5BT1D

Histone chaperone hif1 playing with histone h2a-h2b dimer
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
90
structure length
90
Chain Sequence
KETYSSYIYKVLKQTHPDTGISQKSMSILNSFVNDIFERIATEASKLAAYNKKSTISAREIQTAVRLILPGELAKHAVSEGTRAVTKYSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HAT1-interacting factor 1
publication title Structural Insights into the Association of Hif1 with Histones H2A-H2B Dimer and H3-H4 Tetramer
pubmed doi rcsb
source organism Saccharomyces cerevisiae (strain atcc 204508 / s288c)
molecule tags Chaperone
total genus 35
structure length 90
sequence length 90
ec nomenclature
pdb deposition date 2015-06-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5bt1D00
5B0YB 2CV5A 5C3IC 1ULYA 3REJA 4ZUXB 3AZMD 5B1MB 5B0YD 3LJAB 5AY8B 1P3KC 2RVQD 5B1MD 3LJAD 5CPIA 4WU8B 3X1UD 4Z5TB 5KDMB 5B32B 1M18C 3UTAB 5GT0C 3AV2A 3AZHC 5GT3A 2BYKA 4J8WA 4Z5TD 5B32D 3UTAD 4R8PB 1P3IA 4J8XB 1KX4A 3AV1D 5B2JB 3VH5T 4R8PD 1P3PB 4J8XD 1KU5A 5AVCC 5AVBD 3MGQB 5B2JD 4YS3A 1P3PD 2HIOD 4CSRB 3WKJB 3LZ0B 3AZKC 4NFTA 1S32D 5JRGC 1N1JB 5B1LC 3VH5W 4AWLC 4X23C 5CPJA 2BYMA 1U35B 2CWEA 1F66A 4YM6C 3WTPE 4QLCB 3WTPC 4LD9A 5CP6A 1ZLAA 1BH8A 5AV6B 5B40A 3MNNA 3LZ1B 3KWQA 3C1BB 3UT9C 3O62B 1M19B 1P3AB 3C1BD 4E44A 3AZEC 4G92B 3MGSC 1M19D 3REKC 4XZQC 3B0BA 3B0CT 3TU4D 3NQJA 3WAAD 5B32G 5F99B 3LELA 5CPKC 1P3OA 3B0CW 5BS7C 1KX5B 3B6FA 5B0ZC 3X1SC 3AYWB 1P3LC 1KX5D 3AYWD 2NZDB 1TAFB 2CV5B 5AY8A 4Z66C 3AZLD 4XUJC 3REJB 3UTBC 3AZGA 2PYOB 2NZDD 2CV5D 4WU8A 3AZMC 5B0YC 1P3GB 3C1CD 2FJ7A 5CPIB 5B1MC 3LJAC 1P3FA 5CPID 5AV5A 3X1UC 3AV2B 3W96A 2BYKB 5GT3B 4J8WB 4JJND 3V9RA 3AV2D 4Z5TC 5B32C 5GT3D 1P3IB 1KX3D 3UTAC 5BNVA 1KX4B 5G49A 1ID3A 3WKJA 3LZ0A 4R8PC 1KX4D 4J8XC 4YS3B 3AZID 3B0DB 5AVBC 1P3PC 5B2JC 2AROA 1S32C 3MGQC 1JFIB 5CPJB 1U35A 5CHLB 3KXBB 2BYMB 5FUGA 1F66B 3LZ1A 3MGRD 5B33A 1M1AA 4H9SA 4J8UA 3AZED 5CP6B 1ZLAB 1BH8B 1P3AA 1F66D 5B40B 3MNNB 1TZYA 3KWQB 1AOIA 4LD9D 5CP6D 1ZLAD 1B67A 5B40D 3MNND 3KWQD 3C1BC 3O62C 2LY8A 3NQJB 1M19C 3VH6A 3TU4C 5DNMD 3LELB 3X1TA 5F99C 1P3OD 4KHAA 3W98A 3AFAD 1BH9A 3B6FB 1TAFA 2YFVA 4Z2MG 3B6GA 3UTBD 4HGAC 1KX5C 2PYOA 5E5AB 2HUEB 3AYWC 1P3GA 4EO5C 4ZUXD 3AZLC 3AZGB 5AY8D 5B24A 2NZDC 2CV5C 3AZGD 2F8NK 2FJ7B 3REJC 3C1CC 5BO0A 4WU8D 4NE6A 1P3FB 2FJ7D 5AV5B 3NQUA 1P3KA 3RELA 3W96B 5CPIC 1P34A 1H3OA 5GXQB 5AV5D 3V9RB 4JJNC 1M18A 2NQBA 5BNVB 3AV2C 5GT3C 4J8VA 1KX3C 5G49B 1HQ3A 4J8WC 1ID3B 5DNNA 3MGQD 1P3IC 1P3BB 1ID3D 3WKJD 4H9RB 3LZ0D 1KX4C 1JFIA 2AROB 3AZIC 3KXBA 3B0DC 4H9NA 5FUGB 1U35D 1F1EA 5CPJC 4QLCD 5B33B 3KSYA 4DRAA 3MGRC 4Z2MH 4J8UB 4WU9A 1M1AB 5AV6D 3LZ1D 1TZYB 5B33D 1M1AD 3O62D 4J8UD 1AOIB 1F66C 4KUDA 1P3AD 3VH5A 4G91B 4LD9C 5CP6C 1TZYD 3REIA 1AOID 1ZLAC 3MNNC 5B40C 3KWQC 5F99D 5BT1D 5DNMC 3REHA 3X1TB 1EQZB 3MVDA 3AZFB 5B31A 3KUYA 2NZDA 3MGPA 3X1TD 3W98B 4KHAB 3LELC 5AV8A 2IO5B 1P3OC 1BH9B 3AFAC 3W98D 2YFVB 5E5AA 3B6GB 3W99A 3B6GD 3B6FC 5B0ZA 3AZNA 3REJD 1P3LA 2PYOD 5B24B 4ZUXC 3A6NA 1P3GD 5AY8C 2HUEC 5B24D 5C3IB 5BO0B 3AZGC 4WU8C 5GXQA 3AZMA 3AN2A 3NQUB 1P3KB 3RELB 2FJ7C 4J8WD 1P34B 1H3OB 4E45A 1P3ID 1P3FC 1P34D 5AV5C 1M18B 2NQBB 1P3BA 4J8VB 3AZHB 1HQ3B 4H9RA 2NQBD 5DNNB 4YS3D 1HQ3D 1WWSA 5DNND 2JSSA 1HTAA 4WZSB 5BNXB 1ID3C 3LZ0C 3WKJC 3AV1A 5CPJD 5AV9A 3KXBD 4H9NB 2AROC 3AZKB 1WWIA 2HIOA 1U35C 4WU9B 4QLCC 5AV6C 3LZ1C 4KUDB 3WA9A 4YM6B 5B33C 1P3MA 4H9SC 4J8UC 3R45B 3REIB 1M1AC 3WTPB 4WV4B 1Q9CA 1P3AC 4KUDD 4KGCA 1TZYC 2F8NG 1AOIC 4G92C 3UT9B 3AZJA 1EQZA 3AZFA 3LELD 3REHB 5BT1C 3MVDB 4NE5A 5B31B 3KUYB 3REHD 3MGPB 4DRBA 3WAAA 5B2IA 5AV8B 5GSUA 5CPKB 3KUYD 3X1TC 3B6FD 4ZBJB 3MGPD 3W99B 4H9PA 3W98C 2IO5C 3W97A 5E5AD 3W99D 5B0ZB 3AZNB 3X1VA 3B6GC 1P3LB 2F8NA 3A6NB 3AZND 2PYOC 1P3GC 3A6ND 3AZLA 5B24C 1P3FD 3AZMB 3AN2B 3W96D 5GXQD 5GT0A 3C1CA 3AZHA 3AN2D 3X1UB 3RELC 1P34C 2F8NH 5BNXA 1P3BD 5JA4B 2NQBC 5AVCA 4JJNA 4J8VC 4YS3C 1HQ3C 2AROD 1KX3A 5B31G 5DNNC 3AZKA 3AV1B 5JRGA 5B1LA 5AV9B 4X23A 5AVBB 2HIOB 3KXBC 3AZIA 5AV9D 1S32B 4YM6A 3R45A 3WTPA 3WA9B 4WU9C 4CAYB 1P3MB 3UT9A 3MGRA 4KGCB 3WA9D 3AZEA 1P3MD 4KUDC 4KGCD 3MGSA 3REKA 4XZQA 3AZJB 3REIC 4WNNA 4NE3A 3AZJD 1EQZD 3AZFD 5CPKA 2YFWB 3TU4B 4H9QA 3REHC 5B2IB 3WAAB 5GSUB 5DNMA 3MVDC 5BS7A 5B31C 3KUYC 5B2ID 5GSUD 4H9PB 3MGPC 3X1SA 5AV8C 3W97B 4ZBJC 4UUZA 3X1VB 5E5AC 3W99C 3AFAA 3W97D 4Z66A 4H9OB 2F8NB 4XUJA 1A7WA 4HGAB 3X1VD 3UTBA 3AZNC 2F8ND 5B0YA 4EO5B 3AZLB 3A6NC 4ZUXA 5B1MA 1P3KD 3LJAA 3RELD 3X1UA 3W96C 5GT0B 3C1CB 2L5AA 5GXQC 1M18D 3AN2C 4J8VD 5GT0D 4Z5TA 5JA4A 5KDMA 5B32A 3AZHD 3UTAA 2RVQC 1BFMA 5AVCB 4JJNB 1P3BC 4R8PA 4J8XA 1KX3B 5AVBA 5AVCD 5B2JA 1P3PA 5JRGB 1S32A 5B1LB 3AZKD 4AWLB 3MGQA 4X23B 5JRGD 4CSRA 3AZIB 5B1LD 3VH6T 3AV1C 4WU9D 1N1JA 4X23D 5AV9C 4CAYA 2HIOC 1R4VA 4YM6D 3REID 3WTPD 3VH6W 3MGRB 4G91C 1B6WA 4QLCA 3AZEB 3UT9D 3WA9C 5AV6A 3C1BA 3MGSB 1P3MC 3REKB 4XZQB 3O62A 4LD9B 4WNNB 1M19A 4KGCC 2YFWA 3MGSD 3TU4A 3REKD 4XZQD 3MVDD 5B31D 3AZJC 1EQZC 4H9QB 3AZFC 5F99A 5AV8D 5DNMB 5CPKD 3X1SB 3WAAC 5B2IC 5GSUC 4M6BA 4H9OA 1P3OB 5B0ZD 4UUZB 3X1SD 1KX5A 3AFAB 1P3LD 4Z66B 4XUJB 3AYWA 3W97C 3UTBB 4Z66D 3X1VC 4XUJD
