1F1EA

Crystal structure of the histone from methanopyrus kandleri
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
151
structure length
151
Chain Sequence
ELPKAAIERIFRQGIGERRLSQDAKDTIYDFVPTMAEYVANAAKSVLDASGKKTLMEEHLKALADVLMVEGVEDYDGELFGRATVRRILKRAGIERASSDAVDLYNKLICRATEELGEKAAEYADEDGRKTVQGEDVEKAITYSMPKGGEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HISTONE FOLD PROTEIN
publication title An ancestral nuclear protein assembly: crystal structure of the Methanopyrus kandleri histone.
pubmed doi rcsb
source organism Methanopyrus kandleri
molecule tags Dna binding protein
total genus 58
structure length 151
sequence length 151
ec nomenclature
pdb deposition date 2000-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00808 CBFD_NFYB_HMF Histone-like transcription factor (CBF/NF-Y) and archaeal histone
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1f1eA00
3AZKD 2YFWA 3W97A 3AZFC 5DNMC 4JJNA 4H9OA 4ZUXB 4CSRB 1AOIC 3VH5W 5B33B 3REJC 4WNNB 3X1UD 2NZDC 1HQ3B 4J8WD 4AWLC 3B6FD 1N1JA 5B32A 5GT0A 4E44A 4KGCC 3TU4C 3AZNC 1ID3D 5B0YA 3LZ0A 5AVBA 5AV8C 3REHB 4H9QA 3W97D 4YM6D 1P3GB 3AV2C 3AZHC 3WAAC 4Z2MG 4ZUXA 2HUEB 5AV5C 3AZIA 5JRGC 3REIA 3O62D 4J8UB 2HIOB 3LZ1A 1M18B 5B32D 5GT0D 3B0CT 3WTPC 4QLCC 4WU8B 5B0YD 3LZ0D 5AVCB 3V9RB 3W96B 3REHA 2AROD 4J8VD 2F8NB 3MGPC 5E5AA 5B32G 3MGSB 3X1VB 4Z66B 4WV4B 5CP6A 3REKC 4NE6A 3AV1A 2PYOB 3B6GC 3AZID 3REID 3UT9D 3LZ1D 4J8XD 4R8PC 3KUYB 2HIOA 3UTAB 3X1UC 1P3OA 3B6FC 3W99A 5B2JB 5AVCA 2F8NH 4YS3A 5E5AD 1ID3C 5BS7A 4ZBJC 3R45B 5CP6D 3AV1D 4Z66A 4Z5TD 2PYOA 3KWQD 4JJNC 4KGCB 3KUYA 4G91C 4UUZB 3AYWB 1P3OD 1H3OB 3MGRB 3W99D 3VH6W 5B32C 4H9SA 5GT0C 5B40A 5B2JA 4YS3D 3AV2B 5AVBC 3LELB 1P3FA 5AV5B 2RVQD 5G49B 1HTAA 4ZUXC 4QLCB 3AZIC 4DRBA 1BH8B 2NQBB 3LZ1C 4UUZA 1H3OA 5B40D 3AZMB 4DRAA 2BYKA 1P3FD 2JSSA 4H9NA 3C1CD 3AZKB 3REHC 1ZLAA 5G49A 1P3KA 5CP6C 3AV1C 3X1UB 4J8WB 1U35A 3B6FB 1BH8A 2NQBA 1P3BD 2HIOC 1M18C 1Q9CA 1ID3B 4E45A 3MGQA 2L5AA 3W99C 3W97B 5AVCC 4YM6B 1ZLAD 4YS3C 4H9RA 3X1SA 4X23D 4KHAB 5CPJA 1P3KD 1BFMA 1KX3A 4LD9A 5CPIA 3AZLA 3X1TA 3X1VC 4Z66C 3W98D 3O62B 2PYOC 4G91B 1U35D 1N1JB 5B32B 5GT0B 3UTBD 3KUYC 2F8NK 5B0YB 1KX4A 3LZ0B 3MGQD 4H9QB 2AROB 3LJAA 4H9SC 5B40C 1P3PA 1TZYA 3B0CW 5B2JC 4YM6A 3X1SD 5CPJD 3WKJA 1KX3D 4LD9D 5CPID 4KHAA 3AZLD 3X1TD 3AZIB 3REIB 2IO5B 3UT9B 5BT1C 3O62A 3LZ1B 4J8XB 5AY8A 1KX4D 3LJAD 3AYWC 3MGRC 4EO5C 1TZYD 1P3PD 2AROA 5E5AB 4J8VA 1M1AA 3WKJD 5CP6B 3AV1B 3LELC 4Z5TB 3KWQB 5AV6A 1P3KC 3UT9A 5AY8D 4J8XA 5B24A 1F66A 3RELA 1U35C 1P3OB 1WWIA 3W99B 2NQBC 5CHLB 4YS3B 1M1AD 3AZMC 4XZQA 3AZKC 1P3MA 4KUDA 4Z5TA 5AV6D 3X1SC 4CAYA 3AFAA 4NE3A 3KWQA 5AV9D 3AZLC 3MVDA 5B24D 1F66D 5F99A 3RELD 4G92B 4J8WC 4XUJA 5B40B 5B1MD 1KX4C 1P3AA 1P3FB 3C1CB 5GSUD 3AZJA 4XZQD 3A6ND 3LJAC 1P3MD 4KUDD 3W97C 1P3PC 1TZYC 4YM6C 3KXBA 3WKJC 3AFAD 5GT3D 3MVDD 1M19A 5F99D 1B6WA 3O62C 5AY8C 1R4VA 4XUJD 2CWEA 4EO5B 2BYKB 1P3AD 5B2IA 4H9NB 3AZJD 5B0YC 3LZ0C 3C1CA 1ZLAB 2BYMB 1TAFA 2AROC 4X23B 4J8VC 1P3KB 3KXBD 2CV5A 1M19D 3AZGD 1U35B 3REIC 1S32A 2IO5C 3UT9C 3B0DC 4J8XC 2FJ7A 5B24C 1P3BA 1F66C 3MGQB 5B2ID 5DNNA 3MNNA 1P3ID 3AZFA 4H9RB 5DNMA 3X1SB 5CPJB 5B0ZA 1KX3B 2BYMA 5CPIB 5E5AC 4LD9B 4X23A 5CPKD 3AZLB 4H9PA 3X1TB 1EQZA 4XZQC 2CV5D 1KX5A 1P3MC 1AOIA 4KUDC 4Z5TC 3W98A 1S32D 2NZDA 3KWQC 4WZSB 1P34A 2FJ7D 3MVDC 3UTAD 3UTBA 1KX4B 3TU4A 3AZNA 5DNND 3MNND 3LJAB 1P3OC 1P3PB 1TZYB 3AZFD 5DNMD 5C3IC 5B0ZD 1P3AC 3WKJB 3AZJC 5BS7C 4NE5A 1EQZD 1KX5D 5FUGA 3WAAA 1AOID 2RVQC 4WU9A 3REJD 1A7WA 2NZDD 5AY8B 1P34D 3VH5A 3AZEA 5GXQA 3TU4D 3AZND 5BO0A 5AV8D 4Z2MH 4G92C 3C1BA 1M1AB 4J8VB 3MGPA 3WA9A 5B2IC 3AZHD 1P3FC 3C1CC 3WAAD 3B6GA 5BNXA 4WU9D 5JA4A 5AV6B 5JRGD 3NQJA 3B0DB 5AV9B 1WWSA 4R8PA 5B24B 1B67A 1F66B 3WTPD 3AZED 3RELB 1ULYA 5GXQD 5B31A 1F1EA 1S32C 1P3LA 5KDMB 2YFVB 3C1BD 5B1MB 1P3BC 3MGPD 3WA9D 5GSUB 3MNNC 4XZQB 3A6NB 1P3MB 3REKD 3B6GD 4KUDB 5B0ZC 4CAYB 1ZLAC 3AFAB 4X23C 5GT3B 3MVDB 1EQZC 4R8PD 1KX5C 5AV9A 5F99B 5BNVA 5B1LA 5B31D 3W98C 1P3LD 3AN2A 4XUJB 1P34C 1JFIA 5KDMA 3UTBC 2YFVA 5C3IB 3B0BA 5B1MA 1P3AB 3AZJB 1KU5A 3MGQC 1BH9A 5GSUA 5B31G 3A6NA 3KXBB 4JJND 5CPJC 1KX3C 4LD9C 5CPIC 1M19B 5GT3A 4CSRA 3AZGB 3X1TC 4WU9C 5B1LD 5B33A 3AN2D 4WNNA 1HQ3A 3AZEC 5GXQC 5B2IB 5AVBD 3VH6A 4NFTA 1P3IB 3C1BC 3NQUB 1TAFB 3VH5T 3WA9C 5CPKB 2LY8A 1P3GA 2CV5B 4ZUXD 1S32B 3AZGA 5B33D 2FJ7B 1HQ3D 4J8UA 1P3BB 1M18A 5B31C 1P3LC 5DNNB 3MNNB 4WU8A 3WTPE 3REHD 3AZFB 5DNMB 3V9RA 1P3IA 