2NZDD

Nucleosome core particle containing 145 bp of dna
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
95
structure length
95
Chain Sequence
b'KTRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA (145-MER)
publication title DNA stretching and extreme kinking in the nucleosome core
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Structural protein/dna
total genus 37
structure length 95
sequence length 95
chains with identical sequence H
ec nomenclature
pdb deposition date 2006-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 2nzdD00
4WNNB 4KGCD 4G91C 3X1SA 2L5AA 1B67A 1A7WA 2YFWA 5B31G 3UTAA 4WU8D 1M18A 4R8PA 1HQ3D 3C1CA 3AZJA 3W99C 3NQJA 3MGQD 4Z2MG 5AY8B 4Z2MH 3A6NB 2IO5B 3X1TD 5AV9D 3C1BA 3O62B 4H9NB 5JRGD 1ULYA 1P3KB 2F8NK 1M19D 5DNNA 3REIB 1P3AD 2CV5B 3AZGA 1ZLAA 3AZHC 3AZKC 3LZ0B 3AZFD 3WTPC 3UTBA 4ZUXA 1P3ID 5AV5C 5B24A 3X1VB 1P3PC 3LELA 2YFVB 5B2JA 3W96A 4YS3C 3NQUB 1KX4D 3B6GB 2RVQC 2AROD 3AZMC 4H9SC 3AFAA 5B33C 3B6FD 3LZ1D 1F66A 5GSUB 5AVCC 3W99D 1M1AC 4QLCC 3MGRA 4KUDB 3KUYC 5B1MA 5B31C 3REHA 4J8VA 4J8VD 3AN2A 3W98B 2LY8A 4KGCA 1KX5D 3WKJB 3MNNB 4WU8A 3KXBD 5B0YD 3UTAC 1M18C 3MGQA 3AV2B 3AZHD 3R45A 4R8PC 3C1CC 3AZJC 4H9RB 3AZKD 3WTPD 3X1UC 5GT0B 3AZIB 5AV5B 3AZNB 3AYWB 1P3PD 3MVDB 4Z66A 3C1BC 3WA9A 4YS3D 3TU4D 1M19A 3AZMB 1BH8A 2BYMB 5B33B 3W97D 5AV8B 5AVCD 5JA4A 1M1AD 3AZGC 1U35B 1ZLAC 3B0CW 3WTPE 1P3IA 4J8XA 1P3MB 5GT3C 5CPKB 3UTBC 5BNXB 2NQBB 1S32C 5B32D 4WZSB 5B24C 5KDMB 1KX4A 3LELC 5BNVA 2AROA 5B2JC 3B6FA 2CWEA 3X1SD 3LZ1A 2FJ7C 2PYOA 1N1JB 3AFAC 5B2IA 1M18D 3LJAA 1H3OB 4R8PD 3C1CD 5BS7A 5CHLB 5AVBC 5BT1C 4H9QB 5B0ZC 1KX5A 5B1MC 3REHC 3C1BD 4J8VC 1KX3B 4DRBA 1P3FD 4KGCC 5CPJA 4KHAB 2NZDA 5CP6B 5AV6A 4YM6B 4WU8C 5DNND 4JJNB 5DNMB 1ID3D 3REJB 3AZGD 1ZLAD 3MGQC 4AWLC 4EO5C 1P3BA 4XZQB 5GSUA 3UTBD 4ZUXD 1P3LA 4X23A 3KWQB 3LELD 4Z66C 3W97A 4CSRB 3W96D 2FJ7B 3W98A 1M19C 5B40A 1P3OD 2F8NA 4E44A 1JFIB 3WKJA 4J8UA 4ZBJB 4XUJA 3UT9B 1F66D 5BT1D 1P3IC 5G49B 3MGRD 5B32A 4J8XC 1EQZA 5B1LD 5B1MD 3REHD 3B0CT 3AN2D 1AOIB 2HIOD 4Z5TA 4LD9B 1KX4C 4UUZB 4E45A 2AROC 3B6FC 3REKD 1HQ3B 3LZ1C 5B32G 2PYOC 5AV8A 5B2IC 3LJAC 3X1TB 5AV9B 5BS7C 4H9OA 4NE6A 3WAAB 5GXQD 4J8WA 1P3FA 5E5AA 5JRGB 1KX5C 3VH6W 4Z66D 3WA9D 3KXBC 5CPJC 5B0YC 1P3AB 4WU9D 1ID3A 3RELB 5F99A 3VH5W 3AZFB 1P34A 1TZYB 3MGPA 3KSYA 4J8XD 1P3BC 1P3GA 4G91B 3TU4C 1P3LC 4X23C 1HTAA 1P3OA 3W97C 3O62D 3AZLA 3B0DC 4WV4B 5B40C 5CPIA 3W99B 2PYOD 5B2ID 1P3KD 3LJAD 4J8UC 4XUJC 5B1LA 3AZEA 3AV1A 3REJA 5C3IC 2HIOA 5B32C 1EQZC 3KXBB 5B0YB 3REKA 5CPJD 3X1SC 2NZDD 5AV6D 1TAFB 3AZHB 3AZKB 2HUEC 3WTPB 4HGAC 4G92C 5GXQA 1P3PB 1P3BD 5GSUD 1WWSA 4YS3B 3TU4B 1P3FC 5E5AC 1P3LD 4X23D 4WU9A 4CAYA 3MGSA 3V9RA 3W98D 1AOIA 4WNNA 3VH6T 5AVCB 5B40D 2F8ND 5DNNC 1M1AB 1ID3C 3WKJD 5F99C 4QLCB 4J8UD 4XUJD 3KUYB 5B31B 3VH5T 4ZUXC 5AY8A 3A6NA 1EQZD 3AZND 1BH9B 3WAAA 3O62A 3W96C 4Z5TD 3VH6A 3AYWD 1P3OC 4H9NA 3UTAB 1M18B 3AZLC 1P3KA 4R8PB 3C1CB 3AZJB 3X1UB 3NQJB 1F66C 3REIA 5AV8D 2CV5A 3MGRC 3C1BB 1TZYA 5B1LC 3LZ0A 3AZEC 3AV1C 1U35D 4J8WD 3AN2C 5E5AD 2HIOC 3X1VA 2YFVA 5CPKD 5DNNB 3REKC 3NQUA 3B6GA 3AZGB 1ZLAB 5F99D 5GT3B 1P34D 1BFMA 2JSSA 3UTBB 4ZUXB 1S32B 5GXQC 5B24B 3MGPD 3LELB 5B2JB 4KUDA 3W96B 1P3GD 3WA9C 5BO0B 3AFAB 4WU9C 3MGSC 3AZLD 3MNNA 1F66B 5CPID 5AVBB 5B0ZB 3AV2A 5B1MB 3REHB 4J8VB 4H9RA 3AZED 3AV1D 3AN2B 2F8NG 3REJD 3AZIA 5GT0A 3AZNA 5AV5A 2F8NH 4KGCB 3A6NC 2IO5C 4XZQD 3MVDA 3AYWA 4WU8B 3O62C 3AZMA 2BYMA 5B33A 3MGQB 3R45B 4AWLB 1P3KC 4EO5B 3REIC 2CV5C 1U35A 4Z66B 3KUYA 1P3MA 3LZ0C 5CPKA 1M19B 1BH8B 5BNXA 2NQBA 3X1VC 5KDMA 2NZDC 3MGSD 5AV6C 1BH9A 1AOID 4LD9D 5JA4B 3B6GC 1N1JA 1P3IB 4J8XB 1H3OA 3X1UA 5GSUC 4H9QA 1KX4B 5AY8D 5BNVB 3A6ND 2AROB 4KUDC 1WWIA 3B6FB 3WAAD 1KX3A 3LZ1B 3W98C 2PYOB 4M6BA 4KHAA 5B2IB 5CP6A 3LJAB 3MNNC 3WKJC 4YM6A 5FUGB 4JJNA 5DNMA 4H9PB 3REID 3RELD 2CV5D 3AV2C 5GT3A 1KX5B 1TZYD 3LZ0D 4XZQA 3AZNC 5GT0C 3AZIC 1S32A 5CPJB 4Z5TC 2NZDB 3X1VD 5AV6B 3AYWC 3MVDC 3KWQA 4CSRA 2FJ7A 4NFTA 3B6GD 5BO0A 5AV8C 1JFIA 1P3BB 1R4VA 5AVBA 2BYKB 3UT9A 5B0ZA 4J8WC 1U35C 1P3LB 4X23B 1P3MC 5G49A 3W97B 4KUDD 3B0DB 5CPKC 5B40B 1B6WA 2F8NB 2NQBC 4LD9A 4UUZA 4J8UB 3MNND 4XUJB 1HQ3A 1P34C 5C3IB 5B32B 3AV2D 1EQZB 3MGPC 3X1TA 5AV9A 4NE5A 3AZID 4Z5TB 5GT0D 5AV5D 1P3GC 3X1SB 5JRGA 3MVDD 2YFWB 2HUEB 1KX3C 2RVQD 3AZMD 5CPIC 1P3AA 5B33D 4HGAB 4G92B 5CP6C 3VH5A 3RELA 4YM6C 3AZFA 4JJNC 4H9OB 5DNMC 4J8WB 1P3FB 5E5AB 4QLCD 4DRAA 3REJC 3KUYD 1P3MD 1F1EA 5B31D 4XZQC 2NQBD 1ID3B 5F99B 3KWQC 1P34B 3UTAD 3W99A 3MGPB 3AZJD 4ZBJC 5FUGA 3X1UD 3UT9C 1P3GB 4H9PA 1KU5A 1P3OB 3AZLB 1KX3D 3KXBA 5CPIB 5B0YA 1AOIC 4LD9C 5CP6D 1TAFA 3AZHA 3MGRB 4YM6D 1HQ3C 5B1LB 3AZEB 3AZKA 3AV1B 4JJND 5DNMD 3WTPA 2HIOB 5GT3D 3X1TC 1Q9CA 5AY8C 5AV9C 1P3PA 2BYKA 4NE3A 1S32D 3REKB 3WAAC 3TU4A 4YS3A 5B24D 5JRGC 5B2JD 3KWQD 4H9SA 2FJ7D 5AVCA 1P3AC 3AFAD 1M1AA 5GXQB 3RELC 4QLCA 3AZFC 5AVBD 5B31A 1TZYC 3UT9D 3WA9B 5B0ZD 4WU9B 4CAYB 3MGSB 3V9RB 3B0BA
