2NZDD

Nucleosome core particle containing 145 bp of dna
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
95
structure length
95
Chain Sequence
KTRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords DNA (145-MER)
publication title DNA stretching and extreme kinking in the nucleosome core
pubmed doi rcsb
source organism Xenopus laevis
total genus 37
structure length 95
sequence length 95
chains with identical sequence H
ec nomenclature
pdb deposition date 2006-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 2nzdD00
5DNMA 5AY8A 1P3IA 4J8WD 3MNNC 3AZFC 3KUYA 5CPJA 5KDMA 3WTPE 5F99B 3C1BB 4QLCC 4ZUXC 5B0ZB 5GT0B 1P3KB 3TU4D 3WA9C 4Z66B 5AY8D 1P3ID 4LD9C 4H9RA 3WAAC 3AYWC 2HIOB 4YM6C 3AZGC 1KU5A 4J8XA 3AZEC 1M19C 3LJAC 1TZYC 4X23A 5CPJD 5AV5D 4H9PA 3O62B 1AOIB 4G91C 1P34D 4KGCB 2CV5A 2F8NA 5GT3A 5B40B 4YM6D 4J8XD 5G49A 3C1CA 3LZ0B 3MGPA 5B33A 3A6NC 1KX5C 5BNVA 4Z5TB 4J8VD 5GXQD 3W98C 5AV6A 4DRAA 5E5AC 2HUEC 1S32A 4H9QB 5C3IB 3X1TB 1KX3A 3B6GD 5KDMB 3WKJB 3AN2C 2CV5D 5FUGB 3VH6A 5GT3D 3WTPA 3AZIC 3W97C 3AFAC 1BFMA 5B2IA 4WZSB 5B1MC 3C1CD 3MGPD 3A6ND 5B33D 3W98D 5GSUC 1P3MA 3W96B 1S32D 1EQZA 1M18A 4CSRA 4WU8A 3W97D 3AZID 3AFAD 1U35A 5B2ID 3AZJA 5JA4A 4WNNB 5AV8A 3VH6W 3AZKD 5B32G 3MGSA 2NQBA 1P3BA 3REKC 3X1VC 5AVCD 1EQZD 2LY8A 3AZHC 5BT1D 4XZQC 5AV9A 2CWEA 2RVQC 4LD9B 3WAAB 4KUDA 3AZGB 5CP6A 2NZDA 3LJAB 3RELC 3W99B 5AV8D 3AZMA 3AZNB 2NQBD 1P3BD 2BYKA 3REIB 3MGRA 1ID3C 4R8PB 4H9SC 3AZHD 4YS3C 3KWQB 3LELB 1P3LA 3KXBC 3REHD 3NQJA 1P3GB 4KUDD 3UTBC 4E45A 4CAYA 3AZLC 5DNNB 3RELD 1TAFA 3X1SB 3AZMD 1M18B 1P3PC 2AROC 3R45B 2HUEB 5B2JB 3MGRD 3UTAB 3AZJB 2FJ7A 1P3AA 3C1BA 5F99A 4WU9D 4AWLB 3AZLD 5B0ZA 5GT0A 5AVBD 1P3KA 4EO5C 5CPKB 5B31C 5GSUB 2HIOA 3B6FC 1B67A 4JJNC 1ZLAC 5JRGA 2IO5B 3VH5A 3LZ1D 4J8WC 3C1BD 5F99D 3UT9B 3O62A 1AOIA 5GT0D 2PYOD 4KGCA 2YFVB 3AV2D 1P3KD 4Z66D 5CPIB 3X1VB 1P3OB 5B40A 3AV1C 1M1AB 3LZ0A 4XZQB 3TU4C 5DNMC 5AY8C 1P3IC 4Z5TA 3VH5W 1AOID 4ZBJC 4H9QA 5CPJC 3X1TA 2FJ7B 1P3AB 5AV5C 4M6BA 3WKJA 3X1UD 5FUGA 3MGQD 4J8UB 3AV1D 5B24A 1B6WA 1HQ3B 3VH5T 5BNXB 1P34C 3KXBB 5DNMD 4XUJA 3W96A 5JRGB 4J8XC 3KUYD 4X23C 1P3PB 3X1TD 3WKJD 1R4VA 4J8VC 5GXQC 5B32B 5B1LB 4WNNA 3B6GC 3B0DC 2CV5C 1H3OB 5B0YB 5GT3C 3W96D 3C1CC 3MGPC 4X23D 5B33C 4LD9A 5BS7A 3AYWA 1KX4B 3WAAA 4JJNB 5AV6C 3AZGA 3LJAA 1S32C 3W99A 3AZNA 2F8ND 5B24B 3REIA 1P3FB 4R8PA 3REJB 5B2IC 3MVDB 3KWQA 3LELA 1F66B 3AZKC 3B0CW 1P3GA 5AV6D 4XUJB 5AVCC 1P3MC 5DNNA 1EQZC 3TU4B 5BT1C 3X1SA 1KX3D 3AZND 3MNNB 3AZFB 3R45A 2YFWB 3B0CT 3WTPD 3REID 5B2JA 4R8PD 1U35C 3UTAA 5AV8C 2F8NK 3MGSC 2NQBC 4QLCB 1N1JB 1P3GD 2L5AA 4ZUXB 1P3BC 1P3MD 3WA9B 3X1SD 1M18D 5CPKA 3REHC 3AYWB 3VH6T 5GSUA 4WU8D 4YM6B 4KUDC 2NZDC 3AZEB 5B31G 5B2JD 1M19B 1TZYB 1U35D 3UTAD 4G92C 3AZJD 4DRBA 3AZMC 3MGSD 1HTAA 5GXQB 4J8VB 3UT9A 4G91B 3V9RB 3MGRC 5BO0B 3B6GB 2YFVA 5AV9D 4WU9C 2JSSA 5CPIA 3X1VA 5CP6D 1P3OA 2NZDD 1M1AA 5AVBC 3A6NB 4XZQA 1KX5B 3W98B 3UT9D 5E5AB 1P3LD 3AN2B 3LZ1C 3NQUB 3C1BC 5F99C 3W97B 3AZIB 1P3OD 4J8UA 3AFAB 4H9SA 5B1MB 5BNXA 1HQ3A 5GT0C 5B0ZC 1M1AD 2PYOC 3KXBA 3AV2C 3AZKB 1P3KC 4Z66C 5AVCB 2HIOC 1TAFB 2FJ7D 1P3PA 1P3AD 3O62C 4J8UD 5B32A 5B0ZD 1AOIC 1HQ3D 5B1LA 1BH8A 3X1UC 3REKB 1H3OA 5B0YA 3MGQC 2HIOD 5B40C 3AZHB 5JRGD 2F8NG 3LZ0C 4H9NB 3REHB 1BH9B 1KX4A 4Z5TC 3O62D 4JJNA 3RELB 4KHAB 5B32D 5CHLB 3KUYC 5B1LD 4KGCD 3X1TC 4Z2MG 3WKJC 5B0YD 1ID3B 5B40D 1P3FA 4YS3B 3REJA 3MVDA 3LZ0D 1F66A 1A7WA 3UTBB 4Z5TD 1KX4D 3AZLB 5AVBB 3W96C 3TU4A 2AROB 3MNNA 3AZFA 2YFWA 5B24D 1P3FD 3REJD 4H9OB 1BH8B 3MVDD 3LZ1B 5AV5A 1WWSA 1F66D 4QLCA 1N1JA 4ZUXA 4XUJD 4NE6A 4UUZA 2PYOB 1P34A 3AV2B 3WA9A 4EO5B 5B31B 3MNND 5BS7C 4YM6A 3B6FB 3AZFD 4WV4B 1ZLAB 3AZEA 1M19A 1TZYA 3KSYA 4E44A 3W99C 2BYMB 1KX3C 1F1EA 4J8WB 3AZNC 4J8VA 5GXQA 4QLCD 4ZUXD 3WTPC 3V9RA 3REIC 4R8PC 5BO0A 3KWQC 3B6GA 3LELC 3WA9D 4LD9D 3X1UB 3AYWD 3WAAD 1JFIB 3MGQB 4HGAC 3AV1B 1P3GC 3AZGD 3AZED 1M19D 5DNNC 3LJAD 1TZYD 2F8NH 3W99D 5DNMB 5AY8B 3A6NA 1KX5A 3X1SC 1P3IB 1M18C 4WU8C 3W98A 5E5AA 4ZBJB 5B2JC 3KUYB 3UTAC 3KWQD 3AZJC 3LELD 5CPJB 5AV5B 4Z2MH 3AN2A 3NQUA 3W97A 3AZIA 4UUZB 3AFAA 4AWLC 1P34B 5DNND 5B1MA 1KX5D 3AZKA 5AV9C 4H9RB 5CPKC 5CP6C 5AVCA 4J8XB 5E5AD 4X23B 2IO5C 3AN2D 4H9PB 3UT9C 4NFTA 5B1MD 1P3LC 3B0DB 2CV5B 5CPKD 5GSUD 2F8NB 5GT3B 3REKA 5CPIC 1P3OC 5G49B 3C1CB 3AZHA 1M1AC 3MGPB 5B33B 4H9NA 5BNVB 3REHA 1BH9A 5AV6B 3RELA 1S32B 4KHAA 1Q9CA 1KX3B 2FJ7C 1P3AC 5CPID 3REKD 3WTPB 3X1VD 1ID3A 4J8UC 5B2IB 4YS3A 1HQ3C 4XZQD 2RVQD 4WU9A 4HGAB 3UTBA 3AZLA 1P3MB 1EQZB 5AVBA 5JRGC 4CSRB 2AROA 4WU8B 1ID3D 1U35B 5B32C 4YS3D 5AV8B 5JA4B 3KXBD 4H9OA 5B1LC 4KGCC 3LZ1A 3MGSB 2NQBB 1ULYA 1P3BB 3UTBD 5B0YC 2PYOA 3AV2A 5AV9B 4Z66A 1P3PD 2AROD 5B31A 4NE5A 4KUDB 5CP6B 1KX4C 2NZDB 3B6FA 1WWIA 1ZLAA 4G92B 3AZMB 2BYMA 5C3IC 4J8WA 2BYKB 3MGRB 5B24C 1P3FC 3REJC 1P3LB 3MVDC 3B0BA 5B31D 4WU9B 3NQJB 3X1UA 1F66C 1JFIA 3MGQA 3AV1A 4CAYB 4JJND 3B6FD 4XUJC 1ZLAD 4NE3A
