1F1EA

Crystal structure of the histone from methanopyrus kandleri
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
151
structure length
151
Chain Sequence
ELPKAAIERIFRQGIGERRLSQDAKDTIYDFVPTMAEYVANAAKSVLDASGKKTLMEEHLKALADVLMVEGVEDYDGELFGRATVRRILKRAGIERASSDAVDLYNKLICRATEELGEKAAEYADEDGRKTVQGEDVEKAITYSMPKGGEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords HISTONE FOLD PROTEIN
publication title An ancestral nuclear protein assembly: crystal structure of the Methanopyrus kandleri histone.
pubmed doi rcsb
source organism Methanopyrus kandleri
total genus 58
structure length 151
sequence length 151
ec nomenclature
pdb deposition date 2000-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00808 CBFD_NFYB_HMF Histone-like transcription factor (CBF/NF-Y) and archaeal histone
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1f1eA00
4QLCC 5B40C 3MNNB 5JA4A 1P3IA 3VH5T 3AV2C 5B31C 4H9SC 4UUZB 3RELA 4KGCC 5AVCA 2NZDC 5DNNB 4WU8B 3B6FC 5B2JA 1P3PB 1ID3B 4J8VD 3AZMA 2L5AA 3MNNC 4E44A 3MGPD 3W96B 5DNNC 3MGSA 4WU8C 1HQ3C 3C1BA 1ID3C 5JRGB 4JJND 5AV5C 3WTPD 1TZYD 2LY8A 3X1TC 3X1UB 1P3ID 5B0YA 3W98D 4G91B 3W96C 3WAAA 5AVBB 1P3AA 5AVCD 5JRGC 3KUYB 5B2JD 5BT1C 5C3IB 5CP6A 4R8PA 3AZMD 4H9RB 3X1UC 4J8UA 4KUDA 4G91C 5B1MA 5KDMA 5AV6C 4XUJA 5AVBC 3MGRB 2BYKA 3REKC 3AZLB 3VH6A 3KWQD 1KX5B 3MGSD 4WU9A 1P3BD 3C1BD 3WA9A 3KXBA 4Z5TC 4Z66D 3W99D 3VH6T 3REHD 3LELD 3AN2A 5B24A 3UTAB 1P3MB 3MGRC 3C1CB 3LZ0A 3AYWC 1P3AD 4CAYA 3X1SD 4AWLB 3MGQC 2F8NG 4R8PD 5CP6D 4J8UD 1HTAA 1P3MC 1F1EA 3B0CT 4KUDD 5B1MD 4XUJD 5CPJB 3AZKC 3VH6W 4XZQA 3UTBA 4CSRA 4KHAA 1KX3B 5DNMB 1M18B 3WA9D 4J8XB 3V9RA 3AZFD 1P3OB 5BNXB 1TAFB 5E5AB 1BH8B 4H9PB 5B24D 2FJ7A 5CPJC 3AZGD 1P3LD 2CV5A 5DNMC 4YM6B 4J8XC 1P3OC 2AROA 1KX4A 4X23A 5CPKA 1EQZA 3AZIB 1B67A 3B0DB 5B32B 1S32A 5AV9B 5GSUB 3REJA 3REIA 2HIOB 3AZEA 4YM6C 5GT0A 2F8ND 3UTBD 3X1VA 1P34B 4ZUXB 1N1JA 4J8WA 3NQUA 3TU4C 3B0DC 1F66A 5AV9C 5GSUC 1ZLAD 3UT9B 2HIOC 3AZHC 3A6NA 4LD9C 1M19A 3LJAA 2PYOA 4ZUXC 5AV8D 4YS3D 5GXQD 1P3KA 5CPKD 1M1AA 3B6GD 3UT9C 5F99D 1WWSA 1S32D 1U35C 4NE3A 4EO5B 4J8VB 5BNVB 3REID 3AZED 5B0ZD 5GT0D 2YFVB 2BYMB 3AV1A 5B1LD 3MGPB 1Q9CA 3AZJC 1F66D 3VH5A 5B33A 1P3GA 4J8VC 4JJNB 2F8NK 3AFAA 3WTPB 1TZYB 3A6ND 3LJAD 1A7WA 3W98B 1P3IB 5CPIA 3MVDD 3RELB 2IO5C 5AVCB 5B2ID 1AOIA 4JJNC 4WNNB 5B2JB 3WTPC 3MGQA 3WKJA 4QLCA 3AZMB 5B40A 3W98C 1P3IC 3AV2A 2CWEA 3AZND 2RVQC 3KWQB 3VH5W 3MGSB 2YFWA 5B33D 3C1BB 1P3BB 1P3PC 2NQBD 3B6FA 3MNNA 3LZ1D 4Z66B 3W99B 3REHB 3LELB 4UUZA 4H9OA 3KWQC 3RELD 1P3AB 4WU8A 1P3BC 3X1SB 1HQ3A 5AV5A 4Z66C 3MGQD 4R8PB 5CP6B 3W99C 4QLCD 3REHC 3X1TA 3LELC 4J8UB 4KUDB 5B1MB 3AV2D 3W96A 5KDMB 4XUJB 1P3AC 3WTPE 1KU5A 3X1SC 5JRGA 3KUYC 4HGAB 3B6FD 3WA9B 5CP6C 5C3IC 3AZFB 4ZBJB 3X1UA 4J8UC 4E45A 5B1MC 5B24B 5B0YD 5AV6A 3REKA 3AZGB 3AZLC 1P3LB 3WAAD 1KX5C 4HGAC 1HQ3D 4NE6A 3AZFC 4ZBJC 4H9RA 5AV5D 4Z5TA 3X1TD 5B24C 3UTAC 3AZGC 3C1CC 4Z2MG 1P3LC 3AYWA 1JFIB 5CHLB 5FUGB 2F8NB 3UTBB 5BS7C 4AWLC 4KHAB 4WU9D 3NQJA 3V9RB 3KXBD 1P3MA 3AN2D 5AV6D 2HUEB 3REKD 1ZLAB 3AZKA 3LZ0D 1H3OB 3UTBC 3B0CW 1KX3C 5AV8B 1M18C 4YS3B 5GXQB 4NFTA 4Z5TD 5AY8A 5CPKB 5E5AC 3B6GB 2HUEC 5CPJA 1ZLAC 5F99B 5BO0B 1S32B 3AYWD 5GT3A 3REIB 4G92B 5DNMA 3AZEB 5B0ZB 5AV8C 5GT0B 4YS3C 5GXQC 4XZQD 4J8XA 5CPKC 1TAFA 1BH8A 4H9PA 5B1LB 3AZIC 3B6GC 5F99C 3O62A 5B32C 1S32C 1F66B 2FJ7D 3AZKD 4G92C 5B0ZC 3A6NB 2CV5D 3LJAB 1P34C 1B6WA 1BH9A 3MVDB 5B1LC 2AROD 4H9QA 5AY8D 1KX4D 3W97A 4DRBA 4X23D 3TU4A 1EQZD 5B2IB 5AV9A 2HIOA 3A6NC 3AZHA 4LD9A 3REJD 5GT3D 3LJAC 1R4VA 3MVDC 2F8NH 3X1VD 4H9NA 3AZNB 2JSSA 5B2IC 1ULYA 4J8WD 3UT9A 3O62D 5B33B 1P3FA 1U35A 2NQBB 4EO5C 3LZ1B 1M19D 4WV4B 5JA4B 2PYOD 3AZNC 3MGPC 1P3KD 3W97D 3AZJA 3TU4D 1M1AD 5B31G 5B33C 2NQBC 4J8VA 5BNVA 3LZ1C 3MGQB 3AZHD 4LD9D 1TZYC 4QLCB 3R45A 3AV2B 5B31A 4H9SA 3RELC 4KGCA 5AVCC 3AV1D 2NZDA 4JJNA 3B6FB 1P3FD 5B2JC 1U35D 1P3GD 5G49A 3AZMC 3W98A 3AFAD 5B0YB 4H9OB 5CPID 3WAAB 3AZJD 3MGSC 5DNNA 4WNNA 1HQ3B 3C1BC 1P3PA 1ID3A 1AOID 5AV5B 3WKJD 3X1TB 5B40D 5B0YC 3WAAC 5B31D 3KWQA 4KGCD 2BYKB 1P3BA 2NZDD 4WU9B 4Z66A 3W99A 4R8PC 3REHA 3LELA 3MNND 3KXBB 4KUDC 3AN2B 5AV6B 4XUJC 5AVBA 3REKB 3LZ0B 2RVQD 3X1SA 4CAYB 3KUYA 5DNND 4WU9C 4WU8D 3WA9C 1P3PD 1ID3D 3KXBC 4Z5TB 3AN2C 3MGRA 3AZLA 3LZ0C 3AYWB 3W96D 1KX5A 4XZQB 3AZFA 4CSRB 5JRGD 3NQJB 5BT1D 3X1UD 3UTAA 3AZGA 3C1CA 1P3LA 2FJ7B 5AVBD 3AZKB 2CV5B 4XZQC 5BS7A 3KUYD 2AROB 5AY8B 1KX4B 4X23B 1EQZB 2FJ7C 1JFIA 