chains in the Genus database with same CATH superfamily
4WNNB 4KGCD 4G91C 3X1SA 2L5AA 1B67A 1A7WA 2YFWA 5B31G 3UTAA 4WU8D 1M18A 4R8PA 1HQ3D 3C1CA 3AZJA 3W99C 3NQJA 3MGQD 4Z2MG 5AY8B 4Z2MH 3A6NB 2IO5B 3X1TD 5AV9D 3C1BA 3O62B 2ZY5A 4H9NB 5JRGD 1ULYA 1P3KB 2F8NK 1M19D 5DNNA 3REIB 1P3AD 2CV5B 3AZGA 1ZLAA 3AZHC 3AZKC 3LZ0B 3AZFD 3WTPC 3UTBA 4ZUXA 1P3ID 5AV5C 5B24A 3X1VB 1P3PC 3LELA 2YFVB 2G5HC 5B2JA 3W96A 4YS3C 3NQUB 1KX4D 3B6GB 2RVQC 2AROD 3AZMC 4H9SC 3AFAA 5B33C 3B6FD 2Y2OA 3LZ1D 1F66A 5GSUB 5AVCC 3W99D 1M1AC 4QLCC 3MGRA 4KUDB 3KUYC 5B1MA 5B31C 3REHA 4J8VA 4J8VD 3AN2A 3W98B 2LY8A 4KGCA 1KX5D 2Y2JA 3H0RC 3WKJB 3MNNB 3EPHA 4WU8A 3KXBD 5B0YD 2Y2QA 3UTAC 1M18C 3MGQA 3AV2B 3AZHD 2Y2PA 3R45A 4R8PC 3C1CC 3AZJC 4H9RB 3AZKD 3WTPD 3X1UC 5GT0B 3AZIB 5AV5B 3AZNB 2RIQA 3AYWB 1P3PD 3MVDB 2ZY3A 4Z66A 3C1BC 3WA9A 2ZY2A 4YS3D 3TU4D 1M19A 3AZMB 1BH8A 2BYMB 5B33B 3W97D 5AV8B 2FFFB 5AVCD 5JA4A 3EPJA 2G5IC 1M1AD 3AZGC 1U35B 1ZLAC 3B0CW 3WTPE 1P3IA 4J8XA 1P3MB 5GT3C 5CPKB 3UTBC 5BNXB 2F2AC 2NQBB 1S32C 5B32D 4WZSB 5B24C 5KDMB 1KX4A 3LELC 5BNVA 2AROA 5B2JC 3B6FA 2CWEA 2Y2GA 2DF4C 3X1SD 3LZ1A 2FJ7C 2PYOA 1N1JB 3AFAC 5B2IA 1M18D 3LJAA 1H3OB 4R8PD 3C1CD 5BS7A 5CHLB 5AVBC 5BT1C 4H9QB 1PZRA 5B0ZC 1KX5A 5B1MC 3REHC 3C1BD 4J8VC 1KX3B 4DRBA 1P3FD 4KGCC 5CPJA 2Y2MA 4KHAB 2NZDA 5CP6B 5AV6A 4YM6B 4WU8C 5DNND 4JJNB 5DNMB 1ID3D 3REJB 3AZGD 1ZLAD 3MGQC 4AWLC 4EO5C 1P3BA 4XZQB 5GSUA 3A1KA 3UTBD 4ZUXD 1P3LA 4UPKA 4X23A 3KWQB 3LELD 4Z66C 3W97A 4CSRB 3W96D 2FJ7B 3W98A 1M19C 5B40A 1P3OD 2F8NA 3EG5B 4E44A 1JFIB 3WKJA 4J8UA 4ZBJB 4XUJA 3UT9B 1F66D 5BT1D 1P3IC 5G49B 3MGRD 5B32A 4J8XC 1EQZA 5B1LD 2W8SA 5B1MD 3REHD 3B0CT 3AN2D 1AOIB 2HIOD 4Z5TA 4LD9B 1KX4C 4UUZB 4E45A 2AROC 3B6FC 3REKD 1HQ3B 3LZ1C 5B32G 2PYOC 2Y2IA 5AV8A 5B2IC 3LJAC 3X1TB 5AV9B 2DQNC 5BS7C 4H9OA 4NE6A 3WAAB 5GXQD 4J8WA 1P3FA 5E5AA 5JRGB 1KX5C 3VH6W 4Z66D 3WA9D 3KXBC 5CPJC 5B0YC 1P3AB 3KFUG 4WU9D 1ID3A 3RELB 5F99A 3F6TA 3VH5W 3AZFB 1P34A 1TZYB 3MGPA 3KSYA 4J8XD 1P3BC 3IP4C 1P3GA 4G91B 3TU4C 1P3LC 3AL0C 4X23C 1HTAA 1P3OA 3W97C 2Y2LA 3O62D 3AZLA 3B0DC 4WV4B 3H0LC 5B40C 5CPIA 3W99B 2PYOD 5B2ID 1P3KD 2JCHA 3LJAD 4J8UC 4XUJC 5B1LA 3AZEA 3AV1A 3REJA 5C3IC 2HIOA 5B32C 1EQZC 3KXBB 5B0YB 3REKA 5CPJD 3X1SC 2NZDD 5AV6D 1TAFB 3AZHB 3AZKB 2HUEC 3WTPB 4DQYB 4HGAC 2XD1A 5GXQA 4G92C 1P3PB 1P3BD 5GSUD 1WWSA 4YS3B 3TU4B 2J8PA 1P3FC 5E5AC 1P3LD 4X23D 4WU9A 4CAYA 3MGSA 3V9RA 3W98D 1AOIA 4WNNA 3VH6T 5AVCB 5B40D 2F8ND 5DNNC 1M1AB 1ID3C 3WKJD 5F99C 4QLCB 4J8UD 4XUJD 3KUYB 5B31B 3VH5T 4ZUXC 5AY8A 3A6NA 1EQZD 3H0MC 3AZND 1BH9B 3WAAA 3O62A 3W96C 4Z5TD 3VH6A 3AYWD 1P3OC 4H9NA 3UTAB 1M18B 3AZLC 1P3KA 2VQRA 4R8PB 3C1CB 3AZJB 3X1UB 3NQJB 1F66C 3REIA 5AV8D 4WJ3C 2CV5A 3MGRC 3C1BB 1TZYA 5B1LC 3LZ0A 3A1IA 3AZEC 3AV1C 1U35D 4J8WD 3AN2C 5E5AD 2HIOC 3X1VA 2YFVA 5CPKD 5DNNB 3REKC 3NQUA 3B6GA 3AZGB 1ZLAB 5F99D 2UWXA 5GT3B 1P34D 1BFMA 2JSSA 3UTBB 4ZUXB 1S32B 5GXQC 5B24B 3MGPD 3LELB 5B2JB 4KUDA 3W96B 1P3GD 3WA9C 5BO0B 3AFAB 4WU9C 3MGSC 3AZLD 3MNNA 1F66B 5CPID 5AVBB 5B0ZB 3AV2A 5B1MB 3REHB 4J8VB 4H9RA 3AZED 3AV1D 3AN2B 2F8NG 3REJD 3AZIA 5GT0A 3AZNA 5AV5A 2F8NH 4KGCB 3A6NC 2IO5C 4XZQD 3MVDA 3AYWA 2JE5A 4WU8B 3O62C 3AZMA 2BYMA 5B33A 3MGQB 3R45B 4AWLB 1P3KC 4EO5B 3REIC 2CV5C 1U35A 4Z66B 3KUYA 1P3MA 3LZ0C 5CPKA 1M19B 1BH8B 5BNXA 2NQBA 3X1VC 5KDMA 2NZDC 1T3UA 3MGSD 5AV6C 1BH9A 1AOID 4LD9D 5JA4B 3B6GC 1N1JA 1P3IB 4J8XB 1H3OA 3X1UA 2Y2NA 5GSUC 4H9QA 1KX4B 5AY8D 5BNVB 3A6ND 2AROB 4KUDC 1WWIA 3B6FB 3WAAD 1KX3A 3LZ1B 3W98C 2PYOB 4M6BA 4KHAA 5B2IB 5CP6A 3LJAB 3MNNC 3WKJC 4YM6A 5FUGB 4JJNA 5DNMA 4H9PB 3REID 3RELD 2CV5D 3AV2C 5GT3A 1KX5B 1TZYD 3LZ0D 4XZQA 3AZNC 5GT0C 3AZIC 1S32A 5CPJB 4Z5TC 2NZDB 3P5JB 3X1VD 5AV6B 3AYWC 3MVDC 3KWQA 4CSRA 2FJ7A 4NFTA 3B6GD 5BO0A 5AV8C 1JFIA 1P3BB 1R4VA 5AVBA 2ZM5A 2BYKB 3UT9A 5B0ZA 4J8WC 1U35C 1P3LB 4X23B 1P3MC 5G49A 3W97B 4KUDD 3B0DB 5CPKC 5B40B 1B6WA 2F8NB 