chains in the Genus database with same CATH superfamily
5DNMA 5AY8A 1P3IA 4J8WD 2Y2GA 3MNNC 3AZFC 3KUYA 5CPJA 5KDMA 3WTPE 5F99B 3C1BB 4QLCC 4ZUXC 5B0ZB 5GT0B 1P3KB 3TU4D 3WA9C 4Z66B 5AY8D 1P3ID 4LD9C 4H9RA 3WAAC 3AYWC 2HIOB 4YM6C 3AZGC 1KU5A 4J8XA 3AZEC 1M19C 3LJAC 1TZYC 1Z2CB 4X23A 5CPJD 5AV5D 4H9PA 3O62B 1AOIB 4G91C 1P34D 4KGCB 2CV5A 2DQNC 2F8NA 5GT3A 5B40B 4YM6D 4J8XD 5G49A 3C1CA 3LZ0B 3MGPA 5B33A 3A6NC 1KX5C 5BNVA 4Z5TB 4J8VD 5GXQD 3W98C 5AV6A 4DRAA 5E5AC 2HUEC 1S32A 4H9QB 5C3IB 3X1TB 1KX3A 3B6GD 5KDMB 3WKJB 3AN2C 2CV5D 5FUGB 3VH6A 5GT3D 3WTPA 3AZIC 3W97C 3AFAC 1BFMA 5B2IA 4WZSB 2Y2NA 5B1MC 3MGPD 3C1CD 3A6ND 5B33D 3W98D 5GSUC 1P3MA 3W96B 1S32D 1EQZA 1M18A 4CSRA 4WU8A 3W97D 3AZID 3AL0C 3AFAD 1U35A 5B2ID 3AZJA 5JA4A 4WNNB 5AV8A 3VH6W 3AZKD 5B32G 3MGSA 2NQBA 1P3BA 3REKC 3X1VC 5AVCD 1EQZD 2LY8A 3AZHC 5BT1D 4XZQC 5AV9A 2CWEA 2RVQC 4LD9B 3WAAB 1W2EA 4KUDA 3AZGB 5CP6A 2NZDA 3LJAB 3RELC 2VQRA 3W99B 2G5IC 5AV8D 3AZMA 3AZNB 2NQBD 1P3BD 2BYKA 3REIB 3MGRA 1ID3C 4R8PB 4H9SC 3AZHD 4YS3C 3KWQB 3LELB 1P3LA 3KXBC 3REHD 3NQJA 1P3GB 4KUDD 3UTBC 4E45A 4CAYA 3AZLC 5DNNB 3RELD 2Y2OA 1TAFA 3X1SB 2Y2PA 3AZMD 1M18B 1P3PC 2AROC 3A1IA 2ZY2A 3R45B 2HUEB 5B2JB 3MGRD 3UTAB 3AZJB 2FJ7A 1P3AA 3C1BA 5F99A 4WU9D 4AWLB 3AZLD 5B0ZA 5GT0A 5AVBD 1P3KA 4EO5C 5CPKB 5B31C 5GSUB 2Y2KA 2HIOA 3B6FC 1B67A 4JJNC 1ZLAC 5JRGA 2IO5B 3VH5A 3LZ1D 4J8WC 3C1BD 5F99D 2ZY3A 3UT9B 3O62A 1AOIA 5GT0D 2PYOD 2UWXA 4KGCA 2YFVB 3AV2D 1P3KD 4Z66D 5CPIB 3X1VB 1P3OB 5B40A 3AV1C 1M1AB 3LZ0A 1PZRA 4XZQB 3TU4C 5DNMC 5AY8C 1P3IC 4Z5TA 1T3UA 3VH5W 3KFUG 1AOID 4ZBJC 4H9QA 5CPJC 3X1TA 2FJ7B 1P3AB 5AV5C 4M6BA 3WKJA 3X1UD 5FUGA 2FFFB 3MGQD 4J8UB 3AV1D 5B24A 1B6WA 1HQ3B 3VH5T 3P5JB 5BNXB 1P34C 3KXBB 5DNMD 2JCHA 2Y2JA 2F2AC 4XUJA 3W96A 5JRGB 4J8XC 3KUYD 4X23C 1P3PB 3X1TD 3WKJD 1R4VA 4J8VC 5GXQC 5B32B 5B1LB 4WNNA 3B6GC 3B0DC 2DF4C 2CV5C 1H3OB 5B0YB 5GT3C 3EPLA 3W96D 3EPHA 3C1CC 3MGPC 4X23D 5B33C 4LD9A 5BS7A 3AYWA 1KX4B 3WAAA 4JJNB 5AV6C 3AZGA 3LJAA 1S32C 3FDDA 3W99A 3AZNA 2F8ND 5B24B 3REIA 1P3FB 4R8PA 3REJB 5B2IC 3MVDB 3KWQA 3LELA 1F66B 3AZKC 3B0CW 1P3GA 5AV6D 4XUJB 5AVCC 2Y2LA 5DNNA 1P3MC 1EQZC 3TU4B 5BT1C 3X1SA 1KX3D 3AZND 3MNNB 3AZFB 3R45A 2YFWB 3B0CT 3WTPD 3REID 5B2JA 4R8PD 1U35C 3UTAA 5AV8C 2F8NK 3MGSC 2NQBC 4QLCB 1N1JB 1P3GD 2L5AA 4ZUXB 1P3BC 1P3MD 3WA9B 3EPKA 3X1SD 1M18D 2RIQA 5CPKA 3REHC 3AYWB 3VH6T 5GSUA 4WU8D 4YM6B 4KUDC 2NZDC 3AZEB 5B31G 5B2JD 1M19B 1TZYB 1U35D 3UTAD 4G92C 3AZJD 4DRBA 3AZMC 3MGSD 1HTAA 5GXQB 2ZY5A 4J8VB 3UT9A 4G91B 3V9RB 3MGRC 5BO0B 3B6GB 2YFVA 5AV9D 4WU9C 2JSSA 5CPIA 3X1VA 5CP6D 1P3OA 2NZDD 1M1AA 4DQYB 5AVBC 3A6NB 4XZQA 1KX5B 3W98B 3UT9D 5E5AB 1P3LD 3AN2B 2BG1A 3LZ1C 3NQUB 3C1BC 5F99C 3W97B 3AZIB 1P3OD 4J8UA 3AFAB 4H9SA 5B1MB 5BNXA 1HQ3A 5GT0C 5B0ZC 1M1AD 2PYOC 3KXBA 3AV2C 3EG5B 3AZKB 1P3KC 4Z66C 2XD1A 5AVCB 2HIOC 1TAFB 2FJ7D 1P3PA 1P3AD 3O62C 4J8UD 5B32A 5B0ZD 1AOIC 1HQ3D 5B1LA 1BH8A 3IP4C 3X1UC 3REKB 1H3OA 5B0YA 3MGQC 2HIOD 5B40C 3AZHB 5JRGD 2F8NG 3LZ0C 4H9NB 3REHB 1BH9B 1KX4A 4Z5TC 3O62D 4JJNA 3RELB 4KHAB 5B32D 5CHLB 3KUYC 5B1LD 4KGCD 3X1TC 4Z2MG 3WKJC 5B0YD 1ID3B 5B40D 1P3FA 4YS3B 3REJA 3MVDA 3LZ0D 2Y2MA 1F66A 1A7WA 3UTBB 4Z5TD 1KX4D 3AZLB 4UPKA 5AVBB 3W96C 3TU4A 2AROB 2JE5A 3MNNA 3AZFA 2YFWA 5B24D 1P3FD 3REJD 4H9OB 1BH8B 3MVDD 3LZ1B 5AV5A 1WWSA 1F66D 4QLCA 1N1JA 4ZUXA 2Y2QA 4XUJD 4NE6A 4UUZA 2PYOB 1P34A 3H0RC 3AV2B 3WA9A 4EO5B 5B31B 3MNND 5BS7C 4YM6A 3B6FB 3AZFD 4WV4B 1ZLAB 3AZEA 1M19A 1TZYA 3KSYA 4E44A 3W99C 2BYMB 1KX3C 1F1EA 4J8WB 3AZNC 4J8VA 5GXQA 2Y2HA 4QLCD 4ZUXD 3V9RA 3WTPC 3REIC 4R8PC 5BO0A 3KWQC 3B6GA 3LELC 3WA9D 4LD9D 3X1UB 3AYWD 3WAAD 1JFIB 3MGQB 4HGAC 3AV1B 1P3GC 3AZGD 3AZED 3EPJA 5DNNC 3LJAD 1TZYD 1M19D 2F8NH 3W99D 5DNMB 5AY8B 3A6NA 1KX5A 3X1SC 1P3IB 1M18C 4WU8C 3W98A 5E5AA 4ZBJB 5B2JC 3KUYB 3UTAC 3KWQD 3AZJC 3LELD 5CPJB 5AV5B 4Z2MH 3AN2A 3NQUA 3W97A 3AZIA 4UUZB 3AFAA 4AWLC 1P34B 5DNND 3H0MC 5B1MA 