3W99 C;  3B0D B;  5CP6 A;  3LJA D;  5JA4 B;  3X1V C;  3A6N D;  3AYW C;  4KUD B;  5B40 C;  3WAA A;  4H9S A;  5B32 G;  3LJA B;  4G92 C;  3W97 A;  3A6N B;  1B6W A;  4R8P A;  3UTB C;  1ZLA A;  5B1L A;  2NQB D;  4NE3 A;  3REI C;  3W98 C;  3AN2 D;  4EO5 C;  2NQB B;  3AFA A;  3MVD A;  3C1C A;  4J8U D;  5B2I C;  5B31 C;  3AN2 B;  4J8U B;  1P3B D;  1P3K A;  5B32 D;  4J8X D;  1M1A A;  3W96 C;  3LEL D;  3MGP D;  1P3B B;  1M19 D;  4R8P C;  3AV2 D;  5B32 B;  4J8X B;  3LEL B;  2F8N K;  3MGP B;  4AWL C;  1M19 B;  3AV2 B;  3AZL C;  5GXQ A;  1P3L D;  3MVD C;  1M18 C;  1S32 D;  4G91 B;  3AZJ C;  1HQ3 D;  1TZY C;  1P3L B;  3B0D C;  4KUD C;  1S32 B;  2BYM B;  3MGS A;  1HQ3 B;  1P3K C;  3LJA C;  2YFV B;  4WU8 D;  3WKJ D;  3A6N C;  1ID3 D;  3AZN D;  2HUE B;  4JJN A;  5AVB A;  4YS3 A;  4WU8 B;  3WKJ B;  1ID3 B;  4CSR A;  3REK D;  3AZN B;  4KHA B;  4WU9 D;  1WWS A;  2NQB C;  5AVC A;  3LZ1 A;  3REH A;  2BYK A;  3VH5 T;  3REK B;  3AN2 C;  4WU9 B;  4H9Q A;  3LZ0 D;  4J8U C;  3WA9 A;  2CWE A;  4J8W A;  3VH6 T;  4ZBJ B;  1P3F D;  3O62 D;  1F66 A;  3MGS C;  3LZ0 B;  3C1B A;  1BH9 B;  3TU4 D;  5B2J A;  1P3A A;  3AZI A;  1P3B C;  1P3F B;  3O62 B;  5E5A A;  5B32 C;  3TU4 B;  5AVB C;  3AZM D;  4J8X C;  1ID3 A;  3WKJ A;  4ZUX D;  3LEL C;  5FUG B;  3MGP C;  1N1J B;  1KX5 D;  1M19 C;  5C3I B;  2PYO A;  3AV2 C;  3AZM B;  4ZUX B;  1KX5 B;  1TAF A;  4G91 C;  1P3L C;  1BH8 B;  5CPJ A;  3UTA D;  3WA9 C;  1S32 C;  1HQ3 C;  5CHL B;  3AZE A;  4QLC D;  3NQU B;  5BO0 B;  4H9P B;  3UTA B;  4Z66 A;  3AZI C;  5BNV B;  2HUE C;  4XUJ A;  3W99 A;  4QLC B;  4UUZ A;  4NE5 A;  4WU8 C;  1KU5 A;  3AYW A;  3WKJ C;  1ID3 C;  5AY8 A;  3AZN C;  3AZM A;  3B6F D;  3KXB A;  3R45 B;  3REK C;  3B6F B;  4XZQ D;  2LY8 A;  3WTP D;  5B33 D;  4ZBJ C;  4DRA A;  5AV8 D;  4XZQ B;  3LZ0 C;  3WTP B;  4M6B A;  5GT0 D;  3AZE C;  2YFW A;  5B31 A;  5B33 B;  1P3F C;  3O62 C;  5AV8 B;  5B0Y D;  1R4V A;  3TU4 C;  4XUJ C;  5GT0 B;  3AZG D;  1H3O A;  3REL D;  5AY8 C;  5C3I C;  5B0Y B;  1U35 D;  3AZM C;  4NE6 A;  3W96 A;  4ZUX C;  3AZG B;  4LD9 A;  5KDM B;  1KX5 C;  3KXB C;  3REL B;  1U35 B;  1P3G A;  3B6G D;  5CPI D;  1AOI D;  1P3P D;  3B6G B;  4H9O A;  3AZL A;  5CPI B;  1M18 A;  3UTA C;  2CV5 D;  1WWI A;  1AOI B;  2NZD D;  4WZS B;  3AZJ A;  1P3P B;  4KGC D;  1TZY A;  3AZF D;  4QLC C;  5B24 