2NQBC 3EPLA 4LD9A 4UUZA 4J8UB 3MNND 4XUJB 1HQ3A 2ZY4A 1P34C 5C3IB 5B32B 3AV2D 3EPKA 1EQZB 3MGPC 3X1TA 2Y2KA 5AV9A 4NE5A 3AZID 4Z5TB 5GT0D 5AV5D 1P3GC 3X1SB 5JRGA 2Y2HA 3MVDD 2YFWB 2HUEB 1KX3C 2RVQD 3AZMD 5CPIC 1P3AA 5B33D 4HGAB 4G92B 5CP6C 3VH5A 3RELA 2BG1A 4YM6C 2XD5A 3AZFA 4JJNC 4H9OB 5DNMC 4J8WB 1P3FB 5E5AB 4QLCD 4DRAA 3REJC 3FDDA 3KUYD 1P3MD 1F1EA 5B31D 4XZQC 2NQBD 1Z2CB 1ID3B 5F99B 3KWQC 1P34B 3UTAD 3W99A 3MGPB 3AZJD 4ZBJC 5FUGA 3X1UD 3UT9C 1P3GB 4H9PA 1KU5A 1P3OB 3AZLB 1KX3D 3KXBA 5CPIB 5B0YA 1AOIC 4LD9C 5CP6D 1TAFA 3AZHA 3MGRB 4YM6D 1HQ3C 5B1LB 3AZEB 3AZKA 3AV1B 4JJND 5DNMD 3WTPA 2HIOB 5GT3D 3X1TC 1Q9CA 5AY8C 5AV9C 1P3PA 2BYKA 4NE3A 1S32D 3REKB 3WAAC 3TU4A 4YS3A 5B24D 5JRGC 5B2JD 3KWQD 4H9SA 2FJ7D 5AVCA 1P3AC 3AFAD 1M1AA 5GXQB 3RELC 4QLCA 3AZFC 5AVBD 5B31A 1TZYC 3UT9D 1W2EA 3WA9B 5B0ZD 4WU9B 4CAYB 3MGSB 3V9RB 3B0BA
chains in the Genus database with same CATH topology
4WNNB 4KGCD 4G91C 3X1SA 2L5AA 1B67A 1A7WA 2YFWA 5B31G 3UTAA 4WU8D 1M18A 4R8PA 1HQ3D 3C1CA 3AZJA 3W99C 3NQJA 3MGQD 4Z2MG 5AY8B 4Z2MH 3A6NB 2IO5B 3X1TD 5AV9D 3C1BA 3O62B 2ZY5A 4H9NB 5JRGD 1ULYA 1P3KB 2F8NK 1M19D 5DNNA 3REIB 1P3AD 2CV5B 3AZGA 1ZLAA 3AZHC 3AZKC 3LZ0B 3AZFD 3WTPC 3UTBA 4ZUXA 1P3ID 5AV5C 5B24A 3X1VB 1P3PC 3LELA 2YFVB 2G5HC 5B2JA 3W96A 4YS3C 3NQUB 1KX4D 3B6GB 2RVQC 2AROD 3AZMC 4H9SC 3AFAA 5B33C 3B6FD 2Y2OA 3LZ1D 1F66A 5GSUB 5AVCC 3W99D 1M1AC 4QLCC 3MGRA 4KUDB 3KUYC 5B1MA 5B31C 3REHA 4J8VA 4J8VD 3AN2A 3W98B 2LY8A 4KGCA 1KX5D 2Y2JA 3H0RC 3WKJB 3MNNB 3EPHA 4WU8A 3KXBD 5B0YD 2Y2QA 3UTAC 1M18C 3MGQA 3AV2B 3AZHD 2Y2PA 3R45A 4R8PC 3C1CC 3AZJC 4H9RB 3AZKD 3WTPD 3X1UC 5GT0B 3AZIB 5AV5B 3AZNB 2RIQA 3AYWB 1P3PD 3MVDB 2ZY3A 4Z66A 3C1BC 3WA9A 2ZY2A 4YS3D 3TU4D 1M19A 3AZMB 1BH8A 2BYMB 5B33B 3W97D 5AV8B 2FFFB 5AVCD 5JA4A 3EPJA 2G5IC 1M1AD 3AZGC 1U35B 1ZLAC 3B0CW 3WTPE 1P3IA 4J8XA 1P3MB 5GT3C 5CPKB 3UTBC 5BNXB 2F2AC 2NQBB 1S32C 5B32D 4WZSB 5B24C 5KDMB 1KX4A 3LELC 5BNVA 2AROA 5B2JC 3B6FA 2CWEA 2Y2GA 2DF4C 3X1SD 3LZ1A 2FJ7C 2PYOA 1N1JB 3AFAC 5B2IA 1M18D 3LJAA 1H3OB 4R8PD 3C1CD 5BS7A 5CHLB 5AVBC 5BT1C 4H9QB 1PZRA 5B0ZC 1KX5A 5B1MC 3REHC 3C1BD 4J8VC 1KX3B 4DRBA 1P3FD 4KGCC 5CPJA 2Y2MA 4KHAB 2NZDA 5CP6B 5AV6A 4YM6B 4WU8C 5DNND 4JJNB 5DNMB 1ID3D 3REJB 3AZGD 1ZLAD 3MGQC 4AWLC 4EO5C 1P3BA 4XZQB 5GSUA 3A1KA 3UTBD 4ZUXD 1P3LA 4UPKA 4X23A 3KWQB 3LELD 4Z66C 3W97A 4CSRB 3W96D 2FJ7B 3W98A 1M19C 5B40A 1P3OD 2F8NA 3EG5B 4E44A 1JFIB 3WKJA 4J8UA 4ZBJB 4XUJA 3UT9B 1F66D 5BT1D 1P3IC 5G49B 3MGRD 5B32A 4J8XC 1EQZA 5B1LD 2W8SA 5B1MD 3REHD 3B0CT 3AN2D 1AOIB 2HIOD 4Z5TA 4LD9B 1KX4C 4UUZB 4E45A 2AROC 3B6FC 3REKD 1HQ3B 3LZ1C 5B32G 2PYOC 2Y2IA 5AV8A 5B2IC 3LJAC 3X1TB 5AV9B 2DQNC 5BS7C 4H9OA 4NE6A 3WAAB 5GXQD 4J8WA 1P3FA 5E5AA 5JRGB 1KX5C 3VH6W 4Z66D 3WA9D 3KXBC 5CPJC 5B0YC 1P3AB 3KFUG 4WU9D 1ID3A 3RELB 5F99A 3F6TA 3VH5W 3AZFB 1P34A 1TZYB 3MGPA 3KSYA 4J8XD 1P3BC 3IP4C 1P3GA 4G91B 3TU4C 1P3LC 3AL0C 4X23C 1HTAA 1P3OA 3W97C 2Y2LA 3O62D 3AZLA 3B0DC 4WV4B 3H0LC 5B40C 5CPIA 3W99B 2PYOD 5B2ID 1P3KD 2JCHA 3LJAD 4J8UC 4XUJC 5B1LA 3AZEA 3AV1A 3REJA 5C3IC 2HIOA 5B32C 1EQZC 3KXBB 5B0YB 3REKA 5CPJD 3X1SC 2NZDD 5AV6D 1TAFB 3AZHB 3AZKB 2HUEC 3WTPB 4DQYB 4HGAC 2XD1A 5GXQA 4G92C 1P3PB 1P3BD 5GSUD 1WWSA 4YS3B 3TU4B 2J8PA 1P3FC 5E5AC 1P3LD 4X23D 4WU9A 4CAYA 3MGSA 3V9RA 3W98D 1AOIA 4WNNA 3VH6T 5AVCB 5B40D 2F8ND 5DNNC 1M1AB 1ID3C 3WKJD 5F99C 4QLCB 4J8UD 4XUJD 3KUYB 5B31B 3VH5T 4ZUXC 5AY8A 3A6NA 1EQZD 3H0MC 3AZND 1BH9B 3WAAA 3O62A 3W96C 4Z5TD 3VH6A 3AYWD 1P3OC 4H9NA 3UTAB 1M18B 3AZLC 1P3KA 2VQRA 4R8PB 3C1CB 3AZJB 3X1UB 3NQJB 1F66C 3REIA 5AV8D 4WJ3C 2CV5A 3MGRC 3C1BB 1TZYA 5B1LC 3LZ0A 3A1IA 3AZEC 3AV1C 1U35D 4J8WD 3AN2C 5E5AD 2HIOC 3X1VA 2YFVA 5CPKD 5DNNB 3REKC 3NQUA 3B6GA 3AZGB 1ZLAB 5F99D 2UWXA 5GT3B 1P34D 1BFMA 2JSSA 3UTBB 4ZUXB 1S32B 5GXQC 5B24B 3MGPD 3LELB 5B2JB 4KUDA 3W96B 1P3GD 3WA9C 5BO0B 3AFAB 4WU9C 3MGSC 3AZLD 3MNNA 1F66B 5CPID 5AVBB 5B0ZB 3AV2A 5B1MB 3REHB 4J8VB 4H9RA 3AZED 3AV1D 3AN2B 2F8NG 3REJD 3AZIA 5GT0A 3AZNA 5AV5A 2F8NH 4KGCB 3A6NC 2IO5C 4XZQD 3MVDA 3AYWA 2JE5A 4WU8B 3O62C 3AZMA 2BYMA 5B33A 3MGQB 3R45B 4AWLB 1P3KC 4EO5B 3REIC 2CV5C 1U35A 4Z66B 3KUYA 1P3MA 3LZ0C 5CPKA 1M19B 1BH8B 5BNXA 2NQBA 3X1VC 5KDMA 2NZDC 1T3UA 3MGSD 5AV6C 1BH9A 1AOID 4LD9D 5JA4B 3B6GC 1N1JA 1P3IB 4J8XB 1H3OA 3X1UA 2Y2NA 5GSUC 4H9QA 1KX4B 5AY8D 5BNVB 3A6ND 2AROB 4KUDC 1WWIA 3B6FB 3WAAD 1KX3A 3LZ1B 3W98C 2PYOB 4M6BA 4KHAA 5B2IB 5CP6A 3LJAB 3MNNC 