5BT1D

Histone chaperone hif1 playing with histone h2a-h2b dimer
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
90
structure length
90
Chain Sequence
KETYSSYIYKVLKQTHPDTGISQKSMSILNSFVNDIFERIATEASKLAAYNKKSTISAREIQTAVRLILPGELAKHAVSEGTRAVTKYSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Chaperone
molecule keywords HAT1-interacting factor 1
publication title Structural Insights into the Association of Hif1 with Histones H2A-H2B Dimer and H3-H4 Tetramer
pubmed doi rcsb
source organism Saccharomyces cerevisiae (strain atcc 204508 / s288c)
total genus 35
structure length 90
sequence length 90
ec nomenclature
pdb deposition date 2015-06-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5bt1D00
5C3IB 5DNNB 5GT0B 1P3GB 3LELB 3A6ND 3B6GA 3UTBC 3AZFB 4QLCA 3REJA 1P3AB 4NE3A 2NQBB 4AWLC 3UT9B 3AV2A 3MGSD 2AROC 4H9PA 5BT1C 1TAFB 3LJAD 3B0CT 3MNNB 4H9OA 3B6FC 4M6BA 1B67A 1BH9B 3AZGD 4WU9A 3REKB 3VH5A 3B0BA 3X1UA 5CPID 5GXQA 5B40C 3REID 3TU4B 5GT3C 1P3PB 4R8PC 4XUJB 3AFAA 5AV5C 1KX5D 3AYWC 4KUDD 4YM6D 4KGCC 1F66C 2LY8A 5CPKA 3LZ0D 5F99B 3MGSC 3WAAD 4H9QB 1P3IA 1M18A 4ZUXD 5CPJD 5AVBD 3WTPE 3WA9B 2YFWB 1S32A 2FJ7B 4AWLB 3B6GD 4X23A 4QLCD 1EQZC 4KHAA 2PYOB 4J8UA 3NQUA 3MGQD 3AZKB 1P3MA 1F1EA 4DRAA 2BYMA 5E5AD 1ID3A 3MGPA 5B32C 3REHA 1U35B 1P3GA 1HTAA 5GT0A 5DNNA 5AV5B 3X1UD 3LELA 5GXQD 3WKJC 4J8XC 3C1BD 3AYWB 1M1AC 3AFAD 4Z5TB 3AZFA 1B6WA 1P3AA 3W98C 3KXBC 2NQBA 3C1CC 3UT9A 1F66B 5AV8C 5B2JC 1P3OC 5AVCB 1TAFA 3UTAC 5CPKD 1M19B 1BFMA 3MNNA 5GSUC 1M18D 1BH9A 5KDMB 3REKA 3X1SD 3AZLC 3AN2D 3AZIB 2RVQD 5JRGD 4WV4B 1S32D 4X23D 3TU4A 1P3PA 3MGRB 4XUJA 5B33C 1TZYC 4HGAC 4E44A 4J8WC 4J8UD 3AZNC 1P3MD 1HQ3B 4EO5C 1ID3D 5G49B 4H9OB 5CHLB 5F99A 3W97C 3REHD 4H9QA 3KUYB 2JSSA 2HIOC 1P3GD 4YS3C 5AV9B 5GT0D 1WWSA 3LELD 3WA9A 2YFWA 4XZQB 2FJ7A 3AZFD 4J8VC 3AZHB 3X1SC 1AOIC 3AN2C 2NQBD 2PYOA 3UT9D 5JRGC 1H3OB 5B31C 3RELD 3AZKA 3O62B 1P3BB 5GSUB 4NFTA 2NZDC 3MNND 3WTPC 3AZLB 1P34B 3B0DC 4WZSB 1P3IB 1P3LD 3REKD 3LZ1B 5GT3A 1U35A 1R4VA 5B0YB 5AV5A 4ZBJC 4G91B 3X1TC 3TU4D 4LD9C 3AZEB 1P3PD 4XUJD 3AYWA 3AZJB 4Z5TA 5DNMC 1P3KC 5AV6B 1F66A 5B1LC 3AZMB 4CSRB 5AVCA 1ZLAD 3KWQC 5B24C 3MGPB 1KU5A 5CP6C 1M19A 2HUEB 5F99D 5KDMA 3MVDB 3AZIA 4JJNB 3WA9D 1AOIB 2FJ7D 1KX4C 4Z66C 3MGRA 2PYOD 5AY8B 5B1MB 4H9SC 3AV1C 1P3FB 5BS7C 1HQ3A 2IO5B 5G49A 3W99C 4H9NA 4WU8B 3X1TB 3KUYA 1U35D 1ZLAC 5AV9A 2YFVB 1KX3C 4XZQA 5B2IC 3AZHA 3A6NC 3W96B 1H3OA 5AVCD 3O62A 1P3BA 3X1VD 2F8NB 5B0ZB 5GSUA 1M19D 2CV5B 4CAYB 3AZLA 1P34A 3LJAC 3LZ1A 3UTBB 3AZID 5B0YA 3AZGC 3REJD 2AROB 3AZEA 3AZJA 3AV2D 5CPIC 5AV6A 3REIC 3B6FB 3AZMA 1HQ3D 4CSRA 1KX5C 2HIOA 4KUDC 4WU9D 5B40B 3KUYD 4YM6C 5GT3B 4R8PB 3MVDA 1BH8B 3LZ0C 5AV9D 4JJNA 1AOIA 4XZQD 3WAAC 1JFIB 4G92C 4ZUXC 3AZHD 5AY8A 5B1MA 5AVBC 4WNNB 5CPJC 2L5AA 4KGCB 3B6GC 1P3FA 4QLCC 3O62D 3MGSB 3REJC 1P3BD 2CWEA 1Q9CA 3AV2C 3MGQC 1P34D 4WU8A 1P3ID 3X1TA 1EQZB 5E5AC 5B0YD 2YFVA 1WWIA 2F8NK 3AZED 4WU9C 3AZJD 5CPIB 3X1UC 5GXQC 3W96A 5AV6D 3C1BC 5B32B 3AZMD 3AFAC 2F8NA 4E45A 5B0ZA 4KUDB 3MGPD 2CV5A 4H9NB 4CAYA 3WKJB 4J8XB 1M1AB 3UTBA 3MVDD 5DNND 5CPKC 3W98B 4JJND 3KXBB 3V9RB 5CPJB 5AVBB 3C1CB 5AV8B 1M18C 2AROA 1P3AD 5JA4B 5B2JB 1P3OB 5AY8D 5B1MD 3UTAB 2RVQC 1S32C 4X23C 1P3FD 2F8NG 3B6FA 3MGQB 4J8UC 5E5AB 4WU8D 1P3MC 5B40A 4R8PA 1ID3C 5B33B 1BH8A 1TZYB 4HGAB 4J8WB 3AZNB 3REHC 1JFIA 3B0CW 5FUGB 3C1BB 4EO5B 5C3IC 5GT0C 5DNNC 4WNNA 3LELC 1P3GC 4KGCA 3W96D 3AZFC 2F8ND 3W97B 3MGSA 1P3AC 5B0ZD 2NQBC 1ULYA 2CV5D 3UT9C 2HIOB 4YS3B 3RELC 4UUZB 4NE6A 3UTBD 4H9RB 4J8VB 1EQZA 3MNNC 3X1SB 3AN2B 5JRGB 1P3LC 2AROD 5B31B 3REKC 5CPIA 5BT1D 2NZDB 3AZKD 3WTPB 3TU4C 1P3PC 4XUJC 3B0DB 5B32A 3KSYA 4KUDA 5BNVB 4ZBJB 5B40D 3WKJA 5GT3D 4LD9B 4J8XA 4R8PD 5BNXB 1M1AA 5AV5D 3W98A 5DNMB 5F99C 3KXBA 3V9RA 2BYKB 5CPJA 5AVBA 1P3KB 3C1CA 3AYWD 5AV8A 4Z5TD 5B1LB 5JA4A 5B2JA 1P3OA 4KGCD 3WA9C 3UTAA 3KWQB 5B24B 1F66D 5CP6B 2FJ7C 5B32G 3MGQA 3RELB 2PYOC 5E5AA 3AZKC 1KX4B 4Z66B 1EQZD 1P3LB 5B33A 1TZYA 3R45B 3AV1B 4J8WA 3AZNA 3MGRD 1U35C 5FUGA 3C1BA 3VH6A 3W99B 5B32D 3W97A 4Z5TC 4Z2MG 1ZLAB 4NE5A 4YS3A 1KX3B 4UUZA 5AVCC 3WKJD 3X1VC 2F8NH 4J8XD 5B2IB 1M1AD 1M19C 4H9RA 4J8VA 3W98D 3X1SA 3NQJB 3VH5W 3KXBD 3AN2A 1N1JB 3C1CD 3A6NB 5AV8D 5JRGA 5B31A 5B2JD 1P3OD 3AZIC 1A7WA 3UTAD 2NZDA 3WTPA 3MGRC 3VH6W 5GSUD 3LJAB 5BNVA 3AZLD 1HQ3C 3LZ1D 3AZGB 4LD9A 5BNXA 5B33D 1TZYD 5DNMA 2BYKA 4J8WD 1P3KA 5B31G 3AZND 3REIB 3KUYC 5B1LA 5AV9C 3KWQA 5B24A 