chains in the Genus database with same CATH superfamily
5B0YB 2CV5A 5C3IC 2XD1A 1ULYA 3REJA 2Y2IA 4ZUXB 3AZMD 2ZY2A 5B1MB 5B0YD 3AL0C 3LJAB 5AY8B 2ZM5A 1P3KC 1W2EA 2RVQD 5B1MD 3LJAD 5CPIA 4WU8B 3X1UD 4Z5TB 5KDMB 5B32B 1M18C 3UTAB 5GT0C 3AV2A 3AZHC 5GT3A 2BYKA 4J8WA 4Z5TD 5B32D 3UTAD 4R8PB 1P3IA 4J8XB 1KX4A 3AV1D 5B2JB 3VH5T 4R8PD 1P3PB 4J8XD 1KU5A 5AVCC 5AVBD 3MGQB 5B2JD 4YS3A 1P3PD 2HIOD 4CSRB 3WKJB 3LZ0B 3AZKC 4NFTA 1S32D 5JRGC 1N1JB 2G5IC 5B1LC 3VH5W 4AWLC 4X23C 5CPJA 2BYMA 1U35B 2CWEA 1F66A 4YM6C 3WTPE 2ZY5A 4QLCB 3WTPC 5CP6A 4LD9A 1ZLAA 1BH8A 5AV6B 5B40A 3MNNA 3LZ1B 3KWQA 3C1BB 3UT9C 3O62B 1M19B 1P3AB 3C1BD 4E44A 3AZEC 4G92B 2JE5A 3MGSC 1M19D 3REKC 4XZQC 3B0BA 3B0CT 3TU4D 3NQJA 3WAAD 5B32G 5F99B 3LELA 5CPKC 1P3OA 3B0CW 5BS7C 1KX5B 3B6FA 5B0ZC 3X1SC 3AYWB 1P3LC 1KX5D 3AYWD 2NZDB 1TAFB 2CV5B 5AY8A 4Z66C 3AZLD 4XUJC 3REJB 3UTBC 3AZGA 2PYOB 2NZDD 2CV5D 4WU8A 3AZMC 5B0YC 1P3GB 3C1CD 2FJ7A 5CPIB 3P5JB 5B1MC 3LJAC 1P3FA 5CPID 5AV5A 3X1UC 3AV2B 3W96A 2BYKB 5GT3B 4J8WB 4JJND 3V9RA 3AV2D 4Z5TC 5B32C 5GT3D 1P3IB 1KX3D 3UTAC 5BNVA 1KX4B 5G49A 1ID3A 3WKJA 3LZ0A 4R8PC 1KX4D 4J8XC 3A1KA 4YS3B 3AZID 3B0DB 1T3UA 5AVBC 5B2JC 1P3PC 2AROA 1S32C 3MGQC 1JFIB 5CPJB 1U35A 5CHLB 3KXBB 2BYMB 5FUGA 1F66B 3LZ1A 3MGRD 5B33A 1M1AA 4H9SA 4J8UA 3AZED 5CP6B 2RIQA 1ZLAB 1BH8B 1P3AA 1F66D 5B40B 3MNNB 1TZYA 3KWQB 1AOIA 3H0LC 4LD9D 5CP6D 1ZLAD 1B67A 5B40D 3MNND 3KWQD 3C1BC 3O62C 2LY8A 3NQJB 1M19C 3VH6A 3TU4C 5DNMD 2G5HC 3LELB 3X1TA 5F99C 1P3OD 4KHAA 2DQNC 3W98A 3AFAD 1BH9A 3B6FB 1TAFA 2YFVA 4Z2MG 3B6GA 3UTBD 4HGAC 1KX5C 2PYOA 2Y2OA 5E5AB 2HUEB 3AYWC 1P3GA 4EO5C 4ZUXD 2Y2MA 3AZLC 3AZGB 5AY8D 5B24A 2NZDC 2CV5C 2UWXA 3AZGD 2F8NK 2FJ7B 3REJC 3C1CC 5BO0A 4WU8D 4NE6A 1P3FB 2FJ7D 5AV5B 3NQUA 1P3KA 3RELA 3W96B 5CPIC 1P34A 1H3OA 5GXQB 5AV5D 3V9RB 4JJNC 1M18A 2NQBA 5BNVB 3AV2C 5GT3C 4J8VA 1KX3C 5G49B 1HQ3A 4J8WC 1ID3B 5DNNA 3MGQD 1P3IC 1P3BB 1ID3D 3WKJD 4H9RB 3LZ0D 1KX4C 1JFIA 2AROB 2ZY4A 3AZIC 3KXBA 2Y2GA 3EPKA 3KFUG 3B0DC 4H9NA 5FUGB 1U35D 1F1EA 5CPJC 4QLCD 5B33B 3KSYA 4DRAA 3MGRC 4Z2MH 4J8UB 4WU9A 1M1AB 2BG1A 5AV6D 3LZ1D 1TZYB 5B33D 1M1AD 3O62D 4J8UD 1AOIB 1F66C 4KUDA 1P3AD 3VH5A 4G91B 4LD9C 5CP6C 1TZYD 3REIA 1AOID 1ZLAC 3MNNC 5B40C 3KWQC 5F99D 2XD5A 5BT1D 5DNMC 3REHA 3X1TB 1EQZB 3MVDA 3AZFB 5B31A 3KUYA 2NZDA 3MGPA 3X1TD 3W98B 4KHAB 3LELC 5AV8A 2IO5B 1P3OC 1BH9B 3AFAC 3W98D 2YFVB 5E5AA 3B6GB 3W99A 3B6GD 3B6FC 5B0ZA 3AZNA 3REJD 3IP4C 1P3LA 2PYOD 5B24B 4ZUXC 3A6NA 1P3GD 5AY8C 2HUEC 2Y2PA 5B24D 5C3IB 5BO0B 3AZGC 4WU8C 5GXQA 3AZMA 3AN2A 3NQUB 1P3KB 3RELB 2FJ7C 4J8WD 1P34B 1H3OB 2FFFB 4E45A 1P3ID 1P3FC 1P34D 5AV5C 1M18B 2NQBB 1P3BA 4J8VB 3AZHB 1HQ3B 4H9RA 2NQBD 5DNNB 4YS3D 1HQ3D 1WWSA 5DNND 2JSSA 1HTAA 4WZSB 5BNXB 1ID3C 3LZ0C 3WKJC 2JCHA 3AV1A 5CPJD 5AV9A 3KXBD 4H9NB 2AROC 3AZKB 1WWIA 2HIOA 1U35C 4WU9B 4QLCC 5AV6C 3LZ1C 4KUDB 3WA9A 4YM6B 5B33C 1P3MA 4H9SC 4J8UC 3R45B 3REIB 1M1AC 3WTPB 4WV4B 1Q9CA 1P3AC 4KUDD 4KGCA 1TZYC 2F8NG 1AOIC 4G92C 2Y2JA 3UT9B 2Y2KA 3AZJA 1EQZA 3AZFA 3LELD 3REHB 1PZRA 5BT1C 3MVDB 3F6TA 4NE5A 5B31B 3KUYB 3REHD 3MGPB 4DRBA 2J8PA 5B2IA 3WAAA 5AV8B 5GSUA 5CPKB 3KUYD 3X1TC 3B6FD 4ZBJB 3MGPD 3W99B 4H9PA 3W98C 2IO5C 3W97A 5E5AD 3W99D 2Y2LA 5B0ZB 3AZNB 3X1VA 3B6GC 1P3LB 2F8NA 3A6NB 3AZND 2PYOC 3EPHA 4WJ3C 1P3GC 3A6ND 3AZLA 5B24C 1P3FD 3AZMB 3AN2B 3W96D 4DQYB 5GXQD 4UPKA 5GT0A 3C1CA 3AZHA 3AN2D 3H0MC 3X1UB 3RELC 1P34C 2F8NH 5BNXA 1P3BD 5JA4B 2NQBC 5AVCA 4JJNA 4J8VC 4YS3C 1HQ3C 2AROD 1KX3A 5B31G 5DNNC 3AZKA 3AV1B 5JRGA 5B1LA 5AV9B 4X23A 5AVBB 2HIOB 3KXBC 3AZIA 5AV9D 1S32B 4YM6A 3R45A 3WTPA 3WA9B 4WU9C 4CAYB 1P3MB 3UT9A 3FDDA 3MGRA 4KGCB 3WA9D 3AZEA 1P3MD 4KUDC 4KGCD 3MGSA 3REKA 4XZQA 3AZJB 2ZY3A 3REIC 4WNNA 4NE3A 2W8SA 3AZJD 1EQZD 1Z2CB 3AZFD 5CPKA 2YFWB 3TU4B 4H9QA 3REHC 5B2IB 