3WKJC 4YM6A 5FUGB 4JJNA 5DNMA 4H9PB 3REID 3RELD 2CV5D 3AV2C 5GT3A 1KX5B 1TZYD 3LZ0D 4XZQA 3AZNC 5GT0C 3AZIC 1S32A 5CPJB 4Z5TC 2NZDB 3P5JB 3X1VD 5AV6B 3AYWC 3MVDC 3KWQA 4CSRA 2FJ7A 4NFTA 3B6GD 5BO0A 5AV8C 1JFIA 1P3BB 1R4VA 5AVBA 2ZM5A 2BYKB 3UT9A 5B0ZA 4J8WC 1U35C 1P3LB 4X23B 1P3MC 5G49A 3W97B 4KUDD 3B0DB 5CPKC 5B40B 1B6WA 2F8NB 2NQBC 3EPLA 4LD9A 4UUZA 4J8UB 3MNND 4XUJB 1HQ3A 2ZY4A 1P34C 5C3IB 5B32B 3AV2D 3EPKA 1EQZB 3MGPC 3X1TA 2Y2KA 5AV9A 4NE5A 3AZID 4Z5TB 5GT0D 5AV5D 1P3GC 3X1SB 5JRGA 2Y2HA 3MVDD 2YFWB 2HUEB 1KX3C 2RVQD 3AZMD 5CPIC 1P3AA 5B33D 4HGAB 4G92B 5CP6C 3VH5A 3RELA 2BG1A 4YM6C 2XD5A 3AZFA 4JJNC 4H9OB 5DNMC 4J8WB 1P3FB 5E5AB 4QLCD 4DRAA 3REJC 3FDDA 3KUYD 1P3MD 1F1EA 5B31D 4XZQC 2NQBD 1Z2CB 1ID3B 5F99B 3KWQC 1P34B 3UTAD 3W99A 3MGPB 3AZJD 4ZBJC 5FUGA 3X1UD 3UT9C 1P3GB 4H9PA 1KU5A 1P3OB 3AZLB 1KX3D 3KXBA 5CPIB 5B0YA 1AOIC 4LD9C 5CP6D 1TAFA 3AZHA 3MGRB 4YM6D 1HQ3C 5B1LB 3AZEB 3AZKA 3AV1B 4JJND 5DNMD 3WTPA 2HIOB 5GT3D 3X1TC 1Q9CA 5AY8C 5AV9C 1P3PA 2BYKA 4NE3A 1S32D 3REKB 3WAAC 3TU4A 4YS3A 5B24D 5JRGC 5B2JD 3KWQD 4H9SA 2FJ7D 5AVCA 1P3AC 3AFAD 1M1AA 5GXQB 3RELC 4QLCA 3AZFC 5AVBD 5B31A 1TZYC 3UT9D 1W2EA 3WA9B 5B0ZD 4WU9B 4CAYB 3MGSB 3V9RB 3B0BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WNN B;  4KGC D;  4G91 C;  3X1S A;  2L5A A;  1B67 A;  1A7W A;  2YFW A;  5B31 G;  3UTA A;  4WU8 D;  1M18 A;  4R8P A;  1HQ3 D;  3C1C A;  3AZJ A;  3W99 C;  3NQJ A;  3MGQ D;  4Z2M G;  5AY8 B;  4Z2M H;  3A6N B;  2IO5 B;  3X1T D;  5AV9 D;  3C1B A;  3O62 B;  4H9N B;  5JRG D;  1ULY A;  1P3K B;  2F8N K;  1M19 D;  5DNN A;  3REI B;  1P3A D;  2CV5 B;  3AZG A;  1ZLA A;  3AZH C;  3AZK C;  3LZ0 B;  3AZF D;  3WTP C;  3UTB A;  4ZUX A;  1P3I D;  5AV5 C;  5B24 A;  3X1V B;  1P3P C;  3LEL A;  2YFV B;  5B2J A;  3W96 A;  4YS3 C;  3NQU B;  1KX4 D;  3B6G B;  2RVQ C;  2ARO D;  3AZM C;  4H9S C;  3AFA A;  5B33 C;  3B6F D;  3LZ1 D;  1F66 A;  5GSU B;  5AVC C;  3W99 D;  1M1A C;  4QLC C;  3MGR A;  4KUD B;  3KUY C;  5B1M A;  5B31 C;  3REH A;  4J8V A;  4J8V D;  3AN2 A;  3W98 B;  2LY8 A;  4KGC A;  1KX5 D;  3WKJ B;  3MNN B;  4WU8 A;  3KXB D;  5B0Y D;  3UTA C;  1M18 C;  3MGQ A;  3AV2 B;  3AZH D;  3R45 A;  4R8P C;  3C1C C;  3AZJ C;  4H9R B;  3AZK D;  3WTP D;  3X1U C;  5GT0 B;  3AZI B;  5AV5 B;  3AZN B;  3AYW B;  1P3P D;  3MVD B;  4Z66 A;  3C1B C;  3WA9 A;  4YS3 D;  3TU4 D;  1M19 A;  3AZM B;  1BH8 A;  2BYM B;  5B33 B;  3W97 D;  5AV8 B;  5AVC D;  5JA4 A;  1M1A D;  3AZG C;  1U35 B;  1ZLA C;  3B0C W;  3WTP E;  1P3I A;  4J8X A;  1P3M B;  5GT3 C;  5CPK B;  3UTB C;  5BNX B;  2NQB B;  1S32 C;  5B32 D;  4WZS B;  5B24 C;  5KDM B;  1KX4 A;  3LEL C;  5BNV A;  2ARO A;  5B2J C;  3B6F A;  2CWE A;  3X1S D;  3LZ1 A;  2FJ7 C;  2PYO A;  1N1J B;  3AFA C;  5B2I A;  1M18 D;  3LJA A;  1H3O B;  4R8P D;  3C1C D;  5BS7 A;  5CHL B;  5AVB C;  5BT1 C;  4H9Q B;  5B0Z C;  1KX5 A;  5B1M C;  3REH C;  3C1B D;  4J8V C;  1KX3 B;  4DRB A;  1P3F D;  4KGC C;  5CPJ A;  4KHA B;  2NZD A;  5CP6 B;  5AV6 A;  4YM6 B;  4WU8 C;  5DNN D;  4JJN B;  5DNM B;  1ID3 D;  3REJ B;  3AZG D;  1ZLA D;  3MGQ C;  4AWL C;  4EO5 C;  1P3B A;  4XZQ B;  5GSU A;  3UTB D;  4ZUX D;  1P3L A;  4X23 A;  3KWQ B;  3LEL D;  4Z66 C;  3W97 A;  4CSR B;  3W96 D;  2FJ7 B;  3W98 A;  1M19 C;  5B40 A;  1P3O D;  2F8N A;  4E44 A;  1JFI B;  3WKJ A;  4J8U A;  4ZBJ B;  4XUJ A;  3UT9 B;  1F66 D;  5BT1 D;  1P3I C;  5G49 B;  3MGR D;  5B32 A;  4J8X C;  1EQZ A;  5B1L D;  5B1M D;  3REH D;  3B0C T;  3AN2 D;  1AOI B;  2HIO D;  4Z5T A;  4LD9 B;  1KX4 C;  4UUZ B;  4E45 A;  2ARO C;  3B6F C;  3REK D;  1HQ3 B;  3LZ1 C;  5B32 G;  2PYO C;  5AV8 A;  5B2I C;  3LJA C;  3X1T B;  5AV9 B;  5BS7 C;  4H9O A;  4NE6 A;  3WAA B;  5GXQ D;  4J8W A;  1P3F A;  5E5A A;  5JRG B;  1KX5 C;  3VH6 W;  4Z66 D;  3WA9 D;  3KXB C;  5CPJ C;  5B0Y C;  1P3A B;  4WU9 D;  1ID3 A;  3REL B;  5F99 A;  3VH5 W;  3AZF B;  1P34 A;  1TZY B;  3MGP A;  3KSY A;  4J8X D;  1P3B C;  1P3G A;  4G91 B;  3TU4 C;  1P3L C;  4X23 C;  1HTA A;  1P3O A;  3W97 C;  3O62 D;  3AZL A;  3B0D C;  4WV4 B;  5B40 C;  5CPI A;  3W99 B;  2PYO D;  5B2I D;  1P3K D;  3LJA D;  4J8U C;  4XUJ C;  5B1L A;  3AZE A;  3AV1 A;  3REJ A;  5C3I C;  2HIO A;  5B32 C;  1EQZ C;  3KXB B;  5B0Y B;  3REK A;  5CPJ D;  3X1S C;  2NZD D;  5AV6 D;  1TAF B;  3AZH B;  3AZK B;  2HUE C;  3WTP B;  4HGA C;  4G92 C;  5GXQ A;  1P3P B;  1P3B D;  5GSU D;  1WWS A;  4YS3 B;  3TU4 B;  1P3F C;  5E5A