5CP6A 4XZQC 1KX5B 3W97D 3RELA 3AZHC 5BO0B 4YM6B 3X1VB 2HIOD 4YS3D 3LZ0B 3O62C 1P3BC 1KX4A 3WAAB 4Z66A 4J8VD 4G92B 1P3LA 4ZUXB 1AOID 1P34C 3R45A 4H9SA 3AV1A 1P3IC 3B6GB 5B31D 3LZ1C 4QLCB 5BS7A 3REJB 5B0YC 2NZDD 4G91C 3AV2B 3WTPD 3AZEC 3AZJC 3W99A 4H9PB 3VH5T 5AV6C 1ZLAA 1KX3A 3AZMC 3X1TD 4LD9D 4WU9B 5B2IA 3MGPC 2HUEC 5DNMD 3NQJA 3VH6T 1P3KD 3X1UB 1N1JA 5GXQB 3A6NA 5B1LD 3MVDC 3AFAB 4JJNC 3KWQD 5B24D 5CP6D 5AY8C 5B1MC 3LJAA 5CPKB 1P3FC 1KX4D 1M18B 4Z66D 3AZGA 2IO5C 4Z2MH 3AV1D 4WU8C 1S32B 4X23B 3REIA 4KHAB 4J8UB 3NQUB 3B6FD 1KX5A 3W99D 1P3MB 5BO0A 4YM6A 2BYMB 3X1VA 3W96C 1ID3B 3LZ0A 1KX3D 4DRBA 5B2ID 5B0ZC 3REHB 3WAAA 2CV5C 4ZUXA
chains in the Genus database with same CATH superfamily
5C3IB 5DNNB 5GT0B 1P3GB 3LELB 3A6ND 3B6GA 3UTBC 3AZFB 4QLCA 3REJA 1P3AB 4NE3A 2NQBB 2DQNC 4AWLC 3UT9B 3AV2A 2Y2QA 3MGSD 2AROC 4H9PA 5BT1C 1TAFB 3LJAD 2ZM5A 3B0CT 3MNNB 4H9OA 3B6FC 4M6BA 1B67A 1W2EA 1BH9B 3AZGD 4WU9A 3REKB 3VH5A 3B0BA 3X1UA 5CPID 5GXQA 5B40C 3REID 3TU4B 5GT3C 1P3PB 4R8PC 4XUJB 3AFAA 5AV5C 1KX5D 3AYWC 3H0LC 4KUDD 4YM6D 4KGCC 1T3UA 1F66C 2LY8A 5CPKA 3LZ0D 5F99B 3MGSC 3WAAD 4H9QB 1P3IA 1M18A 4ZUXD 5CPJD 5AVBD 3WTPE 3WA9B 2YFWB 1S32A 2FJ7B 4AWLB 3B6GD 4X23A 4QLCD 1EQZC 4KHAA 2PYOB 4J8UA 3NQUA 3MGQD 3AZKB 1P3MA 1F1EA 2Y2JA 4DRAA 2BYMA 5E5AD 1ID3A 4UPKA 3MGPA 5B32C 3REHA 1U35B 1P3GA 1HTAA 5GT0A 5DNNA 5AV5B 3X1UD 3LELA 5GXQD 3WKJC 4J8XC 3C1BD 3AYWB 1M1AC 3AFAD 4Z5TB 3AZFA 1B6WA 1P3AA 3W98C 3KXBC 2NQBA 3C1CC 3UT9A 1F66B 5AV8C 5B2JC 1P3OC 5AVCB 1TAFA 2Y2NA 3UTAC 5CPKD 1M19B 1BFMA 3MNNA 5GSUC 1M18D 1BH9A 2RIQA 5KDMB 3REKA 3X1SD 3AZLC 2ZY3A 3AN2D 3AZIB 2RVQD 5JRGD 4WV4B 1S32D 4X23D 3TU4A 1P3PA 3MGRB 4XUJA 5B33C 1TZYC 4HGAC 4E44A 4J8WC 4J8UD 3AZNC 3IP4C 1P3MD 1HQ3B 4EO5C 2ZY2A 1ID3D 5G49B 4H9OB 5CHLB 5F99A 3W97C 3REHD 4H9QA 3KUYB 2JSSA 2HIOC 1P3GD 4YS3C 5AV9B 5GT0D 1WWSA 3LELD 3WA9A 2YFWA 4XZQB 2FJ7A 3AZFD 4J8VC 4WJ3C 3AZHB 3X1SC 1AOIC 3AN2C 2NQBD 2PYOA 3UT9D 5JRGC 1H3OB 5B31C 3RELD 3AZKA 3O62B 1P3BB 5GSUB 4NFTA 2NZDC 3MNND 3WTPC 3AZLB 1P34B 3B0DC 4WZSB 1P3IB 1P3LD 3REKD 3LZ1B 5GT3A 1U35A 1R4VA 5B0YB 5AV5A 4ZBJC 4G91B 3X1TC 3TU4D 4LD9C 3AZEB 1P3PD 4XUJD 3AYWA 3AZJB 4Z5TA 2Y2LA 5DNMC 1P3KC 5AV6B 1F66A 5B1LC 3AZMB 4CSRB 5AVCA 1ZLAD 3KWQC 5B24C 3MGPB 1KU5A 5CP6C 1M19A 2HUEB 5F99D 2Y2IA 5KDMA 3MVDB 3AZIA 4JJNB 3WA9D 3H0RC 1AOIB 2FJ7D 2JE5A 1KX4C 4Z66C 3H0MC 3MGRA 2PYOD 5AY8B 5B1MB 4H9SC 3AV1C 1P3FB 3EG5B 3P5JB 5BS7C 1HQ3A 2IO5B 5G49A 3W99C 4H9NA 4WU8B 3X1TB 3KUYA 1U35D 1ZLAC 5AV9A 2YFVB 1KX3C 4XZQA 5B2IC 2ZY5A 3AZHA 3A6NC 3W96B 1H3OA 5AVCD 3O62A 3A1IA 3X1VD 1P3BA 2F8NB 5B0ZB 2ZY4A 5GSUA 1M19D 2CV5B 3KFUG 4CAYB 3AZLA 3F6TA 1P34A 3LJAC 3LZ1A 3UTBB 3AZID 5B0YA 3AZGC 2Y2PA 3REJD 2AROB 3AZEA 3AZJA 3AV2D 5CPIC 5AV6A 3REIC 3B6FB 2VQRA 3AZMA 1HQ3D 4CSRA 1KX5C 2HIOA 4KUDC 4WU9D 5B40B 3KUYD 4YM6C 5GT3B 4DQYB 2Y2HA 4R8PB 3MVDA 1BH8B 3LZ0C 5AV9D 4JJNA 1AOIA 4XZQD 3WAAC 1JFIB 4G92C 4ZUXC 3AZHD 5AY8A 5B1MA 5AVBC 4WNNB 5CPJC 2L5AA 4KGCB 3B6GC 1P3FA 4QLCC 3O62D 3MGSB 3REJC 1P3BD 2CWEA 1Q9CA 3AV2C 3EPLA 2J8PA 3MGQC 1P34D 4WU8A 1P3ID 2F2AC 2XD5A 3X1TA 1EQZB 5E5AC 5B0YD 2YFVA 1WWIA 2F8NK 3AZED 4WU9C 3AZJD 5CPIB 3X1UC 5GXQC 3W96A 5AV6D 3C1BC 5B32B 3AZMD 3AFAC 2F8NA 2DF4C 4E45A 5B0ZA 4KUDB 3MGPD 2CV5A 4H9NB 4CAYA 3WKJB 4J8XB 1M1AB 3UTBA 3MVDD 5DNND 5CPKC 3W98B 4JJND 3KXBB 3V9RB 5CPJB 5AVBB 3C1CB 5AV8B 1M18C 2AROA 1P3AD 5JA4B 5B2JB 1P3OB 5AY8D 5B1MD 3UTAB 2RVQC 1S32C 4X23C 1P3FD 2F8NG 3B6FA 3MGQB 4J8UC 5E5AB 4WU8D 1P3MC 5B40A 2Y2GA 4R8PA 5B33B 1BH8A 1TZYB 4HGAB 1ID3C 4J8WB 3AZNB 3REHC 1JFIA 3B0CW 5FUGB 3C1BB 4EO5B 5C3IC 5GT0C 5DNNC 4WNNA 3LELC 1P3GC 4KGCA 3W96D 3AZFC 2F8ND 3W97B 3MGSA 1P3AC 5B0ZD 2NQBC 1ULYA 2CV5D 3UT9C 2HIOB 4YS3B 3RELC 4UUZB 2FFFB 4NE6A 2Y2MA 3UTBD 4H9RB 4J8VB 1EQZA 3MNNC 3X1SB 3AN2B 5JRGB 1P3LC 2AROD 5B31B 3REKC 5CPIA 5BT1D 2NZDB 3AZKD 3WTPB 3TU4C 1Z2CB 1P3PC 4XUJC 3B0DB 5B32A 3KSYA 4KUDA 2XD1A 5BNVB 4ZBJB 5B40D 3WKJA 5GT3D 4LD9B 4J8XA 4R8PD 5BNXB 1PZRA 1M1AA 5AV5D 3W98A 5DNMB 5F99C 3KXBA 3V9RA 2BYKB 5CPJA 5AVBA 1P3KB 3C1CA 3AYWD 5AV8A 4Z5TD 2Y2OA 5B1LB 5JA4A 5B2JA 1P3OA 4KGCD 3WA9C 3UTAA 3KWQB 5B24B 1F66D 5CP6B 2FJ7C 5B32G 3MGQA 3RELB 2PYOC 5E5AA 3AZKC 1KX4B 4Z66B 1EQZD 1P3LB 5B33A 1TZYA 3R45B 3AV1B 4J8WA 3AZNA 3MGRD 1U35C 5FUGA 3C1BA 2G5IC 3VH6A 3W99B 5B32D 3W97A 4Z5TC 4Z2MG 1ZLAB 4NE5A 4YS3A 1KX3B 4UUZA 5AVCC 3WKJD 3X1VC 2F8NH 4J8XD 5B2IB 1M1AD 1M19C 4H9RA 4J8VA 3W98D 3X1SA 3NQJB 3VH5W 