5BT1D

Histone chaperone hif1 playing with histone h2a-h2b dimer
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
90
structure length
90
Chain Sequence
b'KETYSSYIYKVLKQTHPDTGISQKSMSILNSFVNDIFERIATEASKLAAYNKKSTISAREIQTAVRLILPGELAKHAVSEGTRAVTKYSS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HAT1-interacting factor 1
molecule tags Chaperone
source organism Saccharomyces cerevisiae (strain atcc 204508 / s288c)
publication title Structural Insights into the Association of Hif1 with Histones H2A-H2B Dimer and H3-H4 Tetramer
pubmed doi rcsb
total genus 35
structure length 90
sequence length 90
ec nomenclature
pdb deposition date 2015-06-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5bt1D00
3O62B 5B31G 3B6GD 3AZMD 1HQ3A 3W97A 4J8VA 2F8NK 1S32A 4KUDA 3W98D 3MGRC 1TAFB 5GXQB 4WU8B 3AZHD 3V9RA 4XUJD 2NZDD 1EQZA 4AWLC 3C1BA 2YFWB 4J8WC 3AN2B 5CHLB 5AVBD 3MNND 5CPKD 3KXBA 3A6NB 5BNVB 5AV9D 5B31C 2CV5B 2F8NG 5GT0B 5KDMA 5GT3C 3REJC 3MVDB 1KX4C 4J8WD 3AZKA 1BH9B 3UT9A 1HQ3C 3X1SD 3AZJC 1F66B 3W97C 5F99D 4LD9C 5AV9C 4X23B 3AZLC 3AZLB 4XUJB 5B1MD 4HGAC 4Z5TD 4Z66D 3LJAA 3AZHC 4H9SA 4YS3D 1TZYB 5CPKC 3AZLD 3B6GC 5KDMB 1M19D 3B0CW 2HIOC 4R8PD 3AZGC 5BNVA 5B0ZB 3AN2A 1ID3D 1EQZB 1S32C 1P3IC 4XZQD 5FUGA 2FJ7C 3REKC 2PYOA 4J8UA 3REHA 3AYWC 4E45A 3O62C 3AZJD 3X1SC 3B0DC 4DRAA 1Q9CA 5B1LD 1KX3C 5AV6D 5F99B 5DNMA 5B2JA 3MGRB 5G49A 1P3BD 3WKJA 3UTBB 1S32D 1P34C 4J8XB 1P3LA 3B6FB 4WNNB 1BH8A 3AZGA 3LELA 2NZDA 4NE5A 2BYKA 4E44A 3O62D 1AOIA 1A7WA 4NE6A 4G92C 3AV1A 5JRGB 5GSUA 1P3FB 3W96C 3MGSB 1M1AA 5B31D 1P3OC 5CP6D 2IO5B 5E5AB 3C1CB 1ZLAD 4KHAB 5B40D 5E5AA 3LZ0A 3C1CA 1P3MC 3W99B 1P3FC 5B1LB 5B0YB 3AYWB 4H9QA 1P3LB 3B6FA 4H9PA 1KX5B 2NQBA 3AZHA 3AZMB 2IO5C 4XUJA 3X1VC 5DNMB 3WKJB 4YS3B 3AZKC 4ZBJC 3MNNA 5AVBA 3KXBD 4J8UB 4R8PB 1P3KA 2JSSA 3X1SB 5CPJB 3AZIB 4EO5B 5B2IC 1ZLAB 5AVCC 2BYMA 2BYMB 3W96D 1B67A 3REIC 4QLCA 5B0ZA 3REJD 3AV2A 4DRBA 4YM6C 3MGSC 5BNXB 5AV8A 1R4VA 4X23D 4G92B 5DNNA 3MGQD 1HQ3B 3W97B 4NE3A 3LJAB 1P3KB 2PYOD 5JA4A 3X1TD 3UTBC 3C1BD 3R45A 1P3IA 5B2IA 5B1LA 3AZFC 3AZLA 2CV5C 1M19A 4YM6D 1P3OA 3AYWA 5B2JD 3AZHB 2RVQD 5B33B 1KX5A 3UTAA 2NQBB 1KU5A 5GSUB 1P3FA 5AV5A 4R8PC 3AZGD 3LELD 1JFIB 3MVDA 3KUYC 5GXQD 4WU8D 1P3GD 1M18D 1P3PB 3VH5A 5G49B 5CPKA 1N1JA 4Z66C 3C1BB 1H3OA 3KXBB 3A6NA 4J8WB 5B32G 4WV4B 3AN2C 4YS3C 1P3BA 5JRGD 4J8XA 4YM6B 4KGCA 2FJ7A 3X1VD 4WZSB 5FUGB 1KX5C 3O62A 3LZ1D 2NQBC 4J8VB 3AV1D 2PYOB 3MGPA 1U35D 5B0YD 4Z2MH 5AY8C 1M1AD 4H9NA 5B32B 5AVCB 3B0BA 3NQUA 3AZFB 3X1UA 4LD9B 3REKD 3KWQC 3WA9B 2HUEB 1P3KC 4Z66A 3LJAD 3VH6W 3REIB 3RELA 4J8UD 4J8XC 3UTAB 4UUZB 5DNMD 4XZQB 4X23A 3W96B 3MGQA 5JA4B 1P3LD 5B24A 3KXBC 3AZKB 4EO5C 5B2IB 1AOID 5AV6B 1P3ID 5GT3A 4H9OB 5C3IB 1TZYC 4Z2MG 5B31A 5AV8B 5F99C 3KUYB 1KX4A 3LZ1B 3AV2D 3AZND 2CV5A 1M19C 3X1UB 3WAAC 4LD9A 3B6GB 5DNND 4H9NB 5CPIA 4JJND 3UTAC 5AY8B 5CPJA 5AVCA 2YFWA 1TAFA 4WU8A 5GXQA 3X1TA 5GSUD 2LY8A 3WTPB 4YM6A 3A6ND 4QLCC 4M6BA 3AZFD 3REJA 4KGCD 1KX3B 2HIOB 5AV5D 3B6FD 1WWSA 1P3PA 2NQBD 3B0DB 5GSUC 3W96A 1P34B 4H9PB 3MVDD 5CPKB 4KUDC 3MGPD 5B0YA 1P3AA 4QLCD 1P3GA 1M18A 3TU4B 1EQZC 5BO0B 2L5AA 5GXQC 3VH5T 4WU8C 4ZUXC 5AV8D 3AZIC 2BYKB 3WAAD 1P3KD 2HIOD 5AV5C 5AV5B 4Z66B 5JRGA 1HTAA 4WU9D 1KX3A 4XUJC 3RELD 1M1AB 3KWQA 3TU4C 3NQUB 3AFAB 5B32A 1BH8B 3AZMC 5B40B 3AZEA 5BS7C 1KX5D 1P3LC 3X1TB 2AROA 1P3FD 3TU4D 1AOIC 3WTPA 4X23C 5BNXA 4HGAB 5E5AC 5GT0D 3C1CC 5CPJC 1P3MA 4CSRB 3WAAB 3MGPC 1KX4B 3NQJB 4ZUXD 3LJAC 5AV8C 1TZYA 1P3OD 1ZLAC 3B6GA 1F66D 2CV5D 5AY8A 5CP6B 4J8XD 3UTAD 2YFVB 3WA9D 4KUDD 1ULYA 5CPID 3W98A 4H9OA 3X1VA 5B24D 1U35C 3W99D 5B1LC 5B33A 3LZ1A 5GT3B 1ID3B 5B31B 3UT9C 3AFAA 5AV6C 3VH6A 3REKB 1P3IB 5AV9A 1BFMA 3REKA 3MGQB 3W99C 1ID3C 3KSYA 2CWEA 5B24C 1WWIA 5B24B 4J8VD 5B0ZC 3AV2C 3MGQC 4ZBJB 4XZQC 2FJ7D 2YFVA 3WKJC 3REIA 5CPJD 3RELB 5AVCD 5DNMC 3X1VB 5DNNC 1EQZD 5CP6C 3MGSA 3LELC 2NZDB 5B32C 1U35A 3KUYD 4J8VC 3LELB 2NZDC 2RVQC 4G91C 4CSRA 5B1MA 4Z5TB 3X1UD 2HIOA 2HUEC 1P3GC 1P3MB 3AZFA 3MGPB 3UTBA 1S32B 3AZIA 3V9RB 5B2JB 3MGRA 3VH5W 4J8WA 3UT9D 4KGCB 1H3OB 2PYOC 3C1BC 3X1TC 2AROB 2F8ND 2FJ7B 1KX4D 3B6FC 1P34D 5BO0A 3REJB 5B40C 1P3BB 4LD9D 3AZMA 1HQ3D 3W97D 5BS7A 5B1MB 4Z5TA 1U35B 5AVBC 3MNNC 1B6WA 3KWQD 1F1EA 3LZ0B 5B33C 1P3PC 4KHAA 5GT3D 1M18C 4KGCC 5B32D 1TZYD 5AV6A 5AY8D 1M1AC 3AZJB 3WKJD 3AZNA 5BT1C 2AROD 4CAYB 2F8NB 3AN2D 3AZGB 1ID3A 3LZ0C 4WU9B 4ZUXB 4JJNA 3AZKD 4XZQA 5AV9B 3W98C 3R45B 5F99A 3X1UC 5CP6A 4Z5TC 3RELC 4WU9C 3LZ0D 5BT1D 3AV2B 2AROC 3AFAC 3W98B 3WA9A 5DNNB 4QLCB 1P3PD 3WTPC 1F66C 5CPIB 5B33D 4AWLB 4J8UC 3NQJA 3X1SA 5AVBB 3MNNB 3REHC 3MVDC 3KUYA 1P3AD 5B2JC 4R8PA 1ZLAA 5B40A 3AZEB 5E5AD 5GT0C 3C1CD 4NFTA 4KUDB 5C3IC 3UTBD 3B0CT 4H9RB 3A6NC 4WU9A 1KX3D 5B1MC 3AV1C 5B0YC 3LZ1C 3AZNB 1N1JB 3REID 1P3AC 3REHD 3AZJA 3KWQB 3WA9C 4YS3A 4CAYA 5CPIC 1P3BC 2F8NA 3WAAA 3MGSD 4ZUXA 4JJNB 3AZED 1F66A 1JFIA 4UUZA 5JRGC 1BH9A 3UT9B 2F8NH 3AZNC 4H9QB 1P3AB 3TU4A 3W99A 3WTPD 4H9SC 3AZID 4JJNC 3MGRD 5GT0A 1P3MD 4WNNA 1P3OB 5B2ID 1AOIB 3AZEC 1M19B 4G91B 1P3GB 1M18B 3WTPE 3AFAD 3AV1B 4H9RA 3AYWD 5B0ZD 1P34A 3VH6T 3REHB