3WAAB 5GSUB 5DNMA 3MVDC 5BS7A 5B31C 3KUYC 5B2ID 5GSUD 4H9PB 3MGPC 3X1SA 5AV8C 3W97B 4ZBJC 4UUZA 3X1VB 5E5AC 3W99C 2DF4C 3AFAA 3W97D 4Z66A 4H9OB 2F8NB 4XUJA 1A7WA 4HGAB 3X1VD 3UTBA 3AZNC 2F8ND 5B0YA 4EO5B 2VQRA 3AZLB 3A6NC 3H0RC 4ZUXA 5B1MA 1P3KD 3LJAA 3RELD 3X1UA 3W96C 5GT0B 3C1CB 2L5AA 5GXQC 1M18D 3AN2C 4J8VD 5GT0D 4Z5TA 5JA4A 5KDMA 5B32A 3EPLA 3UTAA 3AZHD 2RVQC 1BFMA 5AVCB 4JJNB 1P3BC 2Y2HA 4R8PA 4J8XA 1KX3B 2Y2QA 3EPJA 5AVBA 5AVCD 5B2JA 1P3PA 5JRGB 1S32A 5B1LB 3AZKD 4AWLB 3MGQA 4X23B 5JRGD 4CSRA 3AZIB 5B1LD 3VH6T 3AV1C 4WU9D 1N1JA 4X23D 5AV9C 4CAYA 2HIOC 1R4VA 4YM6D 3REID 3WTPD 3VH6W 3MGRB 3EG5B 4G91C 1B6WA 4QLCA 3AZEB 3UT9D 3WA9C 5AV6A 3C1BA 3MGSB 1P3MC 3REKB 4XZQB 3O62A 4LD9B 4WNNB 1M19A 4KGCC 2YFWA 3MGSD 3TU4A 3REKD 4XZQD 3MVDD 5B31D 2Y2NA 3AZJC 1EQZC 4H9QB 3AZFC 5F99A 5AV8D 5DNMB 5CPKD 3X1SB 3WAAC 5B2IC 5GSUC 4M6BA 4H9OA 1P3OB 5B0ZD 2F2AC 4UUZB 3X1SD 1KX5A 3AFAB 1P3LD 4Z66B 3A1IA 4XUJB 3AYWA 3W97C 3UTBB 4Z66D 3X1VC 4XUJD
chains in the Genus database with same CATH topology
5B0YB 2CV5A 5C3IC 2XD1A 1ULYA 3REJA 2Y2IA 4ZUXB 3AZMD 2ZY2A 5B1MB 5B0YD 3AL0C 3LJAB 5AY8B 2ZM5A 1P3KC 1W2EA 2RVQD 5B1MD 3LJAD 5CPIA 4WU8B 3X1UD 4Z5TB 5KDMB 5B32B 1M18C 3UTAB 5GT0C 3AV2A 3AZHC 5GT3A 2BYKA 4J8WA 4Z5TD 5B32D 3UTAD 4R8PB 1P3IA 4J8XB 1KX4A 3AV1D 5B2JB 3VH5T 4R8PD 1P3PB 4J8XD 1KU5A 5AVCC 5AVBD 3MGQB 5B2JD 4YS3A 1P3PD 2HIOD 4CSRB 3WKJB 3LZ0B 3AZKC 4NFTA 1S32D 5JRGC 1N1JB 2G5IC 5B1LC 3VH5W 4AWLC 4X23C 5CPJA 2BYMA 1U35B 2CWEA 1F66A 4YM6C 3WTPE 2ZY5A 4QLCB 3WTPC 5CP6A 4LD9A 1ZLAA 1BH8A 5AV6B 5B40A 3MNNA 3LZ1B 3KWQA 3C1BB 3UT9C 3O62B 1M19B 1P3AB 3C1BD 4E44A 3AZEC 4G92B 2JE5A 3MGSC 1M19D 3REKC 4XZQC 3B0BA 3B0CT 3TU4D 3NQJA 3WAAD 5B32G 5F99B 3LELA 5CPKC 1P3OA 3B0CW 5BS7C 1KX5B 3B6FA 5B0ZC 3X1SC 3AYWB 1P3LC 1KX5D 3AYWD 2NZDB 1TAFB 2CV5B 5AY8A 4Z66C 3AZLD 4XUJC 3REJB 3UTBC 3AZGA 2PYOB 2NZDD 2CV5D 4WU8A 3AZMC 5B0YC 1P3GB 3C1CD 2FJ7A 5CPIB 3P5JB 5B1MC 3LJAC 1P3FA 5CPID 5AV5A 3X1UC 3AV2B 3W96A 2BYKB 5GT3B 4J8WB 4JJND 3V9RA 3AV2D 4Z5TC 5B32C 5GT3D 1P3IB 1KX3D 3UTAC 5BNVA 1KX4B 5G49A 1ID3A 3WKJA 3LZ0A 4R8PC 1KX4D 4J8XC 3A1KA 4YS3B 3AZID 3B0DB 1T3UA 5AVBC 5B2JC 1P3PC 2AROA 1S32C 3MGQC 1JFIB 5CPJB 1U35A 5CHLB 3KXBB 2BYMB 5FUGA 1F66B 3LZ1A 3MGRD 5B33A 1M1AA 4H9SA 4J8UA 3AZED 5CP6B 2RIQA 1ZLAB 1BH8B 1P3AA 1F66D 5B40B 3MNNB 1TZYA 3KWQB 1AOIA 3H0LC 4LD9D 5CP6D 1ZLAD 1B67A 5B40D 3MNND 3KWQD 3C1BC 3O62C 2LY8A 3NQJB 1M19C 3VH6A 3TU4C 5DNMD 2G5HC 3LELB 3X1TA 5F99C 1P3OD 4KHAA 2DQNC 3W98A 3AFAD 1BH9A 3B6FB 1TAFA 2YFVA 4Z2MG 3B6GA 3UTBD 4HGAC 1KX5C 2PYOA 2Y2OA 5E5AB 2HUEB 3AYWC 1P3GA 4EO5C 4ZUXD 2Y2MA 3AZLC 3AZGB 5AY8D 5B24A 2NZDC 2CV5C 2UWXA 3AZGD 2F8NK 2FJ7B 3REJC 3C1CC 5BO0A 4WU8D 4NE6A 1P3FB 2FJ7D 5AV5B 3NQUA 1P3KA 3RELA 3W96B 5CPIC 1P34A 1H3OA 5GXQB 5AV5D 3V9RB 4JJNC 1M18A 2NQBA 5BNVB 3AV2C 5GT3C 4J8VA 1KX3C 5G49B 1HQ3A 4J8WC 1ID3B 5DNNA 3MGQD 1P3IC 1P3BB 1ID3D 3WKJD 4H9RB 3LZ0D 1KX4C 1JFIA 2AROB 2ZY4A 3AZIC 3KXBA 2Y2GA 3EPKA 3KFUG 3B0DC 4H9NA 5FUGB 1U35D 1F1EA 5CPJC 4QLCD 5B33B 3KSYA 4DRAA 3MGRC 4Z2MH 4J8UB 4WU9A 1M1AB 2BG1A 5AV6D 3LZ1D 1TZYB 5B33D 1M1AD 3O62D 4J8UD 1AOIB 1F66C 4KUDA 1P3AD 3VH5A 4G91B 4LD9C 5CP6C 1TZYD 3REIA 1AOID 1ZLAC 3MNNC 5B40C 3KWQC 5F99D 2XD5A 5BT1D 5DNMC 3REHA 3X1TB 1EQZB 3MVDA 3AZFB 5B31A 3KUYA 2NZDA 3MGPA 3X1TD 3W98B 4KHAB 3LELC 5AV8A 2IO5B 1P3OC 1BH9B 3AFAC 3W98D 2YFVB 5E5AA 3B6GB 3W99A 3B6GD 3B6FC 5B0ZA 3AZNA 3REJD 3IP4C 1P3LA 2PYOD 5B24B 4ZUXC 3A6NA 1P3GD 5AY8C 2HUEC 2Y2PA 5B24D 5C3IB 5BO0B 3AZGC 4WU8C 5GXQA 3AZMA 3AN2A 3NQUB 1P3KB 3RELB 2FJ7C 4J8WD 1P34B 1H3OB 2FFFB 4E45A 1P3ID 1P3FC 1P34D 5AV5C 1M18B 2NQBB 1P3BA 4J8VB 3AZHB 1HQ3B 4H9RA 2NQBD 5DNNB 4YS3D 1HQ3D 1WWSA 5DNND 2JSSA 1HTAA 4WZSB 5BNXB 1ID3C 3LZ0C 3WKJC 2JCHA 3AV1A 5CPJD 5AV9A 3KXBD 4H9NB 2AROC 3AZKB 1WWIA 2HIOA 1U35C 4WU9B 4QLCC 5AV6C 3LZ1C 4KUDB 3WA9A 4YM6B 5B33C 1P3MA 4H9SC 4J8UC 3R45B 3REIB 1M1AC 3WTPB 4WV4B 1Q9CA 1P3AC 4KUDD 4KGCA 1TZYC 2F8NG 1AOIC 4G92C 2Y2JA 3UT9B 2Y2KA 3AZJA 1EQZA 3AZFA 3LELD 3REHB 1PZRA 5BT1C 3MVDB 3F6TA 4NE5A 5B31B 3KUYB 3REHD 3MGPB 4DRBA 2J8PA 5B2IA 3WAAA 5AV8B 5GSUA 5CPKB 3KUYD 3X1TC 3B6FD 4ZBJB 3MGPD 3W99B 4H9PA 3W98C 2IO5C 3W97A 5E5AD 3W99D 2Y2LA 5B0ZB 3AZNB 3X1VA 3B6GC 1P3LB 2F8NA 3A6NB 3AZND 2PYOC 3EPHA 4WJ3C 1P3GC 3A6ND 3AZLA 5B24C 1P3FD 3AZMB 3AN2B 3W96D 4DQYB 5GXQD 4UPKA 5GT0A 3C1CA 3AZHA 3AN2D 3H0MC 3X1UB 3RELC 1P34C 2F8NH 5BNXA 1P3BD 5JA4B 2NQBC 5AVCA 4JJNA 4J8VC 4YS3C 