3KXBD 3AN2A 1N1JB 3C1CD 3A6NB 5AV8D 5JRGA 5B31A 5B2JD 1P3OD 3AZIC 1A7WA 3UTAD 2NZDA 3WTPA 3FDDA 3MGRC 3VH6W 5GSUD 3LJAB 5BNVA 3AZLD 1HQ3C 3LZ1D 3AZGB 4LD9A 5BNXA 5B33D 1TZYD 5DNMA 2BYKA 4J8WD 1P3KA 5B31G 3AZND 3REIB 3KUYC 5B1LA 5AV9C 3KWQA 5B24A 5CP6A 4XZQC 1KX5B 3W97D 3RELA 3AZHC 5BO0B 4YM6B 3X1VB 2HIOD 4YS3D 3LZ0B 3O62C 1P3BC 1KX4A 3WAAB 4Z66A 4J8VD 4G92B 1P3LA 4ZUXB 1AOID 1P34C 3R45A 4H9SA 3AV1A 1P3IC 2UWXA 3B6GB 5B31D 3A1KA 3LZ1C 4QLCB 5BS7A 3REJB 3EPHA 5B0YC 2NZDD 4G91C 3AV2B 3WTPD 3AZEC 3AZJC 3W99A 4H9PB 3VH5T 5AV6C 1ZLAA 2W8SA 2G5HC 1KX3A 3AZMC 3X1TD 4LD9D 4WU9B 5B2IA 3MGPC 2BG1A 2HUEC 2Y2KA 5DNMD 3NQJA 3VH6T 1P3KD 3EPKA 3X1UB 1N1JA 5GXQB 3A6NA 5B1LD 3MVDC 3AFAB 4JJNC 3KWQD 5B24D 5CP6D 5AY8C 5B1MC 3EPJA 3LJAA 2JCHA 5CPKB 1P3FC 1KX4D 3AL0C 1M18B 4Z66D 3AZGA 2IO5C 4Z2MH 3AV1D 4WU8C 1S32B 4X23B 3REIA 4KHAB 4J8UB 3NQUB 3B6FD 1KX5A 3W99D 1P3MB 5BO0A 4YM6A 2BYMB 3X1VA 3W96C 1ID3B 3LZ0A 1KX3D 4DRBA 5B2ID 5B0ZC 3REHB 3WAAA 2CV5C 4ZUXA
chains in the Genus database with same CATH topology
5C3IB 5DNNB 5GT0B 1P3GB 3LELB 3A6ND 3B6GA 3UTBC 3AZFB 4QLCA 3REJA 1P3AB 4NE3A 2NQBB 2DQNC 4AWLC 3UT9B 3AV2A 2Y2QA 3MGSD 2AROC 4H9PA 5BT1C 1TAFB 3LJAD 2ZM5A 3B0CT 3MNNB 4H9OA 3B6FC 4M6BA 1B67A 1W2EA 1BH9B 3AZGD 4WU9A 3REKB 3VH5A 3B0BA 3X1UA 5CPID 5GXQA 5B40C 3REID 3TU4B 5GT3C 1P3PB 4R8PC 4XUJB 3AFAA 5AV5C 1KX5D 3AYWC 3H0LC 4KUDD 4YM6D 4KGCC 1T3UA 1F66C 2LY8A 5CPKA 3LZ0D 5F99B 3MGSC 3WAAD 4H9QB 1P3IA 1M18A 4ZUXD 5CPJD 5AVBD 3WTPE 3WA9B 2YFWB 1S32A 2FJ7B 4AWLB 3B6GD 4X23A 4QLCD 1EQZC 4KHAA 2PYOB 4J8UA 3NQUA 3MGQD 3AZKB 1P3MA 1F1EA 2Y2JA 4DRAA 2BYMA 5E5AD 1ID3A 4UPKA 3MGPA 5B32C 3REHA 1U35B 1P3GA 1HTAA 5GT0A 5DNNA 5AV5B 3X1UD 3LELA 5GXQD 3WKJC 4J8XC 3C1BD 3AYWB 1M1AC 3AFAD 4Z5TB 3AZFA 1B6WA 1P3AA 3W98C 3KXBC 2NQBA 3C1CC 3UT9A 1F66B 5AV8C 5B2JC 1P3OC 5AVCB 1TAFA 2Y2NA 3UTAC 5CPKD 1M19B 1BFMA 3MNNA 5GSUC 1M18D 1BH9A 2RIQA 5KDMB 3REKA 3X1SD 3AZLC 2ZY3A 3AN2D 3AZIB 2RVQD 5JRGD 4WV4B 1S32D 4X23D 3TU4A 1P3PA 3MGRB 4XUJA 5B33C 1TZYC 4HGAC 4E44A 4J8WC 4J8UD 3AZNC 3IP4C 1P3MD 1HQ3B 4EO5C 2ZY2A 1ID3D 5G49B 4H9OB 5CHLB 5F99A 3W97C 3REHD 4H9QA 3KUYB 2JSSA 2HIOC 1P3GD 4YS3C 5AV9B 5GT0D 1WWSA 3LELD 3WA9A 2YFWA 4XZQB 2FJ7A 3AZFD 4J8VC 4WJ3C 3AZHB 3X1SC 1AOIC 3AN2C 2NQBD 2PYOA 3UT9D 5JRGC 1H3OB 5B31C 3RELD 3AZKA 3O62B 1P3BB 5GSUB 4NFTA 2NZDC 3MNND 3WTPC 3AZLB 1P34B 3B0DC 4WZSB 1P3IB 1P3LD 3REKD 3LZ1B 5GT3A 1U35A 1R4VA 5B0YB 5AV5A 4ZBJC 4G91B 3X1TC 3TU4D 4LD9C 3AZEB 1P3PD 4XUJD 3AYWA 3AZJB 4Z5TA 2Y2LA 5DNMC 1P3KC 5AV6B 1F66A 5B1LC 3AZMB 4CSRB 5AVCA 1ZLAD 3KWQC 5B24C 3MGPB 1KU5A 5CP6C 1M19A 2HUEB 5F99D 2Y2IA 5KDMA 3MVDB 3AZIA 4JJNB 3WA9D 3H0RC 1AOIB 2FJ7D 2JE5A 1KX4C 4Z66C 3H0MC 3MGRA 2PYOD 5AY8B 5B1MB 4H9SC 3AV1C 1P3FB 3EG5B 3P5JB 5BS7C 1HQ3A 2IO5B 5G49A 3W99C 4H9NA 4WU8B 3X1TB 3KUYA 1U35D 1ZLAC 5AV9A 2YFVB 1KX3C 4XZQA 5B2IC 2ZY5A 3AZHA 3A6NC 3W96B 1H3OA 5AVCD 3O62A 3A1IA 3X1VD 1P3BA 2F8NB 5B0ZB 2ZY4A 5GSUA 1M19D 2CV5B 3KFUG 4CAYB 3AZLA 3F6TA 1P34A 3LJAC 3LZ1A 3UTBB 3AZID 5B0YA 3AZGC 2Y2PA 3REJD 2AROB 3AZEA 3AZJA 3AV2D 5CPIC 5AV6A 3REIC 3B6FB 2VQRA 3AZMA 1HQ3D 4CSRA 1KX5C 2HIOA 4KUDC 4WU9D 5B40B 3KUYD 4YM6C 5GT3B 4DQYB 2Y2HA 4R8PB 3MVDA 1BH8B 3LZ0C 5AV9D 4JJNA 1AOIA 4XZQD 3WAAC 1JFIB 4G92C 4ZUXC 3AZHD 5AY8A 5B1MA 5AVBC 4WNNB 5CPJC 2L5AA 4KGCB 3B6GC 1P3FA 4QLCC 3O62D 3MGSB 3REJC 1P3BD 2CWEA 1Q9CA 3AV2C 3EPLA 2J8PA 3MGQC 1P34D 4WU8A 1P3ID 2F2AC 2XD5A 3X1TA 1EQZB 5E5AC 5B0YD 2YFVA 1WWIA 2F8NK 3AZED 4WU9C 3AZJD 5CPIB 3X1UC 5GXQC 3W96A 5AV6D 3C1BC 5B32B 3AZMD 3AFAC 2F8NA 2DF4C 4E45A 5B0ZA 4KUDB 3MGPD 2CV5A 4H9NB 4CAYA 3WKJB 4J8XB 1M1AB 3UTBA 3MVDD 5DNND 5CPKC 3W98B 4JJND 3KXBB 3V9RB 5CPJB 5AVBB 3C1CB 5AV8B 1M18C 2AROA 1P3AD 5JA4B 5B2JB 1P3OB 5AY8D 5B1MD 3UTAB 2RVQC 1S32C 4X23C 1P3FD 2F8NG 3B6FA 3MGQB 4J8UC 5E5AB 4WU8D 1P3MC 5B40A 2Y2GA 4R8PA 5B33B 1BH8A 1TZYB 4HGAB 1ID3C 4J8WB 3AZNB 3REHC 1JFIA 3B0CW 5FUGB 3C1BB 4EO5B 5C3IC 5GT0C 5DNNC 4WNNA 3LELC 1P3GC 4KGCA 3W96D 3AZFC 2F8ND 3W97B 3MGSA 1P3AC 5B0ZD 2NQBC 1ULYA 2CV5D 3UT9C 2HIOB 4YS3B 3RELC 4UUZB 2FFFB 4NE6A 2Y2MA 3UTBD 4H9RB 4J8VB 1EQZA 3MNNC 3X1SB 3AN2B 5JRGB 1P3LC 2AROD 5B31B 3REKC 5CPIA 5BT1D 2NZDB 3AZKD 3WTPB 3TU4C 1Z2CB 1P3PC 4XUJC 3B0DB 5B32A 3KSYA 4KUDA 2XD1A 5BNVB 4ZBJB 5B40D 3WKJA 5GT3D 4LD9B 4J8XA 4R8PD 5BNXB 1PZRA 1M1AA 5AV5D 3W98A 5DNMB 5F99C 3KXBA 3V9RA 2BYKB 5CPJA 5AVBA 1P3KB 3C1CA 3AYWD 5AV8A 4Z5TD 2Y2OA 5B1LB 5JA4A 5B2JA 1P3OA 4KGCD 3WA9C 3UTAA 