D;  5JA4 A;  4KUD A;  2CV5 B;  2NZD B;  1HTA A;  4KGC B;  3LJA A;  3AZF B;  5B24 B;  2F8N H;  5AV5 D;  3A6N A;  4LD9 C;  3B6F C;  5AV5 B;  3MGR D;  1P3G C;  5AV6 D;  2HIO D;  4XZQ C;  2NQB A;  3MGR B;  1EQZ D;  1KX4 D;  5B33 C;  3AN2 A;  5AV8 C;  2HIO B;  4Z5T D;  5AV6 B;  4J8U A;  3AZK D;  1EQZ B;  5GT0 C;  1KX4 B;  4Z5T B;  5B0Y C;  3AZK B;  3MNN D;  4J8V D;  1B67 A;  3AZG C;  3V9R B;  1P3B A;  5CPK D;  2F8N G;  4Z2M H;  5B0Z D;  1P3O D;  1U35 C;  5B32 A;  3AZH D;  4J8X A;  3LEL A;  3MNN B;  4J8V B;  1P34 D;  3MGP A;  5B1M D;  5CPK B;  5B0Z B;  1P3O B;  1M19 A;  5G49 B;  3AV2 A;  3B6G C;  5GT3 D;  5CPI C;  3AZH B;  1P34 B;  4DRB A;  5B1M B;  2HIO A;  3X1T D;  1AOI C;  1P3P C;  5GT3 B;  1P3L A;  4E44 A;  5F99 D;  2CV5 C;  4H9N B;  3X1T B;  2NZD C;  4WV4 B;  4YM6 D;  2BYM A;  3X1S D;  1S32 A;  1A7W A;  1HQ3 A;  3KWQ D;  3AZF C;  5B24 C;  2YFV A;  3NQJ B;  3V9R A;  5F99 B;  4YM6 B;  2ARO D;  1P3M D;  3X1S B;  4X23 D;  2F8N D;  3KWQ B;  5AV5 C;  4WU8 A;  5CPK A;  2ARO B;  1P3M B;  4X23 B;  3AZN A;  2F8N B;  4KHA A;  3MGR C;  1P3I D;  3REK A;  5AV6 C;  2HIO C;  4WU9 A;  3KUY D;  3UT9 D;  1ULY A;  1P3I B;  1EQZ C;  3REJ D;  1KX4 C;  4Z5T C;  3KUY B;  3X1U D;  3UT9 B;  3LZ0 A;  3AZK C;  1BH9 A;  2RVQ D;  3REJ B;  1KX3 D;  5JRG D;  3X1V D;  1P3F A;  3O62 A;  3MGQ D;  5B40 D;  5DNM D;  3X1U B;  5GSU D;  3TU4 A;  3MNN C;  4J8V C;  1KX3 B;  5FUG A;  5JRG B;  3X1V B;  1N1J A;  3MGQ B;  5B40 B;  5CPK C;  5B0Z C;  1P3O C;  5DNM B;  2FJ7 D;  3UTB D;  5GSU B;  3AZH C;  4ZUX A;  4NFT A;  1P34 C;  5B1M C;  5BNX B;  1KX5 A;  3W98 D;  2FJ7 B;  3UTB B;  5DNN D;  5GT3 C;  4WU9 C;  1BH8 A;  5AV9 D;  5B2I D;  3W98 B;  2IO5 B;  3X1T C;  5DNN B;  3NQU A;  5BO0 A;  4H9P A;  5AV9 B;  5B2I B;  5F99 C;  2L5A A;  5CP6 D;  3UTA A;  4YM6 C;  3X1S C;  5BNV A;  4WNN B;  3WAA D;  4QLC A;  4H9R B;  1KX3 A;  5CP6 B;  2ARO C;  1P3M C;  4X23 C;  3W97 D;  3WAA B;  1ZLA D;  5B1L D;  3R45 A;  3W97 B;  3B6F A;  1ZLA B;  5B1L B;  3AFA D;  3C1C D;  5DNN A;  4XZQ A;  3UT9 C;  3WTP A;  3AFA B;  3C1C B;  3REJ C;  5B33 A;  5AV8 A;  3X1U C;  1P3K D;  2RVQ C;  5GT0 A;  3VH5 A;  1KX3 C; 
#chains in the Genus database with same CATH topology