5B0ZB 3NQUA 3W96A 1M1AC 2F8NA 4H9PB 1P3GD 1EQZB 1KX5B 5CPKA 1AOIB 3MGSA 3X1VA 3W98B 3REJB 2NZDB 4AWLB 5AV6C 1P34B 4J8UD 3KSYA 2HIOD 5AV9C 3UTBB 1M18D 3TU4B 3UTAA 5B1LC 3AZNB 5AV8B 3RELC 3AN2C 4WU8D 5AVCD 3W96D 5B1MC 2F8ND 3AZHB 5FUGB 4HGAC 5GSUC 3WAAB 3MGSD 3X1VD 4Z66D 4WU9B 5JRGB 3A6NC 3R45A 2PYOD 3REJA 3AFAC 2F8NG 3WTPB 5GT3C 3AZEB 5GXQB 3KUYD 5F99C 5BO0B 4KGCA 5B33C 1HQ3C 3C1BB 5AV8A 3AYWA 4XUJC 3MGPB 3MGRA 3WA9B 5B2JD 3REKB 3AV2A 3B6GB 3AZHA 5BNXB 3LELA 5JA4B 5AV5A 3NQJB 5JRGA 5BT1D 3KXBC 1P3GC 4R8PB 3VH6T 5B31B 3WTPA 2HUEC 1P3LB 3AZGC 4QLCA 1M19C 4KGCD 4J8UC 3AYWD 3MGRD 3AZMA 4WU8C 4ZBJB 2YFWB 3AV2D 3LELD 3AZKA 5AV5D 3REKA 1P3IC 4M6BA 3W96C 4JJNB 4H9OB 5CPKC 3MGSC 2CV5C 5BNVB 5B1LB 4QLCD 3AN2B 3X1UA 1JFIB 4J8WA 2NQBD 3B6FA 2FJ7C 3UTAC 5AVBB 3AZMD 1BH9B 1ID3A 4HGAB 5DNNC
chains in the Genus database with same CATH superfamily
3AZKD 2ZY2A 2YFWA 3W97A 3AZFC 5DNMC 4JJNA 4H9OA 4ZUXB 4CSRB 1AOIC 3VH5W 5B33B 3REJC 2XD1A 4WNNB 3X1UD 1HQ3B 4J8WD 2NZDC 4AWLC 2XD5A 3B6FD 1N1JA 5B32A 5GT0A 4E44A 4KGCC 3TU4C 3AZNC 1ID3D 5B0YA 3LZ0A 5AVBA 5AV8C 3REHB 4H9QA 3W97D 3IP4C 4YM6D 1P3GB 3AV2C 3AZHC 3WAAC 4Z2MG 4ZUXA 2HUEB 5AV5C 3AZIA 5JRGC 3REIA 3O62D 4J8UB 2HIOB 3LZ1A 1M18B 5B32D 5GT0D 3B0CT 3WTPC 4QLCC 4WU8B 5B0YD 3LZ0D 5AVCB 3V9RB 3W96B 3REHA 2AROD 4J8VD 2F8NB 3MGPC 2FFFB 5E5AA 5B32G 3MGSB 3X1VB 4Z66B 4WV4B 2G5IC 5CP6A 4NE6A 3REKC 3AV1A 2PYOB 3B6GC 3AZID 3REID 3UT9D 3LZ1D 4J8XD 4R8PC 3KUYB 2HIOA 3UTAB 3X1UC 1P3OA 3B6FC 3W99A 5B2JB 5AVCA 2F8NH 4YS3A 5E5AD 1ID3C 5BS7A 4ZBJC 3R45B 5CP6D 3AV1D 4Z66A 4Z5TD 2PYOA 3KWQD 4JJNC 4KGCB 3KUYA 4G91C 4UUZB 3AYWB 1P3OD 1H3OB 3MGRB 3W99D 3VH6W 5B32C 4H9SA 5GT0C 5B40A 5B2JA 4YS3D 3AV2B 5AVBC 3LELB 1P3FA 3H0RC 5AV5B 2RVQD 5G49B 1HTAA 4ZUXC 4QLCB 2ZY4A 3AZIC 4DRBA 1BH8B 2NQBB 3LZ1C 4UUZA 1H3OA 5B40D 3AZMB 4DRAA 2BYKA 1P3FD 1Z2CB 2JSSA 4H9NA 3C1CD 3AZKB 3REHC 1ZLAA 5G49A 1P3KA 5CP6C 3AV1C 3X1UB 3H0LC 4J8WB 1U35A 3B6FB 1BH8A 2NQBA 1P3BD 2HIOC 1M18C 1Q9CA 1ID3B 2DQNC 4E45A 3MGQA 2L5AA 3W99C 3W97B 5AVCC 4YM6B 1ZLAD 4YS3C 4H9RA 3X1SA 4X23D 4KHAB 5CPJA 1P3KD 1BFMA 2ZM5A 1KX3A 5CPIA 4LD9A 3AZLA 3X1TA 3X1VC 4Z66C 3W98D 3O62B 2PYOC 4G91B 2Y2OA 1U35D 1N1JB 5B32B 5GT0B 3UTBD 3KUYC 2F8NK 5B0YB 1KX4A 3LZ0B 3MGQD 4H9QB 2ZY3A 2AROB 3LJAA 4H9SC 5B40C 1P3PA 1TZYA 3B0CW 5B2JC 4YM6A 3X1SD 5CPJD 3WKJA 1KX3D 4LD9D 5CPID 4WJ3C 4KHAA 3AZLD 3F6TA 3X1TD 3AZIB 3REIB 2IO5B 3UT9B 5BT1C 3O62A 3LZ1B 4J8XB 5AY8A 4DQYB 1KX4D 1W2EA 3LJAD 3AYWC 3MGRC 4EO5C 1TZYD 1P3PD 2AROA 5E5AB 4J8VA 1M1AA 3EPHA 3WKJD 2Y2LA 5CP6B 3AV1B 3LELC 4Z5TB 3KWQB 5AV6A 1P3KC 3UT9A 5AY8D 4UPKA 4J8XA 5B24A 1F66A 3RELA 1U35C 1P3OB 1WWIA 3W99B 2NQBC 5CHLB 2ZY5A 4YS3B 1M1AD 3AZMC 4XZQA 3AZKC 1P3MA 4KUDA 3FDDA 4Z5TA 5AV6D 3X1SC 4CAYA 3AFAA 4NE3A 3KWQA 5AV9D 3AZLC 3MVDA 5B24D 1F66D 5F99A 3RELD 4G92B 4J8WC 4XUJA 5B40B 5B1MD 1KX4C 1P3AA 1P3FB 3C1CB 5GSUD 3AZJA 2Y2QA 4XZQD 3A6ND 3LJAC 1P3MD 4KUDD 3W97C 1P3PC 1TZYC 2BG1A 4YM6C 3KXBA 2Y2NA 3WKJC 3AFAD 5GT3D 3MVDD 1M19A 5F99D 1B6WA 3O62C 5AY8C 1R4VA 4XUJD 2Y2KA 2CWEA 4EO5B 2BYKB 1P3AD 5B2IA 4H9NB 3AZJD 5B0YC 3LZ0C 3C1CA 1ZLAB 2BYMB 1TAFA 2AROC 3H0MC 4X23B 4J8VC 1P3KB 3KXBD 2CV5A 1M19D 3AZGD 1U35B 3REIC 1S32A 2IO5C 3UT9C 3B0DC 4J8XC 2FJ7A 5B24C 1P3BA 1F66C 3MGQB 5B2ID 5DNNA 3MNNA 1P3ID 3AZFA 4H9RB 5DNMA 3X1SB 5CPJB 5B0ZA 1KX3B 2BYMA 5CPIB 5E5AC 2G5HC 4X23A 5CPKD 3AZLB 4H9PA 3X1TB 1EQZA 4XZQC 2CV5D 1KX5A 1P3MC 1AOIA 4KUDC 4Z5TC 3W98A 1S32D 2NZDA 3KWQC 4WZSB 1P34A 2FJ7D 3MVDC 3UTAD 3UTBA 1KX4B 3EPKA 3TU4A 3AZNA 5DNND 3MNND 3LJAB 1P3OC 1P3PB 1TZYB 3AZFD 5DNMD 5C3IC 5B0ZD 1P3AC 3WKJB 3AZJC 5BS7C 4NE5A 1EQZD 1KX5D 5FUGA 3WAAA 1AOID 2RVQC 4WU9A 3REJD 1A7WA 2NZDD 5AY8B 1P34D 3VH5A 2JCHA 3AZEA 5GXQA 3TU4D 3AZND 5BO0A 5AV8D 4Z2MH 4G92C 2F2AC 3EPJA 3C1BA 1M1AB 4J8VB 3MGPA 3WA9A 5B2IC 3P5JB 3AZHD 1P3FC 2Y2PA 2J8PA 3C1CC 3B6GA 3WAAD 5BNXA 4WU9D 5JA4A 5AV6B 5JRGD 2Y2IA 3NQJA 3B0DB 5AV9B 1WWSA 4R8PA 5B24B 1B67A 1F66B 3WTPD 3AZED 3RELB 1ULYA 5GXQD 5B31A 1F1EA 1S32C 1P3LA 5KDMB 2YFVB 3C1BD 5B1MB 1P3BC 3MGPD 3WA9D 5GSUB 3MNNC 4XZQB 3A6NB 1P3MB 3REKD 3B6GD 4KUDB 2W8SA 5B0ZC 4CAYB 3EPLA 1ZLAC 3AFAB 4X23C 5GT3B 3MVDB 1EQZC 4R8PD 1KX5C 5AV9A 5F99B 5BNVA 5B1LA 5B31D 3W98C 1P3LD 3AN2A 2UWXA 2Y2JA 4XUJB 1P34C 1JFIA 5KDMA 3UTBC 2YFVA 5C3IB 3B0BA 5B1MA 1P3AB 3AZJB 1KU5A 2DF4C 3MGQC 1BH9A 5GSUA 5B31G 3A6NA 3KXBB 4JJND 5CPJC 1KX3C 4LD9C 5CPIC 1M19B 5GT3A 4CSRA 3AZGB 3X1TC 4WU9C 5B1LD 5B33A 3AN2D 1T3UA 4WNNA 1HQ3A 3AZEC 