3KWQB 5B24B 1F66D 5CP6B 2FJ7C 5B32G 3MGQA 3RELB 2PYOC 5E5AA 3AZKC 1KX4B 4Z66B 1EQZD 1P3LB 5B33A 1TZYA 3R45B 3AV1B 4J8WA 3AZNA 3MGRD 1U35C 5FUGA 3C1BA 2G5IC 3VH6A 3W99B 5B32D 3W97A 4Z5TC 4Z2MG 1ZLAB 4NE5A 4YS3A 1KX3B 4UUZA 5AVCC 3WKJD 3X1VC 2F8NH 4J8XD 5B2IB 1M1AD 1M19C 4H9RA 4J8VA 3W98D 3X1SA 3NQJB 3VH5W 3KXBD 3AN2A 1N1JB 3C1CD 3A6NB 5AV8D 5JRGA 5B31A 5B2JD 1P3OD 3AZIC 1A7WA 3UTAD 2NZDA 3WTPA 3FDDA 3MGRC 3VH6W 5GSUD 3LJAB 5BNVA 3AZLD 1HQ3C 3LZ1D 3AZGB 4LD9A 5BNXA 5B33D 1TZYD 5DNMA 2BYKA 4J8WD 1P3KA 5B31G 3AZND 3REIB 3KUYC 5B1LA 5AV9C 3KWQA 5B24A 5CP6A 4XZQC 1KX5B 3W97D 3RELA 3AZHC 5BO0B 4YM6B 3X1VB 2HIOD 4YS3D 3LZ0B 3O62C 1P3BC 1KX4A 3WAAB 4Z66A 4J8VD 4G92B 1P3LA 4ZUXB 1AOID 1P34C 3R45A 4H9SA 3AV1A 1P3IC 2UWXA 3B6GB 5B31D 3A1KA 3LZ1C 4QLCB 5BS7A 3REJB 3EPHA 5B0YC 2NZDD 4G91C 3AV2B 3WTPD 3AZEC 3AZJC 3W99A 4H9PB 3VH5T 5AV6C 1ZLAA 2W8SA 2G5HC 1KX3A 3AZMC 3X1TD 4LD9D 4WU9B 5B2IA 3MGPC 2BG1A 2HUEC 2Y2KA 5DNMD 3NQJA 3VH6T 1P3KD 3EPKA 3X1UB 1N1JA 5GXQB 3A6NA 5B1LD 3MVDC 3AFAB 4JJNC 3KWQD 5B24D 5CP6D 5AY8C 5B1MC 3EPJA 3LJAA 2JCHA 5CPKB 1P3FC 1KX4D 3AL0C 1M18B 4Z66D 3AZGA 2IO5C 4Z2MH 3AV1D 4WU8C 1S32B 4X23B 3REIA 4KHAB 4J8UB 3NQUB 3B6FD 1KX5A 3W99D 1P3MB 5BO0A 4YM6A 2BYMB 3X1VA 3W96C 1ID3B 3LZ0A 1KX3D 4DRBA 5B2ID 5B0ZC 3REHB 3WAAA 2CV5C 4ZUXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5C3I B;  5DNN B;  5GT0 B;  1P3G B;  3LEL B;  3A6N D;  3B6G A;  3UTB C;  3AZF B;  4QLC A;  3REJ A;  1P3A B;  4NE3 A;  2NQB B;  4AWL C;  3UT9 B;  3AV2 A;  3MGS D;  2ARO C;  4H9P A;  5BT1 C;  1TAF B;  3LJA D;  3B0C T;  3MNN B;  4H9O A;  3B6F C;  4M6B A;  1B67 A;  1BH9 B;  3AZG D;  4WU9 A;  3REK B;  3VH5 A;  3B0B A;  3X1U A;  5CPI D;  5GXQ A;  5B40 C;  3REI D;  3TU4 B;  5GT3 C;  1P3P B;  4R8P C;  4XUJ B;  3AFA A;  5AV5 C;  1KX5 D;  3AYW C;  4KUD D;  4YM6 D;  4KGC C;  1F66 C;  2LY8 A;  5CPK A;  3LZ0 D;  5F99 B;  3MGS C;  3WAA D;  4H9Q B;  1P3I A;  1M18 A;  4ZUX D;  5CPJ D;  5AVB D;  3WTP E;  3WA9 B;  2YFW B;  1S32 A;  2FJ7 B;  4AWL B;  3B6G D;  4X23 A;  4QLC D;  1EQZ C;  4KHA A;  2PYO B;  4J8U A;  3NQU A;  3MGQ D;  3AZK B;  1P3M A;  1F1E A;  4DRA A;  2BYM A;  5E5A D;  1ID3 A;  3MGP A;  5B32 C;  3REH A;  1U35 B;  1P3G A;  1HTA A;  5GT0 A;  5DNN A;  5AV5 B;  3X1U D;  3LEL A;  5GXQ D;  3WKJ C;  4J8X C;  3C1B D;  3AYW B;  1M1A C;  3AFA D;  4Z5T B;  3AZF A;  1B6W A;  1P3A A;  3W98 C;  3KXB C;  2NQB A;  3C1C C;  3UT9 A;  1F66 B;  5AV8 C;  5B2J C;  1P3O C;  5AVC B;  1TAF A;  3UTA C;  5CPK D;  1M19 B;  1BFM A;  3MNN A;  5GSU C;  1M18 D;  1BH9 A;  5KDM B;  3REK A;  3X1S D;  3AZL C;  3AN2 D;  3AZI B;  2RVQ D;  5JRG D;  4WV4 B;  1S32 D;  4X23 D;  3TU4 A;  1P3P A;  3MGR B;  4XUJ A;  5B33 C;  1TZY C;  4HGA C;  4E44 A;  4J8W C;  4J8U D;  3AZN C;  1P3M D;  1HQ3 B;  4EO5 C;  1ID3 D;  5G49 B;  4H9O B;  5CHL B;  5F99 A;  3W97 C;  3REH D;  4H9Q A;  3KUY B;  2JSS A;  2HIO C;  1P3G D;  4YS3 C;  5AV9 B;  5GT0 D;  1WWS A;  3LEL D;  3WA9 A;  2YFW A;  4XZQ B;  2FJ7 A;  3AZF D;  4J8V C;  3AZH B;  3X1S C;  1AOI C;  3AN2 C;  2NQB D;  2PYO A;  3UT9 D;  5JRG C;  1H3O B;  5B31 C;  3REL D;  3AZK A;  3O62 B;  1P3B B;  5GSU B;  4NFT A;  2NZD C;  3MNN D;  3WTP C;  3AZL B;  1P34 B;  3B0D C;  4WZS B;  1P3I B;  1P3L D;  3REK D;  3LZ1 B;  5GT3 A;  1U35 A;  1R4V A;  5B0Y B;  5AV5 A;  4ZBJ C;  4G91 B;  3X1T C;  3TU4 D;  4LD9 C;  3AZE B;  1P3P D;  4XUJ D;  3AYW A;  3AZJ B;  4Z5T A;  5DNM C;  1P3K C;  5AV6 B;  1F66 A;  5B1L C;  3AZM B;  4CSR B;  5AVC A;  1ZLA D;  3KWQ C;  5B24 C;  3MGP B;  1KU5 A;  5CP6 C;  1M19 A;  2HUE B;  5F99 D;  5KDM A;  3MVD B;  3AZI A;  4JJN B;  3WA9 D;  1AOI B;  2FJ7 D;  1KX4 C;  4Z66 C;  3MGR A;  2PYO D;  5AY8 B;  5B1M B;  4H9S C;  3AV1 C;  1P3F B;  5BS7 C;  1HQ3 A;  2IO5 B;  5G49 A;  3W99 C;  4H9N A;  4WU8 B;  3X1T B;  3KUY A;  1U35 D;  1ZLA C;  5AV9 A;  2YFV B;  1KX3 C;  4XZQ A;  5B2I C;  3AZH A;  3A6N C;  3W96 B;  1H3O A;  5AVC D;  3O62 A;  1P3B A;  3X1V D;  2F8N B;  5B0Z B;  5GSU A;  1M19 D;  2CV5 B;  4CAY B;  3AZL A;  1P34 A;  3LJA C;  3LZ1 A;  3UTB B;  3AZI D;  5B0Y A;  3AZG C;  3REJ D;  2ARO B;  3AZE A;  3AZJ A;  3AV2 D;  5CPI C;  5AV6 A;  3REI C;  3B6F B;  3AZM A;  1HQ3 D;  4CSR A;  1KX5 C;  2HIO A;  4KUD C;  4WU9 D;  5B40 B;  3KUY D;  4YM6 C;  5GT3 B;  4R8P B;  3MVD A;  1BH8 B;  3LZ0 C;  5AV9 D;  4JJN A;  1AOI A;  4XZQ D;  3WAA C;  1JFI B;  4G92 C;  4ZUX C;  3AZH D;  5AY8 A;  5B1M A;  5AVB C;  4WNN