3MGRD 3AZLD 5FUGA 3REJB 2F8NA 5GT3B 2CV5C 1KX5D 1KX3A 1M18A 3X1VB 3B0BA 2AROC 5BNXA 1P3OA 5AY8C 1KX4C 4X23C 1EQZC 5E5AA 1N1JB 3UTAD 4J8WB 3NQUB 1P3MD 3C1CD 1ZLAA 3O62B 3REJC 1H3OA 5GT3C 3REIC 5B32G 3AZEC 5AV8A 4YM6A 4DRAA 5GT0C 4YS3A 5GXQA 1M19B 3X1VC 2PYOB 1BH9B 3B6GA 4H9QB 3AZIA 1P3KB 4J8WC 3W97B 3TU4B 1M1AB 3O62C 5F99A 5BO0A 5B32A 1F66C 1BFMA 5GSUA 5CPJD 3AZHB 5B0ZA 4LD9B 1M19C 1P34A 1KX3D 5DNMD 4ZUXA 1M18D 2PYOC 4J8XD 5B1LA 1P3OD 4H9NB 1P3KC 3W97C 3KSYA 1M1AC 3AV1B 5E5AD 4NE5A 4Z2MH 1P3FB 1U35B 1P3GB 3AFAB 4YM6D 3MVDA 4WZSB 5CPIB 3AV1C 5B2IA 3AZID 3AZJB 5B32D 1P3GC 1P3FC 5AV9D 5GSUD 1AOIB 3AFAC 2HIOD 3WKJB 2YFVA 5B40B 1WWIA 3R45B 1P34D 4ZUXD 3AZNA 2BYMA 5CPIC 5B31B 2IO5B 3MGPA 4KGCB 2NZDB 2NQBA 1AOIC 3LZ1A 3UT9D 2YFWB 4M6BA 3WTPA 3WKJC 1TZYA 5G49B
chains in the Genus database with same CATH superfamily
4QLCC 2XD5A 3MNNB 5JA4A 5B40C 1P3IA 3VH5T 3AV2C 5B31C 4H9SC 4UUZB 3RELA 4KGCC 5AVCA 2NZDC 5DNNB 4WU8B 3B6FC 5B2JA 1P3PB 1ID3B 4J8VD 3AZMA 2L5AA 3MNNC 4E44A 2BG1A 2G5IC 3MGPD 3W96B 3FDDA 5DNNC 3MGSA 4WU8C 1HQ3C 3C1BA 1ID3C 5JRGB 4JJND 5AV5C 3WTPD 1TZYD 2LY8A 3X1TC 3X1UB 1P3ID 5B0YA 3W98D 4G91B 3W96C 3WAAA 5AVBB 1P3AA 5AVCD 2ZY3A 5JRGC 3KUYB 5B2JD 5BT1C 5C3IB 5CP6A 4R8PA 3AZMD 4H9RB 3X1UC 4J8UA 2ZM5A 4KUDA 4G91C 5B1MA 5KDMA 5AV6C 4XUJA 5AVBC 3MGRB 2BYKA 3REKC 3AZLB 3VH6A 3KWQD 1KX5B 3MGSD 4WU9A 1P3BD 3C1BD 3WA9A 3KXBA 3EG5B 4Z5TC 4Z66D 3W99D 3VH6T 3REHD 3LELD 3AN2A 5B24A 3UTAB 1P3MB 3MGRC 3C1CB 3LZ0A 3AYWC 1P3AD 4CAYA 3X1SD 4AWLB 3MGQC 2Y2IA 2F8NG 4R8PD 5CP6D 4J8UD 1HTAA 1P3MC 1F1EA 3B0CT 4KUDD 5B1MD 4XUJD 5CPJB 4WJ3C 3AZKC 3VH6W 4XZQA 3UTBA 4CSRA 4KHAA 1KX3B 5DNMB 1M18B 3WA9D 2ZY5A 4J8XB 3V9RA 3AZFD 3EPKA 5BNXB 1P3OB 1TAFB 5E5AB 1BH8B 4H9PB 5B24D 2FJ7A 1PZRA 5CPJC 3AZGD 1P3LD 2CV5A 5DNMC 4YM6B 4J8XC 1P3OC 2AROA 1KX4A 4X23A 5CPKA 1EQZA 3AZIB 1B67A 3B0DB 5B32B 1S32A 5AV9B 5GSUB 3REJA 3REIA 2HIOB 3AZEA 4YM6C 5GT0A 2F8ND 3UTBD 3X1VA 1P34B 4ZUXB 1N1JA 4J8WA 3NQUA 3TU4C 3B0DC 1F66A 5AV9C 5GSUC 1ZLAD 3UT9B 2HIOC 3AZHC 3A6NA 4LD9C 1M19A 3LJAA 2PYOA 4ZUXC 5AV8D 4YS3D 5GXQD 1P3KA 5CPKD 1M1AA 3B6GD 3UT9C 5F99D 1WWSA 1S32D 1U35C 4NE3A 4EO5B 4J8VB 5BNVB 3REID 2UWXA 3AZED 5B0ZD 5GT0D 2Y2OA 2YFVB 2BYMB 3AV1A 5B1LD 3MGPB 1Q9CA 3AZJC 1F66D 3VH5A 5B33A 1P3GA 4J8VC 4JJNB 2F8NK 3AFAA 3WTPB 1TZYB 3A6ND 3LJAD 1A7WA 3W98B 1P3IB 2G5HC 5CPIA 3MVDD 3RELB 2IO5C 5AVCB 5B2ID 1W2EA 1AOIA 4JJNC 4WNNB 5B2JB 3WTPC 2Y2MA 3MGQA 3WKJA 4QLCA 3AZMB 5B40A 3W98C 1P3IC 3AV2A 2CWEA 2Y2KA 3AZND 2RVQC 3KWQB 2Y2HA 3VH5W 3MGSB 2YFWA 5B33D 3C1BB 1P3BB 1P3PC 2NQBD 3B6FA 3MNNA 3LZ1D 4Z66B 2Y2PA 3W99B 2Y2NA 3REHB 3LELB 4UUZA 4H9OA 3KWQC 3RELD 1P3AB 2ZY2A 4WU8A 1P3BC 3X1SB 1HQ3A 5AV5A 4Z66C 3MGQD 3W99C 5CP6B 4R8PB 4QLCD 3REHC 3X1TA 3LELC 4J8UB 4KUDB 5B1MB 3AV2D 3W96A 5KDMB 4XUJB 2F2AC 3WTPE 1KU5A 1Z2CB 2Y2LA 1P3AC 3X1SC 5JRGA 3KUYC 4HGAB 3B6FD 3WA9B 5CP6C 5C3IC 3AZFB 4ZBJB 3X1UA 4J8UC 4E45A 5B1MC 5B24B 5B0YD 5AV6A 3REKA 3AZGB 3AZLC 1P3LB 3WAAD 1KX5C 4HGAC 1HQ3D 4NE6A 3AZFC 4ZBJC 4H9RA 5AV5D 4Z5TA 3X1TD 5B24C 3UTAC 3AZGC 3C1CC 4Z2MG 1P3LC 3AYWA 1JFIB 5CHLB 5FUGB 2F8NB 3UTBB 5BS7C 4AWLC 4KHAB 4WU9D 3NQJA 3V9RB 3KXBD 1P3MA 3AN2D 5AV6D 2HUEB 3REKD 1ZLAB 3AZKA 3LZ0D 1H3OB 3UTBC 3B0CW 1KX3C 5AV8B 1M18C 4YS3B 5GXQB 4NFTA 4Z5TD 5AY8A 5CPKB 5E5AC 3B6GB 2HUEC 5CPJA 1ZLAC 2J8PA 5F99B 5BO0B 1S32B 2VQRA 3AYWD 5GT3A 3REIB 4G92B 5DNMA 3AZEB 5B0ZB 5AV8C 5GT0B 4YS3C 5GXQC 4XZQD 4J8XA 5CPKC 1TAFA 1BH8A 4H9PA 5B1LB 3AZIC 3B6GC 5F99C 3O62A 5B32C 1S32C 1F66B 2FJ7D 3AZKD 3F6TA 4G92C 5B0ZC 3A6NB 2CV5D 3LJAB 1P34C 1B6WA 1BH9A 3MVDB 5B1LC 2AROD 4H9QA 5AY8D 1KX4D 2FFFB 3W97A 4DRBA 4X23D 3TU4A 1EQZD 5B2IB 5AV9A 2HIOA 2JE5A 3A6NC 3AZHA 4LD9A 3REJD 5GT3D 3LJAC 1R4VA 3MVDC 3H0RC 2F8NH 3X1VD 2W8SA 4H9NA 3AZNB 2JSSA 5B2IC 1ULYA 4J8WD 3UT9A 3O62D 5B33B 1P3FA 1U35A 2NQBB 4EO5C 3LZ1B 1M19D 4WV4B 5JA4B 2PYOD 3AZNC 3MGPC 1P3KD 3W97D 3AZJA 3P5JB 3TU4D 1M1AD 5B31G 5B33C 2NQBC 4J8VA 5BNVA 3LZ1C 3MGQB 3AZHD 4LD9D 1TZYC 3A1KA 4QLCB 3R45A 2DQNC 3AV2B 5B31A 4H9SA 3RELC 4KGCA 5AVCC 3AV1D 2NZDA 4JJNA 3B6FB 1P3FD 5B2JC 1U35D 1P3GD 5G49A 3AZMC 3W98A 3AFAD 2JCHA 5B0YB 4H9OB 5CPID 3WAAB 3AZJD 3MGSC 5DNNA 4WNNA 1HQ3B 3C1BC 1P3PA 1ID3A 1AOID 5AV5B 3EPJA 3WKJD 3X1TB 5B40D 5B0YC 2DF4C 3WAAC 5B31D 3KWQA 4KGCD 2BYKB 2Y2JA 1P3BA 2NZDD 4WU9B 4Z66A 3W99A 4R8PC 3REHA 3LELA 3MNND 3KXBB 4KUDC 3AN2B 5AV6B 4XUJC 5AVBA 3REKB 4UPKA 3LZ0B 2RVQD 3X1SA 4CAYB 3KUYA 5DNND 4WU9C 4WU8D 3WA9C 1P3PD 1ID3D 