5GXQC 5B2IB 5AVBD 3AL0C 3VH6A 4NFTA 1P3IB 3C1BC 3NQUB 1TAFB 4LD9B 3VH5T 3WA9C 5CPKB 2LY8A 1P3GA 2CV5B 4ZUXD 1S32B 3AZGA 5B33D 2FJ7B 1HQ3D 4J8UA 1P3BB 1M18A 5B31C 1P3LC 5DNNB 3MNNB 4WU8A 3WTPE 3REHD 3AZFB 5DNMB 3V9RA 1P3IA 5B0ZB 3NQUA 3W96A 1M1AC 2F8NA 4H9PB 1P3GD 1EQZB 1KX5B 5CPKA 1AOIB 3MGSA 3X1VA 3W98B 3REJB 2NZDB 4AWLB 5AV6C 1P34B 4J8UD 3KSYA 2HIOD 5AV9C 3UTBB 1M18D 3TU4B 3UTAA 5B1LC 3AZNB 5AV8B 3RELC 3AN2C 4WU8D 3EG5B 5AVCD 3W96D 5B1MC 3A1IA 2F8ND 2RIQA 3AZHB 5FUGB 4HGAC 5GSUC 3WAAB 3MGSD 3X1VD 4Z66D 4WU9B 5JRGB 3A6NC 3R45A 2PYOD 3REJA 3AFAC 2F8NG 3WTPB 5GT3C 3AZEB 5GXQB 3KUYD 5F99C 5BO0B 4KGCA 5B33C 1HQ3C 3C1BB 5AV8A 3AYWA 2Y2MA 4XUJC 3MGPB 3MGRA 3WA9B 5B2JD 3REKB 3AV2A 3B6GB 3AZHA 5BNXB 3LELA 5JA4B 5AV5A 3NQJB 5BT1D 5JRGA 3KXBC 1P3GC 4R8PB 2Y2HA 3VH6T 5B31B 3WTPA 2HUEC 1P3LB 3AZGC 4QLCA 1M19C 4KGCD 4J8UC 3AYWD 3MGRD 3AZMA 4WU8C 4ZBJB 2YFWB 3AV2D 3LELD 3AZKA 5AV5D 3REKA 1P3IC 4M6BA 3W96C 2VQRA 4JJNB 4H9OB 5CPKC 3KFUG 3MGSC 2CV5C 5BNVB 5B1LB 4QLCD 3AN2B 2JE5A 3X1UA 1JFIB 4J8WA 1PZRA 2NQBD 3B6FA 2FJ7C 2Y2GA 3UTAC 5AVBB 3AZMD 1BH9B 3A1KA 1ID3A 4HGAB 5DNNC
chains in the Genus database with same CATH topology
3AZKD 2ZY2A 2YFWA 3W97A 3AZFC 5DNMC 4JJNA 4H9OA 4ZUXB 4CSRB 1AOIC 3VH5W 5B33B 3REJC 2XD1A 4WNNB 3X1UD 1HQ3B 4J8WD 2NZDC 4AWLC 2XD5A 3B6FD 1N1JA 5B32A 5GT0A 4E44A 4KGCC 3TU4C 3AZNC 1ID3D 5B0YA 3LZ0A 5AVBA 5AV8C 3REHB 4H9QA 3W97D 3IP4C 4YM6D 1P3GB 3AV2C 3AZHC 3WAAC 4Z2MG 4ZUXA 2HUEB 5AV5C 3AZIA 5JRGC 3REIA 3O62D 4J8UB 2HIOB 3LZ1A 1M18B 5B32D 5GT0D 3B0CT 3WTPC 4QLCC 4WU8B 5B0YD 3LZ0D 5AVCB 3V9RB 3W96B 3REHA 2AROD 4J8VD 2F8NB 3MGPC 2FFFB 5E5AA 5B32G 3MGSB 3X1VB 4Z66B 4WV4B 2G5IC 5CP6A 4NE6A 3REKC 3AV1A 2PYOB 3B6GC 3AZID 3REID 3UT9D 3LZ1D 4J8XD 4R8PC 3KUYB 2HIOA 3UTAB 3X1UC 1P3OA 3B6FC 3W99A 5B2JB 5AVCA 2F8NH 4YS3A 5E5AD 1ID3C 5BS7A 4ZBJC 3R45B 5CP6D 3AV1D 4Z66A 4Z5TD 2PYOA 3KWQD 4JJNC 4KGCB 3KUYA 4G91C 4UUZB 3AYWB 1P3OD 1H3OB 3MGRB 3W99D 3VH6W 5B32C 4H9SA 5GT0C 5B40A 5B2JA 4YS3D 3AV2B 5AVBC 3LELB 1P3FA 3H0RC 5AV5B 2RVQD 5G49B 1HTAA 4ZUXC 4QLCB 2ZY4A 3AZIC 4DRBA 1BH8B 2NQBB 3LZ1C 4UUZA 1H3OA 5B40D 3AZMB 4DRAA 2BYKA 1P3FD 1Z2CB 2JSSA 4H9NA 3C1CD 3AZKB 3REHC 1ZLAA 5G49A 1P3KA 5CP6C 3AV1C 3X1UB 3H0LC 4J8WB 1U35A 3B6FB 1BH8A 2NQBA 1P3BD 2HIOC 1M18C 1Q9CA 1ID3B 2DQNC 4E45A 3MGQA 2L5AA 3W99C 3W97B 5AVCC 4YM6B 1ZLAD 4YS3C 4H9RA 3X1SA 4X23D 4KHAB 5CPJA 1P3KD 1BFMA 2ZM5A 1KX3A 5CPIA 4LD9A 3AZLA 3X1TA 3X1VC 4Z66C 3W98D 3O62B 2PYOC 4G91B 2Y2OA 1U35D 1N1JB 5B32B 5GT0B 3UTBD 3KUYC 2F8NK 5B0YB 1KX4A 3LZ0B 3MGQD 4H9QB 2ZY3A 2AROB 3LJAA 4H9SC 5B40C 1P3PA 1TZYA 3B0CW 5B2JC 4YM6A 3X1SD 5CPJD 3WKJA 1KX3D 4LD9D 5CPID 4WJ3C 4KHAA 3AZLD 3F6TA 3X1TD 3AZIB 3REIB 2IO5B 3UT9B 5BT1C 3O62A 3LZ1B 4J8XB 5AY8A 4DQYB 1KX4D 1W2EA 3LJAD 3AYWC 3MGRC 4EO5C 1TZYD 1P3PD 2AROA 5E5AB 4J8VA 1M1AA 3EPHA 3WKJD 2Y2LA 5CP6B 3AV1B 3LELC 4Z5TB 3KWQB 5AV6A 1P3KC 3UT9A 5AY8D 4UPKA 4J8XA 5B24A 1F66A 3RELA 1U35C 1P3OB 1WWIA 3W99B 2NQBC 5CHLB 2ZY5A 4YS3B 1M1AD 3AZMC 4XZQA 3AZKC 1P3MA 4KUDA 3FDDA 4Z5TA 5AV6D 3X1SC 4CAYA 3AFAA 4NE3A 3KWQA 5AV9D 3AZLC 3MVDA 5B24D 1F66D 5F99A 3RELD 4G92B 4J8WC 4XUJA 5B40B 5B1MD 1KX4C 1P3AA 1P3FB 3C1CB 5GSUD 3AZJA 2Y2QA 4XZQD 3A6ND 3LJAC 1P3MD 4KUDD 3W97C 1P3PC 1TZYC 2BG1A 4YM6C 3KXBA 2Y2NA 3WKJC 3AFAD 5GT3D 3MVDD 1M19A 5F99D 1B6WA 3O62C 5AY8C 1R4VA 4XUJD 2Y2KA 2CWEA 4EO5B 2BYKB 1P3AD 5B2IA 4H9NB 3AZJD 5B0YC 3LZ0C 3C1CA 1ZLAB 2BYMB 1TAFA 2AROC 3H0MC 4X23B 4J8VC 1P3KB 3KXBD 2CV5A 1M19D 3AZGD 1U35B 3REIC 1S32A 2IO5C 3UT9C 3B0DC 4J8XC 2FJ7A 5B24C 1P3BA 1F66C 3MGQB 5B2ID 5DNNA 3MNNA 1P3ID 3AZFA 4H9RB 5DNMA 3X1SB 5CPJB 5B0ZA 1KX3B 2BYMA 5CPIB 5E5AC 2G5HC 4X23A 5CPKD 3AZLB 4H9PA 3X1TB 1EQZA 4XZQC 2CV5D 1KX5A 1P3MC 1AOIA 4KUDC 4Z5TC 3W98A 1S32D 2NZDA 3KWQC 4WZSB 1P34A 2FJ7D 3MVDC 3UTAD 3UTBA 1KX4B 3EPKA 3TU4A 3AZNA 5DNND 3MNND 3LJAB 1P3OC 1P3PB 1TZYB 3AZFD 5DNMD 5C3IC 5B0ZD 1P3AC 3WKJB 3AZJC 5BS7C 4NE5A 1EQZD 1KX5D 5FUGA 3WAAA 1AOID 2RVQC 4WU9A 3REJD 1A7WA 2NZDD 5AY8B 1P34D 3VH5A 2JCHA 3AZEA 5GXQA 3TU4D 3AZND 5BO0A 5AV8D 4Z2MH 4G92C 2F2AC 3EPJA 3C1BA 1M1AB 4J8VB 3MGPA 3WA9A 5B2IC 3P5JB 3AZHD 1P3FC 2Y2PA 2J8PA 3C1CC 3B6GA 3WAAD 5BNXA 4WU9D 5JA4A 5AV6B 5JRGD 2Y2IA 3NQJA 3B0DB 5AV9B 1WWSA 4R8PA 5B24B 1B67A 1F66B 3WTPD 3AZED 3RELB 1ULYA 5GXQD 5B31A 1F1EA 1S32C 1P3LA 5KDMB 2YFVB 3C1BD 5B1MB 1P3BC 3MGPD 3WA9D 5GSUB 3MNNC 4XZQB 3A6NB 1P3MB 3REKD 3B6GD 4KUDB 2W8SA 5B0ZC 4CAYB 3EPLA 1ZLAC 3AFAB 4X23C 5GT3B 3MVDB 1EQZC 4R8PD 