5BT1D

Histone chaperone hif1 playing with histone h2a-h2b dimer
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
90
structure length
90
Chain Sequence
KETYSSYIYKVLKQTHPDTGISQKSMSILNSFVNDIFERIATEASKLAAYNKKSTISAREIQTAVRLILPGELAKHAVSEGTRAVTKYSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Insights into the Association of Hif1 with Histones H2A-H2B Dimer and H3-H4 Tetramer
pubmed doi rcsb
source organism Saccharomyces cerevisiae (strain atcc 204508 / s288c)
molecule tags Chaperone
molecule keywords HAT1-interacting factor 1
total genus 35
structure length 90
sequence length 90
ec nomenclature
pdb deposition date 2015-06-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5bt1D00
1EQZD 3W96C 4Z66B 3REKB 1M18B 3REHA 1F66B 3C1CA 5AY8B 4XZQB 4G92C 5B32D 5B32B 3B0CW 3AZGD 1P3MC 3UT9D 1ZLAC 1HQ3A 3WTPB 4NE5A 3AZNC 3KUYA 4KUDD 4J8WD 3MVDC 1U35C 4XZQA 5JRGC 3RELC 1KX5C 3WA9C 5B32C 5CPKA 1HQ3D 5CPIA 1HQ3B 1TAFA 1ID3B 3KSYA 3VH6T 3AZEB 3AV2C 3AZFC 4HGAC 4Z66C 3REKC 1M18C 3W96B 5AV9C 3AZHA 3AFAB 3MGSB 2AROD 3X1SC 2CV5C 5CP6C 3LELB 4H9NA 5AV6C 3X1TC 4Z5TC 1P3BA 3NQUA 1KX4C 3AN2D 1P3OB 1EQZC 5F99B 1KX3D 4H9OA 2HUEB 1P3BD 1BH8A 3B6FC 1M1AB 3VH5W 3REHB 1F66A 3W98C 2NQBB 1P3MD 3LJAC 5AVBC 1P3KB 3VH6A 3MGQB 4QLCB 4ZUXA 3A6NA 1A7WA 3UTAC 1M19D 3AZKD 3LJAA 3O62D 4YM6D 1N1JB 4J8UD 2NQBA 4QLCC 5DNNA 3AV1D 3WAAB 3LJAB 3AV1B 1M19A 1P3PD 5B0YB 1P3OD 3AZKA 3WAAD 3W97C 3MGPD 3REJA 4WU9D 3MNNA 3TU4A 3AZFD 3AYWB 1P3KA 2NZDA 4Z66D 3REKD 1M18D 3REHC 3LELD 4KHAA 3LZ0A 3WAAA 3AYWC 1ID3A 2F8ND 4LD9A 3AV1C 4R8PA 4E44A 1TZYD 3LZ0D 5AV8D 3UTBD 1M1AD 3KXBD 3AZLD 3UTAB 4R8PD 3REIA 1B67A 1TZYA 5B1MC 2BYKB 3X1VD 5B0YD 3MGSA 3VH5T 4J8XA 4H9OB 4H9SA 5B1LB 5F99C 3MGSD 3WTPA 1P3LD 2BYMA 1KX4B 3MVDB 5GSUC 4J8UC 5B0ZA 3B6GD 4KGCD 1Q9CA 5B33C 1KX4A 1ZLAB 5DNMB 2BYKA 3UT9C 1ZLAD 4J8XC 3C1CB 2LY8A 3AZJD 2HIOD 5AV6D 4Z5TD 5GSUD 3B6GC 4EO5B 5B31D 5B2JA 5AV9A 2IO5B 3AZHC 4KGCC 3AZJA 2PYOD 3W97A 4AWLC 3KUYB 2FJ7B 2PYOB 1P3GC 2NZDC 3WKJD 5AV9D 3VH5A 3MGRD 3LZ1A 1P3MB 2AROC 5CP6D 4X23A 3X1VC 3AZNA 4Z2MG 3MGRC 5GT3D 1F66C 1P3AD 1ULYA 3AZND 4CAYA 3REJB 3AZGA 3C1CC 3AN2B 1P3PC 5AVCB 5JRGD 3X1UB 5DNNB 3RELD 5GT3A 3A6NC 5C3IB 4ZUXC 1KX5D 4CAYB 2FJ7D 4XZQD 5B2ID 3AZIB 5B31B 5GXQA 1P3AC 4QLCA 1BFMA 4Z2MH 3NQJB 5G49B 5B1MA 4G91B 3AZHD 4QLCD 1M19B 4NFTA 3MNND 4J8VB 3TU4D 3AZFA 4WU9A 1P3FB 3W96D 1KX3C 1ID3D 1S32C 5CPJC 3C1BC 1P3LB 2F8NA 3W96A 2F8NH 3REIC 3B6FD 3MNNC 1B6WA 3TU4C 1P3IC 4XUJB 5AVBB 5F99D 1KX3B 4X23B 1F66D 5B24C 5E5AD 4LD9C 2NQBC 5F99A 3AZLB 1S32A 1TAFB 1AOIB 5AVCD 4ZUXD 5B0YC 3A6ND 3R45B 4YS3A 2HUEC 4WNNB 5E5AA 5B40B 3KWQB 3AZJB 3O62A 3KWQD 1P3GA 1P3IB 5AV5A 5E5AC 2NQBD 3V9RB 3LELC 3X1TB 3MGPA 3X1SB 2CV5B 1JFIA 1P3PB 1KU5A 3MGPB 1ZLAA 4HGAB 5CPKB 4YM6B 1P3BC 5JA4B 3KXBC 5BS7A 1P3IA 2BYMB 1ID3C 5GSUA 5CPJD 5AY8D 5B0ZC 3W98D 3W99B 1WWIA 1AOIA 1U35B 2HIOB 3REID 1P3AB 3LZ0B 3AV2A 4Z5TB 1P3ID 5AV6B 2YFVA 1P34B 3WKJA 3UTAD 3REHD 2F8NB 5DNNC 3B0DB 3X1VA 3LZ1D 1AOID 5B0YA 4AWLB 5AV8B 1TZYB 1N1JA 4XZQC 3UTAA 4EO5C 3MGRB 4WU8B 3AZEC 1BH9A 5BNXA 4CSRA 4H9RB 4KGCA 2AROB 1HTAA 5JRGA 3RELA 1KX5A 3WTPC 4J8UB 1F1EA 3LZ0C 3B0BA 3AYWA 3KUYC 2FJ7C 2NZDB 3UT9A 5GXQD 4H9PB 4Z5TA 4G92B 5B2JD 4KUDA 2IO5C 4KGCB 3B6GB 1P3BB 2YFWA 4NE6A 4ZBJB 4JJND 4KUDB 4H9SC 4WU8A 3UT9B 3C1BA 3AZGB 5BT1D 1P34C 2JSSA 5CPIC 4WU8D 2HIOC 5GT3C 3C1BD 2AROA 3AZMC 3B6FA 3KWQC 5B33D 3AZED 3O62B 5B2JB 3AZKC 4YS3B 2F8NK 5B33A 5B24B 5JA4A 5B24D 3X1TA 3AZMD 2FJ7A 3W97B 5AV5B 3WAAC 5DNMA 1P3PA 4H9QA 5E5AB 5AVBA 3KWQA 4Z66A 3REKA 1M18A 3MGQC 1P3KC 5B40C 5B2IB 5KDMB 3AZID 4J8VC 1P3FC 4R8PB 3R45A 4E45A 3UTBC 1M1AC 3MVDA 5B2IC 4J8VA 1P3FA 1P3KD 4XUJC 3AZMB 1EQZB 1H3OB 3MNNB 5AY8A 3MVDD 3TU4B 4J8VD 1P3FD 4LD9D 2RVQC 5CP6B 4H9RA 4NE3A 3AZGC 4WU9B 5AVCC 3KXBA 5BNVA 3W99D 3W98B 4KUDC 3WTPD 3B6FB 4UUZA 3WTPE 5AV5D 4J8XD 3WA9B 2HIOA 5C3IC 3NQUB 4ZUXB 3A6NB 1P3LA 3MGSC 4H9NB 4J8WA 5B0ZD 3B6GA 4ZBJC 2PYOA 1KX4D 3AZFB 3X1UA 5CPID 4WU8C 4H9PA 1WWSA 3AFAA 1R4VA 5BNVB 1HQ3C 1JFIB 5AV6A 