3KXBC 4Z5TB 3AN2C 3MGRA 3AZLA 3KFUG 3LZ0C 3AYWB 3W96D 3EPHA 1KX5A 2ZY4A 3H0MC 4XZQB 3AZFA 4CSRB 5JRGD 1T3UA 3NQJB 5BT1D 3X1UD 3UTAA 3AZGA 3C1CA 1P3LA 2FJ7B 3IP4C 5AVBD 3AZKB 2CV5B 4XZQC 5BS7A 3AL0C 3KUYD 2AROB 5AY8B 1KX4B 4X23B 1EQZB 2FJ7C 1JFIA 3MGRD 3AZLD 5FUGA 3REJB 2F8NA 5GT3B 2CV5C 1KX5D 1KX3A 1M18A 3X1VB 3B0BA 2AROC 5BNXA 1P3OA 5AY8C 1KX4C 4X23C 1EQZC 5E5AA 1N1JB 3UTAD 4J8WB 3NQUB 1P3MD 3C1CD 1ZLAA 3O62B 4DQYB 3REJC 1H3OA 5GT3C 3REIC 5B32G 3AZEC 5AV8A 4YM6A 4DRAA 5GT0C 4YS3A 5GXQA 1M19B 3X1VC 2PYOB 1BH9B 3B6GA 4H9QB 3AZIA 1P3KB 4J8WC 3W97B 3TU4B 1M1AB 3O62C 5F99A 5BO0A 5B32A 1F66C 1BFMA 5GSUA 5CPJD 3AZHB 5B0ZA 4LD9B 1M19C 2Y2GA 1P34A 1KX3D 5DNMD 4ZUXA 1M18D 2PYOC 4J8XD 5B1LA 1P3OD 4H9NB 1P3KC 3W97C 3KSYA 1M1AC 3AV1B 5E5AD 4NE5A 4Z2MH 2Y2QA 1P3FB 1U35B 1P3GB 3A1IA 3AFAB 4YM6D 3MVDA 4WZSB 3H0LC 5CPIB 3AV1C 5B2IA 3AZID 3AZJB 5B32D 1P3GC 1P3FC 2XD1A 5AV9D 5GSUD 2RIQA 1AOIB 3AFAC 2HIOD 3WKJB 2YFVA 5B40B 1WWIA 3R45B 1P34D 4ZUXD 3AZNA 2BYMA 5CPIC 5B31B 2IO5B 3MGPA 4KGCB 2NZDB 2NQBA 3EPLA 1AOIC 3LZ1A 3UT9D 2YFWB 4M6BA 3WTPA 3WKJC 1TZYA 5G49B
chains in the Genus database with same CATH topology
4QLCC 2XD5A 3MNNB 5JA4A 5B40C 1P3IA 3VH5T 3AV2C 5B31C 4H9SC 4UUZB 3RELA 4KGCC 5AVCA 2NZDC 5DNNB 4WU8B 3B6FC 5B2JA 1P3PB 1ID3B 4J8VD 3AZMA 2L5AA 3MNNC 4E44A 2BG1A 2G5IC 3MGPD 3W96B 3FDDA 5DNNC 3MGSA 4WU8C 1HQ3C 3C1BA 1ID3C 5JRGB 4JJND 5AV5C 3WTPD 1TZYD 2LY8A 3X1TC 3X1UB 1P3ID 5B0YA 3W98D 4G91B 3W96C 3WAAA 5AVBB 1P3AA 5AVCD 2ZY3A 5JRGC 3KUYB 5B2JD 5BT1C 5C3IB 5CP6A 4R8PA 3AZMD 4H9RB 3X1UC 4J8UA 2ZM5A 4KUDA 4G91C 5B1MA 5KDMA 5AV6C 4XUJA 5AVBC 3MGRB 2BYKA 3REKC 3AZLB 3VH6A 3KWQD 1KX5B 3MGSD 4WU9A 1P3BD 3C1BD 3WA9A 3KXBA 3EG5B 4Z5TC 4Z66D 3W99D 3VH6T 3REHD 3LELD 3AN2A 5B24A 3UTAB 1P3MB 3MGRC 3C1CB 3LZ0A 3AYWC 1P3AD 4CAYA 3X1SD 4AWLB 3MGQC 2Y2IA 2F8NG 4R8PD 5CP6D 4J8UD 1HTAA 1P3MC 1F1EA 3B0CT 4KUDD 5B1MD 4XUJD 5CPJB 4WJ3C 3AZKC 3VH6W 4XZQA 3UTBA 4CSRA 4KHAA 1KX3B 5DNMB 1M18B 3WA9D 2ZY5A 4J8XB 3V9RA 3AZFD 3EPKA 5BNXB 1P3OB 1TAFB 5E5AB 1BH8B 4H9PB 5B24D 2FJ7A 1PZRA 5CPJC 3AZGD 1P3LD 2CV5A 5DNMC 4YM6B 4J8XC 1P3OC 2AROA 1KX4A 4X23A 5CPKA 1EQZA 3AZIB 1B67A 3B0DB 5B32B 1S32A 5AV9B 5GSUB 3REJA 3REIA 2HIOB 3AZEA 4YM6C 5GT0A 2F8ND 3UTBD 3X1VA 1P34B 4ZUXB 1N1JA 4J8WA 3NQUA 3TU4C 3B0DC 1F66A 5AV9C 5GSUC 1ZLAD 3UT9B 2HIOC 3AZHC 3A6NA 4LD9C 1M19A 3LJAA 2PYOA 4ZUXC 5AV8D 4YS3D 5GXQD 1P3KA 5CPKD 1M1AA 3B6GD 3UT9C 5F99D 1WWSA 1S32D 1U35C 4NE3A 4EO5B 4J8VB 5BNVB 3REID 2UWXA 3AZED 5B0ZD 5GT0D 2Y2OA 2YFVB 2BYMB 3AV1A 5B1LD 3MGPB 1Q9CA 3AZJC 1F66D 3VH5A 5B33A 1P3GA 4J8VC 4JJNB 2F8NK 3AFAA 3WTPB 1TZYB 3A6ND 3LJAD 1A7WA 3W98B 1P3IB 2G5HC 5CPIA 3MVDD 3RELB 2IO5C 5AVCB 5B2ID 1W2EA 1AOIA 4JJNC 4WNNB 5B2JB 3WTPC 2Y2MA 3MGQA 3WKJA 4QLCA 3AZMB 5B40A 3W98C 1P3IC 3AV2A 2CWEA 2Y2KA 3AZND 2RVQC 3KWQB 2Y2HA 3VH5W 3MGSB 2YFWA 5B33D 3C1BB 1P3BB 1P3PC 2NQBD 3B6FA 3MNNA 3LZ1D 4Z66B 2Y2PA 3W99B 2Y2NA 3REHB 3LELB 4UUZA 4H9OA 3KWQC 3RELD 1P3AB 2ZY2A 4WU8A 1P3BC 3X1SB 1HQ3A 5AV5A 4Z66C 3MGQD 3W99C 5CP6B 4R8PB 4QLCD 3REHC 3X1TA 3LELC 4J8UB 4KUDB 5B1MB 3AV2D 3W96A 5KDMB 4XUJB 2F2AC 3WTPE 1KU5A 1Z2CB 2Y2LA 1P3AC 3X1SC 5JRGA 3KUYC 4HGAB 3B6FD 3WA9B 5CP6C 5C3IC 3AZFB 4ZBJB 3X1UA 4J8UC 4E45A 5B1MC 5B24B 5B0YD 5AV6A 3REKA 3AZGB 3AZLC 1P3LB 3WAAD 1KX5C 4HGAC 1HQ3D 4NE6A 3AZFC 4ZBJC 4H9RA 5AV5D 4Z5TA 3X1TD 5B24C 3UTAC 3AZGC 3C1CC 4Z2MG 1P3LC 3AYWA 1JFIB 5CHLB 5FUGB 2F8NB 3UTBB 5BS7C 4AWLC 4KHAB 4WU9D 3NQJA 3V9RB 3KXBD 1P3MA 3AN2D 5AV6D 2HUEB 3REKD 1ZLAB 3AZKA 3LZ0D 1H3OB 3UTBC 3B0CW 1KX3C 5AV8B 1M18C 4YS3B 5GXQB 4NFTA 4Z5TD 5AY8A 5CPKB 5E5AC 3B6GB 2HUEC 5CPJA 1ZLAC 2J8PA 5F99B 5BO0B 1S32B 2VQRA 3AYWD 5GT3A 3REIB 4G92B 5DNMA 3AZEB 5B0ZB 5AV8C 5GT0B 4YS3C 5GXQC 4XZQD 4J8XA 5CPKC 1TAFA 1BH8A 4H9PA 5B1LB 3AZIC 3B6GC 5F99C 3O62A 5B32C 1S32C 1F66B 2FJ7D 3AZKD 3F6TA 4G92C 5B0ZC 3A6NB 2CV5D 3LJAB 1P34C 1B6WA 1BH9A 3MVDB 5B1LC 2AROD 4H9QA 5AY8D 1KX4D 2FFFB 3W97A 4DRBA 4X23D 3TU4A 1EQZD 5B2IB 5AV9A 2HIOA 2JE5A 3A6NC 3AZHA 4LD9A 3REJD 5GT3D 3LJAC 1R4VA 3MVDC 3H0RC 2F8NH 3X1VD 2W8SA 4H9NA 3AZNB 2JSSA 5B2IC 1ULYA 4J8WD 3UT9A 3O62D 5B33B 1P3FA 1U35A 2NQBB 4EO5C 3LZ1B 1M19D 4WV4B 5JA4B 2PYOD 3AZNC 3MGPC 1P3KD 3W97D 3AZJA 3P5JB 3TU4D 1M1AD 5B31G 5B33C 2NQBC 4J8VA 5BNVA 3LZ1C 3MGQB 3AZHD 4LD9D 1TZYC 3A1KA 4QLCB 3R45A 2DQNC 3AV2B 5B31A 4H9SA 3RELC 4KGCA 5AVCC 3AV1D 2NZDA 4JJNA 3B6FB 1P3FD 5B2JC 1U35D 1P3GD 5G49A 3AZMC 3W98A 3AFAD 2JCHA 5B0YB 4H9OB 5CPID 3WAAB 3AZJD 3MGSC 