1KX5D 3AZKA 5AV9C 4H9RB 5CPKC 4WJ3C 5CP6C 5AVCA 4J8XB 5E5AD 4X23B 2IO5C 3AN2D 4H9PB 3UT9C 2W8SA 4NFTA 5B1MD 1P3LC 3B0DB 2CV5B 5CPKD 5GSUD 2F8NB 5GT3B 3REKA 5CPIC 1P3OC 5G49B 3C1CB 3AZHA 1M1AC 3MGPB 2G5HC 5B33B 3F6TA 4H9NA 5BNVB 3REHA 1BH9A 5AV6B 3RELA 1S32B 4KHAA 1Q9CA 1KX3B 2FJ7C 1P3AC 5CPID 3REKD 3WTPB 3X1VD 1ID3A 4J8UC 2Y2IA 5B2IB 4YS3A 1HQ3C 2XD5A 4XZQD 2RVQD 4WU9A 4HGAB 3UTBA 2ZY4A 3AZLA 1P3MB 1EQZB 5AVBA 5JRGC 4CSRB 2AROA 4WU8B 1ID3D 1U35B 5B32C 2ZM5A 4YS3D 5AV8B 5JA4B 3KXBD 4H9OA 5B1LC 4KGCC 3LZ1A 3MGSB 2NQBB 1ULYA 1P3BB 3UTBD 5B0YC 2PYOA 3AV2A 5AV9B 4Z66A 1P3PD 2AROD 5B31A 4NE5A 4KUDB 2J8PA 5CP6B 1KX4C 2NZDB 3B6FA 1WWIA 1ZLAA 4G92B 3AZMB 2BYMA 5C3IC 4J8WA 2BYKB 3MGRB 5B24C 1P3FC 3REJC 1P3LB 3MVDC 3A1KA 3B0BA 5B31D 4WU9B 3NQJB 3X1UA 1F66C 3H0LC 1JFIA 3MGQA 3AV1A 4CAYB 4JJND 3B6FD 4XUJC 1ZLAD 4NE3A
chains in the Genus database with same CATH topology
5DNMA 5AY8A 1P3IA 4J8WD 2Y2GA 3MNNC 3AZFC 3KUYA 5CPJA 5KDMA 3WTPE 5F99B 3C1BB 4QLCC 4ZUXC 5B0ZB 5GT0B 1P3KB 3TU4D 3WA9C 4Z66B 5AY8D 1P3ID 4LD9C 4H9RA 3WAAC 3AYWC 2HIOB 4YM6C 3AZGC 1KU5A 4J8XA 3AZEC 1M19C 3LJAC 1TZYC 1Z2CB 4X23A 5CPJD 5AV5D 4H9PA 3O62B 1AOIB 4G91C 1P34D 4KGCB 2CV5A 2DQNC 2F8NA 5GT3A 5B40B 4YM6D 4J8XD 5G49A 3C1CA 3LZ0B 3MGPA 5B33A 3A6NC 1KX5C 5BNVA 4Z5TB 4J8VD 5GXQD 3W98C 5AV6A 4DRAA 5E5AC 2HUEC 1S32A 4H9QB 5C3IB 3X1TB 1KX3A 3B6GD 5KDMB 3WKJB 3AN2C 2CV5D 5FUGB 3VH6A 5GT3D 3WTPA 3AZIC 3W97C 3AFAC 1BFMA 5B2IA 4WZSB 2Y2NA 5B1MC 3MGPD 3C1CD 3A6ND 5B33D 3W98D 5GSUC 1P3MA 3W96B 1S32D 1EQZA 1M18A 4CSRA 4WU8A 3W97D 3AZID 3AL0C 3AFAD 1U35A 5B2ID 3AZJA 5JA4A 4WNNB 5AV8A 3VH6W 3AZKD 5B32G 3MGSA 2NQBA 1P3BA 3REKC 3X1VC 5AVCD 1EQZD 2LY8A 3AZHC 5BT1D 4XZQC 5AV9A 2CWEA 2RVQC 4LD9B 3WAAB 1W2EA 4KUDA 3AZGB 5CP6A 2NZDA 3LJAB 3RELC 2VQRA 3W99B 2G5IC 5AV8D 3AZMA 3AZNB 2NQBD 1P3BD 2BYKA 3REIB 3MGRA 1ID3C 4R8PB 4H9SC 3AZHD 4YS3C 3KWQB 3LELB 1P3LA 3KXBC 3REHD 3NQJA 1P3GB 4KUDD 3UTBC 4E45A 4CAYA 3AZLC 5DNNB 3RELD 2Y2OA 1TAFA 3X1SB 2Y2PA 3AZMD 1M18B 1P3PC 2AROC 3A1IA 2ZY2A 3R45B 2HUEB 5B2JB 3MGRD 3UTAB 3AZJB 2FJ7A 1P3AA 3C1BA 5F99A 4WU9D 4AWLB 3AZLD 5B0ZA 5GT0A 5AVBD 1P3KA 4EO5C 5CPKB 5B31C 5GSUB 2Y2KA 2HIOA 3B6FC 1B67A 4JJNC 1ZLAC 5JRGA 2IO5B 3VH5A 3LZ1D 4J8WC 3C1BD 5F99D 2ZY3A 3UT9B 3O62A 1AOIA 5GT0D 2PYOD 2UWXA 4KGCA 2YFVB 3AV2D 1P3KD 4Z66D 5CPIB 3X1VB 1P3OB 5B40A 3AV1C 1M1AB 3LZ0A 1PZRA 4XZQB 3TU4C 5DNMC 5AY8C 1P3IC 4Z5TA 1T3UA 3VH5W 3KFUG 1AOID 4ZBJC 4H9QA 5CPJC 3X1TA 2FJ7B 1P3AB 5AV5C 4M6BA 3WKJA 3X1UD 5FUGA 2FFFB 3MGQD 4J8UB 3AV1D 5B24A 1B6WA 1HQ3B 3VH5T 3P5JB 5BNXB 1P34C 3KXBB 5DNMD 2JCHA 2Y2JA 2F2AC 4XUJA 3W96A 5JRGB 4J8XC 3KUYD 4X23C 1P3PB 3X1TD 3WKJD 1R4VA 4J8VC 5GXQC 5B32B 5B1LB 4WNNA 3B6GC 3B0DC 2DF4C 2CV5C 1H3OB 5B0YB 5GT3C 3EPLA 3W96D 3EPHA 3C1CC 3MGPC 4X23D 5B33C 4LD9A 5BS7A 3AYWA 1KX4B 3WAAA 4JJNB 5AV6C 3AZGA 3LJAA 1S32C 3FDDA 3W99A 3AZNA 2F8ND 5B24B 3REIA 1P3FB 4R8PA 3REJB 5B2IC 3MVDB 3KWQA 3LELA 1F66B 3AZKC 3B0CW 1P3GA 5AV6D 4XUJB 5AVCC 2Y2LA 5DNNA 1P3MC 1EQZC 3TU4B 5BT1C 3X1SA 1KX3D 3AZND 3MNNB 3AZFB 3R45A 2YFWB 3B0CT 3WTPD 3REID 5B2JA 4R8PD 1U35C 3UTAA 5AV8C 2F8NK 3MGSC 2NQBC 4QLCB 1N1JB 1P3GD 2L5AA 4ZUXB 1P3BC 1P3MD 3WA9B 3EPKA 3X1SD 1M18D 2RIQA 5CPKA 3REHC 3AYWB 3VH6T 5GSUA 4WU8D 4YM6B 4KUDC 2NZDC 3AZEB 5B31G 5B2JD 1M19B 1TZYB 1U35D 3UTAD 4G92C 3AZJD 4DRBA 3AZMC 3MGSD 1HTAA 5GXQB 2ZY5A 4J8VB 3UT9A 4G91B 3V9RB 3MGRC 5BO0B 3B6GB 2YFVA 5AV9D 4WU9C 2JSSA 5CPIA 3X1VA 5CP6D 1P3OA 2NZDD 1M1AA 4DQYB 5AVBC 3A6NB 4XZQA 1KX5B 3W98B 3UT9D 5E5AB 1P3LD 3AN2B 2BG1A 3LZ1C 3NQUB 3C1BC 5F99C 3W97B 3AZIB 1P3OD 4J8UA 3AFAB 4H9SA 5B1MB 5BNXA 1HQ3A 5GT0C 5B0ZC 1M1AD 2PYOC 3KXBA 3AV2C 3EG5B 3AZKB 1P3KC 4Z66C 2XD1A 5AVCB 2HIOC 1TAFB 2FJ7D 1P3PA 1P3AD 3O62C 4J8UD 5B32A 5B0ZD 1AOIC 1HQ3D 5B1LA 1BH8A 3IP4C 3X1UC 3REKB 1H3OA 5B0YA 3MGQC 2HIOD 5B40C 3AZHB 5JRGD 2F8NG 3LZ0C 4H9NB 3REHB 1BH9B 1KX4A 4Z5TC 3O62D 4JJNA 3RELB 4KHAB 5B32D 5CHLB 3KUYC 5B1LD 4KGCD 3X1TC 4Z2MG 3WKJC 5B0YD 1ID3B 5B40D 1P3FA 4YS3B 3REJA 3MVDA 3LZ0D 2Y2MA 1F66A 1A7WA 3UTBB 4Z5TD 1KX4D 3AZLB 4UPKA 5AVBB 3W96C 3TU4A 2AROB 2JE5A 3MNNA 3AZFA 2YFWA 5B24D 1P3FD 3REJD 4H9OB 1BH8B 3MVDD 3LZ1B 5AV5A 1WWSA 1F66D 4QLCA 1N1JA 4ZUXA 2Y2QA 4XUJD 4NE6A 4UUZA 2PYOB 1P34A 3H0RC 3AV2B 3WA9A 4EO5B 5B31B 3MNND 5BS7C 4YM6A 3B6FB 3AZFD 4WV4B 1ZLAB 3AZEA 1M19A 1TZYA 3KSYA 4E44A 3W99C 2BYMB 1KX3C 1F1EA 4J8WB 3AZNC 4J8VA 5GXQA 2Y2HA 4QLCD 4ZUXD 3V9RA 3WTPC 3REIC 4R8PC 5BO0A 3KWQC 3B6GA 3LELC 3WA9D 4LD9D 3X1UB 3AYWD 3WAAD 1JFIB 3MGQB 4HGAC 3AV1B 1P3GC 3AZGD 3AZED 3EPJA 5DNNC 3LJAD 1TZYD 1M19D 2F8NH 3W99D 5DNMB 5AY8B 3A6NA 1KX5A 3X1SC 1P3IB 1M18C 4WU8C 3W98A 5E5AA 4ZBJB 5B2JC 3KUYB 3UTAC 3KWQD 3AZJC 3LELD 5CPJB 5AV5B 4Z2MH 3AN2A 3NQUA 3W97A 3AZIA 4UUZB 3AFAA 4AWLC 1P34B 5DNND 3H0MC 5B1MA 1KX5D 3AZKA 5AV9C 4H9RB 5CPKC 4WJ3C 5CP6C 5AVCA 4J8XB 5E5AD 4X23B 2IO5C 3AN2D 4H9PB 3UT9C 2W8SA 4NFTA 5B1MD 1P3LC 3B0DB 2CV5B 5CPKD 5GSUD 2F8NB 5GT3B 3REKA 5CPIC 1P3OC 5G49B 3C1CB 3AZHA 1M1AC 3MGPB 2G5HC 5B33B 3F6TA 4H9NA 5BNVB 3REHA 1BH9A 5AV6B 3RELA 1S32B 4KHAA 1Q9CA 1KX3B 2FJ7C 1P3AC 5CPID 3REKD 3WTPB 3X1VD 1ID3A 4J8UC 2Y2IA 5B2IB 4YS3A 1HQ3C 2XD5A 4XZQD 2RVQD 4WU9A 4HGAB 3UTBA 2ZY4A 3AZLA 1P3MB 1EQZB 5AVBA 5JRGC 4CSRB 2AROA 4WU8B 1ID3D 1U35B 5B32C 2ZM5A 4YS3D 5AV8B 5JA4B 3KXBD 4H9OA 5B1LC 4KGCC 3LZ1A 3MGSB 2NQBB 1ULYA 1P3BB 3UTBD 5B0YC 2PYOA 3AV2A 5AV9B 4Z66A 1P3PD 2AROD 5B31A 4NE5A 4KUDB 2J8PA 5CP6B 1KX4C 2NZDB 3B6FA 1WWIA 1ZLAA 4G92B 3AZMB 2BYMA 5C3IC 4J8WA 2BYKB 3MGRB 5B24C 1P3FC 3REJC 1P3LB 3MVDC 3A1KA 3B0BA 5B31D 4WU9B 3NQJB 3X1UA 1F66C 3H0LC 1JFIA 3MGQA 3AV1A 4CAYB 4JJND 3B6FD 4XUJC 1ZLAD 4NE3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DNM A;  5AY8 A;  1P3I A;  4J8W D;  3MNN C;  3AZF C;  3KUY A;  5CPJ A;  5KDM A;  3WTP E;  5F99 B;  3C1B B;  4QLC C;  4ZUX C;  5B0Z B;  5GT0 B;  1P3K B;  3TU4 D;  3WA9 C;  4Z66 B;  5AY8 D;  1P3I D;  4LD9 C;  4H9R A;  3WAA C;  3AYW C;  2HIO B;  4YM6 C;  3AZG C;  1KU5 A;  4J8X A;  3AZE C;  1M19 C;  3LJA C;  1TZY C;  4X23 A;  5CPJ D;  5AV5 D;  4H9P A;  3O62 B;  1AOI B;  4G91 C;  1P34 D;  4KGC B;  2CV5 A;  2F8N A;  5GT3 A;  5B40 B;  4YM6 D;  4J8X D;  5G49 A;  3C1C A;  3LZ0 B;  3MGP A;  5B33 A;  3A6N C;  1KX5 C;  5BNV A;  4Z5T B;  4J8V D;  5GXQ D;  3W98 C;  5AV6 A;  4DRA A;  5E5A C;  2HUE C;  1S32 A;  4H9Q B;  5C3I B;  3X1T B;  1KX3 A;  3B6G D;  5KDM B;  3WKJ B;  3AN2 C;  2CV5 D;  5FUG B;  3VH6 A;  5GT3 D;  3WTP A;  3AZI C;  3W97 C;  3AFA C;  1BFM A;  5B2I A;  4WZS B;  5B1M C;  3C1C D;  3MGP D;  3A6N D;  5B33 D;  3W98 D;  5GSU C;  1P3M A;  3W96 B;  1S32 D;  1EQZ A;  1M18 A;  4CSR A;  4WU8 A;  3W97 D;  3AZI D;  3AFA D;  1U35 A;  5B2I D;  3AZJ A;  5JA4 A;  4WNN B;  5AV8 A;  3VH6 W;  3AZK D;  5B32 G;  3MGS A;  2NQB A;  1P3B A;  3REK C;  3X1V C;  5AVC D;  1EQZ D;  2LY8 A;  3AZH C;  5BT1 D;  4XZQ C;  5AV9 A;  2CWE A;  2RVQ C;  4LD9 B;  3WAA B;  4KUD A;  3AZG B;  5CP6 A;  2NZD A;  3LJA B;  3REL C;  3W99 B;  5AV8 D;  3AZM A;  3AZN B;  2NQB D;  1P3B D;  2BYK A;  3REI B;  3MGR A;  1ID3 C;  4R8P B;  4H9S C;  3AZH D;  4YS3 C;  3KWQ B;  3LEL B;  1P3L A;  3KXB C;  3REH D;  3NQJ A;  1P3G B;  4KUD D;  3UTB C;  4E45 A;  4CAY A;  3AZL C;  5DNN B;  3REL D;  1TAF A;  3X1S B;  3AZM D;  1M18 B;  1P3P C;  2ARO C;  3R45 B;  2HUE B;  5B2J B;  3MGR D;  3UTA B;  3AZJ B;  2FJ7 A;  1P3A A;  3C1B A;  5F99 A;  4WU9 D;  4AWL B;  3AZL D;  5B0Z A;  5GT0 A;  5AVB D;  1P3K A;  4EO5 C;  5CPK B;  5B31 C;  5GSU B;  2HIO A;  3B6F C;  1B67 A;  4JJN C;  1ZLA C;  5JRG A;  2IO5 B;  3VH5 A;  3LZ1 D;  4J8W C;  3C1B D;  5F99 D;  3UT9 B;  3O62 A;  1AOI A;  5GT0 D;  2PYO D;  4KGC A;  2YFV B;  3AV2 D;  1P3K D;  4Z66 D;  5CPI B;  3X1V B;  1P3O B;  5B40 A;  3AV1 C;  1M1A B;  3LZ0 A;  4XZQ B;  3TU4 C;  5DNM C;  5AY8 C;  1P3I C;  4Z5T A;  3VH5 W;  1AOI D;  4ZBJ C;  4H9Q A;  5CPJ C;  3X1T A;  2FJ7 B;  1P3A B;  5AV5 C;  4M6B A;  3WKJ A;  3X1U D;  5FUG A;  3MGQ D;  4J8U B;  3AV1 D;  5B24 A;  1B6W A;  1HQ3 B;  3VH5 T;  5BNX B;  1P34 C;  3KXB B;  5DNM D;  4XUJ A;  3W96 A;  5JRG B;  4J8X C;  3KUY D;  4X23 C;  1P3P B;  3X1T D;  3WKJ D;  1R4V A;  4J8V C;  5GXQ C;  5B32 B;  5B1L B;  4WNN A;  3B6G C;  3B0D C;  2CV5 C;  1H3O B;  5B0Y B;  5GT3 C;  3W96 D;  3C1C C;  3MGP C;  4X23 D;  5B33 C;  4LD9 A;  5BS7 A;  3AYW A;  1KX4 B;  3WAA A;  4JJN B;  5AV6 C;  3AZG A;  3LJA A;  1S32 C;  3W99 A;  3AZN A;  2F8N D;  5B24 B;  3REI A;  1P3F B;  4R8P A;  3REJ B;  5B2I C;  3MVD B;  3KWQ A;  3LEL A;  1F66 B;  3AZK C;  3B0C W;  1P3G A;  5AV6 D;  4XUJ B;  5AVC C;  1P3M C;  5DNN A;  1EQZ C;  3TU4 B;  5BT1 C;  3X1S A;  1KX3 D;  3AZN D;  3MNN B;  3AZF B;  3R45 A;  2YFW B;  3B0C T;  3WTP D;  3REI D;  5B2J A;  4R8P D;  1U35 C;  3UTA A;  5AV8 C;  2F8N K;  3MGS C;  2NQB C;  4QLC B;  1N1J B;  1P3G D;  2L5A A;  4ZUX B;  1P3B C;  1P3M D;  3WA9 B;  3X1S D;  1M18 D;  