1HQ3C 2AROD 1KX3A 5B31G 5DNNC 3AZKA 3AV1B 5JRGA 5B1LA 5AV9B 4X23A 5AVBB 2HIOB 3KXBC 3AZIA 5AV9D 1S32B 4YM6A 3R45A 3WTPA 3WA9B 4WU9C 4CAYB 1P3MB 3UT9A 3FDDA 3MGRA 4KGCB 3WA9D 3AZEA 1P3MD 4KUDC 4KGCD 3MGSA 3REKA 4XZQA 3AZJB 2ZY3A 3REIC 4WNNA 4NE3A 2W8SA 3AZJD 1EQZD 1Z2CB 3AZFD 5CPKA 2YFWB 3TU4B 4H9QA 3REHC 5B2IB 3WAAB 5GSUB 5DNMA 3MVDC 5BS7A 5B31C 3KUYC 5B2ID 5GSUD 4H9PB 3MGPC 3X1SA 5AV8C 3W97B 4ZBJC 4UUZA 3X1VB 5E5AC 3W99C 2DF4C 3AFAA 3W97D 4Z66A 4H9OB 2F8NB 4XUJA 1A7WA 4HGAB 3X1VD 3UTBA 3AZNC 2F8ND 5B0YA 4EO5B 2VQRA 3AZLB 3A6NC 3H0RC 4ZUXA 5B1MA 1P3KD 3LJAA 3RELD 3X1UA 3W96C 5GT0B 3C1CB 2L5AA 5GXQC 1M18D 3AN2C 4J8VD 5GT0D 4Z5TA 5JA4A 5KDMA 5B32A 3EPLA 3UTAA 3AZHD 2RVQC 1BFMA 5AVCB 4JJNB 1P3BC 2Y2HA 4R8PA 4J8XA 1KX3B 2Y2QA 3EPJA 5AVBA 5AVCD 5B2JA 1P3PA 5JRGB 1S32A 5B1LB 3AZKD 4AWLB 3MGQA 4X23B 5JRGD 4CSRA 3AZIB 5B1LD 3VH6T 3AV1C 4WU9D 1N1JA 4X23D 5AV9C 4CAYA 2HIOC 1R4VA 4YM6D 3REID 3WTPD 3VH6W 3MGRB 3EG5B 4G91C 1B6WA 4QLCA 3AZEB 3UT9D 3WA9C 5AV6A 3C1BA 3MGSB 1P3MC 3REKB 4XZQB 3O62A 4LD9B 4WNNB 1M19A 4KGCC 2YFWA 3MGSD 3TU4A 3REKD 4XZQD 3MVDD 5B31D 2Y2NA 3AZJC 1EQZC 4H9QB 3AZFC 5F99A 5AV8D 5DNMB 5CPKD 3X1SB 3WAAC 5B2IC 5GSUC 4M6BA 4H9OA 1P3OB 5B0ZD 2F2AC 4UUZB 3X1SD 1KX5A 3AFAB 1P3LD 4Z66B 3A1IA 4XUJB 3AYWA 3W97C 3UTBB 4Z66D 3X1VC 4XUJD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5B0Y B;  2CV5 A;  5C3I C;  1ULY A;  3REJ A;  4ZUX B;  3AZM D;  5B1M B;  5B0Y D;  3LJA B;  5AY8 B;  1P3K C;  2RVQ D;  5B1M D;  3LJA D;  5CPI A;  4WU8 B;  3X1U D;  4Z5T B;  5KDM B;  5B32 B;  1M18 C;  3UTA B;  5GT0 C;  3AV2 A;  3AZH C;  5GT3 A;  2BYK A;  4J8W A;  4Z5T D;  5B32 D;  3UTA D;  4R8P B;  1P3I A;  4J8X B;  1KX4 A;  3AV1 D;  5B2J B;  3VH5 T;  4R8P D;  1P3P B;  4J8X D;  1KU5 A;  5AVC C;  5AVB D;  3MGQ B;  5B2J D;  4YS3 A;  1P3P D;  2HIO D;  4CSR B;  3WKJ B;  3LZ0 B;  3AZK C;  4NFT A;  1S32 D;  5JRG C;  1N1J B;  5B1L C;  3VH5 W;  4AWL C;  4X23 C;  5CPJ A;  2BYM A;  1U35 B;  2CWE A;  1F66 A;  4YM6 C;  3WTP E;  4QLC B;  3WTP C;  4LD9 A;  5CP6 A;  1ZLA A;  1BH8 A;  5AV6 B;  5B40 A;  3MNN A;  3LZ1 B;  3KWQ A;  3C1B B;  3UT9 C;  3O62 B;  1M19 B;  1P3A B;  3C1B D;  4E44 A;  3AZE C;  4G92 B;  3MGS C;  1M19 D;  3REK C;  4XZQ C;  3B0B A;  3B0C T;  3TU4 D;  3NQJ A;  3WAA D;  5B32 G;  5F99 B;  3LEL A;  5CPK C;  1P3O A;  3B0C W;  5BS7 C;  1KX5 B;  3B6F A;  5B0Z C;  3X1S C;  3AYW B;  1P3L C;  1KX5 D;  3AYW D;  2NZD B;  1TAF B;  2CV5 B;  5AY8 A;  4Z66 C;  3AZL D;  4XUJ C;  3REJ B;  3UTB C;  3AZG A;  2PYO B;  2NZD D;  2CV5 D;  4WU8 A;  3AZM C;  5B0Y C;  1P3G B;  3C1C D;  2FJ7 A;  5CPI B;  5B1M C;  3LJA C;  1P3F A;  5CPI D;  5AV5 A;  3X1U C;  3AV2 B;  3W96 A;  2BYK B;  5GT3 B;  4J8W B;  4JJN D;  3V9R A;  3AV2 D;  4Z5T C;  5B32 C;  5GT3 D;  1P3I B;  1KX3 D;  3UTA C;  5BNV A;  1KX4 B;  5G49 A;  1ID3 A;  3WKJ A;  3LZ0 A;  4R8P C;  1KX4 D;  4J8X C;  4YS3 B;  3AZI D;  3B0D B;  5AVB C;  1P3P C;  5B2J C;  2ARO A;  1S32 C;  3MGQ C;  1JFI B;  5CPJ B;  1U35 A;  5CHL B;  3KXB B;  2BYM B;  5FUG A;  1F66 B;  3LZ1 A;  3MGR D;  5B33 A;  1M1A A;  4H9S A;  4J8U A;  3AZE D;  5CP6 B;  1ZLA B;  1BH8 B;  1P3A A;  1F66 D;  5B40 B;  3MNN B;  1TZY A;  3KWQ B;  1AOI A;  4LD9 D;  5CP6 D;  1ZLA D;  1B67 A;  5B40 D;  3MNN D;  3KWQ D;  3C1B C;  3O62 C;  2LY8 A;  3NQJ B;  1M19 C;  3VH6 A;  3TU4 C;  5DNM D;  3LEL B;  3X1T A;  5F99 C;  1P3O D;  4KHA A;  3W98 A;  3AFA D;  1BH9 A;  3B6F B;  1TAF A;  2YFV A;  4Z2M G;  3B6G A;  3UTB D;  4HGA C;  1KX5 C;  2PYO A;  5E5A B;  2HUE B;  3AYW C;  1P3G A;  4EO5 C;  4ZUX D;  3AZL C;  3AZG B;  5AY8 D;  5B24 A;  2NZD C;  2CV5 C;  3AZG D;  2F8N K;  2FJ7 B;  3REJ C;  3C1C C;  5BO0 A;  4WU8 D;  4NE6 A;  1P3F B;  2FJ7 D;  5AV5 B;  3NQU A;  1P3K A;  3REL A;  3W96 B;  5CPI C;  1P34 A;  1H3O A;  5GXQ B;  5AV5 D;  3V9R B;  4JJN C;  1M18 A;  2NQB A;  5BNV B;  3AV2 C;  5GT3 C;  4J8V A;  1KX3 C;  5G49 B;  1HQ3 A;  4J8W C;  1ID3 B;  5DNN A;  3MGQ D;  1P3I C;  1P3B B;  1ID3 D;  3WKJ D;  4H9R B;  3LZ0 D;  1KX4 C;  1JFI A;  2ARO B;  3AZI C;  3KXB A;  3B0D C;  4H9N A;  5FUG B;  1U35 D;  1F1E A;  5CPJ C;  4QLC D;  5B33 B;  3KSY A;  4DRA A;  3MGR C;  4Z2M H;  4J8U B;  4WU9 A;  1M1A B;  5AV6 D;  3LZ1 D;  1TZY B;  5B33 D;  1M1A D;  3O62 D;  4J8U D;  1AOI B;  1F66 C;  4KUD A;  1P3A D;  3VH5 A;  4G91 B;  4LD9 C;  5CP6 C;  1TZY D;  3REI A;  1AOI D;  1ZLA C;  3MNN C;  5B40 C;  3KWQ C;  5F99 D;  5BT1 D;  5DNM C;  3REH