5JRGB 3X1UD 3RELB 1KX5B 3X1SA 2CV5A 3NQJA 5CP6A 4X23D 4JJNC 3AZNB 4DRAA 5GSUB 4JJNB 3W97D 1EQZA 5BO0B 5BT1C 1P3GB 2PYOC 3W99C 3LZ1B 3MGRA 3C1CD 5B1LC 3AN2A 5AY8C 3AZHB 3KXBB 5B1LA 5B32A 5CPKC 3AZEA 5B2IA 1TZYC 3MGPC 5B40D 5AV8C 3WKJB 4J8XB 4DRBA 3KUYD 3B0DC 4WV4B 5B1LD 5DNMC 4J8WC 5GXQC 1P3AA 5B33B 5B24A 3AZMA 1P3MA 3AYWD 4WNNA 5B40A 5CPKD 4WZSB 3LJAD 5AVBD 3V9RA 5B0ZB 4YM6A 4XUJD 5KDMA 5DNND 1AOIC 4JJNA 4YM6C 2L5AA 3UTBB 3REJD 4XUJA 5B1MD 2F8NG 5B1MB 4X23C 4WU9C 4H9QB 4M6BA 5FUGB 1KX3A 5GT0C 3C1BB 3AZJC 3AZLA 5AV5C 1S32B 1P3LC 5B32G 1S32D 4KHAB 2RVQD 5BO0A 3AZLC 2YFWB 4R8PC 4YS3C 3AZKB 3X1TD 4LD9B 5B2JC 4G91C 5DNMD 4CSRB 1BH8B 5GT0B 4UUZB 3REIB 4J8UA 5GT3B 3AV1A 5AVCA 4YS3D 3AZIC 1P3OA 2NZDD 5CPJB 1P34D 1P3GD 5GXQB 4J8WB 2CWEA 3B0CT 3X1UC 3AZIA 3LELA 1U35D 3WA9D 5CHLB 5CPJA 3REJC 3VH6W 5AV9B 5BS7C 1M19C 2YFVB 1P34A 5G49A 5B31G 3O62C 3AV2B 3AV2D 1H3OA 1U35A 5GT0A 3WA9A 5AV8A 5B31A 3UTBA 3AFAD 1M1AA 3LZ1C 3X1VB 1P3OC 3MGQD 5B31C 5CPIB 1BH9B 5BNXB 5GT0D 3X1SD 2CV5D 5FUGA 3W98A 3MGQA 3W99A 3WKJC 3AN2C 3AFAC
chains in the Genus database with same CATH superfamily
1EQZD 3W96C 4Z66B 3REKB 1M18B 3REHA 1F66B 3C1CA 2Y2GA 5AY8B 4XZQB 4G92C 5B32D 2G5HC 5B32B 3B0CW 2Y2OA 3AZGD 1P3MC 3UT9D 1ZLAC 1HQ3A 3WTPB 4NE5A 3AZNC 3KUYA 4KUDD 4J8WD 3MVDC 1U35C 4XZQA 5JRGC 3RELC 1KX5C 3WA9C 5B32C 5CPKA 1HQ3D 5CPIA 1HQ3B 1TAFA 1ID3B 3KSYA 3VH6T 3AZEB 3AV2C 3AZFC 4HGAC 4Z66C 3REKC 1M18C 3W96B 5AV9C 3AZHA 3AFAB 3MGSB 1PZRA 2AROD 3X1SC 2CV5C 2Y2LA 5CP6C 3LELB 4H9NA 5AV6C 3X1TC 4Z5TC 1P3BA 3NQUA 1KX4C 3AN2D 2UWXA 1P3OB 1EQZC 5F99B 1KX3D 2Y2IA 4H9OA 2HUEB 1P3BD 1BH8A 3B6FC 1M1AB 3VH5W 3REHB 1F66A 3W98C 2NQBB 1P3MD 3LJAC 5AVBC 1P3KB 3VH6A 3MGQB 4QLCB 4ZUXA 3A6NA 1A7WA 2FFFB 3UTAC 1M19D 3AZKD 3LJAA 3O62D 4YM6D 1N1JB 4J8UD 2NQBA 4QLCC 5DNNA 3AV1D 3WAAB 3LJAB 3AV1B 1M19A 1P3PD 5B0YB 1P3OD 3AZKA 3WAAD 3W97C 3MGPD 3REJA 4WU9D 3MNNA 3TU4A 3AZFD 3AYWB 1P3KA 3KFUG 4Z66D 3REKD 1M18D 3REHC 3LELD 4KHAA 2F2AC 3LZ0A 3WAAA 3AYWC 1ID3A 2F8ND 4LD9A 3AV1C 4R8PA 4E44A 1TZYD 3LZ0D 5AV8D 3UTBD 4DQYB 1M1AD 3KXBD 3AZLD 3UTAB 4R8PD 3REIA 1B67A 1TZYA 5B1MC 2BYKB 3X1VD 5B0YD 3MGSA 3VH5T 3EPLA 4J8XA 4H9OB 4H9SA 5B1LB 5F99C 3MGSD 3WTPA 1P3LD 2BYMA 1KX4B 3MVDB 5GSUC 4J8UC 5B0ZA 3B6GD 4KGCD 1Q9CA 5B33C 2Y2PA 2Y2JA 1KX4A 5DNMB 1ZLAB 2BYKA 3UT9C 1ZLAD 4J8XC 3C1CB 2LY8A 2Y2QA 3AZJD 2HIOD 5AV6D 4Z5TD 5GSUD 3B6GC 4EO5B 5B31D 5B2JA 5AV9A 2IO5B 3AZHC 4KGCC 3AZJA 2PYOD 3W97A 4AWLC 3KUYB 2FJ7B 2PYOB 1P3GC 2NZDC 3WKJD 5AV9D 2DQNC 3VH5A 3MGRD 3LZ1A 3P5JB 1P3MB 2AROC 5CP6D 4X23A 3X1VC 3AZNA 4Z2MG 2XD5A 3MGRC 5GT3D 3F6TA 1F66C 1P3AD 1ULYA 3AZND 4CAYA 3REJB 3AZGA 3C1CC 3AN2B 1P3PC 5AVCB 5JRGD 3X1UB 5DNNB 3RELD 5GT3A 5C3IB 4ZUXC 3A6NC 1KX5D 4CAYB 3A1KA 2FJ7D 4XZQD 5B2ID 3AZIB 5B31B 5GXQA 1P3AC 4QLCA 1BFMA 4Z2MH 3EG5B 3NQJB 5G49B 5B1MA 4G91B 3AZHD 4QLCD 4WJ3C 1M19B 4NFTA 3MNND 4J8VB 3TU4D 3AZFA 4WU9A 1P3FB 3W96D 1KX3C 1ID3D 1S32C 5CPJC 3C1BC 1P3LB 2F8NA 3IP4C 3W96A 2F8NH 3REIC 3B6FD 3MNNC 1B6WA 3TU4C 1P3IC 4XUJB 5AVBB 5F99D 1KX3B 4X23B 2Y2HA 1F66D 5B24C 5E5AD 4LD9C 2NQBC 5F99A 3AZLB 1S32A 1TAFB 1AOIB 5AVCD 2Y2KA 4ZUXD 5B0YC 3R45B 3A6ND 2HUEC 4YS3A 4WNNB 5E5AA 5B40B 3KWQB 3AZJB 3O62A 3KWQD 1P3GA 1P3IB 2ZY5A 5AV5A 5E5AC 2NQBD 3V9RB 3LELC 3X1TB 3MGPA 3X1SB 2CV5B 1JFIA 1P3PB 1KU5A 3MGPB 1ZLAA 4HGAB 5CPKB 3H0RC 4YM6B 1P3BC 5JA4B 3KXBC 5BS7A 1P3IA 2BYMB 1ID3C 5GSUA 5CPJD 5AY8D 5B0ZC 3W98D 3W99B 1WWIA 1AOIA 1U35B 2HIOB 3REID 1P3AB 3LZ0B 3AV2A 4Z5TB 1P3ID 5AV6B 2YFVA 1P34B 3WKJA 2ZM5A 3UTAD 3REHD 2F8NB 5DNNC 3B0DB 3X1VA 3LZ1D 1AOID 5B0YA 4AWLB 5AV8B 3EPJA 1TZYB 1N1JA 4XZQC 3UTAA 2G5IC 4EO5C 3MGRB 4WU8B 3AZEC 1BH9A 5BNXA 4CSRA 4H9RB 4KGCA 2AROB 1HTAA 5JRGA 3RELA 2W8SA 1KX5A 3WTPC 4J8UB 1T3UA 1F1EA 3LZ0C 3B0BA 3AYWA 3KUYC 2FJ7C 2NZDB 3UT9A 5GXQD 4H9PB 4Z5TA 4G92B 4UPKA 5B2JD 4KUDA 2IO5C 4KGCB 3B6GB 1P3BB 2YFWA 4NE6A 4ZBJB 4JJND 4KUDB 2RIQA 2NZDA 4H9SC 4WU8A 3UT9B 3C1BA 3AZGB 5BT1D 1P34C 2JSSA 2DF4C 5CPIC 4WU8D 2HIOC 5GT3C 3C1BD 2AROA 3AZMC 3B6FA 3KWQC 5B33D 