5CPK A;  3REH C;  3AYW B;  3VH6 T;  5GSU A;  4WU8 D;  4YM6 B;  4KUD C;  2NZD C;  3AZE B;  5B31 G;  5B2J D;  1M19 B;  1TZY B;  1U35 D;  3UTA D;  4G92 C;  3AZJ D;  4DRB A;  3AZM C;  3MGS D;  1HTA A;  5GXQ B;  4J8V B;  3UT9 A;  4G91 B;  3V9R B;  3MGR C;  5BO0 B;  3B6G B;  2YFV A;  5AV9 D;  4WU9 C;  2JSS A;  5CPI A;  3X1V A;  5CP6 D;  1P3O A;  2NZD D;  1M1A A;  5AVB C;  3A6N B;  4XZQ A;  1KX5 B;  3W98 B;  3UT9 D;  5E5A B;  1P3L D;  3AN2 B;  3LZ1 C;  3NQU B;  3C1B C;  5F99 C;  3W97 B;  3AZI B;  1P3O D;  4J8U A;  3AFA B;  4H9S A;  5B1M B;  5BNX A;  1HQ3 A;  5GT0 C;  5B0Z C;  1M1A D;  2PYO C;  3KXB A;  3AV2 C;  3AZK B;  1P3K C;  4Z66 C;  5AVC B;  2HIO C;  1TAF B;  2FJ7 D;  1P3P A;  1P3A D;  3O62 C;  4J8U D;  5B32 A;  5B0Z D;  1AOI C;  1HQ3 D;  5B1L A;  1BH8 A;  3X1U C;  3REK B;  1H3O A;  5B0Y A;  3MGQ C;  2HIO D;  5B40 C;  3AZH B;  5JRG D;  2F8N G;  3LZ0 C;  4H9N B;  3REH B;  1BH9 B;  1KX4 A;  4Z5T C;  3O62 D;  4JJN A;  3REL B;  4KHA B;  5B32 D;  5CHL B;  3KUY C;  5B1L D;  4KGC D;  3X1T C;  4Z2M G;  3WKJ C;  5B0Y D;  1ID3 B;  5B40 D;  1P3F A;  4YS3 B;  3REJ A;  3MVD A;  3LZ0 D;  1F66 A;  1A7W A;  3UTB B;  4Z5T D;  1KX4 D;  3AZL B;  5AVB B;  3W96 C;  3TU4 A;  2ARO B;  3MNN A;  3AZF A;  2YFW A;  5B24 D;  1P3F D;  3REJ D;  4H9O B;  1BH8 B;  3MVD D;  3LZ1 B;  5AV5 A;  1WWS A;  1F66 D;  4QLC A;  1N1J A;  4ZUX A;  4XUJ D;  4NE6 A;  4UUZ A;  2PYO B;  1P34 A;  3AV2 B;  3WA9 A;  4EO5 B;  5B31 B;  3MNN D;  5BS7 C;  4YM6 A;  3B6F B;  3AZF D;  4WV4 B;  1ZLA B;  3AZE A;  1M19 A;  1TZY A;  3KSY A;  4E44 A;  3W99 C;  2BYM B;  1KX3 C;  1F1E A;  4J8W B;  3AZN C;  4J8V A;  5GXQ A;  4QLC D;  4ZUX D;  3WTP C;  3V9R A;  3REI C;  4R8P C;  5BO0 A;  3KWQ C;  3B6G A;  3LEL C;  3WA9 D;  4LD9 D;  3X1U B;  3AYW D;  3WAA D;  1JFI B;  3MGQ B;  4HGA C;  3AV1 B;  1P3G C;  3AZG D;  3AZE D;  1M19 D;  5DNN C;  3LJA D;  1TZY D;  2F8N H;  3W99 D;  5DNM B;  5AY8 B;  3A6N A;  1KX5 A;  3X1S C;  1P3I B;  1M18 C;  4WU8 C;  3W98 A;  5E5A A;  4ZBJ B;  5B2J C;  3KUY B;  3UTA C;  3KWQ D;  3AZJ C;  3LEL D;  5CPJ B;  5AV5 B;  4Z2M H;  3AN2 A;  3NQU A;  3W97 A;  3AZI A;  4UUZ B;  3AFA A;  4AWL C;  1P34 B;  5DNN D;  5B1M A;  1KX5 D;  3AZK A;  5AV9 C;  4H9R B;  5CPK C;  5CP6 C;  5AVC A;  4J8X B;  5E5A D;  4X23 B;  2IO5 C;  3AN2 D;  4H9P B;  3UT9 C;  4NFT A;  5B1M D;  1P3L C;  3B0D B;  2CV5 B;  5CPK D;  5GSU D;  2F8N B;  5GT3 B;  3REK A;  5CPI C;  1P3O C;  5G49 B;  3C1C B;  3AZH A;  1M1A C;  3MGP B;  5B33 B;  4H9N A;  5BNV B;  3REH A;  1BH9 A;  5AV6 B;  3REL A;  1S32 B;  4KHA A;  1Q9C A;  1KX3 B;  2FJ7 C;  1P3A C;  5CPI D;  3REK D;  3WTP B;  3X1V D;  1ID3 A;  4J8U C;  5B2I B;  4YS3 A;  1HQ3 C;  4XZQ D;  2RVQ D;  4WU9 A;  4HGA B;  3UTB A;  3AZL A;  1P3M B;  1EQZ B;  5AVB A;  5JRG C;  4CSR B;  2ARO A;  4WU8 B;  1ID3 D;  1U35 B;  5B32 C;  4YS3 D;  5AV8 B;  5JA4 B;  3KXB D;  4H9O A;  5B1L C;  4KGC C;  3LZ1 A;  3MGS B;  2NQB B;  1ULY A;  1P3B B;  3UTB D;  5B0Y C;  2PYO A;  3AV2 A;  5AV9 B;  4Z66 A;  1P3P D;  2ARO D;  5B31 A;  4NE5 A;  4KUD B;  5CP6 B;  1KX4 C;  2NZD B;  3B6F A;  1WWI A;  1ZLA A;  4G92 B;  3AZM B;  2BYM A;  5C3I C;  4J8W A;  2BYK B;  3MGR B;  5B24 C;  1P3F C;  3REJ C;  1P3L B;  3MVD C;  3B0B A;  5B31 D;  4WU9 B;  3NQJ B;  3X1U A;  1F66 C;  1JFI A;  3MGQ A;  3AV1 A;  4CAY B;  4JJN D;  3B6F D;  4XUJ C;  1ZLA D;  4NE3 A; 
#chains in the Genus database with same CATH topology
 5DNM A;  5AY8 A;  1P3I A;  4J8W D;  2Y2G A;  3MNN C;  3AZF C;  3KUY A;  5CPJ A;  5KDM A;  3WTP E;  5F99 B;  3C1B B;  4QLC C;  4ZUX C;  5B0Z B;  5GT0 B;  1P3K B;  3TU4 D;  3WA9 C;  4Z66 B;  5AY8 D;  1P3I D;  4LD9 C;  4H9R A;  3WAA C;  3AYW C;  2HIO B;  4YM6 C;  3AZG C;  1KU5 A;  4J8X A;  3AZE C;  1M19 C;  3LJA C;  1TZY C;  1Z2C B;  4X23 A;  5CPJ D;  5AV5 D;  4H9P A;  3O62 B;  1AOI B;  4G91 C;  1P34 D;  4KGC B;  2CV5 A;  2DQN C;  2F8N A;  5GT3 A;  5B40 B;  4YM6 D;  4J8X D;  5G49 A;  3C1C A;  3LZ0 B;  3MGP A;  5B33 A;  3A6N C;  1KX5 C;  5BNV A;  4Z5T B;  4J8V D;  5GXQ D;  3W98 C;  5AV6 A;  4DRA A;  5E5A C;  2HUE C;  1S32 A;  4H9Q B;  5C3I B;  3X1T B;  1KX3 A;  3B6G D;  5KDM B;  3WKJ B;  3AN2 C;  2CV5 D;  5FUG B;  3VH6 A;  5GT3 D;  3WTP A;  3AZI C;  3W97 C;  3AFA C;  1BFM A;  5B2I A;  4WZS B;  2Y2N A;  5B1M C;  3MGP D;  3C1C D;  3A6N D;  5B33 D;  3W98 D;  5GSU C;  1P3M A;  3W96 B;  1S32 D;  1EQZ A;  1M18 A;  4CSR A;  4WU8 A;  