1KX5C 5AV9A 5F99B 5BNVA 5B1LA 5B31D 3W98C 1P3LD 3AN2A 2UWXA 2Y2JA 4XUJB 1P34C 1JFIA 5KDMA 3UTBC 2YFVA 5C3IB 3B0BA 5B1MA 1P3AB 3AZJB 1KU5A 2DF4C 3MGQC 1BH9A 5GSUA 5B31G 3A6NA 3KXBB 4JJND 5CPJC 1KX3C 4LD9C 5CPIC 1M19B 5GT3A 4CSRA 3AZGB 3X1TC 4WU9C 5B1LD 5B33A 3AN2D 1T3UA 4WNNA 1HQ3A 3AZEC 5GXQC 5B2IB 5AVBD 3AL0C 3VH6A 4NFTA 1P3IB 3C1BC 3NQUB 1TAFB 4LD9B 3VH5T 3WA9C 5CPKB 2LY8A 1P3GA 2CV5B 4ZUXD 1S32B 3AZGA 5B33D 2FJ7B 1HQ3D 4J8UA 1P3BB 1M18A 5B31C 1P3LC 5DNNB 3MNNB 4WU8A 3WTPE 3REHD 3AZFB 5DNMB 3V9RA 1P3IA 5B0ZB 3NQUA 3W96A 1M1AC 2F8NA 4H9PB 1P3GD 1EQZB 1KX5B 5CPKA 1AOIB 3MGSA 3X1VA 3W98B 3REJB 2NZDB 4AWLB 5AV6C 1P34B 4J8UD 3KSYA 2HIOD 5AV9C 3UTBB 1M18D 3TU4B 3UTAA 5B1LC 3AZNB 5AV8B 3RELC 3AN2C 4WU8D 3EG5B 5AVCD 3W96D 5B1MC 3A1IA 2F8ND 2RIQA 3AZHB 5FUGB 4HGAC 5GSUC 3WAAB 3MGSD 3X1VD 4Z66D 4WU9B 5JRGB 3A6NC 3R45A 2PYOD 3REJA 3AFAC 2F8NG 3WTPB 5GT3C 3AZEB 5GXQB 3KUYD 5F99C 5BO0B 4KGCA 5B33C 1HQ3C 3C1BB 5AV8A 3AYWA 2Y2MA 4XUJC 3MGPB 3MGRA 3WA9B 5B2JD 3REKB 3AV2A 3B6GB 3AZHA 5BNXB 3LELA 5JA4B 5AV5A 3NQJB 5BT1D 5JRGA 3KXBC 1P3GC 4R8PB 2Y2HA 3VH6T 5B31B 3WTPA 2HUEC 1P3LB 3AZGC 4QLCA 1M19C 4KGCD 4J8UC 3AYWD 3MGRD 3AZMA 4WU8C 4ZBJB 2YFWB 3AV2D 3LELD 3AZKA 5AV5D 3REKA 1P3IC 4M6BA 3W96C 2VQRA 4JJNB 4H9OB 5CPKC 3KFUG 3MGSC 2CV5C 5BNVB 5B1LB 4QLCD 3AN2B 2JE5A 3X1UA 1JFIB 4J8WA 1PZRA 2NQBD 3B6FA 2FJ7C 2Y2GA 3UTAC 5AVBB 3AZMD 1BH9B 3A1KA 1ID3A 4HGAB 5DNNC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AZK D;  2YFW A;  3W97 A;  3AZF C;  5DNM C;  4JJN A;  4H9O A;  4ZUX B;  4CSR B;  1AOI C;  3VH5 W;  5B33 B;  3REJ C;  4WNN B;  3X1U D;  2NZD C;  1HQ3 B;  4J8W D;  4AWL C;  3B6F D;  1N1J A;  5B32 A;  5GT0 A;  4E44 A;  4KGC C;  3TU4 C;  3AZN C;  1ID3 D;  5B0Y A;  3LZ0 A;  5AVB A;  5AV8 C;  3REH B;  4H9Q A;  3W97 D;  4YM6 D;  1P3G B;  3AV2 C;  3AZH C;  3WAA C;  4Z2M G;  4ZUX A;  2HUE B;  5AV5 C;  3AZI A;  5JRG C;  3REI A;  3O62 D;  4J8U B;  2HIO B;  3LZ1 A;  1M18 B;  5B32 D;  5GT0 D;  3B0C T;  3WTP C;  4QLC C;  4WU8 B;  5B0Y D;  3LZ0 D;  5AVC B;  3V9R B;  3W96 B;  3REH A;  2ARO D;  4J8V D;  2F8N B;  3MGP C;  5E5A A;  5B32 G;  3MGS B;  3X1V B;  4Z66 B;  4WV4 B;  5CP6 A;  3REK C;  4NE6 A;  3AV1 A;  2PYO B;  3B6G C;  3AZI D;  3REI D;  3UT9 D;  3LZ1 D;  4J8X D;  4R8P C;  3KUY B;  2HIO A;  3UTA B;  3X1U C;  1P3O A;  3B6F C;  3W99 A;  5B2J B;  5AVC A;  2F8N H;  4YS3 A;  5E5A D;  1ID3 C;  5BS7 A;  4ZBJ C;  3R45 B;  5CP6 D;  3AV1 D;  4Z66 A;  4Z5T D;  2PYO A;  3KWQ D;  4JJN C;  4KGC B;  3KUY A;  4G91 C;  4UUZ B;  3AYW B;  1P3O D;  1H3O B;  3MGR B;  3W99 D;  3VH6 W;  5B32 C;  4H9S A;  5GT0 C;  5B40 A;  5B2J A;  4YS3 D;  3AV2 B;  5AVB C;  3LEL B;  1P3F A;  5AV5 B;  2RVQ D;  5G49 B;  1HTA A;  4ZUX C;  4QLC B;  3AZI C;  4DRB A;  1BH8 B;  2NQB B;  3LZ1 C;  4UUZ A;  1H3O A;  5B40 D;  3AZM B;  4DRA A;  2BYK A;  1P3F D;  2JSS A;  4H9N A;  3C1C D;  3AZK B;  3REH C;  1ZLA A;  5G49 A;  1P3K A;  5CP6 C;  3AV1 C;  3X1U B;  4J8W B;  1U35 A;  3B6F B;  1BH8 A;  2NQB A;  1P3B D;  2HIO C;  1M18 C;  1Q9C A;  1ID3 B;  4E45 A;  3MGQ A;  2L5A A;  3W99 C;  3W97 B;  5AVC C;  4YM6 B;  1ZLA D;  4YS3 C;  4H9R A;  3X1S A;  4X23 D;  4KHA B;  5CPJ A;  1P3K D;  1BFM A;  1KX3 A;  4LD9 A;  5CPI A;  3AZL A;  3X1T A;  3X1V C;  4Z66 C;  3W98 D;  3O62 B;  2PYO C;  4G91 B;  1U35 D;  1N1J B;  5B32 B;  5GT0 B;  3UTB D;  3KUY C;  2F8N K;  5B0Y B;  1KX4 A;  3LZ0 B;  3MGQ D;  4H9Q B;  2ARO B;  3LJA A;  4H9S C;  5B40 C;  1P3P A;  1TZY A;  3B0C W;  5B2J C;  4YM6 A;  3X1S D;  5CPJ D;  3WKJ A;  1KX3 D;  4LD9 D;  5CPI D;  4KHA A;  3AZL D;  3X1T D;  3AZI B;  3REI B;  2IO5 B;  3UT9 B;  5BT1 C;  3O62 A;  3LZ1 B;  4J8X B;  5AY8 A;  1KX4 D;  3LJA D;  3AYW C;  3MGR C;  4EO5 C;  1TZY D;  1P3P D;  2ARO A;  5E5A B;  4J8V A;  1M1A A;  3WKJ D;  5CP6 B;  3AV1 B;  3LEL C;  4Z5T B;  3KWQ B;  5AV6 A;  1P3K C;  3UT9 A;  5AY8 D;  4J8X A;  5B24 A;  1F66 A;  3REL A;  1U35 C;  1P3O B;  1WWI A;  3W99 B;  2NQB C;  5CHL B;  4YS3 B;  1M1A D;  3AZM C;  4XZQ A;  3AZK C;  1P3M A;  4KUD A;  4Z5T A;  5AV6 D;  3X1S C;  4CAY A;  3AFA A;  4NE3 A;  3KWQ A;  5AV9 D;  3AZL C;  3MVD A;  5B24 D;  1F66 D;  5F99 A;  3REL D;  4G92 B;  4J8W C;  4XUJ A;  5B40 B;  5B1M D;  1KX4 C;  1P3A A;  1P3F B;  3C1C B;  5GSU D;  3AZJ A;  4XZQ D;  3A6N D;  3LJA C;  1P3M D;  4KUD D;  3W97 C;  1P3P C;  1TZY C;  4YM6 C;  3KXB A;  3WKJ C;  3AFA D;  5GT3 D;  3MVD D;  1M19 A;  5F99 D;  1B6W A;  3O62 C;  5AY8 C;  1R4V A;  