chains in the Genus database with same CATH superfamily
3O62B 3H0LC 5B31G 3B6GD 3AZMD 1HQ3A 3W97A 4J8VA 2F8NK 1S32A 4KUDA 3W98D 3MGRC 1TAFB 5GXQB 4WU8B 3AZHD 3F6TA 3V9RA 2ZY4A 4XUJD 2NZDD 1EQZA 3H0RC 4AWLC 3C1BA 2YFWB 4J8WC 3AN2B 5CHLB 5AVBD 3MNND 5CPKD 3KXBA 3A6NB 5BNVB 5AV9D 5B31C 2CV5B 2F8NG 5GT0B 5KDMA 5GT3C 3REJC 3MVDB 1KX4C 4J8WD 3AZKA 1BH9B 3UT9A 1HQ3C 3X1SD 3AZJC 1F66B 3W97C 5F99D 4LD9C 5AV9C 4X23B 3AZLC 3AZLB 4XUJB 2Y2JA 5B1MD 4HGAC 4Z5TD 4Z66D 3LJAA 2W8SA 3AZHC 4H9SA 2Y2HA 4YS3D 1TZYB 5CPKC 3AZLD 3B6GC 5KDMB 1M19D 3B0CW 2Y2KA 2HIOC 4R8PD 3AZGC 5BNVA 5B0ZB 3AN2A 1ID3D 1EQZB 1S32C 1P3IC 4XZQD 5FUGA 2FJ7C 3REKC 2PYOA 1W2EA 4J8UA 3REHA 3AYWC 4E45A 3O62C 3AZJD 3X1SC 3B0DC 4DRAA 1Q9CA 5B1LD 1KX3C 5AV6D 5F99B 5DNMA 3P5JB 5B2JA 5G49A 3MGRB 1P3BD 3WKJA 3UTBB 1S32D 1P34C 4J8XB 2Y2LA 1P3LA 3B6FB 4WNNB 1BH8A 3AZGA 3LELA 2NZDA 4NE5A 2BYKA 4E44A 3O62D 1AOIA 1A7WA 4NE6A 4G92C 3AV1A 5JRGB 5GSUA 1P3FB 3W96C 3MGSB 1M1AA 5B31D 1P3OC 5CP6D 2IO5B 3A1KA 5E5AB 3C1CB 1ZLAD 4KHAB 5B40D 5E5AA 3LZ0A 3C1CA 1P3MC 3W99B 1P3FC 5B1LB 5B0YB 3AYWB 4H9QA 1P3LB 3B6FA 4H9PA 1KX5B 2NQBA 3AZHA 3AZMB 2IO5C 4XUJA 3X1VC 5DNMB 3WKJB 4YS3B 3AZKC 4ZBJC 5AVBA 3MNNA 3KXBD 4J8UB 4R8PB 1P3KA 2JSSA 3X1SB 5CPJB 3AZIB 4EO5B 5B2IC 1ZLAB 5AVCC 2ZY5A 2BYMA 2BYMB 3W96D 1B67A 2Y2MA 3EPJA 3REIC 4QLCA 5B0ZA 3REJD 3AV2A 4DRBA 4YM6C 3MGSC 5BNXB 5AV8A 1R4VA 4X23D 4G92B 5DNNA 3MGQD 1HQ3B 3W97B 4NE3A 3LJAB 1P3KB 3FDDA 2PYOD 5JA4A 3X1TD 3UTBC 3C1BD 3R45A 1P3IA 5B2IA 5B1LA 3AZFC 3AZLA 2CV5C 1M19A 4YM6D 2Y2NA 1P3OA 2Y2QA 3AYWA 5B2JD 3AZHB 2RVQD 5B33B 1KX5A 3UTAA 2NQBB 1KU5A 5GSUB 1P3FA 5AV5A 3EPHA 4R8PC 3AZGD 3LELD 1JFIB 3MVDA 3KUYC 5GXQD 4WU8D 1P3GD 1M18D 1P3PB 3VH5A 5G49B 5CPKA 2RIQA 1N1JA 4Z66C 3C1BB 3H0MC 1H3OA 3KXBB 3A6NA 4J8WB 5B32G 4WV4B 3AN2C 4YS3C 1P3BA 5JRGD 4J8XA 4YM6B 4KGCA 2DF4C 3X1VD 4WZSB 2FJ7A 5FUGB 1KX5C 3O62A 3LZ1D 2NQBC 4J8VB 3AV1D 2PYOB 3MGPA 1U35D 5B0YD 4Z2MH 5AY8C 1M1AD 4H9NA 5B32B 5AVCB 3B0BA 3NQUA 3AZFB 3X1UA 4LD9B 3REKD 3KWQC 4UPKA 3WA9B 2HUEB 1Z2CB 1P3KC 4Z66A 3LJAD 3VH6W 3REIB 3RELA 4J8UD 4J8XC 3EG5B 3UTAB 4UUZB 5DNMD 4XZQB 4X23A 3W96B 3MGQA 5JA4B 1P3LD 5B24A 3KXBC 2ZM5A 3AZKB 4EO5C 5B2IB 1AOID 5AV6B 1P3ID 5GT3A 4H9OB 5C3IB 1TZYC 4Z2MG 5B31A 5AV8B 5F99C 3KUYB 1KX4A 3LZ1B 3AV2D 3AZND 2CV5A 1M19C 3X1UB 3WAAC 4LD9A 3B6GB 5DNND 4H9NB 5CPIA 4JJND 3UTAC 5AY8B 5CPJA 5AVCA 2YFWA 1TAFA 4WU8A 5GXQA 3X1TA 5GSUD 2LY8A 3WTPB 4YM6A 3A6ND 4QLCC 4M6BA 3AZFD 3REJA 3IP4C 4KGCD 1KX3B 2HIOB 5AV5D 3B6FD 1WWSA 1P3PA 2NQBD 3B0DB 5GSUC 3W96A 1P34B 4H9PB 3MVDD 5CPKB 4KUDC 3MGPD 5B0YA 1P3AA 4QLCD 1P3GA 1M18A 3TU4B 1EQZC 5BO0B 2L5AA 5GXQC 3VH5T 4WU8C 4ZUXC 5AV8D 4DQYB 3AZIC 2BYKB 3WAAD 1P3KD 2HIOD 5AV5C 5AV5B 4Z66B 5JRGA 1HTAA 4WU9D 1KX3A 3AL0C 4XUJC 3RELD 1M1AB 3KWQA 3TU4C 3NQUB 3AFAB 5B32A 1BH8B 3AZMC 5B40B 3AZEA 5BS7C 1KX5D 1P3LC 3X1TB 2AROA 2ZY3A 1P3FD 3TU4D 1AOIC 3WTPA 2BG1A 4X23C 5BNXA 4HGAB 5E5AC 5GT0D 3C1CC 5CPJC 1P3MA 4CSRB 3WAAB 3MGPC 1KX4B 3NQJB 4ZUXD 3LJAC 5AV8C 1TZYA 1P3OD 2XD1A 1ZLAC 3B6GA 1F66D 2CV5D 5AY8A 5CP6B 4J8XD 3UTAD 2YFVB 3EPLA 3WA9D 4KUDD 1ULYA 5CPID 3W98A 4H9OA 3X1VA 5B24D 1U35C 3W99D 5B1LC 5B33A 3LZ1A 5GT3B 1ID3B 5B31B 3UT9C 3AFAA 5AV6C 3VH6A 3REKB 1P3IB 5AV9A 1BFMA 3REKA 3MGQB 3W99C 1ID3C 3KSYA 2CWEA 5B24C 1WWIA 5B24B 2DQNC 5B0ZC 4J8VD 3AV2C 3MGQC 4ZBJB 4XZQC 2FJ7D 2YFVA 3WKJC 3REIA 5CPJD 3RELB 5AVCD 5DNMC 3X1VB 5DNNC 1EQZD 5CP6C 3MGSA 3LELC 2NZDB 5B32C 1U35A 3KUYD 4J8VC 3LELB 2NZDC 2RVQC 4G91C 4CSRA 5B1MA 4Z5TB 3X1UD 2HIOA 2HUEC 1P3GC 1P3MB 3AZFA 3MGPB 3UTBA 1S32B 3AZIA 3V9RB 5B2JB 3MGRA 3VH5W 4J8WA 3UT9D 4KGCB 1H3OB 2FFFB 2PYOC 3C1BC 3X1TC 2AROB 2J8PA 2F8ND 2FJ7B 1KX4D 3B6FC 1P34D 5BO0A 3REJB 5B40C 2Y2PA 1P3BB 4LD9D 3AZMA 1HQ3D 3W97D 2JE5A 5BS7A 5B1MB 4Z5TA 1U35B 5AVBC 