B;  5CPJ C;  2L5A A;  4KGC B;  3B6G C;  1P3F A;  4QLC C;  3O62 D;  3MGS B;  3REJ C;  1P3B D;  2CWE A;  1Q9C A;  3AV2 C;  3MGQ C;  1P34 D;  4WU8 A;  1P3I D;  3X1T A;  1EQZ B;  5E5A C;  5B0Y D;  2YFV A;  1WWI A;  2F8N K;  3AZE D;  4WU9 C;  3AZJ D;  5CPI B;  3X1U C;  5GXQ C;  3W96 A;  5AV6 D;  3C1B C;  5B32 B;  3AZM D;  3AFA C;  2F8N A;  4E45 A;  5B0Z A;  4KUD B;  3MGP D;  2CV5 A;  4H9N B;  4CAY A;  3WKJ B;  4J8X B;  1M1A B;  3UTB A;  3MVD D;  5DNN D;  5CPK C;  3W98 B;  4JJN D;  3KXB B;  3V9R B;  5CPJ B;  5AVB B;  3C1C B;  5AV8 B;  1M18 C;  2ARO A;  1P3A D;  5JA4 B;  5B2J B;  1P3O B;  5AY8 D;  5B1M D;  3UTA B;  2RVQ C;  1S32 C;  4X23 C;  1P3F D;  2F8N G;  3B6F A;  3MGQ B;  4J8U C;  5E5A B;  4WU8 D;  1P3M C;  5B40 A;  4R8P A;  1ID3 C;  5B33 B;  1BH8 A;  1TZY B;  4HGA B;  4J8W B;  3AZN B;  3REH C;  1JFI A;  3B0C W;  5FUG B;  3C1B B;  4EO5 B;  5C3I C;  5GT0 C;  5DNN C;  4WNN A;  3LEL C;  1P3G C;  4KGC A;  3W96 D;  3AZF C;  2F8N D;  3W97 B;  3MGS A;  1P3A C;  5B0Z D;  2NQB C;  1ULY A;  2CV5 D;  3UT9 C;  2HIO B;  4YS3 B;  3REL C;  4UUZ B;  4NE6 A;  3UTB D;  4H9R B;  4J8V B;  1EQZ A;  3MNN C;  3X1S B;  3AN2 B;  5JRG B;  1P3L C;  2ARO D;  5B31 B;  3REK C;  5CPI A;  5BT1 D;  2NZD B;  3AZK D;  3WTP B;  3TU4 C;  1P3P C;  4XUJ C;  3B0D B;  5B32 A;  3KSY A;  4KUD A;  5BNV B;  4ZBJ B;  5B40 D;  3WKJ A;  5GT3 D;  4LD9 B;  4J8X A;  4R8P D;  5BNX B;  1M1A A;  5AV5 D;  3W98 A;  5DNM B;  5F99 C;  3KXB A;  3V9R A;  2BYK B;  5CPJ A;  5AVB A;  1P3K B;  3C1C A;  3AYW D;  5AV8 A;  4Z5T D;  5B1L B;  5JA4 A;  5B2J A;  1P3O A;  4KGC D;  3WA9 C;  3UTA A;  3KWQ B;  5B24 B;  1F66 D;  5CP6 B;  2FJ7 C;  5B32 G;  3MGQ A;  3REL B;  2PYO C;  5E5A A;  3AZK C;  1KX4 B;  4Z66 B;  1EQZ D;  1P3L B;  5B33 A;  1TZY A;  3R45 B;  3AV1 B;  4J8W A;  3AZN A;  3MGR D;  1U35 C;  5FUG A;  3C1B A;  3VH6 A;  3W99 B;  5B32 D;  3W97 A;  4Z5T C;  4Z2M G;  1ZLA B;  4NE5 A;  4YS3 A;  1KX3 B;  4UUZ A;  5AVC C;  3WKJ D;  3X1V C;  2F8N H;  4J8X D;  5B2I B;  1M1A D;  1M19 C;  4H9R A;  4J8V A;  3W98 D;  3X1S A;  3NQJ B;  3VH5 W;  3KXB D;  3AN2 A;  1N1J B;  3C1C D;  3A6N B;  5AV8 D;  5JRG A;  5B31 A;  5B2J D;  1P3O D;  3AZI C;  1A7W A;  3UTA D;  2NZD A;  3WTP A;  3MGR C;  3VH6 W;  5GSU D;  3LJA B;  5BNV A;  3AZL D;  1HQ3 C;  3LZ1 D;  3AZG B;  4LD9 A;  5BNX A;  5B33 D;  1TZY D;  5DNM A;  2BYK A;  4J8W D;  1P3K A;  5B31 G;  3AZN D;  3REI B;  3KUY C;  5B1L A;  5AV9 C;  3KWQ A;  5B24 A;  5CP6 A;  4XZQ C;  1KX5 B;  3W97 D;  3REL A;  3AZH C;  5BO0 B;  4YM6 B;  3X1V B;  2HIO D;  4YS3 D;  3LZ0 B;  3O62 C;  1P3B C;  1KX4 A;  3WAA B;  4Z66 A;  4J8V D;  4G92 B;  1P3L A;  4ZUX B;  1AOI D;  1P34 C;  3R45 A;  4H9S A;  3AV1 A;  1P3I C;  3B6G B;  5B31 D;  3LZ1 C;  4QLC B;  5BS7 A;  3REJ B;  5B0Y C;  2NZD D;  4G91 C;  3AV2 B;  3WTP D;  3AZE C;  3AZJ C;  3W99 A;  4H9P B;  3VH5 T;  5AV6 C;  1ZLA A;  1KX3 A;  3AZM C;  3X1T D;  4LD9 D;  4WU9 B;  5B2I A;  3MGP C;  2HUE C;  5DNM D;  3NQJ A;  3VH6 T;  1P3K D;  3X1U B;  1N1J A;  5GXQ B;  3A6N A;  5B1L D;  3MVD C;  3AFA B;  4JJN C;  3KWQ D;  5B24 D;  5CP6 D;  5AY8 C;  5B1M C;  3LJA A;  5CPK B;  1P3F C;  1KX4 D;  1M18 B;  4Z66 D;  3AZG A;  2IO5 C;  4Z2M H;  3AV1 D;  4WU8 C;  1S32 B;  4X23 B;  3REI A;  4KHA B;  4J8U B;  3NQU B;  3B6F D;  1KX5 A;  3W99 D;  1P3M B;  5BO0 A;  4YM6 A;  2BYM B;  3X1V A;  3W96 C;  1ID3 B;  3LZ0 A;  1KX3 D;  4DRB A;  5B2I D;  5B0Z C;  3REH B;  3WAA A;  2CV5 C;  4ZUX A; 
#chains in the Genus database with same CATH topology
 5C3I B;  5DNN B;  5GT0 B;  1P3G B;  3LEL B;  3A6N D;  3B6G A;  3UTB C;  3AZF B;  4QLC A;  3REJ A;  1P3A B;  4NE3 A;  2NQB B;  2DQN C;  4AWL C;  3UT9 B;  3AV2 A;  2Y2Q A;  3MGS D;  2ARO C;  4H9P A;  5BT1 C;  1TAF B;  3LJA D;  2ZM5 A;  3B0C T;  3MNN B;  4H9O A;  3B6F C;  4M6B A;  1B67 A;  1W2E A;  1BH9 B;  3AZG D;  4WU9 A;  3REK B;  3VH5 A;  3B0B A;  3X1U A;  5CPI D;  5GXQ A;  5B40 C;  3REI D;  3TU4 B;  5GT3 C;  1P3P B;  4R8P C;  4XUJ B;  3AFA A;  5AV5 C;  1KX5 D;  3AYW C;  3H0L C;  4KUD D;  4YM6 D;  4KGC C;  1T3U A;  1F66 C;  2LY8 A;  5CPK A;  3LZ0 D;  5F99 B;  3MGS C;  3WAA D;  4H9Q B;  1P3I A;  1M18 A;  4ZUX D;  5CPJ D;  5AVB D;  3WTP E;  3WA9 B;  2YFW B;  1S32 A;  2FJ7 B;  4AWL B;  3B6G D;  4X23 A;  4QLC D;  1EQZ C;  4KHA A;  2PYO B;  4J8U A;  3NQU A;  3MGQ D;  3AZK B;  1P3M A;  1F1E A;  2Y2J A;  4DRA A;  2BYM A;  5E5A D;  1ID3 A;  4UPK A;  3MGP A;  5B32 C;  