A;  3X1T B;  1EQZ B;  3MVD A;  3AZF B;  5B31 A;  3KUY A;  2NZD A;  3MGP A;  3X1T D;  3W98 B;  4KHA B;  3LEL C;  5AV8 A;  2IO5 B;  1P3O C;  1BH9 B;  3AFA C;  3W98 D;  2YFV B;  5E5A A;  3B6G B;  3W99 A;  3B6G D;  3B6F C;  5B0Z A;  3AZN A;  3REJ D;  1P3L A;  2PYO D;  5B24 B;  4ZUX C;  3A6N A;  1P3G D;  5AY8 C;  2HUE C;  5B24 D;  5C3I B;  5BO0 B;  3AZG C;  4WU8 C;  5GXQ A;  3AZM A;  3AN2 A;  3NQU B;  1P3K B;  3REL B;  2FJ7 C;  4J8W D;  1P34 B;  1H3O B;  4E45 A;  1P3I D;  1P3F C;  1P34 D;  5AV5 C;  1M18 B;  2NQB B;  1P3B A;  4J8V B;  3AZH B;  1HQ3 B;  4H9R A;  2NQB D;  5DNN B;  4YS3 D;  1HQ3 D;  1WWS A;  5DNN D;  2JSS A;  1HTA A;  4WZS B;  5BNX B;  1ID3 C;  3LZ0 C;  3WKJ C;  3AV1 A;  5CPJ D;  5AV9 A;  3KXB D;  4H9N B;  2ARO C;  3AZK B;  1WWI A;  2HIO A;  1U35 C;  4WU9 B;  4QLC C;  5AV6 C;  3LZ1 C;  4KUD B;  3WA9 A;  4YM6 B;  5B33 C;  1P3M A;  4H9S C;  4J8U C;  3R45 B;  3REI B;  1M1A C;  3WTP B;  4WV4 B;  1Q9C A;  1P3A C;  4KUD D;  4KGC A;  1TZY C;  2F8N G;  1AOI C;  4G92 C;  3UT9 B;  3AZJ A;  1EQZ A;  3AZF A;  3LEL D;  3REH B;  5BT1 C;  3MVD B;  4NE5 A;  5B31 B;  3KUY B;  3REH D;  3MGP B;  4DRB A;  3WAA A;  5B2I A;  5AV8 B;  5GSU A;  5CPK B;  3KUY D;  3X1T C;  3B6F D;  4ZBJ B;  3MGP D;  3W99 B;  4H9P A;  3W98 C;  2IO5 C;  3W97 A;  5E5A D;  3W99 D;  5B0Z B;  3AZN B;  3X1V A;  3B6G C;  1P3L B;  2F8N A;  3A6N B;  3AZN D;  2PYO C;  1P3G C;  3A6N D;  3AZL A;  5B24 C;  1P3F D;  3AZM B;  3AN2 B;  3W96 D;  5GXQ D;  5GT0 A;  3C1C A;  3AZH A;  3AN2 D;  3X1U B;  3REL C;  1P34 C;  2F8N H;  5BNX A;  1P3B D;  5JA4 B;  2NQB C;  5AVC A;  4JJN A;  4J8V C;  4YS3 C;  1HQ3 C;  2ARO D;  1KX3 A;  5B31 G;  5DNN C;  3AZK A;  3AV1 B;  5JRG A;  5B1L A;  5AV9 B;  4X23 A;  5AVB B;  2HIO B;  3KXB C;  3AZI A;  5AV9 D;  1S32 B;  4YM6 A;  3R45 A;  3WTP A;  3WA9 B;  4WU9 C;  4CAY B;  1P3M B;  3UT9 A;  3MGR A;  4KGC B;  3WA9 D;  3AZE A;  1P3M D;  4KUD C;  4KGC D;  3MGS A;  3REK A;  4XZQ A;  3AZJ B;  3REI C;  4WNN A;  4NE3 A;  3AZJ D;  1EQZ D;  3AZF D;  5CPK A;  2YFW B;  3TU4 B;  4H9Q A;  3REH C;  5B2I B;  3WAA B;  5GSU B;  5DNM A;  3MVD C;  5BS7 A;  5B31 C;  3KUY C;  5B2I D;  5GSU D;  4H9P B;  3MGP C;  3X1S A;  5AV8 C;  3W97 B;  4ZBJ C;  4UUZ A;  3X1V B;  5E5A C;  3W99 C;  3AFA A;  3W97 D;  4Z66 A;  4H9O B;  2F8N B;  4XUJ A;  1A7W A;  4HGA B;  3X1V D;  3UTB A;  3AZN C;  2F8N D;  5B0Y A;  4EO5 B;  3AZL B;  3A6N C;  4ZUX A;  5B1M A;  1P3K D;  3LJA A;  3REL D;  3X1U A;  3W96 C;  5GT0 B;  3C1C B;  2L5A A;  5GXQ C;  1M18 D;  3AN2 C;  4J8V D;  5GT0 D;  4Z5T A;  5JA4 A;  5KDM A;  5B32 A;  3AZH D;  3UTA A;  2RVQ C;  1BFM A;  5AVC B;  4JJN B;  1P3B C;  4R8P A;  4J8X A;  1KX3 B;  5AVB A;  5AVC D;  5B2J A;  1P3P A;  5JRG B;  1S32 A;  5B1L B;  3AZK D;  4AWL B;  3MGQ A;  4X23 B;  5JRG D;  4CSR A;  3AZI B;  5B1L D;  3VH6 T;  3AV1 C;  4WU9 D;  1N1J A;  4X23 D;  5AV9 C;  4CAY A;  2HIO C;  1R4V A;  4YM6 D;  3REI D;  3WTP D;  3VH6 W;  3MGR B;  4G91 C;  1B6W A;  4QLC A;  3AZE B;  3UT9 D;  3WA9 C;  5AV6 A;  3C1B A;  3MGS B;  1P3M C;  3REK B;  4XZQ B;  3O62 A;  4LD9 B;  4WNN B;  1M19 A;  4KGC C;  2YFW A;  3MGS D;  3TU4 A;  3REK D;  4XZQ D;  3MVD D;  5B31 D;  3AZJ C;  1EQZ C;  4H9Q B;  3AZF C;  5F99 A;  5AV8 D;  5DNM B;  5CPK D;  3X1S B;  3WAA C;  5B2I C;  5GSU C;  4M6B A;  4H9O A;  1P3O B;  5B0Z D;  4UUZ B;  3X1S D;  1KX5 A;  3AFA B;  1P3L D;  4Z66 B;  4XUJ B;  3AYW A;  3W97 C;  3UTB B;  4Z66 D;  3X1V C;  4XUJ D; 
#chains in the Genus database with same CATH topology
 5B0Y B;  2CV5 A;  5C3I C;  2XD1 A;  1ULY A;  3REJ A;  2Y2I A;  4ZUX B;  3AZM D;  2ZY2 A;  5B1M B;  5B0Y D;  3AL0 C;  3LJA B;  5AY8 B;  2ZM5 A;  1P3K C;  1W2E A;  2RVQ D;  5B1M D;  3LJA D;  5CPI A;  4WU8 B;  3X1U D;  4Z5T B;  5KDM B;  5B32 B;  1M18 C;  3UTA B;  5GT0 C;  3AV2 A;  3AZH C;  5GT3 A;  2BYK A;  4J8W A;  4Z5T D;  5B32 D;  3UTA D;  4R8P B;  1P3I A;  4J8X B;  1KX4 A;  3AV1 D;  5B2J B;  3VH5 T;  4R8P D;  1P3P B;  4J8X D;  1KU5 A;  5AVC C;  5AVB D;  3MGQ B;  5B2J D;  4YS3 A;  1P3P D;  2HIO D;  4CSR B;  3WKJ B;  3LZ0 B;  3AZK C;  4NFT A;  1S32 D;  5JRG C;  1N1J B;  2G5I C;  5B1L C;  3VH5 W;  4AWL C;  4X23 C;  5CPJ A;  2BYM A;  1U35 B;  2CWE A;  1F66 A;  4YM6 C;  3WTP E;  2ZY5 A;  4QLC B;  3WTP C;  5CP6 A;  4LD9 A;  1ZLA A;  1BH8 A;  5AV6 B;  5B40 A;  3MNN A;  3LZ1 B;  3KWQ A;  3C1B B;  3UT9 C;  3O62 B;  1M19 B;  1P3A B;  3C1B D;  4E44 A;  3AZE C;  4G92 B;  