 5JRG C;  3AV1 D;  1M1A D;  3MGQ C;  2JE5 A;  5DNM C;  5B0Y A;  1P3K B;  5GSU C;  2Y2I A;  3VH6 A;  3AZG A;  5KDM A;  3AV1 B;  1M1A B;  3REL A;  2FJ7 C;  1U35 A;  5GXQ D;  2IO5 C;  4HGA B;  3B6G A;  5DNN C;  5CPI A;  3KFU G;  5AV9 C;  5GXQ B;  3WTP C;  1AOI A;  1P3P A;  3MGS D;  2CV5 A;  5CP6 C;  2NZD A;  4KGC A;  3WAA C;  3AZF A;  3MGS B;  4H9S C;  5B24 A;  4JJN D;  5AVB D;  3AV1 A;  4YS3 D;  3W97 C;  1Q9C A;  5BT1 D;  3REL C;  4E45 A;  5AV5 A;  5AVB B;  4JJN B;  5B1L C;  3B0C W;  1ZLA C;  4YS3 B;  5AVC D;  3LZ1 D;  3REH D;  4CSR B;  3MGR A;  3AFA C;  3C1C C;  3P5J B;  5AVC B;  3AL0 C;  3LZ1 B;  3REH B;  3WA9 D;  5AV6 A;  2BYK B;  4CAY B;  1F1E A;  5BS7 A;  4J8W D;  1EQZ A;  4H9Q B;  1F66 D;  1JFI B;  1KX4 A;  3C1B D;  3WA9 B;  5B2J D;  1P3A D;  4Z5T A;  2Y2L A;  4J8W B;  3AZI D;  4KGC C;  2Y2H A;  3AZK A;  1F66 B;  5E5A D;  3C1B B;  3AV1 C;  1M1A C;  5B2J B;  1P3A B;  3AZI B;  2Y2M A;  3WTP E;  1BFM A;  2PYO D;  2Y2Q A;  5E5A B;  3MNN A;  4Z2M G;  4J8V A;  5B0Z A;  1P3O A;  4HGA C;  5G49 A;  3AZH A;  2PYO B;  2VQR A;  1P34 A;  5GXQ C;  5B1M A;  5CPJ D;  4CAY A;  5GT3 A;  1TAF B;  3KSY A;  5BS7 C;  1JFI A;  3AZE D;  4H9N A;  3X1T A;  5CPJ B;  4Z66 D;  5B31 G;  3NQJ A;  5F99 A;  4XUJ D;  3AZE B;  3W99 D;  4YM6 A;  3X1S A;  4Z66 B;  3KWQ A;  3AYW D;  5AY8 D;  4JJN C;  4XUJ B;  3W99 B;  4YS3 C;  4UUZ B;  2ARO A;  1P3M A;  4X23 A;  2F8N A;  3AYW B;  3KXB D;  5BT1 C;  5AY8 B;  4G92 B;  5AVC C;  3LZ1 C;  3REH C;  3REI D;  3KXB B;  1P3I A;  2RIQ A;  3REI B;  3KUY A;  5B31 D;  4J8W C;  3UT9 A;  4EO5 B;  2JSS A;  1F66 C;  3REJ A;  3C1B C;  5B2J C;  1P3A C;  2YFW B;  5B31 B;  3X1U A;  3KWQ C;  5E5A C;  5JRG A;  3EPK A;  3FDD A;  2Y2J A;  3MGQ A;  5B40 A;  3X1V A;  3W96 D;  4LD9 D;  5DNM A;  2FFF B;  1H3O B;  5GSU A;  4R8P D;  2PYO C;  3VH5 W;  1P3G D;  2BG1 A;  5BNX A;  3W96 B;  4LD9 B;  2FJ7 A;  3B0B A;  3UTB A;  4R8P B;  1P3G B;  3VH6 W;  3AZL D;  3REI A;  1P3I C;  3W98 A;  3MVD D;  1M18 D;  5CPJ C;  3B0C T;  4AWL B;  3KUY C;  3AZJ D;  5AV9 A;  1TZY D;  4H9O B;  5B2I A;  3AZL B;  3MVD B;  1M18 B;  2Y2G A;  4Z66 C;  4KUD D;  2XD5 A;  4WNN A;  4H9R A;  3AZJ B;  1TZY B;  3W99 C;  5CP6 A;  3B0D B;  3LJA D;  5JA4 B;  3X1V C;  3A6N D;  3AYW C;  4KUD B;  5B40 C;  3WAA A;  4H9S A;  5B32 G;  3LJA B;  4G92 C;  2XD1 A;  3W97 A;  3A6N B;  1B6W A;  2ZY4 A;  4R8P A;  3UTB C;  1ZLA A;  5B1L A;  2NQB D;  4NE3 A;  3REI C;  3H0R C;  3W98 C;  3AN2 D;  