5DNNA 4WNNA 1HQ3B 3C1BC 1P3PA 1ID3A 1AOID 5AV5B 3EPJA 3WKJD 3X1TB 5B40D 5B0YC 2DF4C 3WAAC 5B31D 3KWQA 4KGCD 2BYKB 2Y2JA 1P3BA 2NZDD 4WU9B 4Z66A 3W99A 4R8PC 3REHA 3LELA 3MNND 3KXBB 4KUDC 3AN2B 5AV6B 4XUJC 5AVBA 3REKB 4UPKA 3LZ0B 2RVQD 3X1SA 4CAYB 3KUYA 5DNND 4WU9C 4WU8D 3WA9C 1P3PD 1ID3D 3KXBC 4Z5TB 3AN2C 3MGRA 3AZLA 3KFUG 3LZ0C 3AYWB 3W96D 3EPHA 1KX5A 2ZY4A 3H0MC 4XZQB 3AZFA 4CSRB 5JRGD 1T3UA 3NQJB 5BT1D 3X1UD 3UTAA 3AZGA 3C1CA 1P3LA 2FJ7B 3IP4C 5AVBD 3AZKB 2CV5B 4XZQC 5BS7A 3AL0C 3KUYD 2AROB 5AY8B 1KX4B 4X23B 1EQZB 2FJ7C 1JFIA 3MGRD 3AZLD 5FUGA 3REJB 2F8NA 5GT3B 2CV5C 1KX5D 1KX3A 1M18A 3X1VB 3B0BA 2AROC 5BNXA 1P3OA 5AY8C 1KX4C 4X23C 1EQZC 5E5AA 1N1JB 3UTAD 4J8WB 3NQUB 1P3MD 3C1CD 1ZLAA 3O62B 4DQYB 3REJC 1H3OA 5GT3C 3REIC 5B32G 3AZEC 5AV8A 4YM6A 4DRAA 5GT0C 4YS3A 5GXQA 1M19B 3X1VC 2PYOB 1BH9B 3B6GA 4H9QB 3AZIA 1P3KB 4J8WC 3W97B 3TU4B 1M1AB 3O62C 5F99A 5BO0A 5B32A 1F66C 1BFMA 5GSUA 5CPJD 3AZHB 5B0ZA 4LD9B 1M19C 2Y2GA 1P34A 1KX3D 5DNMD 4ZUXA 1M18D 2PYOC 4J8XD 5B1LA 1P3OD 4H9NB 1P3KC 3W97C 3KSYA 1M1AC 3AV1B 5E5AD 4NE5A 4Z2MH 2Y2QA 1P3FB 1U35B 1P3GB 3A1IA 3AFAB 4YM6D 3MVDA 4WZSB 3H0LC 5CPIB 3AV1C 5B2IA 3AZID 3AZJB 5B32D 1P3GC 1P3FC 2XD1A 5AV9D 5GSUD 2RIQA 1AOIB 3AFAC 2HIOD 3WKJB 2YFVA 5B40B 1WWIA 3R45B 1P34D 4ZUXD 3AZNA 2BYMA 5CPIC 5B31B 2IO5B 3MGPA 4KGCB 2NZDB 2NQBA 3EPLA 1AOIC 3LZ1A 3UT9D 2YFWB 4M6BA 3WTPA 3WKJC 1TZYA 5G49B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QLC C;  5B40 C;  3MNN B;  5JA4 A;  1P3I A;  3VH5 T;  3AV2 C;  5B31 C;  4H9S C;  4UUZ B;  3REL A;  4KGC C;  5AVC A;  2NZD C;  5DNN B;  4WU8 B;  3B6F C;  5B2J A;  1P3P B;  1ID3 B;  4J8V D;  3AZM A;  2L5A A;  3MNN C;  4E44 A;  3MGP D;  3W96 B;  5DNN C;  3MGS A;  4WU8 C;  1HQ3 C;  3C1B A;  1ID3 C;  5JRG B;  4JJN D;  5AV5 C;  3WTP D;  1TZY D;  2LY8 A;  3X1T C;  3X1U B;  1P3I D;  5B0Y A;  3W98 D;  4G91 B;  3W96 C;  3WAA A;  5AVB B;  1P3A A;  5AVC D;  5JRG C;  3KUY B;  5B2J D;  5BT1 C;  5C3I B;  5CP6 A;  4R8P A;  3AZM D;  4H9R B;  3X1U C;  4J8U A;  4KUD A;  4G91 C;  5B1M A;  5KDM A;  5AV6 C;  4XUJ A;  5AVB C;  3MGR B;  2BYK A;  3REK C;  3AZL B;  3VH6 A;  3KWQ D;  1KX5 B;  3MGS D;  4WU9 A;  1P3B D;  3C1B D;  3WA9 A;  3KXB A;  4Z5T C;  4Z66 D;  3W99 D;  3VH6 T;  3REH D;  3LEL D;  3AN2 A;  5B24 A;  3UTA B;  1P3M B;  3MGR C;  3C1C B;  3LZ0 A;  3AYW C;  1P3A D;  4CAY A;  3X1S D;  4AWL B;  3MGQ C;  2F8N G;  4R8P D;  5CP6 D;  4J8U D;  1HTA A;  1P3M C;  1F1E A;  3B0C T;  4KUD D;  5B1M D;  4XUJ D;  5CPJ B;  3AZK C;  3VH6 W;  4XZQ A;  3UTB A;  4CSR A;  4KHA A;  1KX3 B;  5DNM B;  1M18 B;  3WA9 D;  4J8X B;  3V9R A;  3AZF D;  1P3O B;  5BNX B;  1TAF B;  5E5A B;  1BH8 B;  4H9P B;  5B24 D;  2FJ7 A;  5CPJ C;  3AZG D;  1P3L D;  2CV5 A;  5DNM C;  4YM6 B;  4J8X C;  1P3O C;  2ARO A;  1KX4 A;  4X23 A;  5CPK A;  1EQZ A;  3AZI B;  1B67 A;  3B0D B;  5B32 B;  1S32 A;  5AV9 B;  5GSU B;  3REJ A;  3REI A;  2HIO B;  3AZE A;  4YM6 C;  5GT0 A;  2F8N D;  3UTB D;  3X1V A;  1P34 B;  4ZUX B;  1N1J A;  4J8W A;  3NQU A;  3TU4 C;  3B0D C;  1F66 A;  5AV9 C;  5GSU C;  1ZLA D;  3UT9 B;  2HIO C;  3AZH C;  3A6N A;  4LD9 C;  1M19 A;  3LJA A;  2PYO A;  4ZUX C;  5AV8 D;  4YS3 D;  5GXQ D;  1P3K A;  5CPK D;  1M1A A;  3B6G D;  3UT9 C;  5F99 D;  1WWS A;  1S32 D;  1U35 C;  4NE3 A;  4EO5 B;  4J8V B;  5BNV B;  3REI D;  3AZE D;  5B0Z D;  5GT0 D;  2YFV B;  2BYM B;  3AV1 A;  5B1L D;  3MGP B;  1Q9C A;  3AZJ C;  1F66 D;  3VH5 A;  5B33 A;  1P3G A;  4J8V C;  4JJN B;  2F8N K;  3AFA A;  3WTP B;  1TZY B;  3A6N D;  3LJA D;  1A7W A;  3W98 B;  1P3I B;  5CPI A;  3MVD D;  3REL B;  2IO5 C;  5AVC B;  5B2I D;  1AOI A;  4JJN C;  4WNN B;  5B2J B;  3WTP C;  3MGQ A;  3WKJ A;  4QLC A;  3AZM B;  5B40 A;  3W98 C;  1P3I C;  3AV2 A;  2CWE A;  3AZN D;  2RVQ C;  3KWQ B;  3VH5 W;  3MGS B;  2YFW A;  5B33 D;  3C1B B;  1P3B B;  1P3P C;  2NQB D;  3B6F A;  3MNN A;  3LZ1 D;  4Z66 B;  3W99 B;  3REH B;  3LEL B;  4UUZ A;  4H9O A;  3KWQ C;  3REL D;  1P3A B;  4WU8 A;  1P3B C;  3X1S B;  1HQ3 A;  5AV5 A;  4Z66 C;  3MGQ D;  4R8P B;  5CP6 B;  3W99 C;  4QLC D;  3REH C;  3X1T A;  3LEL C;  4J8U B;  4KUD B;  5B1M B;  3AV2 D;  3W96 A;  5KDM B;  4XUJ B;  1P3A C;  3WTP E;  1KU5 A;  3X1S C;  5JRG A;  3KUY C;  4HGA B;  3B6F D;  3WA9 B;  5CP6 C;  5C3I C;  3AZF B;  4ZBJ B;  3X1U A;  4J8U C;  4E45 A;  5B1M C;  5B24 B;  5B0Y D;  5AV6 A;  3REK A;  3AZG B;  3AZL C;  1P3L B;  3WAA D;  1KX5 C;  4HGA C;  1HQ3 D;  4NE6 A;  3AZF C;  4ZBJ C;  4H9R A;  5AV5 D;  4Z5T A;  3X1T D;  5B24 C;  3UTA C;  3AZG C;  3C1C C;  4Z2M G;  1P3L C;  3AYW A;  1JFI B;  5CHL B;  5FUG B;  2F8N B;  3UTB B;  5BS7 C;  4AWL C;  4KHA B;  4WU9 D;  3NQJ A;  3V9R B;  3KXB D;  1P3M A;  3AN2 D;  5AV6 D;  2HUE B;  3REK D;  1ZLA B;  3AZK A;  3LZ0 D;  1H3O B;  3UTB C;  3B0C W;  1KX3 C;  5AV8 B;  1M18 C;  4YS3 B;  5GXQ B;  4NFT A;  4Z5T D;  5AY8 A;  5CPK B;  5E5A C;  3B6G B;  2HUE C;  5CPJ A;  1ZLA C;  5F99 B;  5BO0 B;  1S32 B;  3AYW D;  5GT3 A;  3REI B;  4G92 B;  5DNM A;  3AZE B;  5B0Z B;  5AV8 C;  5GT0 B;  4YS3 C;  5GXQ C;  4XZQ D;  4J8X A;  5CPK C;  1TAF A;  1BH8 A;  4H9P A;  5B1L B;  3AZI C;  3B6G C;  5F99 C;  3O62 A;  5B32 C;  1S32 C;  1F66 B;  2FJ7 D;  3AZK D;  4G92 C;  5B0Z C;  3A6N B;  2CV5 D;  3LJA B;  1P34 C;  1B6W A;  1BH9 A;  3MVD B;  5B1L C;  2ARO D;  4H9Q A;  5AY8 D;  1KX4 D;  3W97 A;  4DRB A;  4X23 D;  3TU4 A;  1EQZ D;  5B2I B;  5AV9 A;  2HIO A;  3A6N C;  3AZH A;  4LD9 A;  3REJ D;  5GT3 D;  3LJA C;  1R4V A;  3MVD C;  2F8N H;  3X1V D;  4H9N A;  3AZN B;  2JSS A;  5B2I C;  1ULY A;  4J8W D;  3UT9 A;  3O62 D;  5B33 B;  1P3F A;  1U35 A;  2NQB B;  4EO5 C;  3LZ1 B;  1M19 D;  4WV4 B;  5JA4 B;  2PYO D;  3AZN C;  3MGP C;  1P3K D;  3W97 D;  3AZJ A;  3TU4 D;  1M1A D;  5B31 G;  5B33 C;  2NQB C;  4J8V A;  5BNV A;  3LZ1 C;  3MGQ B;  3AZH D;  4LD9 D;  1TZY C;  4QLC B;  3R45 A;  3AV2 B;  5B31 A;  4H9S A;  3REL C;  4KGC A;  5AVC C;  3AV1 D;  2NZD A;  4JJN A;  3B6F B;  1P3F D;  5B2J C;  1U35 D;  1P3G D;  5G49 A;  3AZM C;  3W98 A;  3AFA D;  5B0Y B;  4H9O B;  5CPI D;  3WAA B;  3AZJ D;  3MGS C;  5DNN A;  4WNN A;  1HQ3 B;  3C1B C;  1P3P A;  1ID3 A;  1AOI D;  5AV5 B;  3WKJ D;  3X1T B;  5B40 D;  5B0Y C;  3WAA C;  5B31 D;  3KWQ A;  4KGC D;  2BYK B;  1P3B A;  2NZD D;  4WU9 B;  4Z66 A;  3W99 A;  4R8P C;  3REH A;  3LEL A;  3MNN D;  3KXB B;  4KUD C;  3AN2 B;  5AV6 B;  4XUJ C;  5AVB A;  3REK B;  3LZ0 B;  2RVQ D;  3X1S A;  4CAY B;  3KUY A;  5DNN D;  4WU9 C;  4WU8 D;  3WA9 C;  1P3P D;  1ID3 D;  3KXB C;  4Z5T B;  3AN2 C;  3MGR A;  3AZL A;  3LZ0 C;  3AYW B;  3W96 D;  1KX5 A;  4XZQ B;  3AZF A;  4CSR B;  5JRG D;  3NQJ B;  5BT1 D;  3X1U D;  3UTA A;  3AZG A;  3C1C A;  1P3L A;  2FJ7 B;  5AVB D;  3AZK B;  2CV5 B;  4XZQ C;  5BS7 A;  3KUY D;  2ARO B;  5AY8 B;  1KX4 B;  4X23 B;  1EQZ B;  2FJ7 C;  1JFI A;  3MGR D;  3AZL D;  5FUG A;  3REJ B;  2F8N A;  5GT3 B;  2CV5 C;  1KX5 D;  1KX3 A;  1M18 A;  3X1V B;  3B0B A;  2ARO C;  5BNX A;  1P3O A;  5AY8 C;  1KX4 C;  4X23 C;  1EQZ C;  5E5A A;  1N1J B;  3UTA D;  4J8W B;  3NQU B;  1P3M D;  3C1C D;  1ZLA A;  3O62 B;  3REJ C;  1H3O A;  5GT3 C;  3REI C;  5B32 G;  3AZE C;  5AV8 A;  4YM6 A;  4DRA A;  5GT0 C;  4YS3 A;  5GXQ A;  1M19 B;  3X1V C;  2PYO B;  1BH9 B;  3B6G A;  4H9Q B;  3AZI A;  1P3K B;  4J8W C;  3W97 B;  3TU4 B;  1M1A B;  3O62 C;  5F99 A;  5BO0 A;  5B32 A;  1F66 C;  1BFM A;  5GSU A;  5CPJ D;  3AZH B;  5B0Z A;  4LD9 B;  1M19 C;  1P34 A;  1KX3 D;  5DNM D;  4ZUX A;  1M18 D;  2PYO C;  4J8X D;  5B1L A;  1P3O D;  4H9N B;  1P3K C;  3W97 C;  3KSY A;  1M1A C;  3AV1 B;  5E5A D;  4NE5 A;  4Z2M H;  1P3F B;  1U35 B;  1P3G B;  3AFA B;  4YM6 D;  3MVD A;  4WZS B;  5CPI B;  3AV1 C;  5B2I A;  3AZI D;  3AZJ B;  5B32 D;  1P3G C;  1P3F C;  5AV9 D;  5GSU D;  1AOI B;  3AFA C;  2HIO D;  3WKJ B;  2YFV A;  5B40 B;  1WWI A;  3R45 B;  1P34 D;  4ZUX D;  3AZN A;  2BYM A;  5CPI C;  5B31 B;  2IO5 B;  3MGP A;  4KGC B;  2NZD B;  2NQB A;  1AOI C;  3LZ1 A;  3UT9 D;  2YFW B;  4M6B A;  3WTP A;  3WKJ C;  1TZY A;  5G49 B; 
#chains in the Genus database with same CATH topology
 4QLC C;  2XD5 A;  3MNN B;  5JA4 A;  5B40 C;  1P3I A;  3VH5 T;  3AV2 C;  5B31 C;  4H9S C;  4UUZ B;  3REL A;  4KGC C;  5AVC A;  2NZD C;  5DNN B;  4WU8 B;  3B6F C;  5B2J A;  1P3P B;  1ID3 B;  4J8V D;  3AZM A;  2L5A A;  3MNN C;  4E44 A;  2BG1 A;  2G5I C;  3MGP D;  3W96 B;  3FDD A;  5DNN C;  3MGS A;  4WU8 C;  1HQ3 C;  3C1B A;  1ID3 C;  5JRG B;  4JJN D;  5AV5 C;  3WTP D;  1TZY D;  2LY8 A;  3X1T C;  3X1U B;  1P3I D;  5B0Y A;  3W98 D;  4G91 B;  3W96 C;  3WAA A;  5AVB B;  1P3A A;  5AVC D;  2ZY3 A;  5JRG C;  3KUY B;  5B2J D;  5BT1 C;  5C3I B;  5CP6 A;  4R8P A;  3AZM D;  4H9R B;  3X1U C;  4J8U A;  2ZM5 A;  4KUD A;  4G91 C;  5B1M A;  5KDM A;  5AV6 C;  4XUJ A;  5AVB C;  3MGR B;  2BYK A;  3REK C;  3AZL B;  3VH6 A;  3KWQ D;  1KX5 B;  3MGS D;  4WU9 A;  1P3B D;  3C1B D;  3WA9 A;  3KXB A;  3EG5 B;  4Z5T C;  4Z66 D;  3W99 D;  