3W97 D;  3AZI D;  3AL0 C;  3AFA D;  1U35 A;  5B2I D;  3AZJ A;  5JA4 A;  4WNN B;  5AV8 A;  3VH6 W;  3AZK D;  5B32 G;  3MGS A;  2NQB A;  1P3B A;  3REK C;  3X1V C;  5AVC D;  1EQZ D;  2LY8 A;  3AZH C;  5BT1 D;  4XZQ C;  5AV9 A;  2CWE A;  2RVQ C;  4LD9 B;  3WAA B;  1W2E A;  4KUD A;  3AZG B;  5CP6 A;  2NZD A;  3LJA B;  3REL C;  2VQR A;  3W99 B;  2G5I C;  5AV8 D;  3AZM A;  3AZN B;  2NQB D;  1P3B D;  2BYK A;  3REI B;  3MGR A;  1ID3 C;  4R8P B;  4H9S C;  3AZH D;  4YS3 C;  3KWQ B;  3LEL B;  1P3L A;  3KXB C;  3REH D;  3NQJ A;  1P3G B;  4KUD D;  3UTB C;  4E45 A;  4CAY A;  3AZL C;  5DNN B;  3REL D;  2Y2O A;  1TAF A;  3X1S B;  2Y2P A;  3AZM D;  1M18 B;  1P3P C;  2ARO C;  3A1I A;  2ZY2 A;  3R45 B;  2HUE B;  5B2J B;  3MGR D;  3UTA B;  3AZJ B;  2FJ7 A;  1P3A A;  3C1B A;  5F99 A;  4WU9 D;  4AWL B;  3AZL D;  5B0Z A;  5GT0 A;  5AVB D;  1P3K A;  4EO5 C;  5CPK B;  5B31 C;  5GSU B;  2Y2K A;  2HIO A;  3B6F C;  1B67 A;  4JJN C;  1ZLA C;  5JRG A;  2IO5 B;  3VH5 A;  3LZ1 D;  4J8W C;  3C1B D;  5F99 D;  2ZY3 A;  3UT9 B;  3O62 A;  1AOI A;  5GT0 D;  2PYO D;  2UWX A;  4KGC A;  2YFV B;  3AV2 D;  1P3K D;  4Z66 D;  5CPI B;  3X1V B;  1P3O B;  5B40 A;  3AV1 C;  1M1A B;  3LZ0 A;  1PZR A;  4XZQ B;  3TU4 C;  5DNM C;  5AY8 C;  1P3I C;  4Z5T A;  1T3U A;  3VH5 W;  3KFU G;  1AOI D;  4ZBJ C;  4H9Q A;  5CPJ C;  3X1T A;  2FJ7 B;  1P3A B;  5AV5 C;  4M6B A;  3WKJ A;  3X1U D;  5FUG A;  2FFF B;  3MGQ D;  4J8U B;  3AV1 D;  5B24 A;  1B6W A;  1HQ3 B;  3VH5 T;  3P5J B;  5BNX B;  1P34 C;  3KXB B;  5DNM D;  2JCH A;  2Y2J A;  2F2A C;  4XUJ A;  3W96 A;  5JRG B;  4J8X C;  3KUY D;  4X23 C;  1P3P B;  3X1T D;  3WKJ D;  1R4V A;  4J8V C;  5GXQ C;  5B32 B;  5B1L B;  4WNN A;  3B6G C;  3B0D C;  2DF4 C;  2CV5 C;  1H3O B;  5B0Y B;  5GT3 C;  3EPL A;  3W96 D;  3EPH A;  3C1C C;  3MGP C;  4X23 D;  5B33 C;  4LD9 A;  5BS7 A;  3AYW A;  1KX4 B;  3WAA A;  4JJN B;  5AV6 C;  3AZG A;  3LJA A;  1S32 C;  3FDD A;  3W99 A;  3AZN A;  2F8N D;  5B24 B;  3REI A;  1P3F B;  4R8P A;  3REJ B;  5B2I C;  3MVD B;  3KWQ A;  3LEL A;  1F66 B;  3AZK C;  3B0C W;  1P3G A;  5AV6 D;  4XUJ B;  5AVC C;  2Y2L A;  5DNN A;  1P3M C;  1EQZ C;  3TU4 B;  5BT1 C;  3X1S A;  1KX3 D;  3AZN D;  3MNN B;  3AZF B;  3R45 A;  2YFW B;  3B0C T;  3WTP D;  3REI D;  5B2J A;  4R8P D;  1U35 C;  3UTA A;  5AV8 C;  2F8N K;  3MGS C;  2NQB C;  4QLC B;  1N1J B;  1P3G D;  2L5A A;  4ZUX B;  1P3B C;  1P3M D;  3WA9 B;  3EPK A;  3X1S D;  1M18 D;  2RIQ A;  5CPK A;  3REH C;  3AYW B;  3VH6 T;  5GSU A;  4WU8 D;  4YM6 B;  4KUD C;  2NZD C;  3AZE B;  5B31 G;  5B2J D;  1M19 B;  1TZY B;  1U35 D;  3UTA D;  4G92 C;  3AZJ D;  4DRB A;  3AZM C;  3MGS D;  1HTA A;  5GXQ B;  2ZY5 A;  4J8V B;  3UT9 A;  4G91 B;  3V9R B;  3MGR C;  5BO0 B;  3B6G B;  2YFV A;  5AV9 D;  4WU9 C;  2JSS A;  5CPI A;  3X1V A;  5CP6 D;  1P3O A;  2NZD D;  1M1A A;  4DQY B;  5AVB C;  3A6N B;  4XZQ A;  1KX5 B;  3W98 B;  3UT9 D;  5E5A B;  1P3L D;  3AN2 B;  2BG1 A;  3LZ1 C;  3NQU B;  3C1B C;  5F99 C;  3W97 B;  3AZI B;  1P3O D;  4J8U A;  3AFA B;  4H9S A;  5B1M B;  5BNX A;  1HQ3 A;  5GT0 C;  5B0Z C;  1M1A D;  2PYO C;  3KXB A;  3AV2 C;  3EG5 B;  3AZK B;  1P3K C;  4Z66 C;  2XD1 A;  5AVC B;  2HIO C;  1TAF B;  2FJ7 D;  1P3P A;  1P3A D;  3O62 C;  4J8U D;  5B32 A;  5B0Z D;  1AOI C;  1HQ3 D;  5B1L A;  1BH8 A;  3IP4 C;  3X1U C;  3REK B;  1H3O A;  5B0Y A;  3MGQ C;  2HIO D;  5B40 C;  3AZH B;  5JRG D;  2F8N G;  3LZ0 C;  4H9N B;  3REH B;  1BH9 B;  1KX4 A;  4Z5T C;  3O62 D;  4JJN A;  3REL B;  4KHA B;  5B32 D;  5CHL B;  3KUY C;  5B1L D;  4KGC D;  3X1T C;  4Z2M G;  3WKJ C;  5B0Y D;  1ID3 B;  5B40 D;  1P3F A;  4YS3 B;  3REJ A;  3MVD A;  3LZ0 D;  2Y2M A;  1F66 A;  1A7W A;  3UTB B;  4Z5T D;  1KX4 D;  3AZL B;  4UPK A;  5AVB B;  3W96 C;  3TU4 A;  2ARO B;  2JE5 A;  3MNN A;  3AZF A;  2YFW A;  5B24 D;  1P3F D;  3REJ D;  4H9O B;  1BH8 B;  3MVD D;  3LZ1 B;  5AV5 A;  1WWS A;  1F66 D;  4QLC A;  1N1J A;  4ZUX A;  2Y2Q A;  4XUJ D;  4NE6 A;  4UUZ A;  2PYO B;  1P34 A;  3H0R C;  3AV2 B;  3WA9 A;  4EO5 B;  5B31 B;  3MNN D;  5BS7 C;  4YM6 A;  3B6F B;  3AZF D;  4WV4 B;  1ZLA B;  3AZE A;  1M19 A;  1TZY A;  3KSY A;  4E44 A;  3W99 C;  2BYM B;  1KX3 C;  1F1E A;  4J8W B;  3AZN C;  4J8V A;  5GXQ A;  2Y2H A;  4QLC D;  4ZUX D;  3V9R A;  3WTP C;  3REI C;  4R8P C;  5BO0 A;  3KWQ C;  3B6G A;  3LEL C;  3WA9 D;  4LD9 D;  3X1U B;  3AYW D;  3WAA D;  1JFI B;  3MGQ B;  4HGA C;  3AV1 B;  1P3G