4EO5 C;  2NQB B;  3AFA A;  1W2E A;  3MVD A;  3C1C A;  4J8U D;  5B2I C;  5B31 C;  3AN2 B;  4J8U B;  1P3B D;  1P3K A;  5B32 D;  4J8X D;  1M1A A;  4WJ3 C;  3W96 C;  3LEL D;  3MGP D;  1P3B B;  1M19 D;  4R8P C;  3AV2 D;  5B32 B;  4J8X B;  3LEL B;  2F8N K;  2ZM5 A;  3MGP B;  4AWL C;  2ZY5 A;  1M19 B;  3AV2 B;  3AZL C;  5GXQ A;  1P3L D;  3MVD C;  1M18 C;  3H0M C;  1S32 D;  4G91 B;  3AZJ C;  1HQ3 D;  4UPK A;  1TZY C;  1P3L B;  3B0D C;  4KUD C;  1S32 B;  2BYM B;  3MGS A;  1HQ3 B;  1P3K C;  3LJA C;  2YFV B;  4WU8 D;  3WKJ D;  3A6N C;  1ID3 D;  2G5H C;  3AZN D;  2HUE B;  4JJN A;  5AVB A;  3A1I A;  4YS3 A;  2W8S A;  4WU8 B;  3WKJ B;  1ID3 B;  4CSR A;  3REK D;  3AZN B;  4KHA B;  4WU9 D;  1WWS A;  2NQB C;  5AVC A;  3LZ1 A;  3REH A;  2J8P A;  3EPL A;  2BYK A;  3VH5 T;  3REK B;  3AN2 C;  4WU9 B;  2G5I C;  4H9Q A;  3LZ0 D;  4J8U C;  3F6T A;  3WA9 A;  2CWE A;  4J8W A;  3VH6 T;  4ZBJ B;  1P3F D;  3O62 D;  1F66 A;  3MGS C;  3LZ0 B;  3C1B A;  1BH9 B;  3TU4 D;  5B2J A;  1P3A A;  3AZI A;  3EPH A;  1P3B C;  1P3F B;  3O62 B;  5E5A A;  5B32 C;  3TU4 B;  5AVB C;  3AZM D;  4J8X C;  1ID3 A;  3WKJ A;  4ZUX D;  3LEL C;  2JCH A;  5FUG B;  3MGP C;  1N1J B;  4DQY B;  1KX5 D;  1M19 C;  5C3I B;  2PYO A;  3AV2 C;  3AZM B;  4ZUX B;  1KX5 B;  1TAF A;  4G91 C;  1P3L C;  1BH8 B;  5CPJ A;  3UTA D;  3WA9 C;  1S32 C;  1HQ3 C;  3IP4 C;  5CHL B;  3AZE A;  4QLC D;  3NQU B;  5BO0 B;  4H9P B;  3UTA B;  4Z66 A;  2DQN C;  3AZI C;  1T3U A;  5BNV B;  2HUE C;  4XUJ A;  3W99 A;  4QLC B;  4UUZ A;  4NE5 A;  4WU8 C;  1KU5 A;  3AYW A;  3WKJ C;  1ID3 C;  5AY8 A;  3AZN C;  3AZM A;  3B6F D;  2Y2K A;  3KXB A;  3R45 B;  3REK C;  3B6F B;  4XZQ D;  2LY8 A;  3WTP D;  5B33 D;  4ZBJ C;  2F2A C;  4DRA A;  5AV8 D;  4XZQ B;  3LZ0 C;  3WTP B;  4M6B A;  5GT0 D;  3AZE C;  2YFW A;  5B31 A;  5B33 B;  1P3F C;  3O62 C;  5AV8 B;  5B0Y D;  1R4V A;  3TU4 C;  4XUJ C;  5GT0 B;  3AZG D;  1H3O A;  3REL D;  5AY8 C;  5C3I C;  5B0Y B;  1U35 D;  3AZM C;  4NE6 A;  3W96 A;  4ZUX C;  3AZG B;  4LD9 A;  5KDM B;  1KX5 C;  3KXB C;  3REL B;  1U35 B;  1P3G A;  3B6G D;  5CPI D;  2ZY2 A;  1AOI D;  1P3P D;  3B6G B;  4H9O A;  3AZL A;  5CPI B;  1M18 A;  3UTA C;  2Y2O A;  2CV5 D;  1WWI A;  1AOI B;  2NZD D;  4WZS B;  3AZJ A;  1P3P B;  4KGC D;  2ZY3 A;  1TZY A;  2Y2N A;  3AZF D;  4QLC C;  5B24 D;  5JA4 A;  4KUD A;  