4XUJ D;  2CWE A;  4EO5 B;  2BYK B;  1P3A D;  5B2I A;  4H9N B;  3AZJ D;  5B0Y C;  3LZ0 C;  3C1C A;  1ZLA B;  2BYM B;  1TAF A;  2ARO C;  4X23 B;  4J8V C;  1P3K B;  3KXB D;  2CV5 A;  1M19 D;  3AZG D;  1U35 B;  3REI C;  1S32 A;  2IO5 C;  3UT9 C;  3B0D C;  4J8X C;  2FJ7 A;  5B24 C;  1P3B A;  1F66 C;  3MGQ B;  5B2I D;  5DNN A;  3MNN A;  1P3I D;  3AZF A;  4H9R B;  5DNM A;  3X1S B;  5CPJ B;  5B0Z A;  1KX3 B;  2BYM A;  5CPI B;  5E5A C;  4LD9 B;  4X23 A;  5CPK D;  3AZL B;  4H9P A;  3X1T B;  1EQZ A;  4XZQ C;  2CV5 D;  1KX5 A;  1P3M C;  1AOI A;  4KUD C;  4Z5T C;  3W98 A;  1S32 D;  2NZD A;  3KWQ C;  4WZS B;  1P34 A;  2FJ7 D;  3MVD C;  3UTA D;  3UTB A;  1KX4 B;  3TU4 A;  3AZN A;  5DNN D;  3MNN D;  3LJA B;  1P3O C;  1P3P B;  1TZY B;  3AZF D;  5DNM D;  5C3I C;  5B0Z D;  1P3A C;  3WKJ B;  3AZJ C;  5BS7 C;  4NE5 A;  1EQZ D;  1KX5 D;  5FUG A;  3WAA A;  1AOI D;  2RVQ C;  4WU9 A;  3REJ D;  1A7W A;  2NZD D;  5AY8 B;  1P34 D;  3VH5 A;  3AZE A;  5GXQ A;  3TU4 D;  3AZN D;  5BO0 A;  5AV8 D;  4Z2M H;  4G92 C;  3C1B A;  1M1A B;  4J8V B;  3MGP A;  3WA9 A;  5B2I C;  3AZH D;  1P3F C;  3C1C C;  3WAA D;  3B6G A;  5BNX A;  4WU9 D;  5JA4 A;  5AV6 B;  5JRG D;  3NQJ A;  3B0D B;  5AV9 B;  1WWS A;  4R8P A;  5B24 B;  1B67 A;  1F66 B;  3WTP D;  3AZE D;  3REL B;  1ULY A;  5GXQ D;  5B31 A;  1F1E A;  1S32 C;  1P3L A;  5KDM B;  2YFV B;  3C1B D;  5B1M B;  1P3B C;  3MGP D;  3WA9 D;  5GSU B;  3MNN C;  4XZQ B;  3A6N B;  1P3M B;  3REK D;  3B6G D;  4KUD B;  5B0Z C;  4CAY B;  1ZLA C;  3AFA B;  4X23 C;  5GT3 B;  3MVD B;  1EQZ C;  4R8P D;  1KX5 C;  5AV9 A;  5F99 B;  5BNV A;  5B1L A;  5B31 D;  3W98 C;  1P3L D;  3AN2 A;  4XUJ B;  1P34 C;  1JFI A;  5KDM A;  3UTB C;  2YFV A;  5C3I B;  3B0B A;  5B1M A;  1P3A B;  3AZJ B;  1KU5 A;  3MGQ C;  1BH9 A;  5GSU A;  5B31 G;  3A6N A;  3KXB B;  4JJN D;  5CPJ C;  1KX3 C;  4LD9 C;  5CPI C;  1M19 B;  5GT3 A;  4CSR A;  3AZG B;  3X1T C;  4WU9 C;  5B1L D;  5B33 A;  3AN2 D;  4WNN A;  1HQ3 A;  3AZE C;  5GXQ C;  5B2I B;  5AVB D;  3VH6 A;  4NFT A;  1P3I B;  3C1B C;  3NQU B;  1TAF B;  3VH5 T;  3WA9 C;  5CPK B;  2LY8 A;  1P3G A;  2CV5 B;  4ZUX D;  1S32 B;  3AZG A;  5B33 D;  2FJ7 B;  1HQ3 D;  4J8U A;  1P3B B;  1M18 A;  5B31 C;  1P3L C;  5DNN B;  3MNN B;  4WU8 A;  3WTP E;  3REH D;  3AZF B;  5DNM B;  3V9R A;  1P3I A;  5B0Z B;  3NQU A;  3W96 A;  1M1A C;  2F8N A;  4H9P B;  1P3G D;  1EQZ B;  1KX5 B;  5CPK A;  1AOI B;  3MGS A;  3X1V A;  3W98 B;  3REJ B;  2NZD B;  4AWL B;  5AV6 C;  1P34 B;  4J8U D;  3KSY A;  2HIO D;  5AV9 C;  3UTB B;  1M18 D;  3TU4 B;  3UTA A;  5B1L C;  3AZN B;  5AV8 B;  3REL C;  3AN2 C;  4WU8 D;  5AVC D;  3W96 D;  5B1M C;  2F8N D;  3AZH B;  5FUG B;  4HGA C;  5GSU C;  3WAA B;  3MGS D;  3X1V D;  4Z66 D;  4WU9 B;  5JRG B;  3A6N C;  3R45 A;  2PYO D;  3REJ A;  3AFA C;  2F8N G;  3WTP B;  5GT3 C;  3AZE B;  5GXQ B;  3KUY D;  5F99 C;  5BO0 B;  4KGC A;  5B33 C;  1HQ3 C;  3C1B B;  5AV8 A;  3AYW A;  4XUJ C;  3MGP B;  3MGR A;  3WA9 B;  5B2J D;  3REK B;  3AV2 A;  3B6G B;  3AZH A;  5BNX B;  3LEL A;  5JA4 B;  5AV5 A;  3NQJ B;  5JRG A;  5BT1 D;  3KXB C;  1P3G C;  4R8P B;  3VH6 T;  5B31 B;  3WTP A;  2HUE C;  1P3L B;  3AZG C;  4QLC A;  1M19 C;  4KGC D;  4J8U C;  3AYW D;  3MGR D;  3AZM A;  4WU8 C;  4ZBJ B;  2YFW B;  3AV2 D;  3LEL D;  3AZK A;  5AV5 D;  3REK A;  1P3I C;  4M6B A;  3W96 C;  4JJN B;  4H9O B;  5CPK C;  3MGS C;  2CV5 C;  5BNV B;  5B1L B;  4QLC D;  3AN2 B;  3X1U A;  1JFI B;  4J8W A;  2NQB D;  3B6F A;  2FJ7 C;  3UTA C;  5AVB B;  3AZM D;  1BH9 B;  1ID3 A;  4HGA B;  5DNN C; 
#chains in the Genus database with same CATH topology
 3AZK D;  2ZY2 A;  2YFW A;  3W97 A;  3AZF C;  5DNM C;  4JJN A;  4H9O A;  4ZUX B;  4CSR B;  1AOI C;  3VH5 W;  5B33 B;  3REJ C;  2XD1 A;  4WNN B;  3X1U D;  1HQ3 B;  4J8W D;  2NZD C;  4AWL C;  2XD5 A;  3B6F D;  1N1J A;  5B32 A;  5GT0 A;  4E44 A;  4KGC C;  3TU4 C;  3AZN C;  1ID3 D;  5B0Y A;  3LZ0 A;  5AVB A;  5AV8 C;  3REH B;  4H9Q A;  3W97 D;  3IP4 C;  4YM6 D;  1P3G B;  3AV2 C;  3AZH C;  3WAA C;  4Z2M G;  4ZUX A;  2HUE B;  5AV5 C;  3AZI A;  5JRG C;  3REI A;  3O62 D;  4J8U B;  2HIO B;  3LZ1 A;  1M18 B;  5B32 D;  5GT0 D;  3B0C T;  3WTP C;  4QLC C;  4WU8 B;  5B0Y D;  3LZ0 D;  5AVC B;  3V9R B;  3W96 B;  3REH A;  2ARO D;  4J8V D;  2F8N B;  3MGP C;  2FFF B;  5E5A A;  5B32 G;  3MGS B;  3X1V B;  4Z66 B;  4WV4 B;  2G5I C;  5CP6 A;  4NE6 A;  3REK C;  3AV1 A;  2PYO B;  3B6G C;  3AZI D;  3REI D;  3UT9 D;  3LZ1 D;  