C;  1P3L D;  4X23 D;  4WU9 A;  4CAY A;  3MGS A;  3V9R A;  3W98 D;  1AOI A;  4WNN A;  3VH6 T;  5AVC B;  5B40 D;  2F8N D;  5DNN C;  1M1A B;  1ID3 C;  3WKJ D;  5F99 C;  4QLC B;  4J8U D;  4XUJ D;  3KUY B;  5B31 B;  3VH5 T;  4ZUX C;  5AY8 A;  3A6N A;  1EQZ D;  3AZN D;  1BH9 B;  3WAA A;  3O62 A;  3W96 C;  4Z5T D;  3VH6 A;  3AYW D;  1P3O C;  4H9N A;  3UTA B;  1M18 B;  3AZL C;  1P3K A;  4R8P B;  3C1C B;  3AZJ B;  3X1U B;  3NQJ B;  1F66 C;  3REI A;  5AV8 D;  2CV5 A;  3MGR C;  3C1B B;  1TZY A;  5B1L C;  3LZ0 A;  3AZE C;  3AV1 C;  1U35 D;  4J8W D;  3AN2 C;  5E5A D;  2HIO C;  3X1V A;  2YFV A;  5CPK D;  5DNN B;  3REK C;  3NQU A;  3B6G A;  3AZG B;  1ZLA B;  5F99 D;  5GT3 B;  1P34 D;  1BFM A;  2JSS A;  3UTB B;  4ZUX B;  1S32 B;  5GXQ C;  5B24 B;  3MGP D;  3LEL B;  5B2J B;  4KUD A;  3W96 B;  1P3G D;  3WA9 C;  5BO0 B;  3AFA B;  4WU9 C;  3MGS C;  3AZL D;  3MNN A;  1F66 B;  5CPI D;  5AVB B;  5B0Z B;  3AV2 A;  5B1M B;  3REH B;  4J8V B;  4H9R A;  3AZE D;  3AV1 D;  3AN2 B;  2F8N G;  3REJ D;  3AZI A;  5GT0 A;  3AZN A;  5AV5 A;  2F8N H;  4KGC B;  3A6N C;  2IO5 C;  4XZQ D;  3MVD A;  3AYW A;  4WU8 B;  3O62 C;  3AZM A;  2BYM A;  5B33 A;  3MGQ B;  3R45 B;  4AWL B;  1P3K C;  4EO5 B;  3REI C;  2CV5 C;  1U35 A;  4Z66 B;  3KUY A;  1P3M A;  3LZ0 C;  5CPK A;  1M19 B;  1BH8 B;  5BNX A;  2NQB A;  3X1V C;  5KDM A;  2NZD C;  3MGS D;  5AV6 C;  1BH9 A;  1AOI D;  4LD9 D;  5JA4 B;  3B6G C;  1N1J A;  1P3I B;  4J8X B;  1H3O A;  3X1U A;  5GSU C;  4H9Q A;  1KX4 B;  5AY8 D;  5BNV B;  3A6N D;  2ARO B;  4KUD C;  1WWI A;  3B6F B;  3WAA D;  1KX3 A;  3LZ1 B;  3W98 C;  2PYO B;  4M6B A;  4KHA A;  5B2I B;  5CP6 A;  3LJA B;  3MNN C;  3WKJ C;  4YM6 A;  5FUG B;  4JJN A;  5DNM A;  4H9P B;  3REI D;  3REL D;  2CV5 D;  3AV2 C;  5GT3 A;  1KX5 B;  1TZY D;  3LZ0 D;  4XZQ A;  3AZN C;  5GT0 C;  3AZI C;  1S32 A;  5CPJ B;  4Z5T C;  2NZD B;  3X1V D;  5AV6 B;  3AYW C;  3MVD C;  3KWQ A;  4CSR A;  2FJ7 A;  4NFT A;  3B6G D;  5BO0 A;  5AV8 C;  1JFI A;  1P3B B;  1R4V A;  5AVB A;  2BYK B;  3UT9 A;  5B0Z A;  4J8W C;  1U35 C;  1P3L B;  4X23 B;  1P3M C;  5G49 A;  3W97 B;  4KUD D;  3B0D B;  5CPK C;  5B40 B;  1B6W A;  2F8N B;  2NQB C;  4LD9 A;  4UUZ A;  4J8U B;  3MNN D;  4XUJ B;  1HQ3 A;  1P34 C;  5C3I B;  5B32 B;  3AV2 D;  1EQZ B;  3MGP C;  3X1T A;  5AV9 A;  4NE5 A;  3AZI D;  4Z5T B;  5GT0 D;  5AV5 D;  1P3G C;  3X1S B;  5JRG A;  3MVD D;  2YFW B;  2HUE B;  1KX3 C;  2RVQ D;  3AZM D;  5CPI C;  1P3A A;  5B33 D;  4HGA B;  4G92 B;  5CP6 C;  3VH5 A;  3REL A;  4YM6 C;  3AZF A;  4JJN C;  4H9O B;  5DNM C;  4J8W B;  1P3F B;  5E5A B;  4QLC D;  4DRA A;  3REJ C;  3KUY D;  1P3M D;  1F1E A;  5B31 D;  4XZQ C;  2NQB D;  1ID3 B;  5F99 B;  3KWQ C;  1P34 B;  3UTA D;  3W99 A;  3MGP B;  3AZJ D;  4ZBJ C;  5FUG A;  3X1U D;  3UT9 C;  1P3G B;  4H9P A;  1KU5 A;  1P3O B;  3AZL B;  1KX3 D;  3KXB A;  5CPI B;  5B0Y A;  1AOI C;  4LD9 C;  5CP6 D;  1TAF A;  3AZH A;  3MGR B;  4YM6 D;  1HQ3 C;  5B1L B;  3AZE B;  3AZK A;  3AV1 B;  4JJN D;  5DNM D;  3WTP A;  2HIO B;  5GT3 D;  3X1T C;  1Q9C A;  5AY8 C;  5AV9 C;  1P3P A;  2BYK A;  4NE3 A;  1S32 D;  3REK B;  3WAA C;  3TU4 A;  4YS3 A;  5B24 D;  5JRG C;  5B2J D;  3KWQ D;  4H9S A;  2FJ7 D;  5AVC A;  1P3A C;  3AFA D;  1M1A A;  5GXQ B;  3REL C;  4QLC A;  3AZF C;  5AVB D;  5B31 A;  1TZY C;  3UT9 D;  3WA9 B;  5B0Z D;  4WU9 B;  4CAY B;  3MGS B;  3V9R B;  3B0B A; 
#chains in the Genus database with same CATH topology
 4WNN B;  4KGC D;  4G91 C;  3X1S A;  2L5A A;  1B67 A;  1A7W A;  2YFW A;  5B31 G;  3UTA A;  4WU8 D;  1M18 A;  4R8P A;  1HQ3 D;  3C1C A;  3AZJ A;  3W99 C;  3NQJ A;  3MGQ D;  4Z2M G;  5AY8 B;  4Z2M H;  3A6N B;  2IO5 B;  3X1T D;  5AV9 D;  3C1B A;  3O62 B;  2ZY5 A;  4H9N B;  5JRG D;  1ULY A;  1P3K B;  2F8N K;  1M19 D;  5DNN A;  3REI B;  1P3A D;  2CV5 B;  3AZG A;  1ZLA A;  3AZH C;  3AZK C;  3LZ0 B;  3AZF D;  3WTP C;  3UTB A;  4ZUX A;  1P3I D;  5AV5 C;  5B24 A;  3X1V B;  1P3P C;  3LEL A;  2YFV B;  2G5H C;  5B2J A;  3W96 A;  4YS3 C;  3NQU B;  1KX4 D;  3B6G B;  2RVQ C;  2ARO D;  3AZM C;  4H9S C;  3AFA A;  5B33 C;  3B6F D;  2Y2O A;  3LZ1 D;  1F66 A;  5GSU B;  5AVC C;  3W99 D;  1M1A C;  4QLC C;  3MGR A;  4KUD B;  3KUY C;  5B1M A;  5B31 C;  3REH A;  4J8V A;  4J8V D;  3AN2 A;  3W98 B;  2LY8 A;  4KGC A;  1KX5 D;  2Y2J A;  3H0R C;  3WKJ B;  3MNN B;  3EPH A;  4WU8 A;  3KXB D;  5B0Y D;  2Y2Q A;  3UTA C;  1M18 C;  3MGQ A;  3AV2 B;  