2CV5 B;  2NZD B;  1HTA A;  4KGC B;  3LJA A;  3AZF B;  5B24 B;  2F8N H;  5AV5 D;  3A6N A;  4LD9 C;  3B6F C;  5AV5 B;  3MGR D;  1P3G C;  5AV6 D;  2HIO D;  4XZQ C;  2NQB A;  3MGR B;  1EQZ D;  1KX4 D;  5B33 C;  3AN2 A;  5AV8 C;  2HIO B;  4Z5T D;  5AV6 B;  4J8U A;  3AZK D;  1EQZ B;  5GT0 C;  1KX4 B;  2DF4 C;  4Z5T B;  5B0Y C;  3AZK B;  3MNN D;  4J8V D;  1B67 A;  3AZG C;  3V9R B;  1P3B A;  5CPK D;  2F8N G;  4Z2M H;  5B0Z D;  3EPJ A;  1P3O D;  1U35 C;  5B32 A;  3AZH D;  4J8X A;  3LEL A;  3MNN B;  4J8V B;  1P34 D;  3MGP A;  5B1M D;  5CPK B;  5B0Z B;  1P3O B;  1M19 A;  5G49 B;  3AV2 A;  3B6G C;  5GT3 D;  5CPI C;  3AZH B;  1P34 B;  2UWX A;  4DRB A;  3A1K A;  5B1M B;  2HIO A;  3X1T D;  1AOI C;  3H0L C;  1P3P C;  5GT3 B;  1P3L A;  4E44 A;  5F99 D;  2CV5 C;  4H9N B;  3X1T B;  2NZD C;  4WV4 B;  4YM6 D;  2BYM A;  3X1S D;  1S32 A;  1A7W A;  1HQ3 A;  3KWQ D;  3AZF C;  5B24 C;  2YFV A;  3NQJ B;  3V9R A;  5F99 B;  4YM6 B;  2ARO D;  1P3M D;  3X1S B;  4X23 D;  2F8N D;  3KWQ B;  5AV5 C;  4WU8 A;  5CPK A;  2ARO B;  1P3M B;  4X23 B;  3AZN A;  2F8N B;  4KHA A;  2Y2P A;  3MGR C;  1P3I D;  3REK A;  5AV6 C;  2HIO C;  4WU9 A;  3KUY D;  3UT9 D;  1ULY A;  1P3I B;  1EQZ C;  3REJ D;  1KX4 C;  4Z5T C;  3KUY B;  3X1U D;  3UT9 B;  3LZ0 A;  3AZK C;  1BH9 A;  2RVQ D;  3EG5 B;  3REJ B;  1KX3 D;  5JRG D;  3X1V D;  1P3F A;  3O62 A;  3MGQ D;  5B40 D;  5DNM D;  3X1U B;  5GSU D;  3TU4 A;  3MNN C;  4J8V C;  1KX3 B;  5FUG A;  5JRG B;  3X1V B;  1N1J A;  3MGQ B;  5B40 B;  5CPK C;  5B0Z C;  1P3O C;  5DNM B;  2FJ7 D;  3UTB D;  5GSU B;  3AZH C;  4ZUX A;  4NFT A;  1P34 C;  5B1M C;  5BNX B;  1KX5 A;  3W98 D;  2FJ7 B;  3UTB B;  5DNN D;  5GT3 C;  4WU9 C;  1BH8 A;  5AV9 D;  5B2I D;  3W98 B;  2IO5 B;  3X1T C;  5DNN B;  3NQU A;  5BO0 A;  4H9P A;  5AV9 B;  5B2I B;  5F99 C;  2L5A A;  5CP6 D;  3UTA A;  4YM6 C;  3X1S C;  1PZR A;  5BNV A;  4WNN B;  3WAA D;  4QLC A;  4H9R B;  1KX3 A;  5CP6 B;  2ARO C;  1P3M C;  4X23 C;  3W97 D;  3WAA B;  1ZLA D;  5B1L D;  3R45 A;  3W97 B;  3B6F A;  1ZLA B;  5B1L B;  3AFA D;  3C1C D;  1Z2C B;  5DNN A;  4XZQ A;  3UT9 C;  3WTP A;  3AFA B;  3C1C B;  3REJ C;  5B33 A;  5AV8 A;  3X1U C;  1P3K D;  2RVQ C;  5GT0 A;  3VH5 A;  1KX3 C; 
#chains in the Genus database with same CATH homology