3MNNC 1B6WA 3KWQD 1F1EA 3LZ0B 5B33C 1P3PC 4KHAA 5GT3D 1M18C 4KGCC 5B32D 1TZYD 5AV6A 5AY8D 1M1AC 3AZJB 2G5HC 3WKJD 3AZNA 5BT1C 2AROD 4CAYB 2F8NB 3AN2D 3AZGB 1ID3A 3LZ0C 4WU9B 4ZUXB 4JJNA 3KFUG 3AZKD 2Y2IA 4XZQA 5AV9B 3W98C 2JCHA 3R45B 5F99A 1T3UA 3X1UC 5CP6A 4Z5TC 3RELC 4WJ3C 4WU9C 3LZ0D 5BT1D 3AV2B 2AROC 3AFAC 2Y2GA 3W98B 3WA9A 1PZRA 5DNNB 2ZY2A 4QLCB 2F2AC 1P3PD 3WTPC 1F66C 2G5IC 5CPIB 5B33D 4AWLB 4J8UC 3NQJA 3X1SA 5AVBB 3MNNB 3REHC 3MVDC 3KUYA 1P3AD 5B2JC 4R8PA 2XD5A 1ZLAA 5B40A 3AZEB 5E5AD 5GT0C 3C1CD 2Y2OA 4NFTA 4KUDB 5C3IC 3EPKA 3UTBD 3B0CT 4H9RB 3A1IA 3A6NC 4WU9A 1KX3D 5B1MC 3AV1C 5B0YC 3LZ1C 3AZNB 1N1JB 3REID 1P3AC 3REHD 3AZJA 3KWQB 3WA9C 2UWXA 4YS3A 4CAYA 5CPIC 1P3BC 2F8NA 3WAAA 3MGSD 4ZUXA 4JJNB 3AZED 1F66A 1JFIA 4UUZA 5JRGC 1BH9A 3UT9B 2F8NH 3AZNC 4H9QB 1P3AB 3TU4A 3W99A 3WTPD 4H9SC 3AZID 4JJNC 3MGRD 5GT0A 1P3MD 4WNNA 1P3OB 5B2ID 1AOIB 3AZEC 1M19B 4G91B 1P3GB 1M18B 3WTPE 3AFAD 3AV1B 4H9RA 3AYWD 2VQRA 5B0ZD 1P34A 3VH6T 3REHB
chains in the Genus database with same CATH topology
3O62B 3H0LC 5B31G 3B6GD 3AZMD 1HQ3A 3W97A 4J8VA 2F8NK 1S32A 4KUDA 3W98D 3MGRC 1TAFB 5GXQB 4WU8B 3AZHD 3F6TA 3V9RA 2ZY4A 4XUJD 2NZDD 1EQZA 3H0RC 4AWLC 3C1BA 2YFWB 4J8WC 3AN2B 5CHLB 5AVBD 3MNND 5CPKD 3KXBA 3A6NB 5BNVB 5AV9D 5B31C 2CV5B 2F8NG 5GT0B 5KDMA 5GT3C 3REJC 3MVDB 1KX4C 4J8WD 3AZKA 1BH9B 3UT9A 1HQ3C 3X1SD 3AZJC 1F66B 3W97C 5F99D 4LD9C 5AV9C 4X23B 3AZLC 3AZLB 4XUJB 2Y2JA 5B1MD 4HGAC 4Z5TD 4Z66D 3LJAA 2W8SA 3AZHC 4H9SA 2Y2HA 4YS3D 1TZYB 5CPKC 3AZLD 3B6GC 5KDMB 1M19D 3B0CW 2Y2KA 2HIOC 4R8PD 3AZGC 5BNVA 5B0ZB 3AN2A 1ID3D 1EQZB 1S32C 1P3IC 4XZQD 5FUGA 2FJ7C 3REKC 2PYOA 1W2EA 4J8UA 3REHA 3AYWC 4E45A 3O62C 3AZJD 3X1SC 3B0DC 4DRAA 1Q9CA 5B1LD 1KX3C 5AV6D 5F99B 5DNMA 3P5JB 5B2JA 5G49A 3MGRB 1P3BD 3WKJA 3UTBB 1S32D 1P34C 4J8XB 2Y2LA 1P3LA 3B6FB 4WNNB 1BH8A 3AZGA 3LELA 2NZDA 4NE5A 2BYKA 4E44A 3O62D 1AOIA 1A7WA 4NE6A 4G92C 3AV1A 5JRGB 5GSUA 1P3FB 3W96C 3MGSB 1M1AA 5B31D 1P3OC 5CP6D 2IO5B 3A1KA 5E5AB 3C1CB 1ZLAD 4KHAB 5B40D 5E5AA 3LZ0A 3C1CA 1P3MC 3W99B 1P3FC 5B1LB 5B0YB 3AYWB 4H9QA 1P3LB 3B6FA 4H9PA 1KX5B 2NQBA 3AZHA 3AZMB 2IO5C 4XUJA 3X1VC 5DNMB 3WKJB 4YS3B 3AZKC 4ZBJC 5AVBA 3MNNA 3KXBD 4J8UB 4R8PB 1P3KA 2JSSA 3X1SB 5CPJB 3AZIB 4EO5B 5B2IC 1ZLAB 5AVCC 2ZY5A 2BYMA 2BYMB 3W96D 1B67A 2Y2MA 3EPJA 3REIC 4QLCA 5B0ZA 3REJD 3AV2A 4DRBA 4YM6C 3MGSC 5BNXB 5AV8A 1R4VA 4X23D 4G92B 5DNNA 3MGQD 1HQ3B 3W97B 4NE3A 3LJAB 1P3KB 3FDDA 2PYOD 5JA4A 3X1TD 3UTBC 3C1BD 3R45A 1P3IA 5B2IA 5B1LA 3AZFC 3AZLA 2CV5C 1M19A 4YM6D 2Y2NA 1P3OA 2Y2QA 3AYWA 5B2JD 3AZHB 2RVQD 5B33B 1KX5A 3UTAA 2NQBB 1KU5A 5GSUB 1P3FA 5AV5A 3EPHA 4R8PC 3AZGD 3LELD 1JFIB 3MVDA 3KUYC 5GXQD 4WU8D 1P3GD 1M18D 1P3PB 3VH5A 5G49B 5CPKA 2RIQA 1N1JA 4Z66C 3C1BB 3H0MC 1H3OA 3KXBB 3A6NA 4J8WB 5B32G 4WV4B 3AN2C 4YS3C 1P3BA 5JRGD 4J8XA 4YM6B 4KGCA 2DF4C 3X1VD 4WZSB 2FJ7A 5FUGB 1KX5C 3O62A 3LZ1D 2NQBC 4J8VB 3AV1D 2PYOB 3MGPA 1U35D 5B0YD 4Z2MH 5AY8C 1M1AD 4H9NA 5B32B 5AVCB 3B0BA 3NQUA 3AZFB 3X1UA 4LD9B 3REKD 3KWQC 4UPKA 3WA9B 2HUEB 1Z2CB 1P3KC 4Z66A 3LJAD 3VH6W 3REIB 3RELA 4J8UD 4J8XC 3EG5B 3UTAB 4UUZB 5DNMD 4XZQB 4X23A 3W96B 3MGQA 5JA4B 1P3LD 5B24A 3KXBC 2ZM5A 3AZKB 4EO5C 5B2IB 1AOID 5AV6B 1P3ID 5GT3A 4H9OB 5C3IB 1TZYC 4Z2MG 5B31A 5AV8B 5F99C 3KUYB 1KX4A 3LZ1B 3AV2D 3AZND 2CV5A 1M19C 3X1UB 3WAAC 4LD9A 3B6GB 5DNND 4H9NB 5CPIA 4JJND 3UTAC 5AY8B 5CPJA 5AVCA 2YFWA 1TAFA 4WU8A 5GXQA 3X1TA 5GSUD 2LY8A 3WTPB 4YM6A 3A6ND 4QLCC 4M6BA 3AZFD 3REJA 3IP4C 4KGCD 1KX3B 2HIOB 5AV5D 3B6FD 1WWSA 1P3PA 2NQBD 3B0DB 5GSUC 3W96A 1P34B 4H9PB 3MVDD 5CPKB 4KUDC 3MGPD 5B0YA 1P3AA 4QLCD 1P3GA 1M18A 3TU4B 1EQZC 5BO0B 2L5AA 5GXQC 3VH5T 4WU8C 4ZUXC 5AV8D 4DQYB 3AZIC 2BYKB 3WAAD 1P3KD 2HIOD 5AV5C 5AV5B 4Z66B 5JRGA 1HTAA 4WU9D 1KX3A 3AL0C 4XUJC 3RELD 1M1AB 3KWQA 3TU4C 3NQUB 3AFAB 5B32A 1BH8B 3AZMC 5B40B 3AZEA 5BS7C 1KX5D 1P3LC 3X1TB 2AROA 2ZY3A 1P3FD 3TU4D 1AOIC 3WTPA 2BG1A 4X23C 5BNXA 4HGAB 5E5AC 5GT0D 3C1CC 5CPJC 1P3MA 4CSRB 3WAAB 3MGPC 1KX4B 3NQJB 4ZUXD 3LJAC 5AV8C 1TZYA 1P3OD 2XD1A 1ZLAC 3B6GA 1F66D 2CV5D 5AY8A 5CP6B 4J8XD 3UTAD 2YFVB 3EPLA 3WA9D 4KUDD 1ULYA 5CPID 3W98A 4H9OA 3X1VA 5B24D 1U35C 3W99D 5B1LC 5B33A 3LZ1A 5GT3B 1ID3B 5B31B 3UT9C 3AFAA 5AV6C 3VH6A 3REKB 1P3IB 5AV9A 1BFMA 3REKA 3MGQB 3W99C 1ID3C 3KSYA 2CWEA 5B24C 1WWIA 5B24B 2DQNC 5B0ZC 4J8VD 3AV2C 3MGQC 4ZBJB 4XZQC 2FJ7D 2YFVA 3WKJC 3REIA 5CPJD 3RELB 5AVCD 5DNMC 3X1VB 5DNNC 1EQZD 5CP6C 3MGSA 3LELC 2NZDB 5B32C 1U35A 3KUYD 4J8VC 