C;  3AZG D;  3AZE D;  3EPJ A;  5DNN C;  3LJA D;  1TZY D;  1M19 D;  2F8N H;  3W99 D;  5DNM B;  5AY8 B;  3A6N A;  1KX5 A;  3X1S C;  1P3I B;  1M18 C;  4WU8 C;  3W98 A;  5E5A A;  4ZBJ B;  5B2J C;  3KUY B;  3UTA C;  3KWQ D;  3AZJ C;  3LEL D;  5CPJ B;  5AV5 B;  4Z2M H;  3AN2 A;  3NQU A;  3W97 A;  3AZI A;  4UUZ B;  3AFA A;  4AWL C;  1P34 B;  5DNN D;  3H0M C;  5B1M A;  1KX5 D;  3AZK A;  5AV9 C;  4H9R B;  5CPK C;  4WJ3 C;  5CP6 C;  5AVC A;  4J8X B;  5E5A D;  4X23 B;  2IO5 C;  3AN2 D;  4H9P B;  3UT9 C;  2W8S A;  4NFT A;  5B1M D;  1P3L C;  3B0D B;  2CV5 B;  5CPK D;  5GSU D;  2F8N B;  5GT3 B;  3REK A;  5CPI C;  1P3O C;  5G49 B;  3C1C B;  3AZH A;  1M1A C;  3MGP B;  2G5H C;  5B33 B;  3F6T A;  4H9N A;  5BNV B;  3REH A;  1BH9 A;  5AV6 B;  3REL A;  1S32 B;  4KHA A;  1Q9C A;  1KX3 B;  2FJ7 C;  1P3A C;  5CPI D;  3REK D;  3WTP B;  3X1V D;  1ID3 A;  4J8U C;  2Y2I A;  5B2I B;  4YS3 A;  1HQ3 C;  2XD5 A;  4XZQ D;  2RVQ D;  4WU9 A;  4HGA B;  3UTB A;  2ZY4 A;  3AZL A;  1P3M B;  1EQZ B;  5AVB A;  5JRG C;  4CSR B;  2ARO A;  4WU8 B;  1ID3 D;  1U35 B;  5B32 C;  2ZM5 A;  4YS3 D;  5AV8 B;  5JA4 B;  3KXB D;  4H9O A;  5B1L C;  4KGC C;  3LZ1 A;  3MGS B;  2NQB B;  1ULY A;  1P3B B;  3UTB D;  5B0Y C;  2PYO A;  3AV2 A;  5AV9 B;  4Z66 A;  1P3P D;  2ARO D;  5B31 A;  4NE5 A;  4KUD B;  2J8P A;  5CP6 B;  1KX4 C;  2NZD B;  3B6F A;  1WWI A;  1ZLA A;  4G92 B;  3AZM B;  2BYM A;  5C3I C;  4J8W A;  2BYK B;  3MGR B;  5B24 C;  1P3F C;  3REJ C;  1P3L B;  3MVD C;  3A1K A;  3B0B A;  5B31 D;  4WU9 B;  3NQJ B;  3X1U A;  1F66 C;  3H0L C;  1JFI A;  3MGQ A;  3AV1 A;  4CAY B;  4JJN D;  3B6F D;  4XUJ C;  1ZLA D;  4NE3 A; 
#chains in the Genus database with same CATH homology
 5DNM A;  5AY8 A;  1P3I A;  4J8W D;  2Y2G A;  3MNN C;  3AZF C;  3KUY A;  5CPJ A;  5KDM A;  3WTP E;  5F99 B;  3C1B B;  4QLC C;  4ZUX C;  5B0Z B;  5GT0 B;  1P3K B;  3TU4 D;  3WA9 C;  4Z66 B;  5AY8 D;  1P3I D;  4LD9 C;  4H9R A;  3WAA C;  3AYW C;  2HIO B;  4YM6 C;  3AZG C;  1KU5 A;  4J8X A;  3AZE C;  1M19 C;  3LJA C;  1TZY C;  1Z2C B;  4X23 A;  5CPJ D;  5AV5 D;  4H9P A;  3O62 B;  1AOI B;  4G91 C;  1P34 D;  4KGC B;  2CV5 A;  2DQN C;  2F8N A;  5GT3 A;  5B40 B;  4YM6 D;  4J8X D;  5G49 A;  3C1C A;  3LZ0 B;  3MGP A;  5B33 A;  3A6N C;  1KX5 C;  5BNV A;  4Z5T B;  4J8V D;  5GXQ D;  3W98 C;  5AV6 A;  4DRA A;  5E5A C;  2HUE C;  1S32 A;  4H9Q B;  5C3I B;  3X1T B;  1KX3 A;  3B6G D;  5KDM B;  3WKJ B;  3AN2 C;  2CV5 D;  5FUG B;  3VH6 A;  5GT3 D;  3WTP A;  3AZI C;  3W97 C;  3AFA C;  1BFM A;  5B2I A;  4WZS B;  2Y2N A;  5B1M C;  3MGP D;  3C1C D;  3A6N D;  5B33 D;  3W98 D;  5GSU C;  1P3M A;  3W96 B;  1S32 D;  1EQZ A;  1M18 A;  4CSR A;  4WU8 A;  3W97 D;  3AZI D;  3AL0 C;  3AFA D;  1U35 A;  5B2I D;  3AZJ A;  5JA4 A;  4WNN B;  5AV8 A;  3VH6 W;  3AZK D;  5B32 G;  3MGS A;  2NQB A;  1P3B A;  3REK C;  3X1V C;  5AVC D;  1EQZ D;  2LY8 A;  3AZH C;  5BT1 D;  4XZQ C;  5AV9 A;  2CWE A;  2RVQ C;  4LD9 B;  3WAA B;  1W2E A;  4KUD A;  3AZG B;  5CP6 A;  2NZD A;  3LJA B;  3REL C;  2VQR A;  3W99 B;  2G5I C;  5AV8 D;  3AZM A;  3AZN B;  2NQB D;  1P3B D;  2BYK A;  3REI B;  3MGR A;  1ID3 C;  4R8P B;  4H9S C;  3AZH D;  4YS3 C;  3KWQ B;  3LEL B;  1P3L A;  3KXB C;  3REH D;  3NQJ A;  1P3G B;  4KUD D;  3UTB C;  4E45 A;  4CAY A;  3AZL C;  5DNN B;  3REL D;  2Y2O A;  1TAF A;  3X1S B;  2Y2P A;  3AZM D;  1M18 B;  1P3P C;  2ARO C;  3A1I A;  2ZY2 A;  3R45 B;  2HUE B;  5B2J B;  3MGR D;  3UTA B;  3AZJ B;  2FJ7 A;  1P3A A;  3C1B A;  5F99 A;  4WU9 D;  4AWL B;  3AZL D;  5B0Z A;  5GT0 A;  5AVB D;  1P3K A;  4EO5 C;  5CPK B;  5B31 C;  5GSU B;  2Y2K A;  2HIO A;  3B6F C;  1B67 A;  4JJN C;  1ZLA C;  5JRG A;  2IO5 B;  3VH5 A;  3LZ1 D;  4J8W C;  3C1B D;  5F99 D;  2ZY3 A;  3UT9 B;  3O62 A;  1AOI A;  5GT0 D;  2PYO D;  2UWX A;  4KGC A;  2YFV B;  3AV2 D;  1P3K D;  4Z66 D;  5CPI B;  3X1V B;  1P3O B;  5B40 A;  3AV1 C;  1M1A B;  3LZ0 A;  1PZR A;  4XZQ B;  3TU4 C;  5DNM C;  5AY8 C;  1P3I C;  4Z5T A;  1T3U A;  3VH5 W;  3KFU G;  1AOI D;  4ZBJ C;  4H9Q A;  5CPJ C;  3X1T A;  2FJ7 B;  1P3A B;  5AV5 C;  4M6B A;  3WKJ A;  3X1U D;  5FUG A;  2FFF B;  3MGQ D;  4J8U B;  3AV1 D;  5B24 A;  1B6W A;  1HQ3 B;  3VH5 T;  3P5J B;  5BNX B;  1P34 C;  3KXB B;  5DNM D;  2JCH A;  2Y2J A;  2F2A C;  4XUJ A;  3W96 A;  5JRG B;  4J8X C;  3KUY D;  4X23 C;  1P3P B;  3X1T D;  3WKJ D;  1R4V A;  4J8V C;  5GXQ C;  5B32 B;  5B1L B;  4WNN A;  3B6G