3VH6 T;  3REH D;  3LEL D;  3AN2 A;  5B24 A;  3UTA B;  1P3M B;  3MGR C;  3C1C B;  3LZ0 A;  3AYW C;  1P3A D;  4CAY A;  3X1S D;  4AWL B;  3MGQ C;  2Y2I A;  2F8N G;  4R8P D;  5CP6 D;  4J8U D;  1HTA A;  1P3M C;  1F1E A;  3B0C T;  4KUD D;  5B1M D;  4XUJ D;  5CPJ B;  4WJ3 C;  3AZK C;  3VH6 W;  4XZQ A;  3UTB A;  4CSR A;  4KHA A;  1KX3 B;  5DNM B;  1M18 B;  3WA9 D;  2ZY5 A;  4J8X B;  3V9R A;  3AZF D;  3EPK A;  5BNX B;  1P3O B;  1TAF B;  5E5A B;  1BH8 B;  4H9P B;  5B24 D;  2FJ7 A;  1PZR A;  5CPJ C;  3AZG D;  1P3L D;  2CV5 A;  5DNM C;  4YM6 B;  4J8X C;  1P3O C;  2ARO A;  1KX4 A;  4X23 A;  5CPK A;  1EQZ A;  3AZI B;  1B67 A;  3B0D B;  5B32 B;  1S32 A;  5AV9 B;  5GSU B;  3REJ A;  3REI A;  2HIO B;  3AZE A;  4YM6 C;  5GT0 A;  2F8N D;  3UTB D;  3X1V A;  1P34 B;  4ZUX B;  1N1J A;  4J8W A;  3NQU A;  3TU4 C;  3B0D C;  1F66 A;  5AV9 C;  5GSU C;  1ZLA D;  3UT9 B;  2HIO C;  3AZH C;  3A6N A;  4LD9 C;  1M19 A;  3LJA A;  2PYO A;  4ZUX C;  5AV8 D;  4YS3 D;  5GXQ D;  1P3K A;  5CPK D;  1M1A A;  3B6G D;  3UT9 C;  5F99 D;  1WWS A;  1S32 D;  1U35 C;  4NE3 A;  4EO5 B;  4J8V B;  5BNV B;  3REI D;  2UWX A;  3AZE D;  5B0Z D;  5GT0 D;  2Y2O A;  2YFV B;  2BYM B;  3AV1 A;  5B1L D;  3MGP B;  1Q9C A;  3AZJ C;  1F66 D;  3VH5 A;  5B33 A;  1P3G A;  4J8V C;  4JJN B;  2F8N K;  3AFA A;  3WTP B;  1TZY B;  3A6N D;  3LJA D;  1A7W A;  3W98 B;  1P3I B;  2G5H C;  5CPI A;  3MVD D;  3REL B;  2IO5 C;  5AVC B;  5B2I D;  1W2E A;  1AOI A;  4JJN C;  4WNN B;  5B2J B;  3WTP C;  2Y2M A;  3MGQ A;  3WKJ A;  4QLC A;  3AZM B;  5B40 A;  3W98 C;  1P3I C;  3AV2 A;  2CWE A;  2Y2K A;  3AZN D;  2RVQ C;  3KWQ B;  2Y2H A;  3VH5 W;  3MGS B;  2YFW A;  5B33 D;  3C1B B;  1P3B B;  1P3P C;  2NQB D;  3B6F A;  3MNN A;  3LZ1 D;  4Z66 B;  2Y2P A;  3W99 B;  2Y2N A;  3REH B;  3LEL B;  4UUZ A;  4H9O A;  3KWQ C;  3REL D;  1P3A B;  2ZY2 A;  4WU8 A;  1P3B C;  3X1S B;  1HQ3 A;  5AV5 A;  4Z66 C;  3MGQ D;  3W99 C;  5CP6 B;  4R8P B;  4QLC D;  3REH C;  3X1T A;  3LEL C;  4J8U B;  4KUD B;  5B1M B;  3AV2 D;  3W96 A;  5KDM B;  4XUJ B;  2F2A C;  3WTP E;  1KU5 A;  1Z2C B;  2Y2L A;  1P3A C;  3X1S C;  5JRG A;  3KUY C;  4HGA B;  3B6F D;  3WA9 B;  5CP6 C;  5C3I C;  3AZF B;  4ZBJ B;  3X1U A;  4J8U C;  4E45 A;  5B1M C;  5B24 B;  5B0Y D;  5AV6 A;  3REK A;  3AZG B;  3AZL C;  1P3L B;  3WAA D;  1KX5 C;  4HGA C;  1HQ3 D;  4NE6 A;  3AZF C;  4ZBJ C;  4H9R A;  5AV5 D;  4Z5T A;  3X1T D;  5B24 C;  3UTA C;  3AZG C;  3C1C C;  4Z2M G;  1P3L C;  3AYW A;  1JFI B;  5CHL B;  5FUG B;  2F8N B;  3UTB B;  5BS7 C;  4AWL C;  4KHA B;  4WU9 D;  3NQJ A;  3V9R B;  3KXB D;  1P3M A;  3AN2 D;  5AV6 D;  2HUE B;  3REK D;  1ZLA B;  3AZK A;  3LZ0 D;  1H3O B;  3UTB C;  3B0C W;  1KX3 C;  5AV8 B;  1M18 C;  4YS3 B;  5GXQ B;  4NFT A;  4Z5T D;  5AY8 A;  5CPK B;  5E5A C;  3B6G B;  2HUE C;  5CPJ A;  1ZLA C;  2J8P A;  5F99 B;  5BO0 B;  1S32 B;  2VQR A;  3AYW D;  5GT3 A;  3REI B;  4G92 B;  5DNM A;  3AZE B;  5B0Z B;  5AV8 C;  5GT0 B;  4YS3 C;  5GXQ C;  4XZQ D;  4J8X A;  5CPK C;  1TAF A;  1BH8 A;  4H9P A;  5B1L B;  3AZI C;  3B6G C;  5F99 C;  3O62 A;  5B32 C;  1S32 C;  1F66 B;  2FJ7 D;  3AZK D;  3F6T A;  4G92 C;  5B0Z C;  3A6N B;  2CV5 D;  3LJA B;  1P34 C;  1B6W A;  1BH9 A;  3MVD B;  5B1L C;  2ARO D;  4H9Q A;  5AY8 D;  1KX4 D;  2FFF B;  3W97 A;  4DRB A;  4X23 D;  3TU4 A;  1EQZ D;  5B2I B;  5AV9 A;  2HIO A;  2JE5 A;  3A6N C;  3AZH A;  4LD9 A;  3REJ D;  5GT3 D;  3LJA C;  1R4V A;  3MVD C;  3H0R C;  2F8N H;  3X1V D;  2W8S A;  4H9N A;  3AZN B;  2JSS A;  5B2I C;  1ULY A;  4J8W D;  3UT9 A;  3O62 D;  5B33 B;  1P3F A;  1U35 A;  2NQB B;  4EO5 C;  3LZ1 B;  1M19 D;  4WV4 B;  5JA4 B;  2PYO D;  3AZN C;  3MGP C;  1P3K D;  3W97 D;  3AZJ A;  3P5J B;  3TU4 D;  1M1A D;  5B31 G;  5B33 C;  2NQB C;  4J8V A;  5BNV A;  3LZ1 C;  3MGQ B;  3AZH D;  4LD9 D;  1TZY C;  3A1K A;  4QLC B;  3R45 A;  2DQN C;  3AV2 B;  5B31 A;  4H9S A;  3REL C;  4KGC A;  5AVC C;  3AV1 D;  2NZD A;  4JJN A;  3B6F B;  1P3F D;  5B2J C;  1U35 D;  1P3G D;  5G49 A;  3AZM C;  3W98 A;  3AFA D;  2JCH A;  5B0Y B;  4H9O B;  5CPI D;  3WAA B;  3AZJ D;  3MGS C;  5DNN A;  4WNN A;  1HQ3 B;  3C1B C;  1P3P A;  1ID3 A;  1AOI D;  5AV5 B;  3EPJ A;  3WKJ D;  3X1T B;  5B40 D;  5B0Y C;  2DF4 C;  3WAA C;  5B31 D;  3KWQ A;  4KGC D;  2BYK B;  2Y2J A;  1P3B A;  2NZD D;  4WU9 B;  4Z66 A;  3W99 A;  4R8P C;  3REH A;  3LEL A;  3MNN D;  3KXB B;  4KUD C;  3AN2 B;  5AV6 B;  4XUJ C;  5AVB A;  3REK B;  4UPK A;  3LZ0 B;  2RVQ D;  3X1S A;  4CAY B;  3KUY A;  5DNN D;  4WU9 C;  4WU8 D;  3WA9 C;  1P3P D;  1ID3 D;  3KXB C;  4Z5T B;  3AN2 C;  3MGR A;  3AZL A;  3KFU G;  3LZ0 C;  3AYW B;  3W96 D;  3EPH A;  1KX5 A;  2ZY4 A;  3H0M C;  4XZQ B;  3AZF A;  4CSR B;  5JRG D;  1T3U A;  3NQJ B;  5BT1 D;  3X1U D;  3UTA A;  3AZG A;  3C1C A;  1P3L A;  2FJ7 B;  3IP4 C;  5AVB D;  3AZK B;  2CV5 B;  4XZQ C;  5BS7 A;  3AL0 C;  3KUY D;  2ARO B;  5AY8 B;  1KX4 B;  4X23 B;  1EQZ B;  2FJ7 C;  1JFI A;  3MGR D;  3AZL D;  5FUG A;  3REJ B;  2F8N A;  5GT3 B;  2CV5 C;  1KX5 D;  1KX3 A;  1M18 A;  3X1V B;  3B0B A;  2ARO C;  5BNX A;  1P3O A;  5AY8 C;  1KX4 C;  4X23 C;  1EQZ C;  5E5A A;  1N1J B;  3UTA D;  4J8W B;  3NQU B;  1P3M D;  3C1C D;  1ZLA A;  3O62 B;  4DQY B;  3REJ C;  1H3O A;  5GT3 C;  3REI C;  5B32 G;  3AZE C;  5AV8 A;  4YM6 A;  4DRA A;  5GT0 C;  4YS3 A;  5GXQ A;  1M19 B;  3X1V C;  2PYO B;  1BH9 B;  3B6G A;  4H9Q B;  3AZI A;  1P3K B;  4J8W C;  3W97 B;  3TU4 B;  1M1A B;  3O62 C;  5F99 A;  5BO0 A;  5B32 A;  1F66 C;  1BFM A;  5GSU A;  5CPJ D;  3AZH B;  5B0Z A;  4LD9 B;  1M19 C;  2Y2G A;  1P34 A;  1KX3 D;  5DNM D;  4ZUX A;  1M18 D;  2PYO C;  4J8X D;  5B1L A;  1P3O D;  4H9N B;  1P3K C;  3W97 C;  3KSY A;  1M1A C;  3AV1 B;  5E5A D;  4NE5 A;  4Z2M H;  2Y2Q A;  1P3F B;  1U35 B;  1P3G B;  3A1I A;  3AFA B;  4YM6 D;  3MVD A;  4WZS B;  3H0L C;  5CPI B;  3AV1 C;  5B2I A;  3AZI D;  3AZJ B;  5B32 D;  1P3G C;  1P3F C;  2XD1 A;  5AV9 D;  5GSU D;  2RIQ A;  1AOI B;  3AFA C;  2HIO D;  3WKJ B;  2YFV A;  5B40 B;  1WWI A;  3R45 B;  1P34 D;  4ZUX D;  3AZN A;  2BYM A;  5CPI C;  5B31 B;  2IO5 B;  3MGP A;  4KGC B;  2NZD B;  2NQB A;  3EPL A;  1AOI C;  3LZ1 A;  3UT9 D;  2YFW B;  4M6B A;  3WTP A;  3WKJ C;  1TZY A;  5G49 B; 
#chains in the Genus database with same CATH homology
 4QLC C;  2XD5 A;  3MNN B;  5JA4 A;  5B40 C;  1P3I A;  3VH5 T;  3AV2 C;  5B31 C;  4H9S C;  4UUZ B;  3REL A;  4KGC C;  5AVC A;  2NZD C;  5DNN B;  4WU8 B;  3B6F C;  5B2J A;  1P3P B;  1ID3 B;  4J8V D;  3AZM A;  2L5A A;  3MNN C;  4E44 A;  2BG1 A;  2G5I C;  3MGP D;  3W96 B;  3FDD A;  5DNN C;  3MGS A;  4WU8 C;  1HQ3 C;  3C1B A;  1ID3 C;  5JRG B;  4JJN D;  5AV5 C;  3WTP D;  1TZY D;  2LY8 A;  3X1T C;  3X1U B;  1P3I D;  5B0Y A;  3W98 D;  4G91 B;  3W96 C;  3WAA A;  5AVB B;  1P3A A;  5AVC D;  2ZY3 A;  5JRG C;  3KUY B;  5B2J D;  5BT1 C;  5C3I B;  5CP6 A;  4R8P A;  3AZM D;  4H9R B;  3X1U C;  4J8U A;  2ZM5 A;  4KUD A;  4G91 C;  5B1M A;  5KDM A;  5AV6 C;  4XUJ A;  5AVB C;  3MGR B;  2BYK A;  3REK C;  3AZL B;  3VH6 A;  3KWQ D;  1KX5 B;  3MGS D;  4WU9 A;  1P3B D;  3C1B D;  3WA9 A;  3KXB A;  3EG5 B;  4Z5T C;  4Z66 D;  3W99 D;  3VH6 T;  3REH D;  3LEL D;  3AN2 A;  5B24 A;  3UTA B;  1P3M B;  3MGR C;  3C1C B;  3LZ0 A;  3AYW C;  1P3A D;  4CAY A;  3X1S D;  4AWL B;  3MGQ C;  2Y2I A;  2F8N G;  4R8P D;  5CP6 D;  4J8U D;  1HTA A;  1P3M C;  1F1E A;  3B0C T;  4KUD D;  5B1M D;  4XUJ D;  5CPJ B;  4WJ3 C;  3AZK C;  3VH6 W;  4XZQ A;  3UTB A;  4CSR A;  4KHA A;  1KX3 B;  5DNM B;  1M18 B;  3WA9 D;  2ZY5 A;  4J8X B;  3V9R A;  3AZF D;  3EPK A;  5BNX B;  1P3O B;  1TAF B;  5E5A B;  1BH8 B;  4H9P B;  5B24 D;  2FJ7 A;  1PZR A;  5CPJ C;  3AZG D;  1P3L D;  2CV5 A;  5DNM C;  4YM6 B;  4J8X C;  1P3O C;  2ARO A;  1KX4 A;  4X23 A;  5CPK A;  1EQZ A;  3AZI B;  1B67 A;  3B0D B;  5B32 B;  1S32 A;  5AV9 B;  5GSU B;  3REJ A;  3REI A;  2HIO B;  3AZE A;  4YM6 C;  5GT0 A;  2F8N D;  3UTB D;  3X1V A;  1P34 B;  4ZUX B;  1N1J A;  4J8W A;  3NQU A;  3TU4 C;  3B0D C;  1F66 A;  5AV9 C;  5GSU C;  1ZLA D;  3UT9 B;  2HIO C;  3AZH C;  3A6N A;  4LD9 C;  1M19 A;  3LJA A;  2PYO A;  4ZUX C;  5AV8 D;  4YS3 D;  5GXQ D;  1P3K A;  5CPK D;  1M1A A;  3B6G D;  3UT9 C;  5F99 D;  1WWS A;  1S32 D;  1U35 C;  4NE3 A;  4EO5 B;  4J8V B;  5BNV B;  3REI D;  2UWX A;  3AZE D;  5B0Z D;  5GT0 D;  2Y2O A;  2YFV B;  2BYM B;  3AV1 A;  5B1L D;  3MGP B;  1Q9C A;  3AZJ C;  1F66 D;  3VH5 A;  5B33 A;  1P3G A;  4J8V C;  4JJN B;  2F8N K;  3AFA A;  3WTP B;  1TZY B;  3A6N D;  3LJA D;  1A7W A;  3W98 B;  1P3I B;  2G5H C;  5CPI A;  3MVD D;  3REL B;  2IO5 C;  5AVC B;  5B2I D;  1W2E A;  1AOI A;  4JJN C;  4WNN B;  5B2J B;  3WTP C;  2Y2M A;  3MGQ A;  3WKJ A;  4QLC A;  3AZM B;  5B40 A;  3W98 C;  1P3I C;  3AV2 A;  2CWE A;  2Y2K A;  3AZN D;  2RVQ C;  3KWQ B;  2Y2H A;  3VH5 W;  3MGS B;  2YFW A;  5B33 D;  3C1B B;  1P3B B;  1P3P C;  2NQB D;  3B6F A;  3MNN A;  3LZ1 D;  4Z66 B;  2Y2P A;  3W99 B;  2Y2N A;  3REH B;  