4J8X D;  4R8P C;  3KUY B;  2HIO A;  3UTA B;  3X1U C;  1P3O A;  3B6F C;  3W99 A;  5B2J B;  5AVC A;  2F8N H;  4YS3 A;  5E5A D;  1ID3 C;  5BS7 A;  4ZBJ C;  3R45 B;  5CP6 D;  3AV1 D;  4Z66 A;  4Z5T D;  2PYO A;  3KWQ D;  4JJN C;  4KGC B;  3KUY A;  4G91 C;  4UUZ B;  3AYW B;  1P3O D;  1H3O B;  3MGR B;  3W99 D;  3VH6 W;  5B32 C;  4H9S A;  5GT0 C;  5B40 A;  5B2J A;  4YS3 D;  3AV2 B;  5AVB C;  3LEL B;  1P3F A;  3H0R C;  5AV5 B;  2RVQ D;  5G49 B;  1HTA A;  4ZUX C;  4QLC B;  2ZY4 A;  3AZI C;  4DRB A;  1BH8 B;  2NQB B;  3LZ1 C;  4UUZ A;  1H3O A;  5B40 D;  3AZM B;  4DRA A;  2BYK A;  1P3F D;  1Z2C B;  2JSS A;  4H9N A;  3C1C D;  3AZK B;  3REH C;  1ZLA A;  5G49 A;  1P3K A;  5CP6 C;  3AV1 C;  3X1U B;  3H0L C;  4J8W B;  1U35 A;  3B6F B;  1BH8 A;  2NQB A;  1P3B D;  2HIO C;  1M18 C;  1Q9C A;  1ID3 B;  2DQN C;  4E45 A;  3MGQ A;  2L5A A;  3W99 C;  3W97 B;  5AVC C;  4YM6 B;  1ZLA D;  4YS3 C;  4H9R A;  3X1S A;  4X23 D;  4KHA B;  5CPJ A;  1P3K D;  1BFM A;  2ZM5 A;  1KX3 A;  5CPI A;  4LD9 A;  3AZL A;  3X1T A;  3X1V C;  4Z66 C;  3W98 D;  3O62 B;  2PYO C;  4G91 B;  2Y2O A;  1U35 D;  1N1J B;  5B32 B;  5GT0 B;  3UTB D;  3KUY C;  2F8N K;  5B0Y B;  1KX4 A;  3LZ0 B;  3MGQ D;  4H9Q B;  2ZY3 A;  2ARO B;  3LJA A;  4H9S C;  5B40 C;  1P3P A;  1TZY A;  3B0C W;  5B2J C;  4YM6 A;  3X1S D;  5CPJ D;  3WKJ A;  1KX3 D;  4LD9 D;  5CPI D;  4WJ3 C;  4KHA A;  3AZL D;  3F6T A;  3X1T D;  3AZI B;  3REI B;  2IO5 B;  3UT9 B;  5BT1 C;  3O62 A;  3LZ1 B;  4J8X B;  5AY8 A;  4DQY B;  1KX4 D;  1W2E A;  3LJA D;  3AYW C;  3MGR C;  4EO5 C;  1TZY D;  1P3P D;  2ARO A;  5E5A B;  4J8V A;  1M1A A;  3EPH A;  3WKJ D;  2Y2L A;  5CP6 B;  3AV1 B;  3LEL C;  4Z5T B;  3KWQ B;  5AV6 A;  1P3K C;  3UT9 A;  5AY8 D;  4UPK A;  4J8X A;  5B24 A;  1F66 A;  3REL A;  1U35 C;  1P3O B;  1WWI A;  3W99 B;  2NQB C;  5CHL B;  2ZY5 A;  4YS3 B;  1M1A D;  3AZM C;  4XZQ A;  3AZK C;  1P3M A;  4KUD A;  3FDD A;  4Z5T A;  5AV6 D;  3X1S C;  4CAY A;  3AFA A;  4NE3 A;  3KWQ A;  5AV9 D;  3AZL C;  3MVD A;  5B24 D;  1F66 D;  5F99 A;  3REL D;  4G92 B;  4J8W C;  4XUJ A;  5B40 B;  5B1M D;  1KX4 C;  1P3A A;  1P3F B;  3C1C B;  5GSU D;  3AZJ A;  2Y2Q A;  4XZQ D;  3A6N D;  3LJA C;  1P3M D;  4KUD D;  3W97 C;  1P3P C;  1TZY C;  2BG1 A;  4YM6 C;  3KXB A;  2Y2N A;  3WKJ C;  3AFA D;  5GT3 D;  3MVD D;  1M19 A;  5F99 D;  1B6W A;  3O62 C;  5AY8 C;  1R4V A;  4XUJ D;  2Y2K A;  2CWE A;  4EO5 B;  2BYK B;  1P3A D;  5B2I A;  4H9N B;  3AZJ D;  5B0Y C;  3LZ0 C;  3C1C A;  1ZLA B;  2BYM B;  1TAF A;  2ARO C;  3H0M C;  4X23 B;  4J8V C;  1P3K B;  3KXB D;  2CV5 A;  1M19 D;  3AZG D;  1U35 B;  3REI C;  1S32 A;  2IO5 C;  3UT9 C;  3B0D C;  4J8X C;  2FJ7 A;  5B24 C;  1P3B A;  1F66 C;  3MGQ B;  5B2I D;  5DNN A;  3MNN A;  1P3I D;  3AZF A;  4H9R B;  5DNM A;  3X1S B;  5CPJ B;  5B0Z A;  1KX3 B;  2BYM A;  5CPI B;  5E5A C;  2G5H C;  4X23 A;  5CPK D;  3AZL B;  4H9P A;  3X1T B;  1EQZ A;  4XZQ C;  2CV5 D;  1KX5 A;  1P3M C;  1AOI A;  4KUD C;  4Z5T C;  3W98 A;  1S32 D;  2NZD A;  3KWQ C;  4WZS B;  1P34 A;  2FJ7 D;  3MVD C;  3UTA D;  3UTB A;  1KX4 B;  3EPK A;  3TU4 A;  3AZN A;  5DNN D;  3MNN D;  3LJA B;  1P3O C;  1P3P B;  1TZY B;  3AZF D;  5DNM D;  5C3I C;  5B0Z D;  1P3A C;  3WKJ B;  3AZJ C;  5BS7 C;  4NE5 A;  1EQZ D;  1KX5 D;  5FUG A;  3WAA A;  1AOI D;  2RVQ C;  4WU9 A;  3REJ D;  1A7W A;  2NZD D;  5AY8 B;  1P34 D;  3VH5 A;  2JCH A;  3AZE A;  5GXQ A;  3TU4 D;  3AZN D;  5BO0 A;  5AV8 D;  4Z2M H;  4G92 C;  2F2A C;  3EPJ A;  3C1B A;  1M1A B;  4J8V B;  3MGP A;  3WA9 A;  5B2I C;  3P5J B;  3AZH D;  1P3F C;  2Y2P A;  2J8P A;  3C1C C;  3B6G A;  3WAA D;  5BNX A;  4WU9 D;  5JA4 A;  5AV6 B;  5JRG D;  2Y2I A;  3NQJ A;  3B0D B;  5AV9 B;  1WWS A;  4R8P A;  5B24 B;  1B67 A;  1F66 B;  3WTP D;  3AZE D;  3REL B;  1ULY A;  5GXQ D;  5B31 A;  1F1E A;  1S32 C;  1P3L A;  5KDM B;  2YFV B;  3C1B D;  5B1M B;  1P3B C;  3MGP D;  3WA9 D;  5GSU B;  3MNN C;  4XZQ B;  3A6N B;  1P3M B;  3REK D;  3B6G D;  4KUD B;  2W8S A;  5B0Z C;  4CAY B;  3EPL A;  1ZLA C;  3AFA B;  4X23 C;  5GT3 B;  3MVD B;  1EQZ C;  4R8P D;  1KX5 C;  5AV9 A;  5F99 B;  5BNV A;  5B1L A;  5B31 D;  3W98 C;  1P3L D;  3AN2 A;  2UWX A;  2Y2J A;  4XUJ B;  1P34 C;  1JFI A;  5KDM A;  3UTB C;  2YFV A;  5C3I B;  3B0B A;  5B1M A;  1P3A B;  3AZJ B;  1KU5 A;  2DF4 C;  3MGQ C;  1BH9 A;  5GSU A;  5B31 G;  3A6N A;  3KXB B;  4JJN D;  5CPJ C;  1KX3 C;  4LD9 C;  5CPI C;  1M19 B;  5GT3 A;  4CSR A;  3AZG B;  3X1T C;  4WU9 C;  