3REH A;  1U35 B;  1P3G A;  1HTA A;  5GT0 A;  5DNN A;  5AV5 B;  3X1U D;  3LEL A;  5GXQ D;  3WKJ C;  4J8X C;  3C1B D;  3AYW B;  1M1A C;  3AFA D;  4Z5T B;  3AZF A;  1B6W A;  1P3A A;  3W98 C;  3KXB C;  2NQB A;  3C1C C;  3UT9 A;  1F66 B;  5AV8 C;  5B2J C;  1P3O C;  5AVC B;  1TAF A;  2Y2N A;  3UTA C;  5CPK D;  1M19 B;  1BFM A;  3MNN A;  5GSU C;  1M18 D;  1BH9 A;  2RIQ A;  5KDM B;  3REK A;  3X1S D;  3AZL C;  2ZY3 A;  3AN2 D;  3AZI B;  2RVQ D;  5JRG D;  4WV4 B;  1S32 D;  4X23 D;  3TU4 A;  1P3P A;  3MGR B;  4XUJ A;  5B33 C;  1TZY C;  4HGA C;  4E44 A;  4J8W C;  4J8U D;  3AZN C;  3IP4 C;  1P3M D;  1HQ3 B;  4EO5 C;  2ZY2 A;  1ID3 D;  5G49 B;  4H9O B;  5CHL B;  5F99 A;  3W97 C;  3REH D;  4H9Q A;  3KUY B;  2JSS A;  2HIO C;  1P3G D;  4YS3 C;  5AV9 B;  5GT0 D;  1WWS A;  3LEL D;  3WA9 A;  2YFW A;  4XZQ B;  2FJ7 A;  3AZF D;  4J8V C;  4WJ3 C;  3AZH B;  3X1S C;  1AOI C;  3AN2 C;  2NQB D;  2PYO A;  3UT9 D;  5JRG C;  1H3O B;  5B31 C;  3REL D;  3AZK A;  3O62 B;  1P3B B;  5GSU B;  4NFT A;  2NZD C;  3MNN D;  3WTP C;  3AZL B;  1P34 B;  3B0D C;  4WZS B;  1P3I B;  1P3L D;  3REK D;  3LZ1 B;  5GT3 A;  1U35 A;  1R4V A;  5B0Y B;  5AV5 A;  4ZBJ C;  4G91 B;  3X1T C;  3TU4 D;  4LD9 C;  3AZE B;  1P3P D;  4XUJ D;  3AYW A;  3AZJ B;  4Z5T A;  2Y2L A;  5DNM C;  1P3K C;  5AV6 B;  1F66 A;  5B1L C;  3AZM B;  4CSR B;  5AVC A;  1ZLA D;  3KWQ C;  5B24 C;  3MGP B;  1KU5 A;  5CP6 C;  1M19 A;  2HUE B;  5F99 D;  2Y2I A;  5KDM A;  3MVD B;  3AZI A;  4JJN B;  3WA9 D;  3H0R C;  1AOI B;  2FJ7 D;  2JE5 A;  1KX4 C;  4Z66 C;  3H0M C;  3MGR A;  2PYO D;  5AY8 B;  5B1M B;  4H9S C;  3AV1 C;  1P3F B;  3EG5 B;  3P5J B;  5BS7 C;  1HQ3 A;  2IO5 B;  5G49 A;  3W99 C;  4H9N A;  4WU8 B;  3X1T B;  3KUY A;  1U35 D;  1ZLA C;  5AV9 A;  2YFV B;  1KX3 C;  4XZQ A;  5B2I C;  2ZY5 A;  3AZH A;  3A6N C;  3W96 B;  1H3O A;  5AVC D;  3O62 A;  3A1I A;  3X1V D;  1P3B A;  2F8N B;  5B0Z B;  2ZY4 A;  5GSU A;  1M19 D;  2CV5 B;  3KFU G;  4CAY B;  3AZL A;  3F6T A;  1P34 A;  3LJA C;  3LZ1 A;  3UTB B;  3AZI D;  5B0Y A;  3AZG C;  2Y2P A;  3REJ D;  2ARO B;  3AZE A;  3AZJ A;  3AV2 D;  5CPI C;  5AV6 A;  3REI C;  3B6F B;  2VQR A;  3AZM A;  1HQ3 D;  4CSR A;  1KX5 C;  2HIO A;  4KUD C;  4WU9 D;  5B40 B;  3KUY D;  4YM6 C;  5GT3 B;  4DQY B;  2Y2H A;  4R8P B;  3MVD A;  1BH8 B;  3LZ0 C;  5AV9 D;  4JJN A;  1AOI A;  4XZQ D;  3WAA C;  1JFI B;  4G92 C;  4ZUX C;  3AZH D;  5AY8 A;  5B1M A;  5AVB C;  4WNN B;  5CPJ C;  2L5A A;  4KGC B;  3B6G C;  1P3F A;  4QLC C;  3O62 D;  3MGS B;  3REJ C;  1P3B D;  2CWE A;  1Q9C A;  3AV2 C;  3EPL A;  2J8P A;  3MGQ C;  1P34 D;  4WU8 A;  1P3I D;  2F2A C;  2XD5 A;  3X1T A;  1EQZ B;  5E5A C;  5B0Y D;  2YFV A;  1WWI A;  2F8N K;  3AZE D;  4WU9 C;  3AZJ D;  5CPI B;  3X1U C;  5GXQ C;  3W96 A;  5AV6 D;  3C1B C;  5B32 B;  3AZM D;  3AFA C;  2F8N A;  2DF4 C;  4E45 A;  5B0Z A;  4KUD B;  3MGP D;  2CV5 A;  4H9N B;  4CAY A;  3WKJ B;  4J8X B;  1M1A B;  3UTB A;  3MVD D;  5DNN D;  5CPK C;  3W98 B;  4JJN D;  3KXB B;  3V9R B;  5CPJ B;  5AVB B;  3C1C B;  5AV8 B;  1M18 C;  2ARO A;  1P3A D;  5JA4 B;  5B2J B;  1P3O B;  5AY8 D;  5B1M D;  3UTA B;  2RVQ C;  1S32 C;  4X23 C;  1P3F D;  2F8N G;  3B6F A;  3MGQ B;  4J8U C;  5E5A B;  4WU8 D;  1P3M C;  5B40 A;  2Y2G A;  4R8P A;  5B33 B;  1BH8 A;  1TZY B;  4HGA B;  1ID3 C;  4J8W B;  3AZN B;  3REH C;  1JFI A;  3B0C W;  5FUG B;  3C1B B;  4EO5 B;  5C3I C;  5GT0 C;  5DNN C;  4WNN A;  3LEL C;  1P3G C;  4KGC A;  3W96 D;  3AZF C;  2F8N D;  3W97 B;  3MGS A;  1P3A C;  5B0Z D;  2NQB C;  1ULY A;  2CV5 D;  3UT9 C;  2HIO B;  4YS3 B;  3REL C;  4UUZ B;  2FFF B;  4NE6 A;  2Y2M A;  3UTB D;  4H9R B;  4J8V B;  1EQZ A;  3MNN C;  3X1S B;  3AN2 B;  5JRG B;  1P3L C;  2ARO D;  5B31 B;  3REK C;  5CPI A;  5BT1 D;  2NZD B;  3AZK D;  3WTP B;  3TU4 C;  1Z2C B;  1P3P C;  4XUJ C;  3B0D B;  5B32 A;  3KSY A;  4KUD A;  2XD1 A;  5BNV B;  4ZBJ B;  5B40 D;  3WKJ A;  5GT3 D;  4LD9 B;  4J8X A;  4R8P D;  5BNX B;  1PZR A;  1M1A A;  5AV5 D;  3W98 A;  5DNM B;  5F99 C;  3KXB A;  3V9R A;  2BYK B;  5CPJ A;  5AVB A;  1P3K B;  3C1C A;  3AYW D;  5AV8 A;  4Z5T D;  2Y2O A;  5B1L B;  5JA4 A;  5B2J A;  1P3O A;  4KGC D;  3WA9 C;  3UTA A;  3KWQ B;  5B24 B;  1F66 D;  5CP6 B;  2FJ7 C;  5B32 G;  3MGQ A;  3REL B;  2PYO C;  5E5A A;  3AZK C;  1KX4 B;  4Z66 B;  1EQZ D;  1P3L B;  5B33 A;  1TZY A;  3R45 B;  3AV1 B;  4J8W A;  3AZN A;  3MGR D;  1U35 C;  5FUG A;  3C1B A;  2G5I C;  3VH6 A;  3W99 B;  5B32 D;  3W97 A;  4Z5T C;  4Z2M G;  1ZLA B;  4NE5 A;  4YS3 A;  1KX3 B;  4UUZ A;  5AVC C;  3WKJ D;  3X1V C;  2F8N H;  4J8X D;  5B2I B;  1M1A D;  1M19 C;  4H9R A;  4J8V A;  3W98 D;  3X1S A;  3NQJ B;  3VH5 W;  3KXB D;  3AN2 A;  1N1J B;  3C1C D;  3A6N B;  5AV8 D;  5JRG A;  5B31 A;  5B2J D;  1P3O D;  3AZI C;  1A7W A;  3UTA D;  2NZD A;  3WTP A;  3FDD A;  3MGR C;  3VH6 W;  5GSU D;  3LJA B;  5BNV A;  3AZL D;  1HQ3 C;  3LZ1 D;  3AZG B;  4LD9 A;  5BNX A;  5B33 D;  1TZY D;  5DNM A;  2BYK A;  4J8W D;  1P3K A;  5B31 G;  3AZN D;  3REI B;  3KUY C;  5B1L A;  5AV9 C;  3KWQ A;  5B24 A;  5CP6 A;  4XZQ C;  1KX5 B;  3W97 D;  3REL A;  3AZH C;  5BO0 B;  4YM6 B;  3X1V B;  2HIO D;  4YS3 D;  3LZ0 B;  3O62 C;  1P3B C;  1KX4 A;  3WAA B;  4Z66 A;  4J8V D;  4G92 B;  1P3L A;  4ZUX B;  1AOI D;  1P34 C;  3R45 A;  4H9S A;  3AV1 A;  1P3I C;  2UWX A;  3B6G B;  5B31 D;  3A1K A;  3LZ1 C;  4QLC B;  5BS7 A;  3REJ B;  3EPH A;  5B0Y C;  2NZD D;  4G91 C;  3AV2 B;  3WTP D;  3AZE C;  3AZJ C;  3W99 A;  4H9P B;  3VH5 T;  5AV6 C;  1ZLA A;  2W8S A;  2G5H C;  1KX3 A;  3AZM C;  3X1T D;  4LD9 D;  4WU9 B;  5B2I A;  3MGP C;  2BG1 A;  2HUE C;  2Y2K A;  5DNM D;  3NQJ A;  3VH6 T;  1P3K D;  3EPK A;  3X1U B;  1N1J A;  5GXQ B;  3A6N A;  5B1L D;  3MVD C;  3AFA B;  4JJN C;  3KWQ D;  5B24 D;  5CP6 D;  5AY8 C;  5B1M C;  3EPJ A;  3LJA A;  2JCH A;  5CPK B;  1P3F C;  1KX4 D;  3AL0 C;  1M18 B;  4Z66 D;  3AZG A;  2IO5 C;  4Z2M H;  3AV1 D;  4WU8 C;  1S32 B;  4X23 B;  3REI A;  4KHA B;  4J8U B;  3NQU B;  3B6F D;  1KX5 A;  3W99 D;  1P3M B;  5BO0 A;  4YM6 A;  2BYM B;  3X1V A;  3W96 C;  1ID3 B;  3LZ0 A;  1KX3 D;  4DRB A;  5B2I D;  5B0Z C;  3REH B;  3WAA A;  2CV5 C;  4ZUX A; 
#chains in the Genus database with same CATH homology
 5C3I B;  5DNN B;  5GT0 B;  1P3G B;  3LEL B;  3A6N D;  3B6G A;  3UTB C;  3AZF B;  4QLC A;  3REJ A;  1P3A B;  4NE3 A;  2NQB B;  2DQN C;  4AWL C;  3UT9 B;  3AV2 A;  2Y2Q A;  3MGS D;  2ARO C;  4H9P A;  5BT1 C;  1TAF B;  3LJA D;  2ZM5 A;  3B0C T;  3MNN B;  4H9O A;  3B6F C;  4M6B A;  1B67 A;  1W2E A;  1BH9 B;  3AZG D;  4WU9 A;  3REK B;  3VH5 A;  3B0B A;  3X1U A;  5CPI D;  5GXQ A;  5B40 C;  3REI D;  3TU4 B;  5GT3 C;  1P3P B;  4R8P C;  4XUJ B;  3AFA A;  5AV5 C;  1KX5 D;  3AYW C;  3H0L C;  4KUD D;  4YM6 D;  4KGC C;  1T3U A;  1F66 C;  2LY8 A;  5CPK A;  3LZ0 D;  5F99 B;  3MGS C;  3WAA D;  4H9Q B;  1P3I A;  1M18 A;  4ZUX D;  5CPJ D;  5AVB D;  3WTP E;  3WA9 B;  2YFW B;  1S32 A;  2FJ7 B;  4AWL B;  3B6G D;  4X23 A;  4QLC D;  1EQZ C;  4KHA A;  2PYO B;  4J8U A;  3NQU A;  3MGQ D;  3AZK B;  1P3M A;  1F1E A;  2Y2J A;  4DRA A;  2BYM A;  5E5A D;  1ID3 A;  4UPK A;  3MGP A;  5B32 C;  3REH A;  1U35 B;  1P3G A;  1HTA A;  5GT0 A;  5DNN A;  5AV5 B;  3X1U D;  3LEL A;  5GXQ D;  3WKJ C;  4J8X C;  3C1B D;  3AYW B;  1M1A C;  3AFA D;  4Z5T B;  3AZF A;  1B6W A;  1P3A A;  3W98 C;  3KXB C;  2NQB A;  3C1C C;  3UT9 A;  1F66 B;  5AV8 C;  5B2J C;  1P3O C;  5AVC B;  1TAF A;  2Y2N A;  3UTA C;  5CPK D;  1M19 B;  1BFM A;  3MNN A;  5GSU C;  1M18 D;  1BH9 A;  2RIQ A;  5KDM B;  3REK A;  3X1S D;  3AZL C;  2ZY3 A;  3AN2 D;  3AZI B;  2RVQ D;  5JRG D;  4WV4 B;  1S32 D;  4X23 D;  3TU4 A;  1P3P A;  3MGR B;  4XUJ A;  5B33 C;  1TZY C;  4HGA C;  4E44 A;  4J8W C;  4J8U D;  3AZN C;  3IP4 C;  1P3M D;  1HQ3 B;  4EO5 C;  2ZY2 A;  1ID3 D;  5G49 B;  4H9O B;  5CHL B;  5F99 A;  3W97 C;  3REH D;  4H9Q A;  3KUY B;  2JSS A;  2HIO C;  1P3G D;  4YS3 C;  5AV9 B;  5GT0 D;  1WWS A;  3LEL D;  3WA9 A;  2YFW A;  4XZQ B;  2FJ7 A;  3AZF D;  4J8V C;  4WJ3 C;  3AZH B;  3X1S C;  1AOI C;  3AN2 C;  2NQB D;  2PYO A;  3UT9 D;  5JRG C;  1H3O B;  5B31 C;  3REL D;  3AZK A;  3O62 B;  1P3B B;  5GSU B;  4NFT A;  2NZD C;  3MNN D;  3WTP C;  3AZL B;  1P34 B;  3B0D C;  4WZS B;  1P3I B;  1P3L D;  3REK D;  3LZ1 B;  5GT3 A;  1U35 A;  1R4V A;  5B0Y B;  5AV5 A;  4ZBJ C;  4G91 B;  3X1T C;  3TU4 D;  4LD9 C;  3AZE B;  1P3P D;  4XUJ D;  3AYW A;  3AZJ B;  4Z5T A;  2Y2L A;  5DNM C;  1P3K C;  5AV6 B;  1F66 A;  5B1L C;  3AZM B;  4CSR B;  5AVC A;  1ZLA D;  3KWQ C;  5B24 C;  3MGP B;  1KU5 A;  5CP6 C;  1M19 A;  2HUE B;  5F99 D;  2Y2I A;  5KDM A;  3MVD B;  3AZI A;  4JJN B;  3WA9 D;  3H0R C;  1AOI B;  2FJ7 D;  2JE5 A;  1KX4 C;  4Z66 C;  3H0M C;  3MGR A;  2PYO D;  5AY8 B;  5B1M B;  4H9S C;  3AV1 C;  1P3F B;  3EG5 B;  3P5J B;  5BS7 C;  1HQ3 A;  2IO5 B;  5G49 A;  3W99 C;  4H9N A;  4WU8 B;  3X1T B;  3KUY A;  1U35 D;  1ZLA C;  