3LEL B;  4UUZ A;  4H9O A;  3KWQ C;  3REL D;  1P3A B;  2ZY2 A;  4WU8 A;  1P3B C;  3X1S B;  1HQ3 A;  5AV5 A;  4Z66 C;  3MGQ D;  3W99 C;  5CP6 B;  4R8P B;  4QLC D;  3REH C;  3X1T A;  3LEL C;  4J8U B;  4KUD B;  5B1M B;  3AV2 D;  3W96 A;  5KDM B;  4XUJ B;  2F2A C;  3WTP E;  1KU5 A;  1Z2C B;  2Y2L A;  1P3A C;  3X1S C;  5JRG A;  3KUY C;  4HGA B;  3B6F D;  3WA9 B;  5CP6 C;  5C3I C;  3AZF B;  4ZBJ B;  3X1U A;  4J8U C;  4E45 A;  5B1M C;  5B24 B;  5B0Y D;  5AV6 A;  3REK A;  3AZG B;  3AZL C;  1P3L B;  3WAA D;  1KX5 C;  4HGA C;  1HQ3 D;  4NE6 A;  3AZF C;  4ZBJ C;  4H9R A;  5AV5 D;  4Z5T A;  3X1T D;  5B24 C;  3UTA C;  3AZG C;  3C1C C;  4Z2M G;  1P3L C;  3AYW A;  1JFI B;  5CHL B;  5FUG B;  2F8N B;  3UTB B;  5BS7 C;  4AWL C;  4KHA B;  4WU9 D;  3NQJ A;  3V9R B;  3KXB D;  1P3M A;  3AN2 D;  5AV6 D;  2HUE B;  3REK D;  1ZLA B;  3AZK A;  3LZ0 D;  1H3O B;  3UTB C;  3B0C W;  1KX3 C;  5AV8 B;  1M18 C;  4YS3 B;  5GXQ B;  4NFT A;  4Z5T D;  5AY8 A;  5CPK B;  5E5A C;  3B6G B;  2HUE C;  5CPJ A;  1ZLA C;  2J8P A;  5F99 B;  5BO0 B;  1S32 B;  2VQR A;  3AYW D;  5GT3 A;  3REI B;  4G92 B;  5DNM A;  3AZE B;  5B0Z B;  5AV8 C;  5GT0 B;  4YS3 C;  5GXQ C;  4XZQ D;  4J8X A;  5CPK C;  1TAF A;  1BH8 A;  4H9P A;  5B1L B;  3AZI C;  3B6G C;  5F99 C;  3O62 A;  5B32 C;  1S32 C;  1F66 B;  2FJ7 D;  3AZK D;  3F6T A;  4G92 C;  5B0Z C;  3A6N B;  2CV5 D;  3LJA B;  1P34 C;  1B6W A;  1BH9 A;  3MVD B;  5B1L C;  2ARO D;  4H9Q A;  5AY8 D;  1KX4 D;  2FFF B;  3W97 A;  4DRB A;  4X23 D;  3TU4 A;  1EQZ D;  5B2I B;  5AV9 A;  2HIO A;  2JE5 A;  3A6N C;  3AZH A;  4LD9 A;  3REJ D;  5GT3 D;  3LJA C;  1R4V A;  3MVD C;  3H0R C;  2F8N H;  3X1V D;  2W8S A;  4H9N A;  3AZN B;  2JSS A;  5B2I C;  1ULY A;  4J8W D;  3UT9 A;  3O62 D;  5B33 B;  1P3F A;  1U35 A;  2NQB B;  4EO5 C;  3LZ1 B;  1M19 D;  4WV4 B;  5JA4 B;  2PYO D;  3AZN C;  3MGP C;  1P3K D;  3W97 D;  3AZJ A;  3P5J B;  3TU4 D;  1M1A D;  5B31 G;  5B33 C;  2NQB C;  4J8V A;  5BNV A;  3LZ1 C;  3MGQ B;  3AZH D;  4LD9 D;  1TZY C;  3A1K A;  4QLC B;  3R45 A;  2DQN C;  3AV2 B;  5B31 A;  4H9S A;  3REL C;  4KGC A;  5AVC C;  3AV1 D;  2NZD A;  4JJN A;  3B6F B;  1P3F D;  5B2J C;  1U35 D;  1P3G D;  5G49 A;  3AZM C;  3W98 A;  3AFA D;  2JCH A;  5B0Y B;  4H9O B;  5CPI D;  3WAA B;  3AZJ D;  3MGS C;  5DNN A;  4WNN A;  1HQ3 B;  3C1B C;  1P3P A;  1ID3 A;  1AOI D;  5AV5 B;  3EPJ A;  3WKJ D;  3X1T B;  5B40 D;  5B0Y C;  2DF4 C;  3WAA C;  5B31 D;  3KWQ A;  4KGC D;  2BYK B;  2Y2J A;  1P3B A;  2NZD D;  4WU9 B;  4Z66 A;  3W99 A;  4R8P C;  3REH A;  3LEL A;  3MNN D;  3KXB B;  4KUD C;  3AN2 B;  5AV6 B;  4XUJ C;  5AVB A;  3REK B;  4UPK A;  3LZ0 B;  2RVQ D;  3X1S A;  4CAY B;  3KUY A;  5DNN D;  4WU9 C;  4WU8 D;  3WA9 C;  1P3P D;  1ID3 D;  3KXB C;  4Z5T B;  3AN2 C;  3MGR A;  3AZL A;  3KFU G;  3LZ0 C;  3AYW B;  3W96 D;  3EPH A;  1KX5 A;  2ZY4 A;  3H0M C;  4XZQ B;  3AZF A;  4CSR B;  5JRG D;  1T3U A;  3NQJ B;  5BT1 D;  3X1U D;  3UTA A;  3AZG A;  3C1C A;  1P3L A;  2FJ7 B;  3IP4 C;  5AVB D;  3AZK B;  2CV5 B;  4XZQ C;  5BS7 A;  3AL0 C;  3KUY D;  2ARO B;  5AY8 B;  1KX4 B;  4X23 B;  1EQZ B;  2FJ7 C;  1JFI A;  3MGR D;  3AZL D;  5FUG A;  3REJ B;  2F8N A;  5GT3 B;  2CV5 C;  1KX5 D;  1KX3 A;  1M18 A;  3X1V B;  3B0B A;  2ARO C;  5BNX A;  1P3O A;  5AY8 C;  1KX4 C;  4X23 C;  1EQZ C;  5E5A A;  1N1J B;  3UTA D;  4J8W B;  3NQU B;  1P3M D;  3C1C D;  1ZLA A;  3O62 B;  4DQY B;  3REJ C;  1H3O A;  5GT3 C;  3REI C;  5B32 G;  3AZE C;  5AV8 A;  4YM6 A;  4DRA A;  5GT0 C;  4YS3 A;  5GXQ A;  1M19 B;  3X1V C;  2PYO B;  1BH9 B;  3B6G A;  4H9Q B;  3AZI A;  1P3K B;  4J8W C;  3W97 B;  3TU4 B;  1M1A B;  3O62 C;  5F99 A;  5BO0 A;  5B32 A;  1F66 C;  1BFM A;  5GSU A;  5CPJ D;  3AZH B;  5B0Z A;  4LD9 B;  1M19 C;  2Y2G A;  1P34 A;  1KX3 D;  5DNM D;  4ZUX A;  1M18 D;  2PYO C;  4J8X D;  5B1L A;  1P3O D;  4H9N B;  1P3K C;  3W97 C;  3KSY A;  1M1A C;  3AV1 B;  5E5A D;  4NE5 A;  4Z2M H;  2Y2Q A;  1P3F B;  1U35 B;  1P3G B;  3A1I A;  3AFA B;  4YM6 D;  3MVD A;  4WZS B;  3H0L C;  5CPI B;  3AV1 C;  5B2I A;  3AZI D;  3AZJ B;  5B32 D;  1P3G C;  1P3F C;  2XD1 A;  5AV9 D;  5GSU D;  2RIQ A;  1AOI B;  3AFA C;  2HIO D;  3WKJ B;  2YFV A;  5B40 B;  1WWI A;  3R45 B;  1P34 D;  4ZUX D;  3AZN A;  2BYM A;  5CPI C;  5B31 B;  2IO5 B;  3MGP A;  4KGC B;  2NZD B;  2NQB A;  3EPL A;  1AOI C;  3LZ1 A;  3UT9 D;  2YFW B;  4M6B A;  3WTP A;  3WKJ C;  1TZY A;  5G49 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...