3LELB 2NZDC 2RVQC 4G91C 4CSRA 5B1MA 4Z5TB 3X1UD 2HIOA 2HUEC 1P3GC 1P3MB 3AZFA 3MGPB 3UTBA 1S32B 3AZIA 3V9RB 5B2JB 3MGRA 3VH5W 4J8WA 3UT9D 4KGCB 1H3OB 2FFFB 2PYOC 3C1BC 3X1TC 2AROB 2J8PA 2F8ND 2FJ7B 1KX4D 3B6FC 1P34D 5BO0A 3REJB 5B40C 2Y2PA 1P3BB 4LD9D 3AZMA 1HQ3D 3W97D 2JE5A 5BS7A 5B1MB 4Z5TA 1U35B 5AVBC 3MNNC 1B6WA 3KWQD 1F1EA 3LZ0B 5B33C 1P3PC 4KHAA 5GT3D 1M18C 4KGCC 5B32D 1TZYD 5AV6A 5AY8D 1M1AC 3AZJB 2G5HC 3WKJD 3AZNA 5BT1C 2AROD 4CAYB 2F8NB 3AN2D 3AZGB 1ID3A 3LZ0C 4WU9B 4ZUXB 4JJNA 3KFUG 3AZKD 2Y2IA 4XZQA 5AV9B 3W98C 2JCHA 3R45B 5F99A 1T3UA 3X1UC 5CP6A 4Z5TC 3RELC 4WJ3C 4WU9C 3LZ0D 5BT1D 3AV2B 2AROC 3AFAC 2Y2GA 3W98B 3WA9A 1PZRA 5DNNB 2ZY2A 4QLCB 2F2AC 1P3PD 3WTPC 1F66C 2G5IC 5CPIB 5B33D 4AWLB 4J8UC 3NQJA 3X1SA 5AVBB 3MNNB 3REHC 3MVDC 3KUYA 1P3AD 5B2JC 4R8PA 2XD5A 1ZLAA 5B40A 3AZEB 5E5AD 5GT0C 3C1CD 2Y2OA 4NFTA 4KUDB 5C3IC 3EPKA 3UTBD 3B0CT 4H9RB 3A1IA 3A6NC 4WU9A 1KX3D 5B1MC 3AV1C 5B0YC 3LZ1C 3AZNB 1N1JB 3REID 1P3AC 3REHD 3AZJA 3KWQB 3WA9C 2UWXA 4YS3A 4CAYA 5CPIC 1P3BC 2F8NA 3WAAA 3MGSD 4ZUXA 4JJNB 3AZED 1F66A 1JFIA 4UUZA 5JRGC 1BH9A 3UT9B 2F8NH 3AZNC 4H9QB 1P3AB 3TU4A 3W99A 3WTPD 4H9SC 3AZID 4JJNC 3MGRD 5GT0A 1P3MD 4WNNA 1P3OB 5B2ID 1AOIB 3AZEC 1M19B 4G91B 1P3GB 1M18B 3WTPE 3AFAD 3AV1B 4H9RA 3AYWD 2VQRA 5B0ZD 1P34A 3VH6T 3REHB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3O62 B;  5B31 G;  3B6G D;  3AZM D;  1HQ3 A;  3W97 A;  4J8V A;  2F8N K;  1S32 A;  4KUD A;  3W98 D;  3MGR C;  1TAF B;  5GXQ B;  4WU8 B;  3AZH D;  3V9R A;  4XUJ D;  2NZD D;  1EQZ A;  4AWL C;  3C1B A;  2YFW B;  4J8W C;  3AN2 B;  5CHL B;  5AVB D;  3MNN D;  5CPK D;  3KXB A;  3A6N B;  5BNV B;  5AV9 D;  5B31 C;  2CV5 B;  2F8N G;  5GT0 B;  5KDM A;  5GT3 C;  3REJ C;  3MVD B;  1KX4 C;  4J8W D;  3AZK A;  1BH9 B;  3UT9 A;  1HQ3 C;  3X1S D;  3AZJ C;  1F66 B;  3W97 C;  5F99 D;  4LD9 C;  5AV9 C;  4X23 B;  3AZL C;  3AZL B;  4XUJ B;  5B1M D;  4HGA C;  4Z5T D;  4Z66 D;  3LJA A;  3AZH C;  4H9S A;  4YS3 D;  1TZY B;  5CPK C;  3AZL D;  3B6G C;  5KDM B;  1M19 D;  3B0C W;  2HIO C;  4R8P D;  3AZG C;  5BNV A;  5B0Z B;  3AN2 A;  1ID3 D;  1EQZ B;  1S32 C;  1P3I C;  4XZQ D;  5FUG A;  2FJ7 C;  3REK C;  2PYO A;  4J8U A;  3REH A;  3AYW C;  4E45 A;  3O62 C;  3AZJ D;  3X1S C;  3B0D C;  4DRA A;  1Q9C A;  5B1L D;  1KX3 C;  5AV6 D;  5F99 B;  5DNM A;  5B2J A;  3MGR B;  5G49 A;  1P3B D;  3WKJ A;  3UTB B;  1S32 D;  1P34 C;  4J8X B;  1P3L A;  3B6F B;  4WNN B;  1BH8 A;  3AZG A;  3LEL A;  2NZD A;  4NE5 A;  2BYK A;  4E44 A;  3O62 D;  1AOI A;  1A7W A;  4NE6 A;  4G92 C;  3AV1 A;  5JRG B;  5GSU A;  1P3F B;  3W96 C;  3MGS B;  1M1A A;  5B31 D;  1P3O C;  5CP6 D;  2IO5 B;  5E5A B;  3C1C B;  1ZLA D;  4KHA B;  5B40 D;  5E5A A;  3LZ0 A;  3C1C A;  1P3M C;  3W99 B;  1P3F C;  5B1L B;  5B0Y B;  3AYW B;  4H9Q A;  1P3L B;  3B6F A;  4H9P A;  1KX5 B;  2NQB A;  3AZH A;  3AZM B;  2IO5 C;  4XUJ A;  3X1V C;  5DNM B;  3WKJ B;  4YS3 B;  3AZK C;  4ZBJ C;  3MNN A;  5AVB A;  3KXB D;  4J8U B;  4R8P B;  1P3K A;  2JSS A;  3X1S B;  5CPJ B;  3AZI B;  4EO5 B;  5B2I C;  1ZLA B;  5AVC C;  2BYM A;  2BYM B;  3W96 D;  1B67 A;  3REI C;  4QLC A;  5B0Z A;  3REJ D;  3AV2 A;  4DRB A;  4YM6 C;  3MGS C;  5BNX B;  5AV8 A;  1R4V A;  4X23 D;  4G92 B;  5DNN A;  3MGQ D;  1HQ3 B;  3W97 B;  4NE3 A;  3LJA B;  1P3K B;  2PYO D;  5JA4 A;  3X1T D;  3UTB C;  3C1B D;  3R45 A;  1P3I A;  5B2I A;  5B1L A;  3AZF C;  3AZL A;  2CV5 C;  1M19 A;  4YM6 D;  1P3O A;  3AYW A;  5B2J D;  3AZH B;  2RVQ D;  5B33 B;  1KX5 A;  3UTA A;  2NQB B;  1KU5 A;  5GSU B;  1P3F A;  5AV5 A;  4R8P C;  3AZG D;  3LEL D;  1JFI B;  3MVD A;  3KUY C;  5GXQ D;  4WU8 D;  1P3G D;  1M18 D;  1P3P B;  3VH5 A;  5G49 B;  5CPK A;  1N1J A;  4Z66 C;  3C1B B;  1H3O A;  3KXB B;  3A6N A;  4J8W B;  5B32 G;  4WV4 B;  3AN2 C;  4YS3 C;  1P3B A;  5JRG D;  4J8X A;  4YM6 B;  4KGC A;  2FJ7 A;  3X1V D;  4WZS B;  5FUG B;  1KX5 C;  3O62 A;  3LZ1 D;  2NQB C;  4J8V B;  3AV1 D;  2PYO B;  3MGP A;  1U35 D;  5B0Y D;  4Z2M H;  5AY8 C;  1M1A D;  4H9N A;  5B32 B;  5AVC B;  3B0B A;  3NQU A;  3AZF B;  3X1U A;  4LD9 B;  3REK D;  3KWQ C;  3WA9 B;  2HUE B;  1P3K C;  4Z66 A;  3LJA D;  3VH6 W;  3REI B;  3REL A;  4J8U D;  4J8X C;  3UTA B;  4UUZ B;  5DNM D;  4XZQ B;  4X23 A;  3W96 B;  3MGQ A;  5JA4 B;  1P3L D;  5B24 A;  3KXB C;  3AZK B;  4EO5 C;  5B2I B;  1AOI D;  5AV6 B;  1P3I D;  5GT3 A;  4H9O B;  5C3I B;  1TZY C;  4Z2M G;  5B31 A;  5AV8 B;  5F99 C;  3KUY B;  1KX4 