5AV9 A;  2YFV B;  1KX3 C;  4XZQ A;  5B2I C;  2ZY5 A;  3AZH A;  3A6N C;  3W96 B;  1H3O A;  5AVC D;  3O62 A;  3A1I A;  3X1V D;  1P3B A;  2F8N B;  5B0Z B;  2ZY4 A;  5GSU A;  1M19 D;  2CV5 B;  3KFU G;  4CAY B;  3AZL A;  3F6T A;  1P34 A;  3LJA C;  3LZ1 A;  3UTB B;  3AZI D;  5B0Y A;  3AZG C;  2Y2P A;  3REJ D;  2ARO B;  3AZE A;  3AZJ A;  3AV2 D;  5CPI C;  5AV6 A;  3REI C;  3B6F B;  2VQR A;  3AZM A;  1HQ3 D;  4CSR A;  1KX5 C;  2HIO A;  4KUD C;  4WU9 D;  5B40 B;  3KUY D;  4YM6 C;  5GT3 B;  4DQY B;  2Y2H A;  4R8P B;  3MVD A;  1BH8 B;  3LZ0 C;  5AV9 D;  4JJN A;  1AOI A;  4XZQ D;  3WAA C;  1JFI B;  4G92 C;  4ZUX C;  3AZH D;  5AY8 A;  5B1M A;  5AVB C;  4WNN B;  5CPJ C;  2L5A A;  4KGC B;  3B6G C;  1P3F A;  4QLC C;  3O62 D;  3MGS B;  3REJ C;  1P3B D;  2CWE A;  1Q9C A;  3AV2 C;  3EPL A;  2J8P A;  3MGQ C;  1P34 D;  4WU8 A;  1P3I D;  2F2A C;  2XD5 A;  3X1T A;  1EQZ B;  5E5A C;  5B0Y D;  2YFV A;  1WWI A;  2F8N K;  3AZE D;  4WU9 C;  3AZJ D;  5CPI B;  3X1U C;  5GXQ C;  3W96 A;  5AV6 D;  3C1B C;  5B32 B;  3AZM D;  3AFA C;  2F8N A;  2DF4 C;  4E45 A;  5B0Z A;  4KUD B;  3MGP D;  2CV5 A;  4H9N B;  4CAY A;  3WKJ B;  4J8X B;  1M1A B;  3UTB A;  3MVD D;  5DNN D;  5CPK C;  3W98 B;  4JJN D;  3KXB B;  3V9R B;  5CPJ B;  5AVB B;  3C1C B;  5AV8 B;  1M18 C;  2ARO A;  1P3A D;  5JA4 B;  5B2J B;  1P3O B;  5AY8 D;  5B1M D;  3UTA B;  2RVQ C;  1S32 C;  4X23 C;  1P3F D;  2F8N G;  3B6F A;  3MGQ B;  4J8U C;  5E5A B;  4WU8 D;  1P3M C;  5B40 A;  2Y2G A;  4R8P A;  5B33 B;  1BH8 A;  1TZY B;  4HGA B;  1ID3 C;  4J8W B;  3AZN B;  3REH C;  1JFI A;  3B0C W;  5FUG B;  3C1B B;  4EO5 B;  5C3I C;  5GT0 C;  5DNN C;  4WNN A;  3LEL C;  1P3G C;  4KGC A;  3W96 D;  3AZF C;  2F8N D;  3W97 B;  3MGS A;  1P3A C;  5B0Z D;  2NQB C;  1ULY A;  2CV5 D;  3UT9 C;  2HIO B;  4YS3 B;  3REL C;  4UUZ B;  2FFF B;  4NE6 A;  2Y2M A;  3UTB D;  4H9R B;  4J8V B;  1EQZ A;  3MNN C;  3X1S B;  3AN2 B;  5JRG B;  1P3L C;  2ARO D;  5B31 B;  3REK C;  5CPI A;  5BT1 D;  2NZD B;  3AZK D;  3WTP B;  3TU4 C;  1Z2C B;  1P3P C;  4XUJ C;  3B0D B;  5B32 A;  3KSY A;  4KUD A;  2XD1 A;  5BNV B;  4ZBJ B;  5B40 D;  3WKJ A;  5GT3 D;  4LD9 B;  4J8X A;  4R8P D;  5BNX B;  1PZR A;  1M1A A;  5AV5 D;  3W98 A;  5DNM B;  5F99 C;  3KXB A;  3V9R A;  2BYK B;  5CPJ A;  5AVB A;  1P3K B;  3C1C A;  3AYW D;  5AV8 A;  4Z5T D;  2Y2O A;  5B1L B;  5JA4 A;  5B2J A;  1P3O A;  4KGC D;  3WA9 C;  3UTA A;  3KWQ B;  5B24 B;  1F66 D;  5CP6 B;  2FJ7 C;  5B32 G;  3MGQ A;  3REL B;  2PYO C;  5E5A A;  3AZK C;  1KX4 B;  4Z66 B;  1EQZ D;  1P3L B;  5B33 A;  1TZY A;  3R45 B;  3AV1 B;  4J8W A;  3AZN A;  3MGR D;  1U35 C;  5FUG A;  3C1B A;  2G5I C;  3VH6 A;  3W99 B;  5B32 D;  3W97 A;  4Z5T C;  4Z2M G;  1ZLA B;  4NE5 A;  4YS3 A;  1KX3 B;  4UUZ A;  5AVC C;  3WKJ D;  3X1V C;  2F8N H;  4J8X D;  5B2I B;  1M1A D;  1M19 C;  4H9R A;  4J8V A;  3W98 D;  3X1S A;  3NQJ B;  3VH5 W;  3KXB D;  3AN2 A;  1N1J B;  3C1C D;  3A6N B;  5AV8 D;  5JRG A;  5B31 A;  5B2J D;  1P3O D;  3AZI C;  1A7W A;  3UTA D;  2NZD A;  3WTP A;  3FDD A;  3MGR C;  3VH6 W;  5GSU D;  3LJA B;  5BNV A;  3AZL D;  1HQ3 C;  3LZ1 D;  3AZG B;  4LD9 A;  5BNX A;  5B33 D;  1TZY D;  5DNM A;  2BYK A;  4J8W D;  1P3K A;  5B31 G;  3AZN D;  3REI B;  3KUY C;  5B1L A;  5AV9 C;  3KWQ A;  5B24 A;  5CP6 A;  4XZQ C;  1KX5 B;  3W97 D;  3REL A;  3AZH C;  5BO0 B;  4YM6 B;  3X1V B;  2HIO D;  4YS3 D;  3LZ0 B;  3O62 C;  1P3B C;  1KX4 A;  3WAA B;  4Z66 A;  4J8V D;  4G92 B;  1P3L A;  4ZUX B;  1AOI D;  1P34 C;  3R45 A;  4H9S A;  3AV1 A;  1P3I C;  2UWX A;  3B6G B;  5B31 D;  3A1K A;  3LZ1 C;  4QLC B;  5BS7 A;  3REJ B;  3EPH A;  5B0Y C;  2NZD D;  4G91 C;  3AV2 B;  3WTP D;  3AZE C;  3AZJ C;  3W99 A;  4H9P B;  3VH5 T;  5AV6 C;  1ZLA A;  2W8S A;  2G5H C;  1KX3 A;  3AZM C;  3X1T D;  4LD9 D;  4WU9 B;  5B2I A;  3MGP C;  2BG1 A;  2HUE C;  2Y2K A;  5DNM D;  3NQJ A;  3VH6 T;  1P3K D;  3EPK A;  3X1U B;  1N1J A;  5GXQ B;  3A6N A;  5B1L D;  3MVD C;  3AFA B;  4JJN C;  3KWQ D;  5B24 D;  5CP6 D;  5AY8 C;  5B1M C;  3EPJ A;  3LJA A;  2JCH A;  5CPK B;  1P3F C;  1KX4 D;  3AL0 C;  1M18 B;  4Z66 D;  3AZG A;  2IO5 C;  4Z2M H;  3AV1 D;  4WU8 C;  1S32 B;  4X23 B;  3REI A;  4KHA B;  4J8U B;  3NQU B;  3B6F D;  1KX5 A;  3W99 D;  1P3M B;  5BO0 A;  4YM6 A;  2BYM B;  3X1V A;  3W96 C;  1ID3 B;  3LZ0 A;  1KX3 D;  4DRB A;  5B2I D;  5B0Z C;  3REH B;  3WAA A;  2CV5 C;  4ZUX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...