3AZED 3O62B 1Z2CB 5B2JB 3AZKC 4YS3B 2F8NK 5B33A 5B24B 5JA4A 5B24D 3X1TA 3AZMD 2FJ7A 3W97B 3EPKA 5AV5B 3WAAC 5DNMA 1P3PA 4H9QA 5E5AB 5AVBA 3KWQA 4Z66A 3REKA 1M18A 3MGQC 1P3KC 5B40C 5B2IB 5KDMB 3AZID 4J8VC 1P3FC 4R8PB 3R45A 4E45A 3UTBC 1M1AC 3MVDA 5B2IC 4J8VA 1P3FA 1P3KD 3FDDA 3AL0C 4XUJC 3AZMB 1EQZB 1H3OB 3MNNB 5AY8A 3MVDD 3TU4B 4J8VD 1P3FD 4LD9D 2RVQC 5CP6B 4H9RA 4NE3A 3AZGC 4WU9B 5AVCC 2BG1A 5BNVA 3KXBA 3W99D 3W98B 4KUDC 3WTPD 3B6FB 4UUZA 3WTPE 5AV5D 3H0LC 4J8XD 3WA9B 3EPHA 2ZY4A 2HIOA 5C3IC 3NQUB 4ZUXB 3A6NB 1P3LA 3MGSC 4H9NB 4J8WA 5B0ZD 3B6GA 4ZBJC 2PYOA 1KX4D 3AZFB 3X1UA 5CPID 4WU8C 4H9PA 1WWSA 3AFAA 1R4VA 5BNVB 1HQ3C 1JFIB 2Y2NA 5AV6A 5JRGB 3X1UD 3RELB 1KX5B 3X1SA 2CV5A 3NQJA 5CP6A 4X23D 4JJNC 3AZNB 4DRAA 5GSUB 4JJNB 3W97D 1EQZA 5BO0B 5BT1C 1P3GB 2PYOC 3W99C 3LZ1B 3MGRA 3C1CD 5B1LC 3AN2A 5AY8C 3AZHB 3KXBB 5B1LA 5B32A 5CPKC 2VQRA 3AZEA 5B2IA 1TZYC 3MGPC 5B40D 5AV8C 3WKJB 4J8XB 3H0MC 4DRBA 3KUYD 3B0DC 4WV4B 5B1LD 5DNMC 4J8WC 5GXQC 1P3AA 5B33B 5B24A 3AZMA 1P3MA 3AYWD 4WNNA 5B40A 5CPKD 4WZSB 3LJAD 5AVBD 1W2EA 3V9RA 5B0ZB 4XUJD 4YM6A 5KDMA 5DNND 1AOIC 4JJNA 4YM6C 2L5AA 3UTBB 2JE5A 3REJD 4XUJA 5B1MD 2F8NG 5B1MB 4X23C 4WU9C 2ZY2A 4H9QB 4M6BA 5FUGB 1KX3A 5GT0C 2J8PA 3C1BB 3AZJC 3AZLA 5AV5C 2ZY3A 1S32B 1P3LC 5B32G 2JCHA 1S32D 4KHAB 2RVQD 5BO0A 3AZLC 2YFWB 4R8PC 4YS3C 3AZKB 3X1TD 4LD9B 5B2JC 4G91C 5DNMD 4CSRB 1BH8B 5GT0B 4UUZB 3REIB 4J8UA 5GT3B 3AV1A 5AVCA 4YS3D 2XD1A 3AZIC 1P3OA 2NZDD 5CPJB 1P34D 1P3GD 5GXQB 4J8WB 2CWEA 3B0CT 3X1UC 3AZIA 3LELA 1U35D 3WA9D 5CHLB 5CPJA 3REJC 3VH6W 5AV9B 5BS7C 1M19C 2YFVB 1P34A 5G49A 5B31G 3O62C 3AV2B 3AV2D 1H3OA 1U35A 5GT0A 3WA9A 5AV8A 5B31A 3UTBA 3AFAD 1M1AA 3LZ1C 3X1VB 1P3OC 3MGQD 2Y2MA 5B31C 5CPIB 1BH9B 5BNXB 5GT0D 3X1SD 2CV5D 5FUGA 3W98A 3MGQA 3W99A 3A1IA 3WKJC 3AN2C 3AFAC
chains in the Genus database with same CATH topology
1EQZD 3W96C 4Z66B 3REKB 1M18B 3REHA 1F66B 3C1CA 2Y2GA 5AY8B 4XZQB 4G92C 5B32D 2G5HC 5B32B 3B0CW 2Y2OA 3AZGD 1P3MC 3UT9D 1ZLAC 1HQ3A 3WTPB 4NE5A 3AZNC 3KUYA 4KUDD 4J8WD 3MVDC 1U35C 4XZQA 5JRGC 3RELC 1KX5C 3WA9C 5B32C 5CPKA 1HQ3D 5CPIA 1HQ3B 1TAFA 1ID3B 3KSYA 3VH6T 3AZEB 3AV2C 3AZFC 4HGAC 4Z66C 3REKC 1M18C 3W96B 5AV9C 3AZHA 3AFAB 3MGSB 1PZRA 2AROD 3X1SC 2CV5C 2Y2LA 5CP6C 3LELB 4H9NA 5AV6C 3X1TC 4Z5TC 1P3BA 3NQUA 1KX4C 3AN2D 2UWXA 1P3OB 1EQZC 5F99B 1KX3D 2Y2IA 4H9OA 2HUEB 1P3BD 1BH8A 3B6FC 1M1AB 3VH5W 3REHB 1F66A 3W98C 2NQBB 1P3MD 3LJAC 5AVBC 1P3KB 3VH6A 3MGQB 4QLCB 4ZUXA 3A6NA 1A7WA 2FFFB 3UTAC 1M19D 3AZKD 3LJAA 3O62D 4YM6D 1N1JB 4J8UD 2NQBA 4QLCC 5DNNA 3AV1D 3WAAB 3LJAB 3AV1B 1M19A 1P3PD 5B0YB 1P3OD 3AZKA 3WAAD 3W97C 3MGPD 3REJA 4WU9D 3MNNA 3TU4A 3AZFD 3AYWB 1P3KA 3KFUG 4Z66D 3REKD 1M18D 3REHC 3LELD 4KHAA 2F2AC 3LZ0A 3WAAA 3AYWC 1ID3A 2F8ND 4LD9A 3AV1C 4R8PA 4E44A 1TZYD 3LZ0D 5AV8D 3UTBD 4DQYB 1M1AD 3KXBD 3AZLD 3UTAB 4R8PD 3REIA 1B67A 1TZYA 5B1MC 2BYKB 3X1VD 5B0YD 3MGSA 3VH5T 3EPLA 4J8XA 4H9OB 4H9SA 5B1LB 5F99C 3MGSD 3WTPA 1P3LD 2BYMA 1KX4B 3MVDB 5GSUC 4J8UC 5B0ZA 3B6GD 4KGCD 1Q9CA 5B33C 2Y2PA 2Y2JA 1KX4A 5DNMB 1ZLAB 2BYKA 3UT9C 1ZLAD 4J8XC 3C1CB 2LY8A 2Y2QA 3AZJD 2HIOD 5AV6D 4Z5TD 5GSUD 3B6GC 4EO5B 5B31D 5B2JA 5AV9A 2IO5B 3AZHC 4KGCC 3AZJA 2PYOD 3W97A 4AWLC 3KUYB 2FJ7B 2PYOB 1P3GC 2NZDC 3WKJD 5AV9D 2DQNC 3VH5A 3MGRD 3LZ1A 3P5JB 1P3MB 2AROC 5CP6D 4X23A 3X1VC 3AZNA 4Z2MG 2XD5A 3MGRC 5GT3D 3F6TA 1F66C 1P3AD 1ULYA 3AZND 4CAYA 3REJB 3AZGA 3C1CC 3AN2B 1P3PC 5AVCB 5JRGD 3X1UB 5DNNB 3RELD 5GT3A 5C3IB 4ZUXC 3A6NC 1KX5D 4CAYB 3A1KA 2FJ7D 4XZQD 5B2ID 3AZIB 5B31B 5GXQA 1P3AC 4QLCA 1BFMA 4Z2MH 3EG5B 3NQJB 5G49B 5B1MA 4G91B 3AZHD 4QLCD 4WJ3C 1M19B 4NFTA 3MNND 4J8VB 3TU4D 3AZFA 4WU9A 1P3FB 3W96D 1KX3C 1ID3D 1S32C 5CPJC 3C1BC 1P3LB 2F8NA 3IP4C 3W96A 2F8NH 3REIC 3B6FD 3MNNC 1B6WA 3TU4C 1P3IC 4XUJB 5AVBB 5F99D 1KX3B 4X23B 2Y2HA 1F66D 5B24C 5E5AD 4LD9C 2NQBC 5F99A 3AZLB 1S32A 1TAFB 1AOIB 5AVCD 2Y2KA 4ZUXD 5B0YC 3R45B 3A6ND 2HUEC 4YS3A 4WNNB 5E5AA 5B40B 3KWQB 3AZJB 3O62A 3KWQD 1P3GA 1P3IB 2ZY5A 5AV5A 5E5AC 2NQBD 3V9RB 3LELC 3X1TB 3MGPA 3X1SB 