 5JRG C;  3AV1 D;  1M1A D;  3MGQ C;  2JE5 A;  5DNM C;  5B0Y A;  1P3K B;  5GSU C;  2Y2I A;  3VH6 A;  3AZG A;  5KDM A;  3AV1 B;  1M1A B;  3REL A;  2FJ7 C;  1U35 A;  5GXQ D;  2IO5 C;  4HGA B;  3B6G A;  5DNN C;  5CPI A;  3KFU G;  5AV9 C;  5GXQ B;  3WTP C;  1AOI A;  1P3P A;  3MGS D;  2CV5 A;  5CP6 C;  2NZD A;  4KGC A;  3WAA C;  3AZF A;  3MGS B;  4H9S C;  5B24 A;  4JJN D;  5AVB D;  3AV1 A;  4YS3 D;  3W97 C;  1Q9C A;  5BT1 D;  3REL C;  4E45 A;  5AV5 A;  5AVB B;  4JJN B;  5B1L C;  3B0C W;  1ZLA C;  4YS3 B;  5AVC D;  3LZ1 D;  3REH D;  4CSR B;  3MGR A;  3AFA C;  3C1C C;  3P5J B;  5AVC B;  3AL0 C;  3LZ1 B;  3REH B;  3WA9 D;  5AV6 A;  2BYK B;  4CAY B;  1F1E A;  5BS7 A;  4J8W D;  1EQZ A;  4H9Q B;  1F66 D;  1JFI B;  1KX4 A;  3C1B D;  3WA9 B;  5B2J D;  1P3A D;  4Z5T A;  2Y2L A;  4J8W B;  3AZI D;  4KGC C;  2Y2H A;  3AZK A;  1F66 B;  5E5A D;  3C1B B;  3AV1 C;  1M1A C;  5B2J B;  1P3A B;  3AZI B;  2Y2M A;  3WTP E;  1BFM A;  2PYO D;  2Y2Q A;  5E5A B;  3MNN A;  4Z2M G;  4J8V A;  5B0Z A;  1P3O A;  4HGA C;  5G49 A;  3AZH A;  2PYO B;  2VQR A;  1P34 A;  5GXQ C;  5B1M A;  5CPJ D;  4CAY A;  5GT3 A;  1TAF B;  3KSY A;  5BS7 C;  1JFI A;  3AZE D;  4H9N A;  3X1T A;  5CPJ B;  4Z66 D;  5B31 G;  3NQJ A;  5F99 A;  4XUJ D;  3AZE B;  3W99 D;  4YM6 A;  3X1S A;  4Z66 B;  3KWQ A;  3AYW D;  5AY8 D;  4JJN C;  4XUJ B;  3W99 B;  4YS3 C;  4UUZ B;  2ARO A;  1P3M A;  4X23 A;  2F8N A;  3AYW B;  3KXB D;  5BT1 C;  5AY8 B;  4G92 B;  5AVC C;  3LZ1 C;  3REH C;  3REI D;  3KXB B;  1P3I A;  2RIQ A;  3REI B;  3KUY A;  5B31 D;  4J8W C;  3UT9 A;  4EO5 B;  2JSS A;  1F66 C;  3REJ A;  3C1B C;  5B2J C;  1P3A C;  2YFW B;  5B31 B;  3X1U A;  3KWQ C;  5E5A C;  5JRG A;  3EPK A;  3FDD A;  2Y2J A;  3MGQ A;  5B40 A;  3X1V A;  3W96 D;  4LD9 D;  5DNM A;  2FFF B;  1H3O B;  5GSU A;  4R8P D;  2PYO C;  3VH5 W;  1P3G D;  2BG1 A;  5BNX A;  3W96 B;  4LD9 B;  2FJ7 A;  3B0B A;  3UTB A;  4R8P B;  1P3G B;  3VH6 W;  3AZL D;  3REI A;  1P3I C;  3W98 A;  3MVD D;  1M18 D;  5CPJ C;  3B0C T;  4AWL B;  3KUY C;  3AZJ D;  5AV9 A;  1TZY D;  4H9O B;  5B2I A;  3AZL B;  3MVD B;  1M18 B;  2Y2G A;  4Z66 C;  4KUD D;  2XD5 A;  4WNN A;  4H9R A;  3AZJ B;  1TZY B;  3W99 C;  5CP6 A;  3B0D B;  3LJA D;  5JA4 B;  3X1V C;  3A6N D;  3AYW C;  4KUD B;  5B40 C;  3WAA A;  4H9S A;  5B32 G;  3LJA B;  4G92 C;  2XD1 A;  3W97 A;  3A6N B;  1B6W A;  2ZY4 A;  4R8P A;  3UTB C;  1ZLA A;  