5B1L D;  5B33 A;  3AN2 D;  1T3U A;  4WNN A;  1HQ3 A;  3AZE C;  5GXQ C;  5B2I B;  5AVB D;  3AL0 C;  3VH6 A;  4NFT A;  1P3I B;  3C1B C;  3NQU B;  1TAF B;  4LD9 B;  3VH5 T;  3WA9 C;  5CPK B;  2LY8 A;  1P3G A;  2CV5 B;  4ZUX D;  1S32 B;  3AZG A;  5B33 D;  2FJ7 B;  1HQ3 D;  4J8U A;  1P3B B;  1M18 A;  5B31 C;  1P3L C;  5DNN B;  3MNN B;  4WU8 A;  3WTP E;  3REH D;  3AZF B;  5DNM B;  3V9R A;  1P3I A;  5B0Z B;  3NQU A;  3W96 A;  1M1A C;  2F8N A;  4H9P B;  1P3G D;  1EQZ B;  1KX5 B;  5CPK A;  1AOI B;  3MGS A;  3X1V A;  3W98 B;  3REJ B;  2NZD B;  4AWL B;  5AV6 C;  1P34 B;  4J8U D;  3KSY A;  2HIO D;  5AV9 C;  3UTB B;  1M18 D;  3TU4 B;  3UTA A;  5B1L C;  3AZN B;  5AV8 B;  3REL C;  3AN2 C;  4WU8 D;  3EG5 B;  5AVC D;  3W96 D;  5B1M C;  3A1I A;  2F8N D;  2RIQ A;  3AZH B;  5FUG B;  4HGA C;  5GSU C;  3WAA B;  3MGS D;  3X1V D;  4Z66 D;  4WU9 B;  5JRG B;  3A6N C;  3R45 A;  2PYO D;  3REJ A;  3AFA C;  2F8N G;  3WTP B;  5GT3 C;  3AZE B;  5GXQ B;  3KUY D;  5F99 C;  5BO0 B;  4KGC A;  5B33 C;  1HQ3 C;  3C1B B;  5AV8 A;  3AYW A;  2Y2M A;  4XUJ C;  3MGP B;  3MGR A;  3WA9 B;  5B2J D;  3REK B;  3AV2 A;  3B6G B;  3AZH A;  5BNX B;  3LEL A;  5JA4 B;  5AV5 A;  3NQJ B;  5BT1 D;  5JRG A;  3KXB C;  1P3G C;  4R8P B;  2Y2H A;  3VH6 T;  5B31 B;  3WTP A;  2HUE C;  1P3L B;  3AZG C;  4QLC A;  1M19 C;  4KGC D;  4J8U C;  3AYW D;  3MGR D;  3AZM A;  4WU8 C;  4ZBJ B;  2YFW B;  3AV2 D;  3LEL D;  3AZK A;  5AV5 D;  3REK A;  1P3I C;  4M6B A;  3W96 C;  2VQR A;  4JJN B;  4H9O B;  5CPK C;  3KFU G;  3MGS C;  2CV5 C;  5BNV B;  5B1L B;  4QLC D;  3AN2 B;  2JE5 A;  3X1U A;  1JFI B;  4J8W A;  1PZR A;  2NQB D;  3B6F A;  2FJ7 C;  2Y2G A;  3UTA C;  5AVB B;  3AZM D;  1BH9 B;  3A1K A;  1ID3 A;  4HGA B;  5DNN C; 
#chains in the Genus database with same CATH homology
 3AZK D;  2ZY2 A;  2YFW A;  3W97 A;  3AZF C;  5DNM C;  4JJN A;  4H9O A;  4ZUX B;  4CSR B;  1AOI C;  3VH5 W;  5B33 B;  3REJ C;  2XD1 A;  4WNN B;  3X1U D;  1HQ3 B;  4J8W D;  2NZD C;  4AWL C;  2XD5 A;  3B6F D;  1N1J A;  5B32 A;  5GT0 A;  4E44 A;  4KGC C;  3TU4 C;  3AZN C;  1ID3 D;  5B0Y A;  3LZ0 A;  5AVB A;  5AV8 C;  3REH B;  4H9Q A;  3W97 D;  3IP4 C;  4YM6 D;  1P3G B;  3AV2 C;  3AZH C;  3WAA C;  4Z2M G;  4ZUX A;  2HUE B;  5AV5 C;  3AZI A;  5JRG C;  3REI A;  3O62 D;  4J8U B;  2HIO B;  3LZ1 A;  1M18 B;  5B32 D;  5GT0 D;  3B0C T;  3WTP C;  4QLC C;  4WU8 B;  5B0Y D;  3LZ0 D;  5AVC B;  3V9R B;  3W96 B;  3REH A;  2ARO D;  4J8V D;  2F8N B;  3MGP C;  2FFF B;  5E5A A;  5B32 G;  3MGS B;  3X1V B;  4Z66 B;  4WV4 B;  2G5I C;  5CP6 A;  4NE6 A;  3REK C;  3AV1 A;  2PYO B;  3B6G C;  3AZI D;  3REI D;  3UT9 D;  3LZ1 D;  4J8X D;  4R8P C;  3KUY B;  2HIO A;  3UTA B;  3X1U C;  1P3O A;  3B6F C;  3W99 A;  5B2J B;  5AVC A;  2F8N H;  4YS3 A;  5E5A D;  1ID3 C;  5BS7 A;  4ZBJ C;  3R45 B;  5CP6 D;  3AV1 D;  4Z66 A;  4Z5T D;  2PYO A;  3KWQ D;  4JJN C;  4KGC B;  3KUY A;  4G91 C;  4UUZ B;  3AYW B;  1P3O D;  1H3O B;  3MGR B;  3W99 D;  3VH6 W;  5B32 C;  4H9S A;  5GT0 C;  5B40 A;  5B2J A;  4YS3 D;  3AV2 B;  5AVB C;  3LEL B;  1P3F A;  3H0R C;  5AV5 B;  2RVQ D;  5G49 B;  1HTA A;  4ZUX C;  4QLC B;  2ZY4 A;  3AZI C;  4DRB A;  1BH8 B;  2NQB B;  3LZ1 C;  4UUZ A;  1H3O A;  5B40 D;  3AZM B;  4DRA A;  2BYK A;  1P3F D;  1Z2C B;  2JSS A;  4H9N A;  3C1C D;  3AZK B;  3REH C;  1ZLA A;  5G49 A;  1P3K A;  5CP6 C;  3AV1 C;  3X1U B;  3H0L C;  4J8W B;  1U35 A;  3B6F B;  1BH8 A;  2NQB A;  1P3B D;  2HIO C;  1M18 C;  1Q9C A;  1ID3 B;  2DQN C;  4E45 A;  3MGQ A;  2L5A A;  3W99 C;  3W97 B;  5AVC C;  4YM6 B;  1ZLA D;  4YS3 C;  4H9R A;  3X1S A;  4X23 D;  4KHA B;  5CPJ A;  1P3K D;  1BFM A;  2ZM5 A;  1KX3 A;  5CPI A;  4LD9 A;  3AZL A;  3X1T A;  3X1V C;  4Z66 C;  3W98 D;  3O62 B;  2PYO C;  4G91 B;  2Y2O A;  1U35 D;  1N1J B;  5B32 B;  5GT0 B;  3UTB D;  3KUY C;  2F8N K;  5B0Y B;  1KX4 A;  3LZ0 B;  3MGQ D;  4H9Q B;  2ZY3 A;  2ARO B;  3LJA A;  4H9S C;  5B40 C;  1P3P A;  1TZY A;  3B0C W;  5B2J C;  4YM6 A;  3X1S D;  5CPJ D;  3WKJ A;  1KX3 D;  4LD9 D;  5CPI D;  4WJ3 C;  4KHA A;  3AZL D;  3F6T A;  3X1T D;  3AZI B;  3REI B;  2IO5 B;  3UT9 B;  5BT1 C;  3O62 A;  3LZ1 B;  4J8X B;  5AY8 A;  4DQY B;  1KX4 D;  1W2E A;  3LJA D;  3AYW C;  3MGR C;  4EO5 C;  1TZY D;  1P3P D;  2ARO A;  5E5A B;  4J8V A;  1M1A A;  3EPH A;  3WKJ D;  2Y2L A;  5CP6 B;  3AV1 B;  3LEL C;  4Z5T B;  3KWQ B;  5AV6 A;  1P3K C;  3UT9 A;  5AY8 D;  4UPK A;  4J8X A;  5B24 A;  1F66 A;  3REL A;  1U35 C;  1P3O B;  