2CV5B 1JFIA 1P3PB 1KU5A 3MGPB 1ZLAA 4HGAB 5CPKB 3H0RC 4YM6B 1P3BC 5JA4B 3KXBC 5BS7A 1P3IA 2BYMB 1ID3C 5GSUA 5CPJD 5AY8D 5B0ZC 3W98D 3W99B 1WWIA 1AOIA 1U35B 2HIOB 3REID 1P3AB 3LZ0B 3AV2A 4Z5TB 1P3ID 5AV6B 2YFVA 1P34B 3WKJA 2ZM5A 3UTAD 3REHD 2F8NB 5DNNC 3B0DB 3X1VA 3LZ1D 1AOID 5B0YA 4AWLB 5AV8B 3EPJA 1TZYB 1N1JA 4XZQC 3UTAA 2G5IC 4EO5C 3MGRB 4WU8B 3AZEC 1BH9A 5BNXA 4CSRA 4H9RB 4KGCA 2AROB 1HTAA 5JRGA 3RELA 2W8SA 1KX5A 3WTPC 4J8UB 1T3UA 1F1EA 3LZ0C 3B0BA 3AYWA 3KUYC 2FJ7C 2NZDB 3UT9A 5GXQD 4H9PB 4Z5TA 4G92B 4UPKA 5B2JD 4KUDA 2IO5C 4KGCB 3B6GB 1P3BB 2YFWA 4NE6A 4ZBJB 4JJND 4KUDB 2RIQA 2NZDA 4H9SC 4WU8A 3UT9B 3C1BA 3AZGB 5BT1D 1P34C 2JSSA 2DF4C 5CPIC 4WU8D 2HIOC 5GT3C 3C1BD 2AROA 3AZMC 3B6FA 3KWQC 5B33D 3AZED 3O62B 1Z2CB 5B2JB 3AZKC 4YS3B 2F8NK 5B33A 5B24B 5JA4A 5B24D 3X1TA 3AZMD 2FJ7A 3W97B 3EPKA 5AV5B 3WAAC 5DNMA 1P3PA 4H9QA 5E5AB 5AVBA 3KWQA 4Z66A 3REKA 1M18A 3MGQC 1P3KC 5B40C 5B2IB 5KDMB 3AZID 4J8VC 1P3FC 4R8PB 3R45A 4E45A 3UTBC 1M1AC 3MVDA 5B2IC 4J8VA 1P3FA 1P3KD 3FDDA 3AL0C 4XUJC 3AZMB 1EQZB 1H3OB 3MNNB 5AY8A 3MVDD 3TU4B 4J8VD 1P3FD 4LD9D 2RVQC 5CP6B 4H9RA 4NE3A 3AZGC 4WU9B 5AVCC 2BG1A 5BNVA 3KXBA 3W99D 3W98B 4KUDC 3WTPD 3B6FB 4UUZA 3WTPE 5AV5D 3H0LC 4J8XD 3WA9B 3EPHA 2ZY4A 2HIOA 5C3IC 3NQUB 4ZUXB 3A6NB 1P3LA 3MGSC 4H9NB 4J8WA 5B0ZD 3B6GA 4ZBJC 2PYOA 1KX4D 3AZFB 3X1UA 5CPID 4WU8C 4H9PA 1WWSA 3AFAA 1R4VA 5BNVB 1HQ3C 1JFIB 2Y2NA 5AV6A 5JRGB 3X1UD 3RELB 1KX5B 3X1SA 2CV5A 3NQJA 5CP6A 4X23D 4JJNC 3AZNB 4DRAA 5GSUB 4JJNB 3W97D 1EQZA 5BO0B 5BT1C 1P3GB 2PYOC 3W99C 3LZ1B 3MGRA 3C1CD 5B1LC 3AN2A 5AY8C 3AZHB 3KXBB 5B1LA 5B32A 5CPKC 2VQRA 3AZEA 5B2IA 1TZYC 3MGPC 5B40D 5AV8C 3WKJB 4J8XB 3H0MC 4DRBA 3KUYD 3B0DC 4WV4B 5B1LD 5DNMC 4J8WC 5GXQC 1P3AA 5B33B 5B24A 3AZMA 1P3MA 3AYWD 4WNNA 5B40A 5CPKD 4WZSB 3LJAD 5AVBD 1W2EA 3V9RA 5B0ZB 4XUJD 4YM6A 5KDMA 5DNND 1AOIC 4JJNA 4YM6C 2L5AA 3UTBB 2JE5A 3REJD 4XUJA 5B1MD 2F8NG 5B1MB 4X23C 4WU9C 2ZY2A 4H9QB 4M6BA 5FUGB 1KX3A 5GT0C 2J8PA 3C1BB 3AZJC 3AZLA 5AV5C 2ZY3A 1S32B 1P3LC 5B32G 2JCHA 1S32D 4KHAB 2RVQD 5BO0A 3AZLC 2YFWB 4R8PC 4YS3C 3AZKB 3X1TD 4LD9B 5B2JC 4G91C 5DNMD 4CSRB 1BH8B 5GT0B 4UUZB 3REIB 4J8UA 5GT3B 3AV1A 5AVCA 4YS3D 2XD1A 3AZIC 1P3OA 2NZDD 5CPJB 1P34D 1P3GD 5GXQB 4J8WB 2CWEA 3B0CT 3X1UC 3AZIA 3LELA 1U35D 3WA9D 5CHLB 5CPJA 3REJC 3VH6W 5AV9B 5BS7C 1M19C 2YFVB 1P34A 5G49A 5B31G 3O62C 3AV2B 3AV2D 1H3OA 1U35A 5GT0A 3WA9A 5AV8A 5B31A 3UTBA 3AFAD 1M1AA 3LZ1C 3X1VB 1P3OC 3MGQD 2Y2MA 5B31C 5CPIB 1BH9B 5BNXB 5GT0D 3X1SD 2CV5D 5FUGA 3W98A 3MGQA 3W99A 3A1IA 3WKJC 3AN2C 3AFAC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EQZ D;  3W96 C;  4Z66 B;  3REK B;  1M18 B;  3REH A;  1F66 B;  3C1C A;  5AY8 B;  4XZQ B;  4G92 C;  5B32 D;  5B32 B;  3B0C W;  3AZG D;  1P3M C;  3UT9 D;  1ZLA C;  1HQ3 A;  3WTP B;  4NE5 A;  3AZN C;  3KUY A;  4KUD D;  4J8W D;  3MVD C;  1U35 C;  4XZQ A;  5JRG C;  3REL C;  1KX5 C;  3WA9 C;  5B32 C;  5CPK A;  1HQ3 D;  5CPI A;  1HQ3 B;  1TAF A;  1ID3 B;  3KSY A;  3VH6 T;  3AZE B;  3AV2 C;  3AZF C;  4HGA C;  4Z66 C;  3REK C;  1M18 C;  3W96 B;  5AV9 C;  3AZH A;  3AFA B;  3MGS B;  2ARO D;  3X1S C;  2CV5 C;  5CP6 C;  3LEL B;  4H9N A;  5AV6 C;  3X1T C;  4Z5T C;  1P3B A;  3NQU A;  1KX4 C;  3AN2 D;  1P3O B;  1EQZ C;  5F99 B;  1KX3 D;  4H9O A;  2HUE B;  1P3B D;  1BH8 A;  3B6F C;  1M1A B;  3VH5 W;  3REH B;  1F66 A;  3W98 C;  2NQB B;  1P3M D;  3LJA C;  5AVB C;  1P3K B;  3VH6 A;  3MGQ B;  4QLC B;  4ZUX A;  3A6N A;  1A7W A;  3UTA C;  1M19 D;  3AZK D;  3LJA A;  3O62 D;  4YM6 D;  1N1J B;  4J8U D;  2NQB A;  4QLC C;  5DNN A;  3AV1 D;  3WAA B;  3LJA B;  3AV1 B;  1M19 A;  1P3P D;  5B0Y B;  1P3O D;  3AZK A;  3WAA D;  3W97 C;  3MGP D;  3REJ A;  4WU9 D;  3MNN A;  3TU4 A;  3AZF D;  3AYW B;  1P3K A;  2NZD A;  4Z66 D;  3REK D;  1M18 D;  3REH C;  3LEL D;  4KHA A;  3LZ0 A;  3WAA A;  3AYW C;  1ID3 A;  2F8N D;  4LD9 A;  3AV1 C;  4R8P A;  4E44 A;  1TZY D;  3LZ0 D;  5AV8 D;  3UTB D;  1M1A D;  3KXB D;  3AZL D;  3UTA B;  4R8P D;  3REI A;  1B67 A;  1TZY A;  5B1M C;  