2JE5 A;  3MGS C;  1M19 D;  3REK C;  4XZQ C;  3B0B A;  3B0C T;  3TU4 D;  3NQJ A;  3WAA D;  5B32 G;  5F99 B;  3LEL A;  5CPK C;  1P3O A;  3B0C W;  5BS7 C;  1KX5 B;  3B6F A;  5B0Z C;  3X1S C;  3AYW B;  1P3L C;  1KX5 D;  3AYW D;  2NZD B;  1TAF B;  2CV5 B;  5AY8 A;  4Z66 C;  3AZL D;  4XUJ C;  3REJ B;  3UTB C;  3AZG A;  2PYO B;  2NZD D;  2CV5 D;  4WU8 A;  3AZM C;  5B0Y C;  1P3G B;  3C1C D;  2FJ7 A;  5CPI B;  3P5J B;  5B1M C;  3LJA C;  1P3F A;  5CPI D;  5AV5 A;  3X1U C;  3AV2 B;  3W96 A;  2BYK B;  5GT3 B;  4J8W B;  4JJN D;  3V9R A;  3AV2 D;  4Z5T C;  5B32 C;  5GT3 D;  1P3I B;  1KX3 D;  3UTA C;  5BNV A;  1KX4 B;  5G49 A;  1ID3 A;  3WKJ A;  3LZ0 A;  4R8P C;  1KX4 D;  4J8X C;  3A1K A;  4YS3 B;  3AZI D;  3B0D B;  1T3U A;  5AVB C;  5B2J C;  1P3P C;  2ARO A;  1S32 C;  3MGQ C;  1JFI B;  5CPJ B;  1U35 A;  5CHL B;  3KXB B;  2BYM B;  5FUG A;  1F66 B;  3LZ1 A;  3MGR D;  5B33 A;  1M1A A;  4H9S A;  4J8U A;  3AZE D;  5CP6 B;  2RIQ A;  1ZLA B;  1BH8 B;  1P3A A;  1F66 D;  5B40 B;  3MNN B;  1TZY A;  3KWQ B;  1AOI A;  3H0L C;  4LD9 D;  5CP6 D;  1ZLA D;  1B67 A;  5B40 D;  3MNN D;  3KWQ D;  3C1B C;  3O62 C;  2LY8 A;  3NQJ B;  1M19 C;  3VH6 A;  3TU4 C;  5DNM D;  2G5H C;  3LEL B;  3X1T A;  5F99 C;  1P3O D;  4KHA A;  2DQN C;  3W98 A;  3AFA D;  1BH9 A;  3B6F B;  1TAF A;  2YFV A;  4Z2M G;  3B6G A;  3UTB D;  4HGA C;  1KX5 C;  2PYO A;  2Y2O A;  5E5A B;  2HUE B;  3AYW C;  1P3G A;  4EO5 C;  4ZUX D;  2Y2M A;  3AZL C;  3AZG B;  5AY8 D;  5B24 A;  2NZD C;  2CV5 C;  2UWX A;  3AZG D;  2F8N K;  2FJ7 B;  3REJ C;  3C1C C;  5BO0 A;  4WU8 D;  4NE6 A;  1P3F B;  2FJ7 D;  5AV5 B;  3NQU A;  1P3K A;  3REL A;  3W96 B;  5CPI C;  1P34 A;  1H3O A;  5GXQ B;  5AV5 D;  3V9R B;  4JJN C;  1M18 A;  2NQB A;  5BNV B;  3AV2 C;  5GT3 C;  4J8V A;  1KX3 C;  5G49 B;  1HQ3 A;  4J8W C;  1ID3 B;  5DNN A;  3MGQ D;  1P3I C;  1P3B B;  1ID3 D;  3WKJ D;  4H9R B;  3LZ0 D;  1KX4 C;  1JFI A;  2ARO B;  2ZY4 A;  3AZI C;  3KXB A;  2Y2G A;  3EPK A;  3KFU G;  3B0D C;  4H9N A;  5FUG B;  1U35 D;  1F1E A;  5CPJ C;  4QLC D;  5B33 B;  3KSY A;  4DRA A;  3MGR C;  4Z2M H;  4J8U B;  4WU9 A;  1M1A B;  2BG1 A;  5AV6 D;  3LZ1 D;  1TZY B;  5B33 D;  1M1A D;  3O62 D;  4J8U D;  1AOI B;  1F66 C;  4KUD A;  1P3A D;  3VH5 A;  4G91 B;  4LD9 C;  5CP6 C;  1TZY D;  3REI A;  1AOI D;  1ZLA C;  3MNN C;  5B40 C;  3KWQ C;  5F99 D;  2XD5 A;  5BT1 D;  5DNM C;  3REH A;  3X1T B;  1EQZ B;  3MVD A;  3AZF B;  5B31 A;  3KUY A;  2NZD A;  3MGP A;  3X1T D;  3W98 B;  4KHA B;  3LEL C;  5AV8 A;  2IO5 B;  1P3O C;  1BH9 B;  3AFA C;  3W98 D;  2YFV B;  5E5A A;  3B6G B;  3W99 A;  3B6G D;  3B6F C;  5B0Z A;  3AZN A;  3REJ D;  3IP4 C;  1P3L A;  2PYO D;  5B24 B;  4ZUX C;  3A6N A;  1P3G D;  5AY8 C;  2HUE C;  2Y2P A;  5B24 D;  5C3I B;  5BO0 B;  3AZG C;  4WU8 C;  5GXQ A;  3AZM A;  3AN2 A;  3NQU B;  1P3K B;  3REL B;  2FJ7 C;  4J8W D;  1P34 B;  1H3O B;  2FFF B;  4E45 A;  1P3I D;  1P3F C;  1P34 D;  5AV5 C;  1M18 B;  2NQB B;  1P3B A;  4J8V B;  3AZH B;  1HQ3 B;  4H9R A;  2NQB D;  5DNN B;  4YS3 D;  1HQ3 D;  1WWS A;  5DNN D;  2JSS A;  1HTA A;  4WZS B;  5BNX B;  1ID3 C;  3LZ0 C;  3WKJ C;  2JCH A;  3AV1 A;  5CPJ D;  5AV9 A;  3KXB D;  4H9N B;  2ARO C;  3AZK B;  1WWI A;  2HIO A;  1U35 C;  4WU9 B;  4QLC C;  5AV6 C;  3LZ1 C;  4KUD B;  3WA9 A;  4YM6 B;  5B33 C;  1P3M A;  4H9S C;  4J8U C;  3R45 B;  3REI B;  1M1A C;  3WTP B;  4WV4 B;  1Q9C A;  1P3A C;  4KUD D;  4KGC A;  1TZY C;  2F8N G;  1AOI C;  4G92 C;  2Y2J A;  3UT9 B;  2Y2K A;  3AZJ A;  1EQZ A;  3AZF A;  3LEL D;  3REH B;  1PZR A;  5BT1 C;  3MVD B;  3F6T A;  4NE5 A;  5B31 B;  3KUY B;  3REH D;  3MGP B;  4DRB A;  2J8P A;  5B2I A;  3WAA A;  5AV8 B;  5GSU A;  5CPK B;  3KUY D;  3X1T C;  3B6F D;  4ZBJ B;  3MGP D;  3W99 B;  4H9P A;  3W98 C;  2IO5 C;  3W97 A;  5E5A D;  3W99 D;  2Y2L A;  5B0Z B;  3AZN B;  3X1V A;  3B6G C;  1P3L B;  2F8N A;  3A6N B;  3AZN D;  2PYO C;  3EPH A;  4WJ3 C;  1P3G C;  3A6N D;  3AZL A;  5B24 C;  1P3F D;  3AZM B;  3AN2 B;  3W96 D;  4DQY B;  5GXQ D;  4UPK A;  5GT0 A;  3C1C A;  3AZH A;  3AN2 D;  3H0M C;  3X1U B;  3REL C;  1P34 C;  2F8N H;  5BNX A;  1P3B D;  5JA4 B;  2NQB C;  5AVC A;  4JJN A;  4J8V C;  4YS3 C;  1HQ3 C;  2ARO D;  1KX3 A;  5B31 G;  5DNN C;  3AZK A;  3AV1 B;  5JRG A;  5B1L A;  5AV9 B;  4X23 A;  5AVB B;  2HIO B;  3KXB C;  3AZI A;  5AV9 D;  1S32 B;  4YM6 A;  3R45 A;  3WTP A;  3WA9 B;  4WU9 C;  4CAY B;  1P3M B;  3UT9 A;  3FDD A;  3MGR A;  4KGC