A;  3LZ1 B;  3AV2 D;  3AZN D;  2CV5 A;  1M19 C;  3X1U B;  3WAA C;  4LD9 A;  3B6G B;  5DNN D;  4H9N B;  5CPI A;  4JJN D;  3UTA C;  5AY8 B;  5CPJ A;  5AVC A;  2YFW A;  1TAF A;  4WU8 A;  5GXQ A;  3X1T A;  5GSU D;  2LY8 A;  3WTP B;  4YM6 A;  3A6N D;  4QLC C;  4M6B A;  3AZF D;  3REJ A;  4KGC D;  1KX3 B;  2HIO B;  5AV5 D;  3B6F D;  1WWS A;  1P3P A;  2NQB D;  3B0D B;  5GSU C;  3W96 A;  1P34 B;  4H9P B;  3MVD D;  5CPK B;  4KUD C;  3MGP D;  5B0Y A;  1P3A A;  4QLC D;  1P3G A;  1M18 A;  3TU4 B;  1EQZ C;  5BO0 B;  2L5A A;  5GXQ C;  3VH5 T;  4WU8 C;  4ZUX C;  5AV8 D;  3AZI C;  2BYK B;  3WAA D;  1P3K D;  2HIO D;  5AV5 C;  5AV5 B;  4Z66 B;  5JRG A;  1HTA A;  4WU9 D;  1KX3 A;  4XUJ C;  3REL D;  1M1A B;  3KWQ A;  3TU4 C;  3NQU B;  3AFA B;  5B32 A;  1BH8 B;  3AZM C;  5B40 B;  3AZE A;  5BS7 C;  1KX5 D;  1P3L C;  3X1T B;  2ARO A;  1P3F D;  3TU4 D;  1AOI C;  3WTP A;  4X23 C;  5BNX A;  4HGA B;  5E5A C;  5GT0 D;  3C1C C;  5CPJ C;  1P3M A;  4CSR B;  3WAA B;  3MGP C;  1KX4 B;  3NQJ B;  4ZUX D;  3LJA C;  5AV8 C;  1TZY A;  1P3O D;  1ZLA C;  3B6G A;  1F66 D;  2CV5 D;  5AY8 A;  5CP6 B;  4J8X D;  3UTA D;  2YFV B;  3WA9 D;  4KUD D;  1ULY A;  5CPI D;  3W98 A;  4H9O A;  3X1V A;  5B24 D;  1U35 C;  3W99 D;  5B1L C;  5B33 A;  3LZ1 A;  5GT3 B;  1ID3 B;  5B31 B;  3UT9 C;  3AFA A;  5AV6 C;  3VH6 A;  3REK B;  1P3I B;  5AV9 A;  1BFM A;  3REK A;  3MGQ B;  3W99 C;  1ID3 C;  3KSY A;  2CWE A;  5B24 C;  1WWI A;  5B24 B;  4J8V D;  5B0Z C;  3AV2 C;  3MGQ C;  4ZBJ B;  4XZQ C;  2FJ7 D;  2YFV A;  3WKJ C;  3REI A;  5CPJ D;  3REL B;  5AVC D;  5DNM C;  3X1V B;  5DNN C;  1EQZ D;  5CP6 C;  3MGS A;  3LEL C;  2NZD B;  5B32 C;  1U35 A;  3KUY D;  4J8V C;  3LEL B;  2NZD C;  2RVQ C;  4G91 C;  4CSR A;  5B1M A;  4Z5T B;  3X1U D;  2HIO A;  2HUE C;  1P3G C;  1P3M B;  3AZF A;  3MGP B;  3UTB A;  1S32 B;  3AZI A;  3V9R B;  5B2J B;  3MGR A;  3VH5 W;  4J8W A;  3UT9 D;  4KGC B;  1H3O B;  2PYO C;  3C1B C;  3X1T C;  2ARO B;  2F8N D;  2FJ7 B;  1KX4 D;  3B6F C;  1P34 D;  5BO0 A;  3REJ B;  5B40 C;  1P3B B;  4LD9 D;  3AZM A;  1HQ3 D;  3W97 D;  5BS7 A;  5B1M B;  4Z5T A;  1U35 B;  5AVB C;  3MNN C;  1B6W A;  3KWQ D;  1F1E A;  3LZ0 B;  5B33 C;  1P3P C;  4KHA A;  5GT3 D;  1M18 C;  4KGC C;  5B32 D;  1TZY D;  5AV6 A;  5AY8 D;  1M1A C;  3AZJ B;  3WKJ D;  3AZN A;  5BT1 C;  2ARO D;  4CAY B;  2F8N B;  3AN2 D;  3AZG B;  1ID3 A;  3LZ0 C;  4WU9 B;  4ZUX B;  4JJN A;  3AZK D;  4XZQ A;  5AV9 B;  3W98 C;  3R45 B;  5F99 A;  3X1U C;  5CP6 A;  4Z5T C;  3REL C;  4WU9 C;  3LZ0 D;  5BT1 D;  3AV2 B;  2ARO C;  3AFA C;  3W98 B;  3WA9 A;  5DNN B;  4QLC B;  1P3P D;  3WTP C;  1F66 C;  5CPI B;  5B33 D;  4AWL B;  4J8U C;  3NQJ A;  3X1S A;  5AVB B;  3MNN B;  3REH C;  3MVD C;  3KUY A;  1P3A D;  5B2J C;  4R8P A;  1ZLA A;  5B40 A;  3AZE B;  5E5A D;  5GT0 C;  3C1C D;  4NFT A;  4KUD B;  5C3I C;  3UTB D;  3B0C T;  4H9R B;  3A6N C;  4WU9 A;  1KX3 D;  5B1M C;  3AV1 C;  5B0Y C;  3LZ1 C;  3AZN B;  1N1J B;  3REI D;  1P3A C;  3REH D;  3AZJ A;  3KWQ B;  3WA9 C;  4YS3 A;  4CAY A;  5CPI C;  1P3B C;  2F8N A;  3WAA A;  3MGS D;  4ZUX A;  4JJN B;  3AZE D;  1F66 A;  1JFI A;  4UUZ A;  5JRG C;  1BH9 A;  3UT9 B;  2F8N H;  3AZN C;  4H9Q B;  1P3A B;  3TU4 A;  3W99 A;  3WTP D;  4H9S C;  3AZI D;  4JJN C;  3MGR D;  5GT0 A;  1P3M D;  4WNN A;  1P3O B;  5B2I D;  1AOI B;  3AZE C;  1M19 B;  4G91 B;  1P3G B;  1M18 B;  3WTP E;  3AFA D;  3AV1 B;  4H9R A;  3AYW D;  5B0Z D;  1P34 A;  3VH6 T;  3REH B; 
#chains in the Genus database with same CATH topology
 3O62 B;  3H0L C;  5B31 G;  3B6G D;  3AZM D;  1HQ3 A;  3W97 A;  4J8V A;  2F8N K;  1S32 A;  4KUD A;  3W98 D;  3MGR C;  1TAF B;  5GXQ B;  4WU8 B;  3AZH D;  3F6T A;  3V9R A;  2ZY4 A;  4XUJ D;  2NZD D;  1EQZ A;  3H0R C;  4AWL C;  3C1B A;  2YFW B;  4J8W C;  3AN2 B;  5CHL B;  5AVB D;  3MNN D;  5CPK D;  3KXB A;  3A6N B;  5BNV B;  5AV9 D;  5B31 C;  2CV5 B;  2F8N G;  5GT0 B;  5KDM A;  5GT3 C;  3REJ C;  3MVD B;  1KX4 C;  4J8W D;  3AZK A;  1BH9 B;  3UT9 A;  1HQ3 C;  3X1S D;  3AZJ C;  1F66 B;  3W97 C;  5F99 D;  4LD9 C;  5AV9 C;  4X23 B;  3AZL C;  3AZL B;  4XUJ B;  2Y2J A;  5B1M D;  4HGA C;  4Z5T D;  4Z66 D;  3LJA A;  2W8S A;  3AZH C;  4H9S A;  2Y2H A;  4YS3 D;  1TZY B;  5CPK C;  3AZL D;  3B6G C;  5KDM B;  1M19 D;  3B0C W;  2Y2K A;  2HIO C;  4R8P D;  3AZG C;  5BNV A;  5B0Z B;  3AN2 A;  1ID3 D;  1EQZ B;  1S32 C;  1P3I C;  4XZQ D;  5FUG A;  2FJ7 C;  3REK C;  2PYO A;  1W2E A;  