2BYK B;  3X1V D;  5B0Y D;  3MGS A;  3VH5 T;  4J8X A;  4H9O B;  4H9S A;  5B1L B;  5F99 C;  3MGS D;  3WTP A;  1P3L D;  2BYM A;  1KX4 B;  3MVD B;  5GSU C;  4J8U C;  5B0Z A;  3B6G D;  4KGC D;  1Q9C A;  5B33 C;  1KX4 A;  1ZLA B;  5DNM B;  2BYK A;  3UT9 C;  1ZLA D;  4J8X C;  3C1C B;  2LY8 A;  3AZJ D;  2HIO D;  5AV6 D;  4Z5T D;  5GSU D;  3B6G C;  4EO5 B;  5B31 D;  5B2J A;  5AV9 A;  2IO5 B;  3AZH C;  4KGC C;  3AZJ A;  2PYO D;  3W97 A;  4AWL C;  3KUY B;  2FJ7 B;  2PYO B;  1P3G C;  2NZD C;  3WKJ D;  5AV9 D;  3VH5 A;  3MGR D;  3LZ1 A;  1P3M B;  2ARO C;  5CP6 D;  4X23 A;  3X1V C;  3AZN A;  4Z2M G;  3MGR C;  5GT3 D;  1F66 C;  1P3A D;  1ULY A;  3AZN D;  4CAY A;  3REJ B;  3AZG A;  3C1C C;  3AN2 B;  1P3P C;  5AVC B;  5JRG D;  3X1U B;  5DNN B;  3REL D;  5GT3 A;  3A6N C;  5C3I B;  4ZUX C;  1KX5 D;  4CAY B;  2FJ7 D;  4XZQ D;  5B2I D;  3AZI B;  5B31 B;  5GXQ A;  1P3A C;  4QLC A;  1BFM A;  4Z2M H;  3NQJ B;  5G49 B;  5B1M A;  4G91 B;  3AZH D;  4QLC D;  1M19 B;  4NFT A;  3MNN D;  4J8V B;  3TU4 D;  3AZF A;  4WU9 A;  1P3F B;  3W96 D;  1KX3 C;  1ID3 D;  1S32 C;  5CPJ C;  3C1B C;  1P3L B;  2F8N A;  3W96 A;  2F8N H;  3REI C;  3B6F D;  3MNN C;  1B6W A;  3TU4 C;  1P3I C;  4XUJ B;  5AVB B;  5F99 D;  1KX3 B;  4X23 B;  1F66 D;  5B24 C;  5E5A D;  4LD9 C;  2NQB C;  5F99 A;  3AZL B;  1S32 A;  1TAF B;  1AOI B;  5AVC D;  4ZUX D;  5B0Y C;  3A6N D;  3R45 B;  4YS3 A;  2HUE C;  4WNN B;  5E5A A;  5B40 B;  3KWQ B;  3AZJ B;  3O62 A;  3KWQ D;  1P3G A;  1P3I B;  5AV5 A;  5E5A C;  2NQB D;  3V9R B;  3LEL C;  3X1T B;  3MGP A;  3X1S B;  2CV5 B;  1JFI A;  1P3P B;  1KU5 A;  3MGP B;  1ZLA A;  4HGA B;  5CPK B;  4YM6 B;  1P3B C;  5JA4 B;  3KXB C;  5BS7 A;  1P3I A;  2BYM B;  1ID3 C;  5GSU A;  5CPJ D;  5AY8 D;  5B0Z C;  3W98 D;  3W99 B;  1WWI A;  1AOI A;  1U35 B;  2HIO B;  3REI D;  1P3A B;  3LZ0 B;  3AV2 A;  4Z5T B;  1P3I D;  5AV6 B;  2YFV A;  1P34 B;  3WKJ A;  3UTA D;  3REH D;  2F8N B;  5DNN C;  3B0D B;  3X1V A;  3LZ1 D;  1AOI D;  5B0Y A;  4AWL B;  5AV8 B;  1TZY B;  1N1J A;  4XZQ C;  3UTA A;  4EO5 C;  3MGR B;  4WU8 B;  3AZE C;  1BH9 A;  5BNX A;  4CSR A;  4H9R B;  4KGC A;  2ARO B;  1HTA A;  5JRG A;  3REL A;  1KX5 A;  3WTP C;  4J8U B;  1F1E A;  3LZ0 C;  3B0B A;  3AYW A;  3KUY C;  2FJ7 C;  2NZD B;  3UT9 A;  5GXQ D;  4H9P B;  4Z5T A;  4G92 B;  5B2J D;  4KUD A;  2IO5 C;  4KGC B;  3B6G B;  1P3B B;  2YFW A;  4NE6 A;  4ZBJ B;  4JJN D;  4KUD B;  4H9S C;  4WU8 A;  3UT9 B;  3C1B A;  3AZG B;  5BT1 D;  1P34 C;  2JSS A;  5CPI C;  4WU8 D;  2HIO C;  5GT3 C;  3C1B D;  2ARO A;  3AZM C;  3B6F A;  3KWQ C;  5B33 D;  3AZE D;  3O62 B;  5B2J B;  3AZK C;  4YS3 B;  2F8N K;  5B33 A;  5B24 B;  5JA4 A;  5B24 D;  3X1T A;  3AZM D;  2FJ7 A;  3W97 B;  5AV5 B;  3WAA C;  5DNM A;  1P3P A;  4H9Q A;  5E5A B;  5AVB A;  3KWQ A;  4Z66 A;  3REK A;  1M18 A;  3MGQ C;  1P3K C;  5B40 C;  5B2I B;  5KDM B;  3AZI D;  4J8V C;  1P3F C;  4R8P B;  3R45 A;  4E45 A;  3UTB C;  1M1A C;  3MVD A;  5B2I C;  4J8V A;  1P3F A;  1P3K D;  4XUJ C;  3AZM B;  1EQZ B;  1H3O B;  3MNN B;  5AY8 A;  3MVD D;  3TU4 B;  4J8V D;  1P3F D;  4LD9 D;  2RVQ C;  5CP6 B;  4H9R A;  4NE3 A;  3AZG C;  4WU9 B;  5AVC C;  3KXB A;  5BNV A;  3W99 D;  3W98 B;  4KUD C;  3WTP D;  3B6F B;  4UUZ A;  3WTP E;  5AV5 D;  4J8X D;  3WA9 B;  2HIO A;  5C3I C;  3NQU B;  4ZUX B;  3A6N B;  1P3L A;  3MGS C;  4H9N B;  4J8W A;  5B0Z D;  3B6G A;  4ZBJ C;  2PYO A;  1KX4 D;  3AZF B;  3X1U A;  5CPI D;  4WU8 C;  4H9P A;  1WWS A;  3AFA A;  1R4V A;  5BNV B;  1HQ3 C;  1JFI B;  5AV6 A;  5JRG B;  3X1U D;  3REL B;  1KX5 B;  3X1S A;  2CV5 A;  3NQJ A;  5CP6 A;  4X23 D;  4JJN C;  3AZN B;  4DRA A;  5GSU B;  4JJN B;  3W97 D;  1EQZ A;  5BO0 B;  5BT1 C;  1P3G B;  2PYO C;  3W99 C;  3LZ1 B;  3MGR A;  3C1C D;  5B1L C;  3AN2 A;  5AY8 C;  3AZH B;  3KXB B;  5B1L A;  5B32 A;  5CPK C;  3AZE A;  5B2I A;  1TZY C;  3MGP C;  5B40 D;  5AV8 C;  3WKJ B;  4J8X B;  4DRB A;  3KUY D;  3B0D C;  4WV4 B;  5B1L D;  5DNM C;  4J8W C;  5GXQ C;  1P3A A;  5B33 B;  5B24 A;  3AZM A;  1P3M