3AZH D;  2Y2P A;  3R45 A;  4R8P C;  3C1C C;  3AZJ C;  4H9R B;  3AZK D;  3WTP D;  3X1U C;  5GT0 B;  3AZI B;  5AV5 B;  3AZN B;  2RIQ A;  3AYW B;  1P3P D;  3MVD B;  2ZY3 A;  4Z66 A;  3C1B C;  3WA9 A;  2ZY2 A;  4YS3 D;  3TU4 D;  1M19 A;  3AZM B;  1BH8 A;  2BYM B;  5B33 B;  3W97 D;  5AV8 B;  2FFF B;  5AVC D;  5JA4 A;  3EPJ A;  2G5I C;  1M1A D;  3AZG C;  1U35 B;  1ZLA C;  3B0C W;  3WTP E;  1P3I A;  4J8X A;  1P3M B;  5GT3 C;  5CPK B;  3UTB C;  5BNX B;  2F2A C;  2NQB B;  1S32 C;  5B32 D;  4WZS B;  5B24 C;  5KDM B;  1KX4 A;  3LEL C;  5BNV A;  2ARO A;  5B2J C;  3B6F A;  2CWE A;  2Y2G A;  2DF4 C;  3X1S D;  3LZ1 A;  2FJ7 C;  2PYO A;  1N1J B;  3AFA C;  5B2I A;  1M18 D;  3LJA A;  1H3O B;  4R8P D;  3C1C D;  5BS7 A;  5CHL B;  5AVB C;  5BT1 C;  4H9Q B;  1PZR A;  5B0Z C;  1KX5 A;  5B1M C;  3REH C;  3C1B D;  4J8V C;  1KX3 B;  4DRB A;  1P3F D;  4KGC C;  5CPJ A;  2Y2M A;  4KHA B;  2NZD A;  5CP6 B;  5AV6 A;  4YM6 B;  4WU8 C;  5DNN D;  4JJN B;  5DNM B;  1ID3 D;  3REJ B;  3AZG D;  1ZLA D;  3MGQ C;  4AWL C;  4EO5 C;  1P3B A;  4XZQ B;  5GSU A;  3A1K A;  3UTB D;  4ZUX D;  1P3L A;  4UPK A;  4X23 A;  3KWQ B;  3LEL D;  4Z66 C;  3W97 A;  4CSR B;  3W96 D;  2FJ7 B;  3W98 A;  1M19 C;  5B40 A;  1P3O D;  2F8N A;  3EG5 B;  4E44 A;  1JFI B;  3WKJ A;  4J8U A;  4ZBJ B;  4XUJ A;  3UT9 B;  1F66 D;  5BT1 D;  1P3I C;  5G49 B;  3MGR D;  5B32 A;  4J8X C;  1EQZ A;  5B1L D;  2W8S A;  5B1M D;  3REH D;  3B0C T;  3AN2 D;  1AOI B;  2HIO D;  4Z5T A;  4LD9 B;  1KX4 C;  4UUZ B;  4E45 A;  2ARO C;  3B6F C;  3REK D;  1HQ3 B;  3LZ1 C;  5B32 G;  2PYO C;  2Y2I A;  5AV8 A;  5B2I C;  3LJA C;  3X1T B;  5AV9 B;  2DQN C;  5BS7 C;  4H9O A;  4NE6 A;  3WAA B;  5GXQ D;  4J8W A;  1P3F A;  5E5A A;  5JRG B;  1KX5 C;  3VH6 W;  4Z66 D;  3WA9 D;  3KXB C;  5CPJ C;  5B0Y C;  1P3A B;  3KFU G;  4WU9 D;  1ID3 A;  3REL B;  5F99 A;  3F6T A;  3VH5 W;  3AZF B;  1P34 A;  1TZY B;  3MGP A;  3KSY A;  4J8X D;  1P3B C;  3IP4 C;  1P3G A;  4G91 B;  3TU4 C;  1P3L C;  3AL0 C;  4X23 C;  1HTA A;  1P3O A;  3W97 C;  2Y2L A;  3O62 D;  3AZL A;  3B0D C;  4WV4 B;  3H0L C;  5B40 C;  5CPI A;  3W99 B;  2PYO D;  5B2I D;  1P3K D;  2JCH A;  3LJA D;  4J8U C;  4XUJ C;  5B1L A;  3AZE A;  3AV1 A;  3REJ A;  5C3I C;  2HIO A;  5B32 C;  1EQZ C;  3KXB B;  5B0Y B;  3REK A;  5CPJ D;  3X1S C;  2NZD D;  5AV6 D;  1TAF B;  3AZH B;  3AZK B;  2HUE C;  3WTP B;  4DQY B;  4HGA C;  2XD1 A;  5GXQ A;  4G92 C;  1P3P B;  1P3B D;  5GSU D;  1WWS A;  4YS3 B;  3TU4 B;  2J8P A;  1P3F C;  5E5A C;  1P3L D;  4X23 D;  4WU9 A;  4CAY A;  3MGS A;  3V9R A;  3W98 D;  1AOI A;  4WNN A;  3VH6 T;  5AVC B;  5B40 D;  2F8N D;  5DNN C;  1M1A B;  1ID3 C;  3WKJ D;  5F99 C;  4QLC B;  4J8U D;  4XUJ D;  3KUY B;  5B31 B;  3VH5 T;  4ZUX C;  5AY8 A;  3A6N A;  1EQZ D;  3H0M C;  3AZN D;  1BH9 B;  3WAA A;  3O62 A;  3W96 C;  4Z5T D;  3VH6 A;  3AYW D;  1P3O C;  4H9N A;  3UTA B;  1M18 B;  3AZL C;  1P3K A;  2VQR A;  4R8P B;  3C1C B;  3AZJ B;  3X1U B;  3NQJ B;  1F66 C;  3REI A;  5AV8 D;  4WJ3 C;  2CV5 A;  3MGR C;  3C1B B;  1TZY A;  5B1L C;  3LZ0 A;  3A1I A;  3AZE C;  3AV1 C;  1U35 D;  4J8W D;  3AN2 C;  5E5A D;  2HIO C;  3X1V A;  2YFV A;  5CPK D;  5DNN B;  3REK C;  3NQU A;  3B6G A;  3AZG B;  1ZLA B;  5F99 D;  2UWX A;  5GT3 B;  1P34 D;  1BFM A;  2JSS A;  3UTB B;  4ZUX B;  1S32 B;  5GXQ C;  5B24 B;  3MGP D;  3LEL B;  5B2J B;  4KUD A;  3W96 B;  1P3G D;  3WA9 C;  5BO0 B;  3AFA B;  4WU9 C;  3MGS C;  3AZL D;  3MNN A;  1F66 B;  5CPI D;  5AVB B;  5B0Z B;  3AV2 A;  5B1M B;  3REH B;  4J8V B;  4H9R A;  3AZE D;  3AV1 D;  3AN2 B;  2F8N G;  3REJ D;  3AZI A;  5GT0 A;  3AZN A;  5AV5 A;  2F8N H;  4KGC B;  3A6N C;  2IO5 C;  4XZQ D;  3MVD A;  3AYW A;  2JE5 A;  4WU8 B;  3O62 C;  3AZM A;  2BYM A;  5B33 A;  3MGQ B;  3R45 B;  4AWL B;  1P3K C;  4EO5 B;  3REI C;  2CV5 C;  1U35 A;  4Z66 B;  3KUY A;  1P3M A;  3LZ0 C;  5CPK A;  1M19 B;  1BH8 B;  5BNX A;  2NQB A;  3X1V C;  5KDM A;  2NZD C;  1T3U A;  3MGS D;  5AV6 C;  1BH9 A;  1AOI D;  4LD9 D;  5JA4 B;  3B6G C;  1N1J A;  1P3I B;  4J8X B;  1H3O A;  3X1U A;  2Y2N A;  5GSU C;  4H9Q A;  1KX4 B;  5AY8 D;  5BNV B;  3A6N D;  2ARO B;  4KUD C;  1WWI A;  3B6F B;  3WAA D;  1KX3 A;  3LZ1 B;  3W98 C;  2PYO B;  4M6B A;  4KHA A;  5B2I B;  5CP6 A;  3LJA B;  3MNN C;  3WKJ C;  4YM6 A;  5FUG B;  4JJN A;  5DNM A;  4H9P B;  3REI D;  3REL D;  2CV5 D;  3AV2 C;  5GT3 A;  1KX5 B;  1TZY D;  3LZ0 D;  4XZQ A;  3AZN C;  5GT0 