4J8U A;  3REH A;  3AYW C;  4E45 A;  3O62 C;  3AZJ D;  3X1S C;  3B0D C;  4DRA A;  1Q9C A;  5B1L D;  1KX3 C;  5AV6 D;  5F99 B;  5DNM A;  3P5J B;  5B2J A;  5G49 A;  3MGR B;  1P3B D;  3WKJ A;  3UTB B;  1S32 D;  1P34 C;  4J8X B;  2Y2L A;  1P3L A;  3B6F B;  4WNN B;  1BH8 A;  3AZG A;  3LEL A;  2NZD A;  4NE5 A;  2BYK A;  4E44 A;  3O62 D;  1AOI A;  1A7W A;  4NE6 A;  4G92 C;  3AV1 A;  5JRG B;  5GSU A;  1P3F B;  3W96 C;  3MGS B;  1M1A A;  5B31 D;  1P3O C;  5CP6 D;  2IO5 B;  3A1K A;  5E5A B;  3C1C B;  1ZLA D;  4KHA B;  5B40 D;  5E5A A;  3LZ0 A;  3C1C A;  1P3M C;  3W99 B;  1P3F C;  5B1L B;  5B0Y B;  3AYW B;  4H9Q A;  1P3L B;  3B6F A;  4H9P A;  1KX5 B;  2NQB A;  3AZH A;  3AZM B;  2IO5 C;  4XUJ A;  3X1V C;  5DNM B;  3WKJ B;  4YS3 B;  3AZK C;  4ZBJ C;  5AVB A;  3MNN A;  3KXB D;  4J8U B;  4R8P B;  1P3K A;  2JSS A;  3X1S B;  5CPJ B;  3AZI B;  4EO5 B;  5B2I C;  1ZLA B;  5AVC C;  2ZY5 A;  2BYM A;  2BYM B;  3W96 D;  1B67 A;  2Y2M A;  3EPJ A;  3REI C;  4QLC A;  5B0Z A;  3REJ D;  3AV2 A;  4DRB A;  4YM6 C;  3MGS C;  5BNX B;  5AV8 A;  1R4V A;  4X23 D;  4G92 B;  5DNN A;  3MGQ D;  1HQ3 B;  3W97 B;  4NE3 A;  3LJA B;  1P3K B;  3FDD A;  2PYO D;  5JA4 A;  3X1T D;  3UTB C;  3C1B D;  3R45 A;  1P3I A;  5B2I A;  5B1L A;  3AZF C;  3AZL A;  2CV5 C;  1M19 A;  4YM6 D;  2Y2N A;  1P3O A;  2Y2Q A;  3AYW A;  5B2J D;  3AZH B;  2RVQ D;  5B33 B;  1KX5 A;  3UTA A;  2NQB B;  1KU5 A;  5GSU B;  1P3F A;  5AV5 A;  3EPH A;  4R8P C;  3AZG D;  3LEL D;  1JFI B;  3MVD A;  3KUY C;  5GXQ D;  4WU8 D;  1P3G D;  1M18 D;  1P3P B;  3VH5 A;  5G49 B;  5CPK A;  2RIQ A;  1N1J A;  4Z66 C;  3C1B B;  3H0M C;  1H3O A;  3KXB B;  3A6N A;  4J8W B;  5B32 G;  4WV4 B;  3AN2 C;  4YS3 C;  1P3B A;  5JRG D;  4J8X A;  4YM6 B;  4KGC A;  2DF4 C;  3X1V D;  4WZS B;  2FJ7 A;  5FUG B;  1KX5 C;  3O62 A;  3LZ1 D;  2NQB C;  4J8V B;  3AV1 D;  2PYO B;  3MGP A;  1U35 D;  5B0Y D;  4Z2M H;  5AY8 C;  1M1A D;  4H9N A;  5B32 B;  5AVC B;  3B0B A;  3NQU A;  3AZF B;  3X1U A;  4LD9 B;  3REK D;  3KWQ C;  4UPK A;  3WA9 B;  2HUE B;  1Z2C B;  1P3K C;  4Z66 A;  3LJA D;  3VH6 W;  3REI B;  3REL A;  4J8U D;  4J8X C;  3EG5 B;  3UTA B;  4UUZ B;  5DNM D;  4XZQ B;  4X23 A;  3W96 B;  3MGQ A;  5JA4 B;  1P3L D;  5B24 A;  3KXB C;  2ZM5 A;  3AZK B;  4EO5 C;  5B2I B;  1AOI D;  5AV6 B;  1P3I D;  5GT3 A;  4H9O B;  5C3I B;  1TZY C;  4Z2M G;  5B31 A;  5AV8 B;  5F99 C;  3KUY B;  1KX4 A;  3LZ1 B;  3AV2 D;  3AZN D;  2CV5 A;  1M19 C;  3X1U B;  3WAA C;  4LD9 A;  3B6G B;  5DNN D;  4H9N B;  5CPI A;  4JJN D;  3UTA C;  5AY8 B;  5CPJ A;  5AVC A;  2YFW A;  1TAF A;  4WU8 A;  5GXQ A;  3X1T A;  5GSU D;  2LY8 A;  3WTP B;  4YM6 A;  3A6N D;  4QLC C;  4M6B A;  3AZF D;  3REJ A;  3IP4 C;  4KGC D;  1KX3 B;  2HIO B;  5AV5 D;  3B6F D;  1WWS A;  1P3P A;  2NQB D;  3B0D B;  5GSU C;  3W96 A;  1P34 B;  4H9P B;  3MVD D;  5CPK B;  4KUD C;  3MGP D;  5B0Y A;  1P3A A;  4QLC D;  1P3G A;  1M18 A;  3TU4 B;  1EQZ C;  5BO0 B;  2L5A A;  5GXQ C;  3VH5 T;  4WU8 C;  4ZUX C;  5AV8 D;  4DQY B;  3AZI C;  2BYK B;  3WAA D;  1P3K D;  2HIO D;  5AV5 C;  5AV5 B;  4Z66 B;  5JRG A;  1HTA A;  4WU9 D;  1KX3 A;  3AL0 C;  4XUJ C;  3REL D;  1M1A B;  3KWQ A;  3TU4 C;  3NQU B;  3AFA B;  5B32 A;  1BH8 B;  3AZM C;  5B40 B;  3AZE A;  5BS7 C;  1KX5 D;  1P3L C;  3X1T B;  2ARO A;  2ZY3 A;  1P3F D;  3TU4 D;  1AOI C;  3WTP A;  2BG1 A;  4X23 C;  5BNX A;  4HGA B;  5E5A C;  5GT0 D;  3C1C C;  5CPJ C;  1P3M A;  4CSR B;  3WAA B;  3MGP C;  1KX4 B;  3NQJ B;  4ZUX D;  3LJA C;  5AV8 C;  1TZY A;  1P3O D;  2XD1 A;  1ZLA C;  3B6G A;  1F66 D;  2CV5 D;  5AY8 A;  5CP6 B;  4J8X D;  3UTA D;  2YFV B;  3EPL A;  3WA9 D;  4KUD D;  1ULY A;  5CPI D;  3W98 A;  4H9O A;  3X1V A;  5B24 D;  1U35 C;  3W99 D;  5B1L C;  5B33 A;  3LZ1 A;  5GT3 B;  1ID3 B;  5B31 B;  3UT9 C;  3AFA A;  5AV6 C;  3VH6 A;  3REK B;  1P3I B;  5AV9 A;  1BFM A;  3REK A;  3MGQ B;  3W99 C;  1ID3 C;  3KSY A;  2CWE A;  5B24 C;  1WWI A;  5B24 B;  2DQN C;  5B0Z C;  4J8V D;  3AV2 C;  3MGQ C;  4ZBJ B;  4XZQ C;  2FJ7 D;  2YFV A;  3WKJ C;  3REI A;  5CPJ D;  3REL B;  5AVC D;  5DNM C;  3X1V B;  5DNN C;  1EQZ D;  5CP6 C;  3MGS A;  3LEL C;  2NZD B;  5B32 C;  1U35 A;  3KUY D;  4J8V C;  3LEL B;  2NZD C;  2RVQ C;  4G91 C;  4CSR A;  5B1M A;  4Z5T B;  3X1U D;  2HIO A;  2HUE C;  1P3G C;  1P3M B;  3AZF A;  3MGP B;  3UTB A;  1S32 B;  3AZI A;  3V9R B;  5B2J B;  3MGR A;  3VH5 W;  4J8W A;  3UT9 D;  4KGC B;  1H3O B;  2FFF B;  2PYO C;  3C1B