A;  3AYW D;  4WNN A;  5B40 A;  5CPK D;  4WZS B;  3LJA D;  5AVB D;  3V9R A;  5B0Z B;  4YM6 A;  4XUJ D;  5KDM A;  5DNN D;  1AOI C;  4JJN A;  4YM6 C;  2L5A A;  3UTB B;  3REJ D;  4XUJ A;  5B1M D;  2F8N G;  5B1M B;  4X23 C;  4WU9 C;  4H9Q B;  4M6B A;  5FUG B;  1KX3 A;  5GT0 C;  3C1B B;  3AZJ C;  3AZL A;  5AV5 C;  1S32 B;  1P3L C;  5B32 G;  1S32 D;  4KHA B;  2RVQ D;  5BO0 A;  3AZL C;  2YFW B;  4R8P C;  4YS3 C;  3AZK B;  3X1T D;  4LD9 B;  5B2J C;  4G91 C;  5DNM D;  4CSR B;  1BH8 B;  5GT0 B;  4UUZ B;  3REI B;  4J8U A;  5GT3 B;  3AV1 A;  5AVC A;  4YS3 D;  3AZI C;  1P3O A;  2NZD D;  5CPJ B;  1P34 D;  1P3G D;  5GXQ B;  4J8W B;  2CWE A;  3B0C T;  3X1U C;  3AZI A;  3LEL A;  1U35 D;  3WA9 D;  5CHL B;  5CPJ A;  3REJ C;  3VH6 W;  5AV9 B;  5BS7 C;  1M19 C;  2YFV B;  1P34 A;  5G49 A;  5B31 G;  3O62 C;  3AV2 B;  3AV2 D;  1H3O A;  1U35 A;  5GT0 A;  3WA9 A;  5AV8 A;  5B31 A;  3UTB A;  3AFA D;  1M1A A;  3LZ1 C;  3X1V B;  1P3O C;  3MGQ D;  5B31 C;  5CPI B;  1BH9 B;  5BNX B;  5GT0 D;  3X1S D;  2CV5 D;  5FUG A;  3W98 A;  3MGQ A;  3W99 A;  3WKJ C;  3AN2 C;  3AFA C; 
#chains in the Genus database with same CATH topology
 1EQZ D;  3W96 C;  4Z66 B;  3REK B;  1M18 B;  3REH A;  1F66 B;  3C1C A;  2Y2G A;  5AY8 B;  4XZQ B;  4G92 C;  5B32 D;  2G5H C;  5B32 B;  3B0C W;  2Y2O A;  3AZG D;  1P3M C;  3UT9 D;  1ZLA C;  1HQ3 A;  3WTP B;  4NE5 A;  3AZN C;  3KUY A;  4KUD D;  4J8W D;  3MVD C;  1U35 C;  4XZQ A;  5JRG C;  3REL C;  1KX5 C;  3WA9 C;  5B32 C;  5CPK A;  1HQ3 D;  5CPI A;  1HQ3 B;  1TAF A;  1ID3 B;  3KSY A;  3VH6 T;  3AZE B;  3AV2 C;  3AZF C;  4HGA C;  4Z66 C;  3REK C;  1M18 C;  3W96 B;  5AV9 C;  3AZH A;  3AFA B;  3MGS B;  1PZR A;  2ARO D;  3X1S C;  2CV5 C;  2Y2L A;  5CP6 C;  3LEL B;  4H9N A;  5AV6 C;  3X1T C;  4Z5T C;  1P3B A;  3NQU A;  1KX4 C;  3AN2 D;  2UWX A;  1P3O B;  1EQZ C;  5F99 B;  1KX3 D;  2Y2I A;  4H9O A;  2HUE B;  1P3B D;  1BH8 A;  3B6F C;  1M1A B;  3VH5 W;  3REH B;  1F66 A;  3W98 C;  2NQB B;  1P3M D;  3LJA C;  5AVB C;  1P3K B;  3VH6 A;  3MGQ B;  4QLC B;  4ZUX A;  3A6N A;  1A7W A;  2FFF B;  3UTA C;  1M19 D;  3AZK D;  3LJA A;  3O62 D;  4YM6 D;  1N1J B;  4J8U D;  2NQB A;  4QLC C;  5DNN A;  3AV1 D;  3WAA B;  3LJA B;  3AV1 B;  1M19 A;  1P3P D;  5B0Y B;  1P3O D;  3AZK A;  3WAA D;  3W97 C;  3MGP D;  3REJ A;  4WU9 D;  3MNN A;  3TU4 A;  3AZF D;  3AYW B;  1P3K A;  3KFU G;  4Z66 D;  3REK D;  1M18 D;  3REH C;  3LEL D;  4KHA A;  2F2A C;  3LZ0 A;  3WAA A;  3AYW C;  1ID3 A;  2F8N D;  4LD9 A;  3AV1 C;  4R8P A;  4E44 A;  1TZY D;  3LZ0 D;  5AV8 D;  3UTB D;  4DQY B;  1M1A D;  3KXB D;  3AZL D;  3UTA B;  4R8P D;  3REI A;  1B67 A;  1TZY A;  5B1M C;  2BYK B;  3X1V D;  5B0Y D;  3MGS A;  3VH5 T;  3EPL A;  4J8X A;  4H9O B;  4H9S A;  5B1L B;  5F99 C;  3MGS D;  3WTP A;  1P3L D;  2BYM A;  1KX4 B;  3MVD B;  5GSU C;  4J8U C;  5B0Z A;  3B6G D;  4KGC D;  1Q9C A;  5B33 C;  2Y2P A;  2Y2J A;  1KX4 A;  5DNM B;  1ZLA B;  2BYK A;  3UT9 C;  1ZLA D;  4J8X C;  3C1C B;  2LY8 A;  2Y2Q A;  3AZJ D;  2HIO D;  5AV6 D;  4Z5T D;  5GSU D;  3B6G C;  4EO5 B;  5B31 D;  5B2J A;  5AV9 A;  2IO5 B;  3AZH C;  4KGC C;  3AZJ A;  2PYO D;  3W97 A;  4AWL C;  3KUY B;  2FJ7 B;  2PYO B;  1P3G C;  2NZD C;  3WKJ D;  5AV9 D;  2DQN C;  3VH5 A;  3MGR D;  3LZ1 A;  3P5J B;  1P3M B;  2ARO C;  5CP6 D;  4X23 A;  3X1V C;  3AZN A;  4Z2M G;  2XD5 A;  3MGR C;  5GT3 D;  3F6T A;  1F66 C;  1P3A D;  1ULY A;  3AZN D;  4CAY A;  3REJ B;  3AZG A;  3C1C C;  3AN2 B;  1P3P C;  5AVC B;  5JRG D;  3X1U B;  5DNN B;  3REL D;  5GT3 A;  5C3I B;  4ZUX C;  3A6N C;  1KX5 D;  4CAY B;  3A1K A;  2FJ7 D;  4XZQ D;  5B2I D;  3AZI B;  5B31 B;  5GXQ A;  1P3A C;  4QLC A;  1BFM A;  4Z2M H;  3EG5 B;  3NQJ B;  5G49 B;  5B1M A;  4G91 B;  3AZH D;  4QLC D;  4WJ3 C;  1M19 B;  4NFT A;  3MNN D;  4J8V B;  3TU4 D;  3AZF A;  4WU9 A;  1P3F B;  3W96 D;  1KX3 C;  1ID3 D;  1S32 C;  5CPJ C;  3C1B C;  1P3L B;  2F8N A;  3IP4 C;  3W96 A;  2F8N H;  3REI C;  3B6F D;  3MNN C;  1B6W A;  3TU4 C;  1P3I C;  4XUJ B;  5AVB B;  5F99 