1WWI A;  3W99 B;  2NQB C;  5CHL B;  2ZY5 A;  4YS3 B;  1M1A D;  3AZM C;  4XZQ A;  3AZK C;  1P3M A;  4KUD A;  3FDD A;  4Z5T A;  5AV6 D;  3X1S C;  4CAY A;  3AFA A;  4NE3 A;  3KWQ A;  5AV9 D;  3AZL C;  3MVD A;  5B24 D;  1F66 D;  5F99 A;  3REL D;  4G92 B;  4J8W C;  4XUJ A;  5B40 B;  5B1M D;  1KX4 C;  1P3A A;  1P3F B;  3C1C B;  5GSU D;  3AZJ A;  2Y2Q A;  4XZQ D;  3A6N D;  3LJA C;  1P3M D;  4KUD D;  3W97 C;  1P3P C;  1TZY C;  2BG1 A;  4YM6 C;  3KXB A;  2Y2N A;  3WKJ C;  3AFA D;  5GT3 D;  3MVD D;  1M19 A;  5F99 D;  1B6W A;  3O62 C;  5AY8 C;  1R4V A;  4XUJ D;  2Y2K A;  2CWE A;  4EO5 B;  2BYK B;  1P3A D;  5B2I A;  4H9N B;  3AZJ D;  5B0Y C;  3LZ0 C;  3C1C A;  1ZLA B;  2BYM B;  1TAF A;  2ARO C;  3H0M C;  4X23 B;  4J8V C;  1P3K B;  3KXB D;  2CV5 A;  1M19 D;  3AZG D;  1U35 B;  3REI C;  1S32 A;  2IO5 C;  3UT9 C;  3B0D C;  4J8X C;  2FJ7 A;  5B24 C;  1P3B A;  1F66 C;  3MGQ B;  5B2I D;  5DNN A;  3MNN A;  1P3I D;  3AZF A;  4H9R B;  5DNM A;  3X1S B;  5CPJ B;  5B0Z A;  1KX3 B;  2BYM A;  5CPI B;  5E5A C;  2G5H C;  4X23 A;  5CPK D;  3AZL B;  4H9P A;  3X1T B;  1EQZ A;  4XZQ C;  2CV5 D;  1KX5 A;  1P3M C;  1AOI A;  4KUD C;  4Z5T C;  3W98 A;  1S32 D;  2NZD A;  3KWQ C;  4WZS B;  1P34 A;  2FJ7 D;  3MVD C;  3UTA D;  3UTB A;  1KX4 B;  3EPK A;  3TU4 A;  3AZN A;  5DNN D;  3MNN D;  3LJA B;  1P3O C;  1P3P B;  1TZY B;  3AZF D;  5DNM D;  5C3I C;  5B0Z D;  1P3A C;  3WKJ B;  3AZJ C;  5BS7 C;  4NE5 A;  1EQZ D;  1KX5 D;  5FUG A;  3WAA A;  1AOI D;  2RVQ C;  4WU9 A;  3REJ D;  1A7W A;  2NZD D;  5AY8 B;  1P34 D;  3VH5 A;  2JCH A;  3AZE A;  5GXQ A;  3TU4 D;  3AZN D;  5BO0 A;  5AV8 D;  4Z2M H;  4G92 C;  2F2A C;  3EPJ A;  3C1B A;  1M1A B;  4J8V B;  3MGP A;  3WA9 A;  5B2I C;  3P5J B;  3AZH D;  1P3F C;  2Y2P A;  2J8P A;  3C1C C;  3B6G A;  3WAA D;  5BNX A;  4WU9 D;  5JA4 A;  5AV6 B;  5JRG D;  2Y2I A;  3NQJ A;  3B0D B;  5AV9 B;  1WWS A;  4R8P A;  5B24 B;  1B67 A;  1F66 B;  3WTP D;  3AZE D;  3REL B;  1ULY A;  5GXQ D;  5B31 A;  1F1E A;  1S32 C;  1P3L A;  5KDM B;  2YFV B;  3C1B D;  5B1M B;  1P3B C;  3MGP D;  3WA9 D;  5GSU B;  3MNN C;  4XZQ B;  3A6N B;  1P3M B;  3REK D;  3B6G D;  4KUD B;  2W8S A;  5B0Z C;  4CAY B;  3EPL A;  1ZLA C;  3AFA B;  4X23 C;  5GT3 B;  3MVD B;  1EQZ C;  4R8P D;  1KX5 C;  5AV9 A;  5F99 B;  5BNV A;  5B1L A;  5B31 D;  3W98 C;  1P3L D;  3AN2 A;  2UWX A;  2Y2J A;  4XUJ B;  1P34 C;  1JFI A;  5KDM A;  3UTB C;  2YFV A;  5C3I B;  3B0B A;  5B1M A;  1P3A B;  3AZJ B;  1KU5 A;  2DF4 C;  3MGQ C;  1BH9 A;  5GSU A;  5B31 G;  3A6N A;  3KXB B;  4JJN D;  5CPJ C;  1KX3 C;  4LD9 C;  5CPI C;  1M19 B;  5GT3 A;  4CSR A;  3AZG B;  3X1T C;  4WU9 C;  5B1L D;  5B33 A;  3AN2 D;  1T3U A;  4WNN A;  1HQ3 A;  3AZE C;  5GXQ C;  5B2I B;  5AVB D;  3AL0 C;  3VH6 A;  4NFT A;  1P3I B;  3C1B C;  3NQU B;  1TAF B;  4LD9 B;  3VH5 T;  3WA9 C;  5CPK B;  2LY8 A;  1P3G A;  2CV5 B;  4ZUX D;  1S32 B;  3AZG A;  5B33 D;  2FJ7 B;  1HQ3 D;  4J8U A;  1P3B B;  1M18 A;  5B31 C;  1P3L C;  5DNN B;  3MNN B;  4WU8 A;  3WTP E;  3REH D;  3AZF B;  5DNM B;  3V9R A;  1P3I A;  5B0Z B;  3NQU A;  3W96 A;  1M1A C;  2F8N A;  4H9P B;  1P3G D;  1EQZ B;  1KX5 B;  5CPK A;  1AOI B;  3MGS A;  3X1V A;  3W98 B;  3REJ B;  2NZD B;  4AWL B;  5AV6 C;  1P34 B;  4J8U D;  3KSY A;  2HIO D;  5AV9 C;  3UTB B;  1M18 D;  3TU4 B;  3UTA A;  5B1L C;  3AZN B;  5AV8 B;  3REL C;  3AN2 C;  4WU8 D;  3EG5 B;  5AVC D;  3W96 D;  5B1M C;  3A1I A;  2F8N D;  2RIQ A;  3AZH B;  5FUG B;  4HGA C;  5GSU C;  3WAA B;  3MGS D;  3X1V D;  4Z66 D;  4WU9 B;  5JRG B;  3A6N C;  3R45 A;  2PYO D;  3REJ A;  3AFA C;  2F8N G;  3WTP B;  5GT3 C;  3AZE B;  5GXQ B;  3KUY D;  5F99 C;  5BO0 B;  4KGC A;  5B33 C;  1HQ3 C;  3C1B B;  5AV8 A;  3AYW A;  2Y2M A;  4XUJ C;  3MGP B;  3MGR A;  3WA9 B;  5B2J D;  3REK B;  3AV2 A;  3B6G B;  3AZH A;  5BNX B;  3LEL A;  5JA4 B;  5AV5 A;  3NQJ B;  5BT1 D;  5JRG A;  3KXB C;  1P3G C;  4R8P B;  2Y2H A;  3VH6 T;  5B31 B;  3WTP A;  2HUE C;  1P3L B;  3AZG C;  4QLC A;  1M19 C;  4KGC D;  4J8U C;  3AYW D;  3MGR D;  3AZM A;  4WU8 C;  4ZBJ B;  2YFW B;  3AV2 D;  3LEL D;  3AZK A;  5AV5 D;  3REK A;  1P3I C;  4M6B A;  3W96 C;  2VQR A;  4JJN B;  4H9O B;  5CPK C;  3KFU G;  3MGS C;  2CV5 C;  5BNV B;  5B1L B;  4QLC D;  3AN2 B;  2JE5 A;  3X1U A;  1JFI B;  4J8W A;  1PZR A;  2NQB D;  3B6F A;  2FJ7 C;  2Y2G A;  3UTA C;  5AVB B;  3AZM D;  1BH9 B;  3A1K A;  1ID3 A;  4HGA B;  5DNN C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...