5B1L A;  2NQB D;  4NE3 A;  3REI C;  3H0R C;  3W98 C;  3AN2 D;  4EO5 C;  2NQB B;  3AFA A;  1W2E A;  3MVD A;  3C1C A;  4J8U D;  5B2I C;  5B31 C;  3AN2 B;  4J8U B;  1P3B D;  1P3K A;  5B32 D;  4J8X D;  1M1A A;  4WJ3 C;  3W96 C;  3LEL D;  3MGP D;  1P3B B;  1M19 D;  4R8P C;  3AV2 D;  5B32 B;  4J8X B;  3LEL B;  2F8N K;  2ZM5 A;  3MGP B;  4AWL C;  2ZY5 A;  1M19 B;  3AV2 B;  3AZL C;  5GXQ A;  1P3L D;  3MVD C;  1M18 C;  3H0M C;  1S32 D;  4G91 B;  3AZJ C;  1HQ3 D;  4UPK A;  1TZY C;  1P3L B;  3B0D C;  4KUD C;  1S32 B;  2BYM B;  3MGS A;  1HQ3 B;  1P3K C;  3LJA C;  2YFV B;  4WU8 D;  3WKJ D;  3A6N C;  1ID3 D;  2G5H C;  3AZN D;  2HUE B;  4JJN A;  5AVB A;  3A1I A;  4YS3 A;  2W8S A;  4WU8 B;  3WKJ B;  1ID3 B;  4CSR A;  3REK D;  3AZN B;  4KHA B;  4WU9 D;  1WWS A;  2NQB C;  5AVC A;  3LZ1 A;  3REH A;  2J8P A;  3EPL A;  2BYK A;  3VH5 T;  3REK B;  3AN2 C;  4WU9 B;  2G5I C;  4H9Q A;  3LZ0 D;  4J8U C;  3F6T A;  3WA9 A;  2CWE A;  4J8W A;  3VH6 T;  4ZBJ B;  1P3F D;  3O62 D;  1F66 A;  3MGS C;  3LZ0 B;  3C1B A;  1BH9 B;  3TU4 D;  5B2J A;  1P3A A;  3AZI A;  3EPH A;  1P3B C;  1P3F B;  3O62 B;  5E5A A;  5B32 C;  3TU4 B;  5AVB C;  3AZM D;  4J8X C;  1ID3 A;  3WKJ A;  4ZUX D;  3LEL C;  2JCH A;  5FUG B;  3MGP C;  1N1J B;  4DQY B;  1KX5 D;  1M19 C;  5C3I B;  2PYO A;  3AV2 C;  3AZM B;  4ZUX B;  1KX5 B;  1TAF A;  4G91 C;  1P3L C;  1BH8 B;  5CPJ A;  3UTA D;  3WA9 C;  1S32 C;  1HQ3 C;  3IP4 C;  5CHL B;  3AZE A;  4QLC D;  3NQU B;  5BO0 B;  4H9P B;  3UTA B;  4Z66 A;  2DQN C;  3AZI C;  1T3U A;  5BNV B;  2HUE C;  4XUJ A;  3W99 A;  4QLC B;  4UUZ A;  4NE5 A;  4WU8 C;  1KU5 A;  3AYW A;  3WKJ C;  1ID3 C;  5AY8 A;  3AZN C;  3AZM A;  3B6F D;  2Y2K A;  3KXB A;  3R45 B;  3REK C;  3B6F B;  4XZQ D;  2LY8 A;  3WTP D;  5B33 D;  4ZBJ C;  2F2A C;  4DRA A;  5AV8 D;  4XZQ B;  3LZ0 C;  3WTP B;  4M6B A;  5GT0 D;  3AZE C;  2YFW A;  5B31 A;  5B33 B;  1P3F C;  3O62 C;  5AV8 B;  5B0Y D;  1R4V A;  3TU4 C;  4XUJ C;  5GT0 B;  3AZG D;  1H3O A;  3REL D;  5AY8 C;  5C3I C;  5B0Y B;  1U35 D;  3AZM C;  4NE6 A;  3W96 A;  4ZUX C;  3AZG B;  4LD9 A;  5KDM B;  1KX5 C;  3KXB C;  3REL B;  1U35 B;  1P3G A;  3B6G D;  5CPI D;  2ZY2 A;  1AOI D;  1P3P D;  3B6G B;  4H9O A;  3AZL A;  5CPI B;  1M18 A;  3UTA C;  2Y2O A;  2CV5 D;  1WWI A;  1AOI B;  2NZD D;  4WZS B;  3AZJ A;  1P3P B;  4KGC D;  2ZY3 A;  