D;  1KX3 B;  4X23 B;  2Y2H A;  1F66 D;  5B24 C;  5E5A D;  4LD9 C;  2NQB C;  5F99 A;  3AZL B;  1S32 A;  1TAF B;  1AOI B;  5AVC D;  2Y2K A;  4ZUX D;  5B0Y C;  3R45 B;  3A6N D;  2HUE C;  4YS3 A;  4WNN B;  5E5A A;  5B40 B;  3KWQ B;  3AZJ B;  3O62 A;  3KWQ D;  1P3G A;  1P3I B;  2ZY5 A;  5AV5 A;  5E5A C;  2NQB D;  3V9R B;  3LEL C;  3X1T B;  3MGP A;  3X1S B;  2CV5 B;  1JFI A;  1P3P B;  1KU5 A;  3MGP B;  1ZLA A;  4HGA B;  5CPK B;  3H0R C;  4YM6 B;  1P3B C;  5JA4 B;  3KXB C;  5BS7 A;  1P3I A;  2BYM B;  1ID3 C;  5GSU A;  5CPJ D;  5AY8 D;  5B0Z C;  3W98 D;  3W99 B;  1WWI A;  1AOI A;  1U35 B;  2HIO B;  3REI D;  1P3A B;  3LZ0 B;  3AV2 A;  4Z5T B;  1P3I D;  5AV6 B;  2YFV A;  1P34 B;  3WKJ A;  2ZM5 A;  3UTA D;  3REH D;  2F8N B;  5DNN C;  3B0D B;  3X1V A;  3LZ1 D;  1AOI D;  5B0Y A;  4AWL B;  5AV8 B;  3EPJ A;  1TZY B;  1N1J A;  4XZQ C;  3UTA A;  2G5I C;  4EO5 C;  3MGR B;  4WU8 B;  3AZE C;  1BH9 A;  5BNX A;  4CSR A;  4H9R B;  4KGC A;  2ARO B;  1HTA A;  5JRG A;  3REL A;  2W8S A;  1KX5 A;  3WTP C;  4J8U B;  1T3U A;  1F1E A;  3LZ0 C;  3B0B A;  3AYW A;  3KUY C;  2FJ7 C;  2NZD B;  3UT9 A;  5GXQ D;  4H9P B;  4Z5T A;  4G92 B;  4UPK A;  5B2J D;  4KUD A;  2IO5 C;  4KGC B;  3B6G B;  1P3B B;  2YFW A;  4NE6 A;  4ZBJ B;  4JJN D;  4KUD B;  2RIQ A;  2NZD A;  4H9S C;  4WU8 A;  3UT9 B;  3C1B A;  3AZG B;  5BT1 D;  1P34 C;  2JSS A;  2DF4 C;  5CPI C;  4WU8 D;  2HIO C;  5GT3 C;  3C1B D;  2ARO A;  3AZM C;  3B6F A;  3KWQ C;  5B33 D;  3AZE D;  3O62 B;  1Z2C B;  5B2J B;  3AZK C;  4YS3 B;  2F8N K;  5B33 A;  5B24 B;  5JA4 A;  5B24 D;  3X1T A;  3AZM D;  2FJ7 A;  3W97 B;  3EPK A;  5AV5 B;  3WAA C;  5DNM A;  1P3P A;  4H9Q A;  5E5A B;  5AVB A;  3KWQ A;  4Z66 A;  3REK A;  1M18 A;  3MGQ C;  1P3K C;  5B40 C;  5B2I B;  5KDM B;  3AZI D;  4J8V C;  1P3F C;  4R8P B;  3R45 A;  4E45 A;  3UTB C;  1M1A C;  3MVD A;  5B2I C;  4J8V A;  1P3F A;  1P3K D;  3FDD A;  3AL0 C;  4XUJ C;  3AZM B;  1EQZ B;  1H3O B;  3MNN B;  5AY8 A;  3MVD D;  3TU4 B;  4J8V D;  1P3F D;  4LD9 D;  2RVQ C;  5CP6 B;  4H9R A;  4NE3 A;  3AZG C;  4WU9 B;  5AVC C;  2BG1 A;  5BNV A;  3KXB A;  3W99 D;  3W98 B;  4KUD C;  3WTP D;  3B6F B;  4UUZ A;  3WTP E;  5AV5 D;  3H0L C;  4J8X D;  3WA9 B;  3EPH A;  2ZY4 A;  2HIO A;  5C3I C;  3NQU B;  4ZUX B;  3A6N B;  1P3L A;  3MGS C;  4H9N B;  4J8W A;  5B0Z D;  3B6G A;  4ZBJ C;  2PYO A;  1KX4 D;  3AZF B;  3X1U A;  5CPI D;  4WU8 C;  4H9P A;  1WWS A;  3AFA A;  1R4V A;  5BNV B;  1HQ3 C;  1JFI B;  2Y2N A;  5AV6 A;  5JRG B;  3X1U D;  3REL B;  1KX5 B;  3X1S A;  2CV5 A;  3NQJ A;  5CP6 A;  4X23 D;  4JJN C;  3AZN B;  4DRA A;  5GSU B;  4JJN B;  3W97 D;  1EQZ A;  5BO0 B;  5BT1 C;  1P3G B;  2PYO C;  3W99 C;  3LZ1 B;  3MGR A;  3C1C D;  5B1L C;  3AN2 A;  5AY8 C;  3AZH B;  3KXB B;  5B1L A;  5B32 A;  5CPK C;  2VQR A;  3AZE A;  5B2I A;  1TZY C;  3MGP C;  5B40 D;  5AV8 C;  3WKJ B;  4J8X B;  3H0M C;  4DRB A;  3KUY D;  3B0D C;  4WV4 B;  5B1L D;  5DNM C;  4J8W C;  5GXQ C;  1P3A A;  5B33 B;  5B24 A;  3AZM A;  1P3M A;  3AYW D;  4WNN A;  5B40 A;  5CPK D;  4WZS B;  3LJA D;  5AVB D;  1W2E A;  3V9R A;  5B0Z B;  4XUJ D;  4YM6 A;  5KDM A;  5DNN D;  1AOI C;  4JJN A;  4YM6 C;  2L5A A;  3UTB B;  2JE5 A;  3REJ D;  4XUJ A;  5B1M D;  2F8N G;  5B1M B;  4X23 C;  4WU9 C;  2ZY2 A;  4H9Q B;  4M6B A;  5FUG B;  1KX3 A;  5GT0 C;  2J8P A;  3C1B B;  3AZJ C;  3AZL A;  5AV5 C;  2ZY3 A;  1S32 B;  1P3L C;  5B32 G;  2JCH A;  1S32 D;  4KHA B;  2RVQ D;  5BO0 A;  3AZL C;  2YFW B;  4R8P C;  4YS3 C;  3AZK B;  3X1T D;  4LD9 B;  5B2J C;  4G91 C;  5DNM D;  4CSR B;  1BH8 B;  5GT0 B;  4UUZ B;  3REI B;  4J8U A;  5GT3 B;  3AV1 A;  5AVC A;  4YS3 D;  2XD1 A;  3AZI C;  1P3O A;  2NZD D;  5CPJ B;  1P34 D;  1P3G D;  5GXQ B;  4J8W B;  2CWE A;  3B0C T;  3X1U C;  3AZI A;  3LEL A;  1U35 D;  3WA9 D;  5CHL B;  5CPJ A;  3REJ C;  3VH6 W;  5AV9 B;  5BS7 C;  1M19 C;  2YFV B;  1P34 A;  5G49 A;  5B31 G;  3O62 C;  3AV2 B;  3AV2 D;  1H3O A;  1U35 A;  5GT0 A;  3WA9 A;  5AV8 A;  5B31 A;  3UTB A;  3AFA D;  1M1A A;  3LZ1 C;  3X1V B;  1P3O C;  3MGQ D;  2Y2M A;  5B31 C;  5CPI B;  1BH9 B;  5BNX B;  5GT0 D;  3X1S D;  2CV5 D;  5FUG A;  3W98 A;  3MGQ A;  3W99 A;  3A1I A;  3WKJ C;  3AN2 C;  3AFA C; 