B;  3WA9 D;  3AZE A;  1P3M D;  4KUD C;  4KGC D;  3MGS A;  3REK A;  4XZQ A;  3AZJ B;  2ZY3 A;  3REI C;  4WNN A;  4NE3 A;  2W8S A;  3AZJ D;  1EQZ D;  1Z2C B;  3AZF D;  5CPK A;  2YFW B;  3TU4 B;  4H9Q A;  3REH C;  5B2I B;  3WAA B;  5GSU B;  5DNM A;  3MVD C;  5BS7 A;  5B31 C;  3KUY C;  5B2I D;  5GSU D;  4H9P B;  3MGP C;  3X1S A;  5AV8 C;  3W97 B;  4ZBJ C;  4UUZ A;  3X1V B;  5E5A C;  3W99 C;  2DF4 C;  3AFA A;  3W97 D;  4Z66 A;  4H9O B;  2F8N B;  4XUJ A;  1A7W A;  4HGA B;  3X1V D;  3UTB A;  3AZN C;  2F8N D;  5B0Y A;  4EO5 B;  2VQR A;  3AZL B;  3A6N C;  3H0R C;  4ZUX A;  5B1M A;  1P3K D;  3LJA A;  3REL D;  3X1U A;  3W96 C;  5GT0 B;  3C1C B;  2L5A A;  5GXQ C;  1M18 D;  3AN2 C;  4J8V D;  5GT0 D;  4Z5T A;  5JA4 A;  5KDM A;  5B32 A;  3EPL A;  3UTA A;  3AZH D;  2RVQ C;  1BFM A;  5AVC B;  4JJN B;  1P3B C;  2Y2H A;  4R8P A;  4J8X A;  1KX3 B;  2Y2Q A;  3EPJ A;  5AVB A;  5AVC D;  5B2J A;  1P3P A;  5JRG B;  1S32 A;  5B1L B;  3AZK D;  4AWL B;  3MGQ A;  4X23 B;  5JRG D;  4CSR A;  3AZI B;  5B1L D;  3VH6 T;  3AV1 C;  4WU9 D;  1N1J A;  4X23 D;  5AV9 C;  4CAY A;  2HIO C;  1R4V A;  4YM6 D;  3REI D;  3WTP D;  3VH6 W;  3MGR B;  3EG5 B;  4G91 C;  1B6W A;  4QLC A;  3AZE B;  3UT9 D;  3WA9 C;  5AV6 A;  3C1B A;  3MGS B;  1P3M C;  3REK B;  4XZQ B;  3O62 A;  4LD9 B;  4WNN B;  1M19 A;  4KGC C;  2YFW A;  3MGS D;  3TU4 A;  3REK D;  4XZQ D;  3MVD D;  5B31 D;  2Y2N A;  3AZJ C;  1EQZ C;  4H9Q B;  3AZF C;  5F99 A;  5AV8 D;  5DNM B;  5CPK D;  3X1S B;  3WAA C;  5B2I C;  5GSU C;  4M6B A;  4H9O A;  1P3O B;  5B0Z D;  2F2A C;  4UUZ B;  3X1S D;  1KX5 A;  3AFA B;  1P3L D;  4Z66 B;  3A1I A;  4XUJ B;  3AYW A;  3W97 C;  3UTB B;  4Z66 D;  3X1V C;  4XUJ D; 
#chains in the Genus database with same CATH homology
 5B0Y B;  2CV5 A;  5C3I C;  2XD1 A;  1ULY A;  3REJ A;  2Y2I A;  4ZUX B;  3AZM D;  2ZY2 A;  5B1M B;  5B0Y D;  3AL0 C;  3LJA B;  5AY8 B;  2ZM5 A;  1P3K C;  1W2E A;  2RVQ D;  5B1M D;  3LJA D;  5CPI A;  4WU8 B;  3X1U D;  4Z5T B;  5KDM B;  5B32 B;  1M18 C;  3UTA B;  5GT0 C;  3AV2 A;  3AZH C;  5GT3 A;  2BYK A;  4J8W A;  4Z5T D;  5B32 D;  3UTA D;  4R8P B;  1P3I A;  4J8X B;  1KX4 A;  3AV1 D;  5B2J B;  3VH5 T;  4R8P D;  1P3P B;  4J8X D;  1KU5 A;  5AVC C;  5AVB D;  3MGQ B;  5B2J D;  4YS3 A;  1P3P D;  2HIO D;  4CSR B;  3WKJ B;  3LZ0 B;  3AZK C;  4NFT A;  1S32 D;  5JRG C;  1N1J B;  2G5I C;  5B1L C;  3VH5 W;  4AWL C;  4X23 C;  5CPJ A;  2BYM A;  1U35 B;  2CWE A;  1F66 A;  4YM6 C;  3WTP E;  2ZY5 A;  4QLC B;  3WTP C;  5CP6 A;  4LD9 A;  1ZLA A;  1BH8 A;  5AV6 B;  5B40 A;  3MNN A;  3LZ1 B;  3KWQ A;  3C1B B;  3UT9 C;  3O62 B;  1M19 B;  1P3A B;  3C1B D;  4E44 A;  3AZE C;  4G92 B;  2JE5 A;  3MGS C;  1M19 D;  3REK C;  4XZQ C;  3B0B A;  3B0C T;  3TU4 D;  3NQJ A;  3WAA D;  5B32 G;  5F99 B;  3LEL A;  5CPK C;  1P3O A;  3B0C W;  5BS7 C;  1KX5 B;  3B6F A;  5B0Z C;  3X1S C;  3AYW B;  1P3L C;  1KX5 D;  3AYW D;  2NZD B;  1TAF B;  2CV5 B;  5AY8 A;  4Z66 C;  3AZL D;  4XUJ C;  3REJ B;  3UTB C;  3AZG A;  2PYO B;  2NZD D;  2CV5 D;  4WU8 A;  3AZM C;  5B0Y C;  1P3G B;  3C1C D;  2FJ7 A;  5CPI B;  3P5J B;  5B1M C;  3LJA C;  1P3F A;  5CPI D;  5AV5 A;  3X1U C;  3AV2 B;  3W96 A;  2BYK B;  5GT3 B;  4J8W B;  4JJN D;  3V9R A;  3AV2 D;  4Z5T C;  5B32 C;  5GT3 D;  1P3I B;  1KX3 D;  3UTA C;  5BNV A;  1KX4 B;  5G49 A;  1ID3 A;  3WKJ A;  3LZ0 A;  4R8P C;  1KX4 D;  4J8X C;  3A1K A;  4YS3 B;  3AZI D;  3B0D B;  1T3U A;  5AVB C;  5B2J C;  1P3P C;  2ARO A;  1S32 C;  3MGQ C;  1JFI B;  5CPJ B;  1U35 A;  5CHL B;  3KXB B;  2BYM B;  5FUG A;  1F66 B;  3LZ1 A;  3MGR D;  5B33 A;  1M1A A;  4H9S A;  4J8U A;  3AZE D;  5CP6 B;  2RIQ A;  1ZLA B;  1BH8 B;  1P3A A;  1F66 D;  5B40 B;  3MNN B;  1TZY A;  3KWQ B;  1AOI A;  3H0L C;  4LD9 D;  5CP6 D;  1ZLA D;  1B67 A;  5B40 D;  3MNN D;  3KWQ D;  3C1B C;  3O62 C;  2LY8 A;  3NQJ B;  1M19 C;  3VH6 A;  3TU4 C;  5DNM D;  2G5H C;  3LEL B;  3X1T A;  5F99 C;  1P3O D;  4KHA A;  2DQN C;  3W98 A;  3AFA D;  1BH9 A;  3B6F B;  1TAF A;  2YFV A;  4Z2M G;  3B6G A;  3UTB D;  4HGA C;  1KX5 C;  2PYO A;  2Y2O A;  5E5A B;  2HUE B;  3AYW C;  1P3G A;  4EO5 C;  4ZUX D;  2Y2M A;  3AZL C;  3AZG B;  5AY8 D;  5B24 A;  2NZD C;  2CV5 C;  2UWX A;  3AZG D;  2F8N K;  2FJ7 B;  3REJ C;  3C1C C;  5BO0 A;  4WU8 D;  4NE6 A;  1P3F B;  2FJ7 D;  5AV5 B;  3NQU A;  1P3K A;  3REL A;  3W96 B;  5CPI C;  1P34 A;  1H3O A;  5GXQ B;  5AV5 D;  3V9R B;  4JJN C;  1M18 A;  2NQB A;  5BNV B;  