C;  3B0D C;  2DF4 C;  2CV5 C;  1H3O B;  5B0Y B;  5GT3 C;  3EPL A;  3W96 D;  3EPH A;  3C1C C;  3MGP C;  4X23 D;  5B33 C;  4LD9 A;  5BS7 A;  3AYW A;  1KX4 B;  3WAA A;  4JJN B;  5AV6 C;  3AZG A;  3LJA A;  1S32 C;  3FDD A;  3W99 A;  3AZN A;  2F8N D;  5B24 B;  3REI A;  1P3F B;  4R8P A;  3REJ B;  5B2I C;  3MVD B;  3KWQ A;  3LEL A;  1F66 B;  3AZK C;  3B0C W;  1P3G A;  5AV6 D;  4XUJ B;  5AVC C;  2Y2L A;  5DNN A;  1P3M C;  1EQZ C;  3TU4 B;  5BT1 C;  3X1S A;  1KX3 D;  3AZN D;  3MNN B;  3AZF B;  3R45 A;  2YFW B;  3B0C T;  3WTP D;  3REI D;  5B2J A;  4R8P D;  1U35 C;  3UTA A;  5AV8 C;  2F8N K;  3MGS C;  2NQB C;  4QLC B;  1N1J B;  1P3G D;  2L5A A;  4ZUX B;  1P3B C;  1P3M D;  3WA9 B;  3EPK A;  3X1S D;  1M18 D;  2RIQ A;  5CPK A;  3REH C;  3AYW B;  3VH6 T;  5GSU A;  4WU8 D;  4YM6 B;  4KUD C;  2NZD C;  3AZE B;  5B31 G;  5B2J D;  1M19 B;  1TZY B;  1U35 D;  3UTA D;  4G92 C;  3AZJ D;  4DRB A;  3AZM C;  3MGS D;  1HTA A;  5GXQ B;  2ZY5 A;  4J8V B;  3UT9 A;  4G91 B;  3V9R B;  3MGR C;  5BO0 B;  3B6G B;  2YFV A;  5AV9 D;  4WU9 C;  2JSS A;  5CPI A;  3X1V A;  5CP6 D;  1P3O A;  2NZD D;  1M1A A;  4DQY B;  5AVB C;  3A6N B;  4XZQ A;  1KX5 B;  3W98 B;  3UT9 D;  5E5A B;  1P3L D;  3AN2 B;  2BG1 A;  3LZ1 C;  3NQU B;  3C1B C;  5F99 C;  3W97 B;  3AZI B;  1P3O D;  4J8U A;  3AFA B;  4H9S A;  5B1M B;  5BNX A;  1HQ3 A;  5GT0 C;  5B0Z C;  1M1A D;  2PYO C;  3KXB A;  3AV2 C;  3EG5 B;  3AZK B;  1P3K C;  4Z66 C;  2XD1 A;  5AVC B;  2HIO C;  1TAF B;  2FJ7 D;  1P3P A;  1P3A D;  3O62 C;  4J8U D;  5B32 A;  5B0Z D;  1AOI C;  1HQ3 D;  5B1L A;  1BH8 A;  3IP4 C;  3X1U C;  3REK B;  1H3O A;  5B0Y A;  3MGQ C;  2HIO D;  5B40 C;  3AZH B;  5JRG D;  2F8N G;  3LZ0 C;  4H9N B;  3REH B;  1BH9 B;  1KX4 A;  4Z5T C;  3O62 D;  4JJN A;  3REL B;  4KHA B;  5B32 D;  5CHL B;  3KUY C;  5B1L D;  4KGC D;  3X1T C;  4Z2M G;  3WKJ C;  5B0Y D;  1ID3 B;  5B40 D;  1P3F A;  4YS3 B;  3REJ A;  3MVD A;  3LZ0 D;  2Y2M A;  1F66 A;  1A7W A;  3UTB B;  4Z5T D;  1KX4 D;  3AZL B;  4UPK A;  5AVB B;  3W96 C;  3TU4 A;  2ARO B;  2JE5 A;  3MNN A;  3AZF A;  2YFW A;  5B24 D;  1P3F D;  3REJ D;  4H9O B;  1BH8 B;  3MVD D;  3LZ1 B;  5AV5 A;  1WWS A;  1F66 D;  4QLC A;  1N1J A;  4ZUX A;  2Y2Q A;  4XUJ D;  4NE6 A;  4UUZ A;  2PYO B;  1P34 A;  3H0R C;  3AV2 B;  3WA9 A;  4EO5 B;  5B31 B;  3MNN D;  5BS7 C;  4YM6 A;  3B6F B;  3AZF D;  4WV4 B;  1ZLA B;  3AZE A;  1M19 A;  1TZY A;  3KSY A;  4E44 A;  3W99 C;  2BYM B;  1KX3 C;  1F1E A;  4J8W B;  3AZN C;  4J8V A;  5GXQ A;  2Y2H A;  4QLC D;  4ZUX D;  3V9R A;  3WTP C;  3REI C;  4R8P C;  5BO0 A;  3KWQ C;  3B6G A;  3LEL C;  3WA9 D;  4LD9 D;  3X1U B;  3AYW D;  3WAA D;  1JFI B;  3MGQ B;  4HGA C;  3AV1 B;  1P3G C;  3AZG D;  3AZE D;  3EPJ A;  5DNN C;  3LJA D;  1TZY D;  1M19 D;  2F8N H;  3W99 D;  5DNM B;  5AY8 B;  3A6N A;  1KX5 A;  3X1S C;  1P3I B;  1M18 C;  4WU8 C;  3W98 A;  5E5A A;  4ZBJ B;  5B2J C;  3KUY B;  3UTA C;  3KWQ D;  3AZJ C;  3LEL D;  5CPJ B;  5AV5 B;  4Z2M H;  3AN2 A;  3NQU A;  3W97 A;  3AZI A;  4UUZ B;  3AFA A;  4AWL C;  1P34 B;  5DNN D;  3H0M C;  5B1M A;  1KX5 D;  3AZK A;  5AV9 C;  4H9R B;  5CPK C;  4WJ3 C;  5CP6 C;  5AVC A;  4J8X B;  5E5A D;  4X23 B;  2IO5 C;  3AN2 D;  4H9P B;  3UT9 C;  2W8S A;  4NFT A;  5B1M D;  1P3L C;  3B0D B;  2CV5 B;  5CPK D;  5GSU D;  2F8N B;  5GT3 B;  3REK A;  5CPI C;  1P3O C;  5G49 B;  3C1C B;  3AZH A;  1M1A C;  3MGP B;  2G5H C;  5B33 B;  3F6T A;  4H9N A;  5BNV B;  3REH A;  1BH9 A;  5AV6 B;  3REL A;  1S32 B;  4KHA A;  1Q9C A;  1KX3 B;  2FJ7 C;  1P3A C;  5CPI D;  3REK D;  3WTP B;  3X1V D;  1ID3 A;  4J8U C;  2Y2I A;  5B2I B;  4YS3 A;  1HQ3 C;  2XD5 A;  4XZQ D;  2RVQ D;  4WU9 A;  4HGA B;  3UTB A;  2ZY4 A;  3AZL A;  1P3M B;  1EQZ B;  5AVB A;  5JRG C;  4CSR B;  2ARO A;  4WU8 B;  1ID3 D;  1U35 B;  5B32 C;  2ZM5 A;  4YS3 D;  5AV8 B;  5JA4 B;  3KXB D;  4H9O A;  5B1L C;  4KGC C;  3LZ1 A;  3MGS B;  2NQB B;  1ULY A;  1P3B B;  3UTB D;  5B0Y C;  2PYO A;  3AV2 A;  5AV9 B;  4Z66 A;  1P3P D;  2ARO D;  5B31 A;  4NE5 A;  4KUD B;  2J8P A;  5CP6 B;  1KX4 C;  2NZD B;  3B6F A;  1WWI A;  1ZLA A;  4G92 B;  3AZM B;  2BYM A;  5C3I C;  4J8W A;  2BYK B;  3MGR B;  5B24 C;  1P3F C;  3REJ C;  1P3L B;  3MVD C;  3A1K A;  3B0B A;  5B31 D;  4WU9 B;  3NQJ B;  3X1U A;  1F66 C;  3H0L C;  1JFI A;  3MGQ A;  3AV1 A;  4CAY B;  4JJN D;  3B6F D;  4XUJ C;  1ZLA D;  4NE3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...