C;  3AZI C;  1S32 A;  5CPJ B;  4Z5T C;  2NZD B;  3P5J B;  3X1V D;  5AV6 B;  3AYW C;  3MVD C;  3KWQ A;  4CSR A;  2FJ7 A;  4NFT A;  3B6G D;  5BO0 A;  5AV8 C;  1JFI A;  1P3B B;  1R4V A;  5AVB A;  2ZM5 A;  2BYK B;  3UT9 A;  5B0Z A;  4J8W C;  1U35 C;  1P3L B;  4X23 B;  1P3M C;  5G49 A;  3W97 B;  4KUD D;  3B0D B;  5CPK C;  5B40 B;  1B6W A;  2F8N B;  2NQB C;  3EPL A;  4LD9 A;  4UUZ A;  4J8U B;  3MNN D;  4XUJ B;  1HQ3 A;  2ZY4 A;  1P34 C;  5C3I B;  5B32 B;  3AV2 D;  3EPK A;  1EQZ B;  3MGP C;  3X1T A;  2Y2K A;  5AV9 A;  4NE5 A;  3AZI D;  4Z5T B;  5GT0 D;  5AV5 D;  1P3G C;  3X1S B;  5JRG A;  2Y2H A;  3MVD D;  2YFW B;  2HUE B;  1KX3 C;  2RVQ D;  3AZM D;  5CPI C;  1P3A A;  5B33 D;  4HGA B;  4G92 B;  5CP6 C;  3VH5 A;  3REL A;  2BG1 A;  4YM6 C;  2XD5 A;  3AZF A;  4JJN C;  4H9O B;  5DNM C;  4J8W B;  1P3F B;  5E5A B;  4QLC D;  4DRA A;  3REJ C;  3FDD A;  3KUY D;  1P3M D;  1F1E A;  5B31 D;  4XZQ C;  2NQB D;  1Z2C B;  1ID3 B;  5F99 B;  3KWQ C;  1P34 B;  3UTA D;  3W99 A;  3MGP B;  3AZJ D;  4ZBJ C;  5FUG A;  3X1U D;  3UT9 C;  1P3G B;  4H9P A;  1KU5 A;  1P3O B;  3AZL B;  1KX3 D;  3KXB A;  5CPI B;  5B0Y A;  1AOI C;  4LD9 C;  5CP6 D;  1TAF A;  3AZH A;  3MGR B;  4YM6 D;  1HQ3 C;  5B1L B;  3AZE B;  3AZK A;  3AV1 B;  4JJN D;  5DNM D;  3WTP A;  2HIO B;  5GT3 D;  3X1T C;  1Q9C A;  5AY8 C;  5AV9 C;  1P3P A;  2BYK A;  4NE3 A;  1S32 D;  3REK B;  3WAA C;  3TU4 A;  4YS3 A;  5B24 D;  5JRG C;  5B2J D;  3KWQ D;  4H9S A;  2FJ7 D;  5AVC A;  1P3A C;  3AFA D;  1M1A A;  5GXQ B;  3REL C;  4QLC A;  3AZF C;  5AVB D;  5B31 A;  1TZY C;  3UT9 D;  1W2E A;  3WA9 B;  5B0Z D;  4WU9 B;  4CAY B;  3MGS B;  3V9R B;  3B0B A; 
#chains in the Genus database with same CATH homology
 4WNN B;  4KGC D;  4G91 C;  3X1S A;  2L5A A;  1B67 A;  1A7W A;  2YFW A;  5B31 G;  3UTA A;  4WU8 D;  1M18 A;  4R8P A;  1HQ3 D;  3C1C A;  3AZJ A;  3W99 C;  3NQJ A;  3MGQ D;  4Z2M G;  5AY8 B;  4Z2M H;  3A6N B;  2IO5 B;  3X1T D;  5AV9 D;  3C1B A;  3O62 B;  2ZY5 A;  4H9N B;  5JRG D;  1ULY A;  1P3K B;  2F8N K;  1M19 D;  5DNN A;  3REI B;  1P3A D;  2CV5 B;  3AZG A;  1ZLA A;  3AZH C;  3AZK C;  3LZ0 B;  3AZF D;  3WTP C;  3UTB A;  4ZUX A;  1P3I D;  5AV5 C;  5B24 A;  3X1V B;  1P3P C;  3LEL A;  2YFV B;  2G5H C;  5B2J A;  3W96 A;  4YS3 C;  3NQU B;  1KX4 D;  3B6G B;  2RVQ C;  2ARO D;  3AZM C;  4H9S C;  3AFA A;  5B33 C;  3B6F D;  2Y2O A;  3LZ1 D;  1F66 A;  5GSU B;  5AVC C;  3W99 D;  1M1A C;  4QLC C;  3MGR A;  4KUD B;  3KUY C;  5B1M A;  5B31 C;  3REH A;  4J8V A;  4J8V D;  3AN2 A;  3W98 B;  2LY8 A;  4KGC A;  1KX5 D;  2Y2J A;  3H0R C;  3WKJ B;  3MNN B;  3EPH A;  4WU8 A;  3KXB D;  5B0Y D;  2Y2Q A;  3UTA C;  1M18 C;  3MGQ A;  3AV2 B;  3AZH D;  2Y2P A;  3R45 A;  4R8P C;  3C1C C;  3AZJ C;  4H9R B;  3AZK D;  3WTP D;  3X1U C;  5GT0 B;  3AZI B;  5AV5 B;  3AZN B;  2RIQ A;  3AYW B;  1P3P D;  3MVD B;  2ZY3 A;  4Z66 A;  3C1B C;  3WA9 A;  2ZY2 A;  4YS3 D;  3TU4 D;  1M19 A;  3AZM B;  1BH8 A;  2BYM B;  5B33 B;  3W97 D;  5AV8 B;  2FFF B;  5AVC D;  5JA4 A;  3EPJ A;  2G5I C;  1M1A D;  3AZG C;  1U35 B;  1ZLA C;  3B0C W;  3WTP E;  1P3I A;  4J8X A;  1P3M B;  5GT3 C;  5CPK B;  3UTB C;  5BNX B;  2F2A C;  2NQB B;  1S32 C;  5B32 D;  4WZS B;  5B24 C;  5KDM B;  1KX4 A;  3LEL C;  5BNV A;  2ARO A;  5B2J C;  3B6F A;  2CWE A;  2Y2G A;  2DF4 C;  3X1S D;  3LZ1 A;  2FJ7 C;  2PYO A;  1N1J B;  3AFA C;  5B2I A;  1M18 D;  3LJA A;  1H3O B;  4R8P D;  3C1C D;  5BS7 A;  5CHL B;  5AVB C;  5BT1 C;  4H9Q B;  1PZR A;  5B0Z C;  1KX5 A;  5B1M C;  3REH C;  3C1B D;  4J8V C;  1KX3 B;  4DRB A;  1P3F D;  4KGC C;  5CPJ A;  2Y2M A;  4KHA B;  2NZD A;  5CP6 B;  5AV6 A;  4YM6 B;  4WU8 C;  5DNN D;  4JJN B;  5DNM B;  1ID3 D;  3REJ B;  3AZG D;  1ZLA D;  3MGQ C;  4AWL C;  4EO5 C;  1P3B A;  4XZQ B;  5GSU A;  3A1K A;  3UTB D;  4ZUX D;  1P3L A;  4UPK A;  4X23 A;  3KWQ B;  3LEL D;  4Z66 C;  3W97 A;  4CSR B;  3W96 D;  2FJ7 B;  3W98 A;  1M19 C;  5B40 A;  1P3O D;  2F8N A;  3EG5 B;  4E44 A;  1JFI B;  3WKJ A;  4J8U A;  4ZBJ B;  4XUJ A;  3UT9 B;  1F66 D;  5BT1 D;  1P3I C;  5G49 B;  3MGR D;  5B32 A;  4J8X C;  1EQZ A;  5B1L D;  2W8S A;  5B1M D;  3REH D;  3B0C T;  3AN2 D;  1AOI B;  2HIO D;  4Z5T A;  4LD9 B;  1KX4 C;  4UUZ B;  4E45 A;  2ARO C;  3B6F C;  3REK D;  1HQ3 B;  3LZ1 C;  5B32 G;  2PYO C;  2Y2I A;  5AV8 A;  5B2I C;  3LJA C;  3X1T B;  5AV9 B;  2DQN C;  5BS7 C;  4H9O A;  4NE6 A;  3WAA B;  5GXQ D;  4J8W A;  1P3F A;  