C;  3X1T C;  2ARO B;  2J8P A;  2F8N D;  2FJ7 B;  1KX4 D;  3B6F C;  1P34 D;  5BO0 A;  3REJ B;  5B40 C;  2Y2P A;  1P3B B;  4LD9 D;  3AZM A;  1HQ3 D;  3W97 D;  2JE5 A;  5BS7 A;  5B1M B;  4Z5T A;  1U35 B;  5AVB C;  3MNN C;  1B6W A;  3KWQ D;  1F1E A;  3LZ0 B;  5B33 C;  1P3P C;  4KHA A;  5GT3 D;  1M18 C;  4KGC C;  5B32 D;  1TZY D;  5AV6 A;  5AY8 D;  1M1A C;  3AZJ B;  2G5H C;  3WKJ D;  3AZN A;  5BT1 C;  2ARO D;  4CAY B;  2F8N B;  3AN2 D;  3AZG B;  1ID3 A;  3LZ0 C;  4WU9 B;  4ZUX B;  4JJN A;  3KFU G;  3AZK D;  2Y2I A;  4XZQ A;  5AV9 B;  3W98 C;  2JCH A;  3R45 B;  5F99 A;  1T3U A;  3X1U C;  5CP6 A;  4Z5T C;  3REL C;  4WJ3 C;  4WU9 C;  3LZ0 D;  5BT1 D;  3AV2 B;  2ARO C;  3AFA C;  2Y2G A;  3W98 B;  3WA9 A;  1PZR A;  5DNN B;  2ZY2 A;  4QLC B;  2F2A C;  1P3P D;  3WTP C;  1F66 C;  2G5I C;  5CPI B;  5B33 D;  4AWL B;  4J8U C;  3NQJ A;  3X1S A;  5AVB B;  3MNN B;  3REH C;  3MVD C;  3KUY A;  1P3A D;  5B2J C;  4R8P A;  2XD5 A;  1ZLA A;  5B40 A;  3AZE B;  5E5A D;  5GT0 C;  3C1C D;  2Y2O A;  4NFT A;  4KUD B;  5C3I C;  3EPK A;  3UTB D;  3B0C T;  4H9R B;  3A1I A;  3A6N C;  4WU9 A;  1KX3 D;  5B1M C;  3AV1 C;  5B0Y C;  3LZ1 C;  3AZN B;  1N1J B;  3REI D;  1P3A C;  3REH D;  3AZJ A;  3KWQ B;  3WA9 C;  2UWX A;  4YS3 A;  4CAY A;  5CPI C;  1P3B C;  2F8N A;  3WAA A;  3MGS D;  4ZUX A;  4JJN B;  3AZE D;  1F66 A;  1JFI A;  4UUZ A;  5JRG C;  1BH9 A;  3UT9 B;  2F8N H;  3AZN C;  4H9Q B;  1P3A B;  3TU4 A;  3W99 A;  3WTP D;  4H9S C;  3AZI D;  4JJN C;  3MGR D;  5GT0 A;  1P3M D;  4WNN A;  1P3O B;  5B2I D;  1AOI B;  3AZE C;  1M19 B;  4G91 B;  1P3G B;  1M18 B;  3WTP E;  3AFA D;  3AV1 B;  4H9R A;  3AYW D;  2VQR A;  5B0Z D;  1P34 A;  3VH6 T;  3REH B; 
#chains in the Genus database with same CATH homology
 3O62 B;  3H0L C;  5B31 G;  3B6G D;  3AZM D;  1HQ3 A;  3W97 A;  4J8V A;  2F8N K;  1S32 A;  4KUD A;  3W98 D;  3MGR C;  1TAF B;  5GXQ B;  4WU8 B;  3AZH D;  3F6T A;  3V9R A;  2ZY4 A;  4XUJ D;  2NZD D;  1EQZ A;  3H0R C;  4AWL C;  3C1B A;  2YFW B;  4J8W C;  3AN2 B;  5CHL B;  5AVB D;  3MNN D;  5CPK D;  3KXB A;  3A6N B;  5BNV B;  5AV9 D;  5B31 C;  2CV5 B;  2F8N G;  5GT0 B;  5KDM A;  5GT3 C;  3REJ C;  3MVD B;  1KX4 C;  4J8W D;  3AZK A;  1BH9 B;  3UT9 A;  1HQ3 C;  3X1S D;  3AZJ C;  1F66 B;  3W97 C;  5F99 D;  4LD9 C;  5AV9 C;  4X23 B;  3AZL C;  3AZL B;  4XUJ B;  2Y2J A;  5B1M D;  4HGA C;  4Z5T D;  4Z66 D;  3LJA A;  2W8S A;  3AZH C;  4H9S A;  2Y2H A;  4YS3 D;  1TZY B;  5CPK C;  3AZL D;  3B6G C;  5KDM B;  1M19 D;  3B0C W;  2Y2K A;  2HIO C;  4R8P D;  3AZG C;  5BNV A;  5B0Z B;  3AN2 A;  1ID3 D;  1EQZ B;  1S32 C;  1P3I C;  4XZQ D;  5FUG A;  2FJ7 C;  3REK C;  2PYO A;  1W2E A;  4J8U A;  3REH A;  3AYW C;  4E45 A;  3O62 C;  3AZJ D;  3X1S C;  3B0D C;  4DRA A;  1Q9C A;  5B1L D;  1KX3 C;  5AV6 D;  5F99 B;  5DNM A;  3P5J B;  5B2J A;  5G49 A;  3MGR B;  1P3B D;  3WKJ A;  3UTB B;  1S32 D;  1P34 C;  4J8X B;  2Y2L A;  1P3L A;  3B6F B;  4WNN B;  1BH8 A;  3AZG A;  3LEL A;  2NZD A;  4NE5 A;  2BYK A;  4E44 A;  3O62 D;  1AOI A;  1A7W A;  4NE6 A;  4G92 C;  3AV1 A;  5JRG B;  5GSU A;  1P3F B;  3W96 C;  3MGS B;  1M1A A;  5B31 D;  1P3O C;  5CP6 D;  2IO5 B;  3A1K A;  5E5A B;  3C1C B;  1ZLA D;  4KHA B;  5B40 D;  5E5A A;  3LZ0 A;  3C1C A;  1P3M C;  3W99 B;  1P3F C;  5B1L B;  5B0Y B;  3AYW B;  4H9Q A;  1P3L B;  3B6F A;  4H9P A;  1KX5 B;  2NQB A;  3AZH A;  3AZM B;  2IO5 C;  4XUJ A;  3X1V C;  5DNM B;  3WKJ B;  4YS3 B;  3AZK C;  4ZBJ C;  5AVB A;  3MNN A;  3KXB D;  4J8U B;  4R8P B;  1P3K A;  2JSS A;  3X1S B;  5CPJ B;  3AZI B;  4EO5 B;  5B2I C;  1ZLA B;  5AVC C;  2ZY5 A;  2BYM A;  2BYM B;  3W96 D;  1B67 A;  2Y2M A;  3EPJ A;  3REI C;  4QLC A;  5B0Z A;  3REJ D;  3AV2 A;  4DRB A;  4YM6 C;  3MGS C;  5BNX B;  5AV8 A;  1R4V A;  4X23 D;  4G92 B;  5DNN A;  3MGQ D;  1HQ3 B;  3W97 B;  4NE3 A;  3LJA B;  1P3K B;  3FDD A;  2PYO D;  5JA4 A;  3X1T D;  3UTB C;  3C1B D;  3R45 A;  1P3I A;  5B2I A;  5B1L A;  3AZF C;  3AZL A;  2CV5 C;  1M19 A;  4YM6 D;  2Y2N A;  1P3O A;  2Y2Q A;  3AYW A;  5B2J D;  3AZH B;  2RVQ D;  5B33 B;  1KX5 A;  3UTA A;  2NQB B;  1KU5 A;  5GSU B;  1P3F A;  5AV5 A;  3EPH A;  4R8P C;  3AZG D;  3LEL D;  1JFI B;  3MVD A;  3KUY C;  5GXQ D;  4WU8 D;  1P3G D;  1M18 D;  1P3P B;  3VH5 A;  5G49 B;  5CPK A;  2RIQ A;  1N1J A;  4Z66 C;  3C1B B;  3H0M C;  1H3O A;  3KXB B;  3A6N A;  4J8W B;  5B32 G;  4WV4 B;  3AN2 C;  4YS3 C;  1P3B A;  5JRG D;  4J8X A;  4YM6 B;  4KGC A;  