1TZY A;  2Y2N A;  3AZF D;  4QLC C;  5B24 D;  5JA4 A;  4KUD A;  2CV5 B;  2NZD B;  1HTA A;  4KGC B;  3LJA A;  3AZF B;  5B24 B;  2F8N H;  5AV5 D;  3A6N A;  4LD9 C;  3B6F C;  5AV5 B;  3MGR D;  1P3G C;  5AV6 D;  2HIO D;  4XZQ C;  2NQB A;  3MGR B;  1EQZ D;  1KX4 D;  5B33 C;  3AN2 A;  5AV8 C;  2HIO B;  4Z5T D;  5AV6 B;  4J8U A;  3AZK D;  1EQZ B;  5GT0 C;  1KX4 B;  2DF4 C;  4Z5T B;  5B0Y C;  3AZK B;  3MNN D;  4J8V D;  1B67 A;  3AZG C;  3V9R B;  1P3B A;  5CPK D;  2F8N G;  4Z2M H;  5B0Z D;  3EPJ A;  1P3O D;  1U35 C;  5B32 A;  3AZH D;  4J8X A;  3LEL A;  3MNN B;  4J8V B;  1P34 D;  3MGP A;  5B1M D;  5CPK B;  5B0Z B;  1P3O B;  1M19 A;  5G49 B;  3AV2 A;  3B6G C;  5GT3 D;  5CPI C;  3AZH B;  1P34 B;  2UWX A;  4DRB A;  3A1K A;  5B1M B;  2HIO A;  3X1T D;  1AOI C;  3H0L C;  1P3P C;  5GT3 B;  1P3L A;  4E44 A;  5F99 D;  2CV5 C;  4H9N B;  3X1T B;  2NZD C;  4WV4 B;  4YM6 D;  2BYM A;  3X1S D;  1S32 A;  1A7W A;  1HQ3 A;  3KWQ D;  3AZF C;  5B24 C;  2YFV A;  3NQJ B;  3V9R A;  5F99 B;  4YM6 B;  2ARO D;  1P3M D;  3X1S B;  4X23 D;  2F8N D;  3KWQ B;  5AV5 C;  4WU8 A;  5CPK A;  2ARO B;  1P3M B;  4X23 B;  3AZN A;  2F8N B;  4KHA A;  2Y2P A;  3MGR C;  1P3I D;  3REK A;  5AV6 C;  2HIO C;  4WU9 A;  3KUY D;  3UT9 D;  1ULY A;  1P3I B;  1EQZ C;  3REJ D;  1KX4 C;  4Z5T C;  3KUY B;  3X1U D;  3UT9 B;  3LZ0 A;  3AZK C;  1BH9 A;  2RVQ D;  3EG5 B;  3REJ B;  1KX3 D;  5JRG D;  3X1V D;  1P3F A;  3O62 A;  3MGQ D;  5B40 D;  5DNM D;  3X1U B;  5GSU D;  3TU4 A;  3MNN C;  4J8V C;  1KX3 B;  5FUG A;  5JRG B;  3X1V B;  1N1J A;  3MGQ B;  5B40 B;  5CPK C;  5B0Z C;  1P3O C;  5DNM B;  2FJ7 D;  3UTB D;  5GSU B;  3AZH C;  4ZUX A;  4NFT A;  1P34 C;  5B1M C;  5BNX B;  1KX5 A;  3W98 D;  2FJ7 B;  3UTB B;  5DNN D;  5GT3 C;  4WU9 C;  1BH8 A;  5AV9 D;  5B2I D;  3W98 B;  2IO5 B;  3X1T C;  5DNN B;  3NQU A;  5BO0 A;  4H9P A;  5AV9 B;  5B2I B;  5F99 C;  2L5A A;  5CP6 D;  3UTA A;  4YM6 C;  3X1S C;  1PZR A;  5BNV A;  4WNN B;  3WAA D;  4QLC A;  4H9R B;  1KX3 A;  5CP6 B;  2ARO C;  1P3M C;  4X23 C;  3W97 D;  3WAA B;  1ZLA D;  5B1L D;  3R45 A;  3W97 B;  3B6F A;  1ZLA B;  5B1L B;  3AFA D;  3C1C D;  1Z2C B;  5DNN A;  4XZQ A;  3UT9 C;  3WTP A;  3AFA B;  3C1C B;  3REJ C;  5B33 A;  5AV8 A;  3X1U C;  1P3K D;  2RVQ C;  5GT0 A;  3VH5 A;  1KX3 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...