5E5A A;  5JRG B;  1KX5 C;  3VH6 W;  4Z66 D;  3WA9 D;  3KXB C;  5CPJ C;  5B0Y C;  1P3A B;  3KFU G;  4WU9 D;  1ID3 A;  3REL B;  5F99 A;  3F6T A;  3VH5 W;  3AZF B;  1P34 A;  1TZY B;  3MGP A;  3KSY A;  4J8X D;  1P3B C;  3IP4 C;  1P3G A;  4G91 B;  3TU4 C;  1P3L C;  3AL0 C;  4X23 C;  1HTA A;  1P3O A;  3W97 C;  2Y2L A;  3O62 D;  3AZL A;  3B0D C;  4WV4 B;  3H0L C;  5B40 C;  5CPI A;  3W99 B;  2PYO D;  5B2I D;  1P3K D;  2JCH A;  3LJA D;  4J8U C;  4XUJ C;  5B1L A;  3AZE A;  3AV1 A;  3REJ A;  5C3I C;  2HIO A;  5B32 C;  1EQZ C;  3KXB B;  5B0Y B;  3REK A;  5CPJ D;  3X1S C;  2NZD D;  5AV6 D;  1TAF B;  3AZH B;  3AZK B;  2HUE C;  3WTP B;  4DQY B;  4HGA C;  2XD1 A;  5GXQ A;  4G92 C;  1P3P B;  1P3B D;  5GSU D;  1WWS A;  4YS3 B;  3TU4 B;  2J8P A;  1P3F C;  5E5A C;  1P3L D;  4X23 D;  4WU9 A;  4CAY A;  3MGS A;  3V9R A;  3W98 D;  1AOI A;  4WNN A;  3VH6 T;  5AVC B;  5B40 D;  2F8N D;  5DNN C;  1M1A B;  1ID3 C;  3WKJ D;  5F99 C;  4QLC B;  4J8U D;  4XUJ D;  3KUY B;  5B31 B;  3VH5 T;  4ZUX C;  5AY8 A;  3A6N A;  1EQZ D;  3H0M C;  3AZN D;  1BH9 B;  3WAA A;  3O62 A;  3W96 C;  4Z5T D;  3VH6 A;  3AYW D;  1P3O C;  4H9N A;  3UTA B;  1M18 B;  3AZL C;  1P3K A;  2VQR A;  4R8P B;  3C1C B;  3AZJ B;  3X1U B;  3NQJ B;  1F66 C;  3REI A;  5AV8 D;  4WJ3 C;  2CV5 A;  3MGR C;  3C1B B;  1TZY A;  5B1L C;  3LZ0 A;  3A1I A;  3AZE C;  3AV1 C;  1U35 D;  4J8W D;  3AN2 C;  5E5A D;  2HIO C;  3X1V A;  2YFV A;  5CPK D;  5DNN B;  3REK C;  3NQU A;  3B6G A;  3AZG B;  1ZLA B;  5F99 D;  2UWX A;  5GT3 B;  1P34 D;  1BFM A;  2JSS A;  3UTB B;  4ZUX B;  1S32 B;  5GXQ C;  5B24 B;  3MGP D;  3LEL B;  5B2J B;  4KUD A;  3W96 B;  1P3G D;  3WA9 C;  5BO0 B;  3AFA B;  4WU9 C;  3MGS C;  3AZL D;  3MNN A;  1F66 B;  5CPI D;  5AVB B;  5B0Z B;  3AV2 A;  5B1M B;  3REH B;  4J8V B;  4H9R A;  3AZE D;  3AV1 D;  3AN2 B;  2F8N G;  3REJ D;  3AZI A;  5GT0 A;  3AZN A;  5AV5 A;  2F8N H;  4KGC B;  3A6N C;  2IO5 C;  4XZQ D;  3MVD A;  3AYW A;  2JE5 A;  4WU8 B;  3O62 C;  3AZM A;  2BYM A;  5B33 A;  3MGQ B;  3R45 B;  4AWL B;  1P3K C;  4EO5 B;  3REI C;  2CV5 C;  1U35 A;  4Z66 B;  3KUY A;  1P3M A;  3LZ0 C;  5CPK A;  1M19 B;  1BH8 B;  5BNX A;  2NQB A;  3X1V C;  5KDM A;  2NZD C;  1T3U A;  3MGS D;  5AV6 C;  1BH9 A;  1AOI D;  4LD9 D;  5JA4 B;  3B6G C;  1N1J A;  1P3I B;  4J8X B;  1H3O A;  3X1U A;  2Y2N A;  5GSU C;  4H9Q A;  1KX4 B;  5AY8 D;  5BNV B;  3A6N D;  2ARO B;  4KUD C;  1WWI A;  3B6F B;  3WAA D;  1KX3 A;  3LZ1 B;  3W98 C;  2PYO B;  4M6B A;  4KHA A;  5B2I B;  5CP6 A;  3LJA B;  3MNN C;  3WKJ C;  4YM6 A;  5FUG B;  4JJN A;  5DNM A;  4H9P B;  3REI D;  3REL D;  2CV5 D;  3AV2 C;  5GT3 A;  1KX5 B;  1TZY D;  3LZ0 D;  4XZQ A;  3AZN C;  5GT0 C;  3AZI C;  1S32 A;  5CPJ B;  4Z5T C;  2NZD B;  3P5J B;  3X1V D;  5AV6 B;  3AYW C;  3MVD C;  3KWQ A;  4CSR A;  2FJ7 A;  4NFT A;  3B6G D;  5BO0 A;  5AV8 C;  1JFI A;  1P3B B;  1R4V A;  5AVB A;  2ZM5 A;  2BYK B;  3UT9 A;  5B0Z A;  4J8W C;  1U35 C;  1P3L B;  4X23 B;  1P3M C;  5G49 A;  3W97 B;  4KUD D;  3B0D B;  5CPK C;  5B40 B;  1B6W A;  2F8N B;  2NQB C;  3EPL A;  4LD9 A;  4UUZ A;  4J8U B;  3MNN D;  4XUJ B;  1HQ3 A;  2ZY4 A;  1P34 C;  5C3I B;  5B32 B;  3AV2 D;  3EPK A;  1EQZ B;  3MGP C;  3X1T A;  2Y2K A;  5AV9 A;  4NE5 A;  3AZI D;  4Z5T B;  5GT0 D;  5AV5 D;  1P3G C;  3X1S B;  5JRG A;  2Y2H A;  3MVD D;  2YFW B;  2HUE B;  1KX3 C;  2RVQ D;  3AZM D;  5CPI C;  1P3A A;  5B33 D;  4HGA B;  4G92 B;  5CP6 C;  3VH5 A;  3REL A;  2BG1 A;  4YM6 C;  2XD5 A;  3AZF A;  4JJN C;  4H9O B;  5DNM C;  4J8W B;  1P3F B;  5E5A B;  4QLC D;  4DRA A;  3REJ C;  3FDD A;  3KUY D;  1P3M D;  1F1E A;  5B31 D;  4XZQ C;  2NQB D;  1Z2C B;  1ID3 B;  5F99 B;  3KWQ C;  1P34 B;  3UTA D;  3W99 A;  3MGP B;  3AZJ D;  4ZBJ C;  5FUG A;  3X1U D;  3UT9 C;  1P3G B;  4H9P A;  1KU5 A;  1P3O B;  3AZL B;  1KX3 D;  3KXB A;  5CPI B;  5B0Y A;  1AOI C;  4LD9 C;  5CP6 D;  1TAF A;  3AZH A;  3MGR B;  4YM6 D;  1HQ3 C;  5B1L B;  3AZE B;  3AZK A;  3AV1 B;  4JJN D;  5DNM D;  3WTP A;  2HIO B;  5GT3 D;  3X1T C;  1Q9C A;  5AY8 C;  5AV9 C;  1P3P A;  2BYK A;  4NE3 A;  1S32 D;  3REK B;  3WAA C;  3TU4 A;  4YS3 A;  5B24 D;  5JRG C;  5B2J D;  3KWQ D;  4H9S A;  2FJ7 D;  5AVC A;  1P3A C;  3AFA D;  1M1A A;  5GXQ B;  3REL C;  4QLC A;  3AZF C;  5AVB D;  5B31 A;  1TZY C;  3UT9 D;  1W2E A;  3WA9 B;  5B0Z D;  4WU9 B;  4CAY B;  3MGS B;  3V9R B;  3B0B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...