2DF4 C;  3X1V D;  4WZS B;  2FJ7 A;  5FUG B;  1KX5 C;  3O62 A;  3LZ1 D;  2NQB C;  4J8V B;  3AV1 D;  2PYO B;  3MGP A;  1U35 D;  5B0Y D;  4Z2M H;  5AY8 C;  1M1A D;  4H9N A;  5B32 B;  5AVC B;  3B0B A;  3NQU A;  3AZF B;  3X1U A;  4LD9 B;  3REK D;  3KWQ C;  4UPK A;  3WA9 B;  2HUE B;  1Z2C B;  1P3K C;  4Z66 A;  3LJA D;  3VH6 W;  3REI B;  3REL A;  4J8U D;  4J8X C;  3EG5 B;  3UTA B;  4UUZ B;  5DNM D;  4XZQ B;  4X23 A;  3W96 B;  3MGQ A;  5JA4 B;  1P3L D;  5B24 A;  3KXB C;  2ZM5 A;  3AZK B;  4EO5 C;  5B2I B;  1AOI D;  5AV6 B;  1P3I D;  5GT3 A;  4H9O B;  5C3I B;  1TZY C;  4Z2M G;  5B31 A;  5AV8 B;  5F99 C;  3KUY B;  1KX4 A;  3LZ1 B;  3AV2 D;  3AZN D;  2CV5 A;  1M19 C;  3X1U B;  3WAA C;  4LD9 A;  3B6G B;  5DNN D;  4H9N B;  5CPI A;  4JJN D;  3UTA C;  5AY8 B;  5CPJ A;  5AVC A;  2YFW A;  1TAF A;  4WU8 A;  5GXQ A;  3X1T A;  5GSU D;  2LY8 A;  3WTP B;  4YM6 A;  3A6N D;  4QLC C;  4M6B A;  3AZF D;  3REJ A;  3IP4 C;  4KGC D;  1KX3 B;  2HIO B;  5AV5 D;  3B6F D;  1WWS A;  1P3P A;  2NQB D;  3B0D B;  5GSU C;  3W96 A;  1P34 B;  4H9P B;  3MVD D;  5CPK B;  4KUD C;  3MGP D;  5B0Y A;  1P3A A;  4QLC D;  1P3G A;  1M18 A;  3TU4 B;  1EQZ C;  5BO0 B;  2L5A A;  5GXQ C;  3VH5 T;  4WU8 C;  4ZUX C;  5AV8 D;  4DQY B;  3AZI C;  2BYK B;  3WAA D;  1P3K D;  2HIO D;  5AV5 C;  5AV5 B;  4Z66 B;  5JRG A;  1HTA A;  4WU9 D;  1KX3 A;  3AL0 C;  4XUJ C;  3REL D;  1M1A B;  3KWQ A;  3TU4 C;  3NQU B;  3AFA B;  5B32 A;  1BH8 B;  3AZM C;  5B40 B;  3AZE A;  5BS7 C;  1KX5 D;  1P3L C;  3X1T B;  2ARO A;  2ZY3 A;  1P3F D;  3TU4 D;  1AOI C;  3WTP A;  2BG1 A;  4X23 C;  5BNX A;  4HGA B;  5E5A C;  5GT0 D;  3C1C C;  5CPJ C;  1P3M A;  4CSR B;  3WAA B;  3MGP C;  1KX4 B;  3NQJ B;  4ZUX D;  3LJA C;  5AV8 C;  1TZY A;  1P3O D;  2XD1 A;  1ZLA C;  3B6G A;  1F66 D;  2CV5 D;  5AY8 A;  5CP6 B;  4J8X D;  3UTA D;  2YFV B;  3EPL A;  3WA9 D;  4KUD D;  1ULY A;  5CPI D;  3W98 A;  4H9O A;  3X1V A;  5B24 D;  1U35 C;  3W99 D;  5B1L C;  5B33 A;  3LZ1 A;  5GT3 B;  1ID3 B;  5B31 B;  3UT9 C;  3AFA A;  5AV6 C;  3VH6 A;  3REK B;  1P3I B;  5AV9 A;  1BFM A;  3REK A;  3MGQ B;  3W99 C;  1ID3 C;  3KSY A;  2CWE A;  5B24 C;  1WWI A;  5B24 B;  2DQN C;  5B0Z C;  4J8V D;  3AV2 C;  3MGQ C;  4ZBJ B;  4XZQ C;  2FJ7 D;  2YFV A;  3WKJ C;  3REI A;  5CPJ D;  3REL B;  5AVC D;  5DNM C;  3X1V B;  5DNN C;  1EQZ D;  5CP6 C;  3MGS A;  3LEL C;  2NZD B;  5B32 C;  1U35 A;  3KUY D;  4J8V C;  3LEL B;  2NZD C;  2RVQ C;  4G91 C;  4CSR A;  5B1M A;  4Z5T B;  3X1U D;  2HIO A;  2HUE C;  1P3G C;  1P3M B;  3AZF A;  3MGP B;  3UTB A;  1S32 B;  3AZI A;  3V9R B;  5B2J B;  3MGR A;  3VH5 W;  4J8W A;  3UT9 D;  4KGC B;  1H3O B;  2FFF B;  2PYO C;  3C1B C;  3X1T C;  2ARO B;  2J8P A;  2F8N D;  2FJ7 B;  1KX4 D;  3B6F C;  1P34 D;  5BO0 A;  3REJ B;  5B40 C;  2Y2P A;  1P3B B;  4LD9 D;  3AZM A;  1HQ3 D;  3W97 D;  2JE5 A;  5BS7 A;  5B1M B;  4Z5T A;  1U35 B;  5AVB C;  3MNN C;  1B6W A;  3KWQ D;  1F1E A;  3LZ0 B;  5B33 C;  1P3P C;  4KHA A;  5GT3 D;  1M18 C;  4KGC C;  5B32 D;  1TZY D;  5AV6 A;  5AY8 D;  1M1A C;  3AZJ B;  2G5H C;  3WKJ D;  3AZN A;  5BT1 C;  2ARO D;  4CAY B;  2F8N B;  3AN2 D;  3AZG B;  1ID3 A;  3LZ0 C;  4WU9 B;  4ZUX B;  4JJN A;  3KFU G;  3AZK D;  2Y2I A;  4XZQ A;  5AV9 B;  3W98 C;  2JCH A;  3R45 B;  5F99 A;  1T3U A;  3X1U C;  5CP6 A;  4Z5T C;  3REL C;  4WJ3 C;  4WU9 C;  3LZ0 D;  5BT1 D;  3AV2 B;  2ARO C;  3AFA C;  2Y2G A;  3W98 B;  3WA9 A;  1PZR A;  5DNN B;  2ZY2 A;  4QLC B;  2F2A C;  1P3P D;  3WTP C;  1F66 C;  2G5I C;  5CPI B;  5B33 D;  4AWL B;  4J8U C;  3NQJ A;  3X1S A;  5AVB B;  3MNN B;  3REH C;  3MVD C;  3KUY A;  1P3A D;  5B2J C;  4R8P A;  2XD5 A;  1ZLA A;  5B40 A;  3AZE B;  5E5A D;  5GT0 C;  3C1C D;  2Y2O A;  4NFT A;  4KUD B;  5C3I C;  3EPK A;  3UTB D;  3B0C T;  4H9R B;  3A1I A;  3A6N C;  4WU9 A;  1KX3 D;  5B1M C;  3AV1 C;  5B0Y C;  3LZ1 C;  3AZN B;  1N1J B;  3REI D;  1P3A C;  3REH D;  3AZJ A;  3KWQ B;  3WA9 C;  2UWX A;  4YS3 A;  4CAY A;  5CPI C;  1P3B C;  2F8N A;  3WAA A;  3MGS D;  4ZUX A;  4JJN B;  3AZE D;  1F66 A;  1JFI A;  4UUZ A;  5JRG C;  1BH9 A;  3UT9 B;  2F8N H;  3AZN C;  4H9Q B;  1P3A B;  3TU4 A;  3W99 A;  3WTP D;  4H9S C;  3AZI D;  4JJN C;  3MGR D;  5GT0 A;  1P3M D;  4WNN A;  1P3O B;  5B2I D;  1AOI B;  3AZE C;  1M19 B;  4G91 B;  1P3G B;  1M18 B;  3WTP E;  3AFA D;  3AV1 B;  4H9R A;  3AYW D;  2VQR A;  5B0Z D;  1P34 A;  3VH6 T;  3REH B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...