3AV2 C;  5GT3 C;  4J8V A;  1KX3 C;  5G49 B;  1HQ3 A;  4J8W C;  1ID3 B;  5DNN A;  3MGQ D;  1P3I C;  1P3B B;  1ID3 D;  3WKJ D;  4H9R B;  3LZ0 D;  1KX4 C;  1JFI A;  2ARO B;  2ZY4 A;  3AZI C;  3KXB A;  2Y2G A;  3EPK A;  3KFU G;  3B0D C;  4H9N A;  5FUG B;  1U35 D;  1F1E A;  5CPJ C;  4QLC D;  5B33 B;  3KSY A;  4DRA A;  3MGR C;  4Z2M H;  4J8U B;  4WU9 A;  1M1A B;  2BG1 A;  5AV6 D;  3LZ1 D;  1TZY B;  5B33 D;  1M1A D;  3O62 D;  4J8U D;  1AOI B;  1F66 C;  4KUD A;  1P3A D;  3VH5 A;  4G91 B;  4LD9 C;  5CP6 C;  1TZY D;  3REI A;  1AOI D;  1ZLA C;  3MNN C;  5B40 C;  3KWQ C;  5F99 D;  2XD5 A;  5BT1 D;  5DNM C;  3REH A;  3X1T B;  1EQZ B;  3MVD A;  3AZF B;  5B31 A;  3KUY A;  2NZD A;  3MGP A;  3X1T D;  3W98 B;  4KHA B;  3LEL C;  5AV8 A;  2IO5 B;  1P3O C;  1BH9 B;  3AFA C;  3W98 D;  2YFV B;  5E5A A;  3B6G B;  3W99 A;  3B6G D;  3B6F C;  5B0Z A;  3AZN A;  3REJ D;  3IP4 C;  1P3L A;  2PYO D;  5B24 B;  4ZUX C;  3A6N A;  1P3G D;  5AY8 C;  2HUE C;  2Y2P A;  5B24 D;  5C3I B;  5BO0 B;  3AZG C;  4WU8 C;  5GXQ A;  3AZM A;  3AN2 A;  3NQU B;  1P3K B;  3REL B;  2FJ7 C;  4J8W D;  1P34 B;  1H3O B;  2FFF B;  4E45 A;  1P3I D;  1P3F C;  1P34 D;  5AV5 C;  1M18 B;  2NQB B;  1P3B A;  4J8V B;  3AZH B;  1HQ3 B;  4H9R A;  2NQB D;  5DNN B;  4YS3 D;  1HQ3 D;  1WWS A;  5DNN D;  2JSS A;  1HTA A;  4WZS B;  5BNX B;  1ID3 C;  3LZ0 C;  3WKJ C;  2JCH A;  3AV1 A;  5CPJ D;  5AV9 A;  3KXB D;  4H9N B;  2ARO C;  3AZK B;  1WWI A;  2HIO A;  1U35 C;  4WU9 B;  4QLC C;  5AV6 C;  3LZ1 C;  4KUD B;  3WA9 A;  4YM6 B;  5B33 C;  1P3M A;  4H9S C;  4J8U C;  3R45 B;  3REI B;  1M1A C;  3WTP B;  4WV4 B;  1Q9C A;  1P3A C;  4KUD D;  4KGC A;  1TZY C;  2F8N G;  1AOI C;  4G92 C;  2Y2J A;  3UT9 B;  2Y2K A;  3AZJ A;  1EQZ A;  3AZF A;  3LEL D;  3REH B;  1PZR A;  5BT1 C;  3MVD B;  3F6T A;  4NE5 A;  5B31 B;  3KUY B;  3REH D;  3MGP B;  4DRB A;  2J8P A;  5B2I A;  3WAA A;  5AV8 B;  5GSU A;  5CPK B;  3KUY D;  3X1T C;  3B6F D;  4ZBJ B;  3MGP D;  3W99 B;  4H9P A;  3W98 C;  2IO5 C;  3W97 A;  5E5A D;  3W99 D;  2Y2L A;  5B0Z B;  3AZN B;  3X1V A;  3B6G C;  1P3L B;  2F8N A;  3A6N B;  3AZN D;  2PYO C;  3EPH A;  4WJ3 C;  1P3G C;  3A6N D;  3AZL A;  5B24 C;  1P3F D;  3AZM B;  3AN2 B;  3W96 D;  4DQY B;  5GXQ D;  4UPK A;  5GT0 A;  3C1C A;  3AZH A;  3AN2 D;  3H0M C;  3X1U B;  3REL C;  1P34 C;  2F8N H;  5BNX A;  1P3B D;  5JA4 B;  2NQB C;  5AVC A;  4JJN A;  4J8V C;  4YS3 C;  1HQ3 C;  2ARO D;  1KX3 A;  5B31 G;  5DNN C;  3AZK A;  3AV1 B;  5JRG A;  5B1L A;  5AV9 B;  4X23 A;  5AVB B;  2HIO B;  3KXB C;  3AZI A;  5AV9 D;  1S32 B;  4YM6 A;  3R45 A;  3WTP A;  3WA9 B;  4WU9 C;  4CAY B;  1P3M B;  3UT9 A;  3FDD A;  3MGR A;  4KGC B;  3WA9 D;  3AZE A;  1P3M D;  4KUD C;  4KGC D;  3MGS A;  3REK A;  4XZQ A;  3AZJ B;  2ZY3 A;  3REI C;  4WNN A;  4NE3 A;  2W8S A;  3AZJ D;  1EQZ D;  1Z2C B;  3AZF D;  5CPK A;  2YFW B;  3TU4 B;  4H9Q A;  3REH C;  5B2I B;  3WAA B;  5GSU B;  5DNM A;  3MVD C;  5BS7 A;  5B31 C;  3KUY C;  5B2I D;  5GSU D;  4H9P B;  3MGP C;  3X1S A;  5AV8 C;  3W97 B;  4ZBJ C;  4UUZ A;  3X1V B;  5E5A C;  3W99 C;  2DF4 C;  3AFA A;  3W97 D;  4Z66 A;  4H9O B;  2F8N B;  4XUJ A;  1A7W A;  4HGA B;  3X1V D;  3UTB A;  3AZN C;  2F8N D;  5B0Y A;  4EO5 B;  2VQR A;  3AZL B;  3A6N C;  3H0R C;  4ZUX A;  5B1M A;  1P3K D;  3LJA A;  3REL D;  3X1U A;  3W96 C;  5GT0 B;  3C1C B;  2L5A A;  5GXQ C;  1M18 D;  3AN2 C;  4J8V D;  5GT0 D;  4Z5T A;  5JA4 A;  5KDM A;  5B32 A;  3EPL A;  3UTA A;  3AZH D;  2RVQ C;  1BFM A;  5AVC B;  4JJN B;  1P3B C;  2Y2H A;  4R8P A;  4J8X A;  1KX3 B;  2Y2Q A;  3EPJ A;  5AVB A;  5AVC D;  5B2J A;  1P3P A;  5JRG B;  1S32 A;  5B1L B;  3AZK D;  4AWL B;  3MGQ A;  4X23 B;  5JRG D;  4CSR A;  3AZI B;  5B1L D;  3VH6 T;  3AV1 C;  4WU9 D;  1N1J A;  4X23 D;  5AV9 C;  4CAY A;  2HIO C;  1R4V A;  4YM6 D;  3REI D;  3WTP D;  3VH6 W;  3MGR B;  3EG5 B;  4G91 C;  1B6W A;  4QLC A;  3AZE B;  3UT9 D;  3WA9 C;  5AV6 A;  3C1B A;  3MGS B;  1P3M C;  3REK B;  4XZQ B;  3O62 A;  4LD9 B;  4WNN B;  1M19 A;  4KGC C;  2YFW A;  3MGS D;  3TU4 A;  3REK D;  4XZQ D;  3MVD D;  5B31 D;  2Y2N A;  3AZJ C;  1EQZ C;  4H9Q B;  3AZF C;  5F99 A;  5AV8 D;  5DNM B;  5CPK D;  3X1S B;  3WAA C;  5B2I C;  5GSU C;  4M6B A;  4H9O A;  1P3O B;  5B0Z D;  2F2A C;  4UUZ B;  3X1S D;  1KX5 A;  3AFA B;  1P3L D;  4Z66 B;  3A1I A;  4XUJ B;  3AYW A;  3W97 C;  3UTB B;  4Z66 D;  3X1V C;  4XUJ D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...