#chains in the Genus database with same CATH homology
 1EQZ D;  3W96 C;  4Z66 B;  3REK B;  1M18 B;  3REH A;  1F66 B;  3C1C A;  2Y2G A;  5AY8 B;  4XZQ B;  4G92 C;  5B32 D;  2G5H C;  5B32 B;  3B0C W;  2Y2O A;  3AZG D;  1P3M C;  3UT9 D;  1ZLA C;  1HQ3 A;  3WTP B;  4NE5 A;  3AZN C;  3KUY A;  4KUD D;  4J8W D;  3MVD C;  1U35 C;  4XZQ A;  5JRG C;  3REL C;  1KX5 C;  3WA9 C;  5B32 C;  5CPK A;  1HQ3 D;  5CPI A;  1HQ3 B;  1TAF A;  1ID3 B;  3KSY A;  3VH6 T;  3AZE B;  3AV2 C;  3AZF C;  4HGA C;  4Z66 C;  3REK C;  1M18 C;  3W96 B;  5AV9 C;  3AZH A;  3AFA B;  3MGS B;  1PZR A;  2ARO D;  3X1S C;  2CV5 C;  2Y2L A;  5CP6 C;  3LEL B;  4H9N A;  5AV6 C;  3X1T C;  4Z5T C;  1P3B A;  3NQU A;  1KX4 C;  3AN2 D;  2UWX A;  1P3O B;  1EQZ C;  5F99 B;  1KX3 D;  2Y2I A;  4H9O A;  2HUE B;  1P3B D;  1BH8 A;  3B6F C;  1M1A B;  3VH5 W;  3REH B;  1F66 A;  3W98 C;  2NQB B;  1P3M D;  3LJA C;  5AVB C;  1P3K B;  3VH6 A;  3MGQ B;  4QLC B;  4ZUX A;  3A6N A;  1A7W A;  2FFF B;  3UTA C;  1M19 D;  3AZK D;  3LJA A;  3O62 D;  4YM6 D;  1N1J B;  4J8U D;  2NQB A;  4QLC C;  5DNN A;  3AV1 D;  3WAA B;  3LJA B;  3AV1 B;  1M19 A;  1P3P D;  5B0Y B;  1P3O D;  3AZK A;  3WAA D;  3W97 C;  3MGP D;  3REJ A;  4WU9 D;  3MNN A;  3TU4 A;  3AZF D;  3AYW B;  1P3K A;  3KFU G;  4Z66 D;  3REK D;  1M18 D;  3REH C;  3LEL D;  4KHA A;  2F2A C;  3LZ0 A;  3WAA A;  3AYW C;  1ID3 A;  2F8N D;  4LD9 A;  3AV1 C;  4R8P A;  4E44 A;  1TZY D;  3LZ0 D;  5AV8 D;  3UTB D;  4DQY B;  1M1A D;  3KXB D;  3AZL D;  3UTA B;  4R8P D;  3REI A;  1B67 A;  1TZY A;  5B1M C;  2BYK B;  3X1V D;  5B0Y D;  3MGS A;  3VH5 T;  3EPL A;  4J8X A;  4H9O B;  4H9S A;  5B1L B;  5F99 C;  3MGS D;  3WTP A;  1P3L D;  2BYM A;  1KX4 B;  3MVD B;  5GSU C;  4J8U C;  5B0Z A;  3B6G D;  4KGC D;  1Q9C A;  5B33 C;  2Y2P A;  2Y2J A;  1KX4 A;  5DNM B;  1ZLA B;  2BYK A;  3UT9 C;  1ZLA D;  4J8X C;  3C1C B;  2LY8 A;  2Y2Q A;  3AZJ D;  2HIO D;  5AV6 D;  4Z5T D;  5GSU D;  3B6G C;  4EO5 B;  5B31 D;  5B2J A;  5AV9 A;  2IO5 B;  3AZH C;  4KGC C;  3AZJ A;  2PYO D;  3W97 A;  4AWL C;  3KUY B;  2FJ7 B;  2PYO B;  1P3G C;  2NZD C;  3WKJ D;  5AV9 D;  2DQN C;  3VH5 A;  3MGR D;  3LZ1 A;  3P5J B;  1P3M B;  2ARO C;  5CP6 D;  4X23 A;  3X1V C;  3AZN A;  4Z2M G;  2XD5 A;  3MGR C;  5GT3 D;  3F6T A;  1F66 C;  1P3A D;  1ULY A;  3AZN D;  4CAY A;  3REJ B;  3AZG A;  3C1C C;  3AN2 B;  1P3P C;  5AVC B;  5JRG D;  3X1U B;  5DNN B;  3REL D;  5GT3 A;  5C3I B;  4ZUX C;  3A6N C;  1KX5 D;  4CAY B;  3A1K A;  2FJ7 D;  4XZQ D;  5B2I D;  3AZI B;  5B31 B;  5GXQ A;  1P3A C;  4QLC A;  1BFM A;  4Z2M H;  3EG5 B;  3NQJ B;  5G49 B;  5B1M A;  4G91 B;  3AZH D;  4QLC D;  4WJ3 C;  1M19 B;  4NFT A;  3MNN D;  4J8V B;  3TU4 D;  3AZF A;  4WU9 A;  1P3F B;  3W96 D;  1KX3 C;  1ID3 D;  1S32 C;  5CPJ C;  3C1B C;  1P3L B;  2F8N A;  3IP4 C;  3W96 A;  2F8N H;  3REI C;  3B6F D;  3MNN C;  1B6W A;  3TU4 C;  1P3I C;  4XUJ B;  5AVB B;  5F99 D;  1KX3 B;  4X23 B;  2Y2H A;  1F66 D;  5B24 C;  5E5A D;  4LD9 C;  2NQB C;  5F99 A;  3AZL B;  1S32 A;  1TAF B;  1AOI B;  5AVC D;  2Y2K A;  4ZUX D;  5B0Y C;  3R45 B;  3A6N D;  2HUE C;  4YS3 A;  4WNN B;  5E5A A;  5B40 B;  3KWQ B;  3AZJ B;  3O62 A;  3KWQ D;  1P3G A;  1P3I B;  2ZY5 A;  5AV5 A;  5E5A C;  2NQB D;  3V9R B;  3LEL C;  3X1T B;  3MGP A;  3X1S B;  2CV5 B;  1JFI A;  1P3P B;  1KU5 A;  3MGP B;  1ZLA A;  4HGA B;  5CPK B;  3H0R C;  4YM6 B;  1P3B C;  5JA4 B;  3KXB C;  5BS7 A;  1P3I A;  2BYM B;  1ID3 C;  5GSU A;  5CPJ D;  5AY8 D;  5B0Z C;  3W98 D;  3W99 B;  1WWI A;  1AOI A;  1U35 B;  2HIO B;  3REI D;  1P3A B;  3LZ0 B;  3AV2 A;  4Z5T B;  1P3I D;  5AV6 B;  2YFV A;  1P34 B;  3WKJ A;  2ZM5 A;  3UTA D;  3REH D;  2F8N B;  5DNN C;  3B0D B;  3X1V A;  3LZ1 D;  1AOI D;  5B0Y A;  4AWL B;  5AV8 B;  3EPJ A;  1TZY B;  1N1J A;  4XZQ C;  3UTA A;  2G5I C;  4EO5 C;  3MGR B;  4WU8 B;  3AZE C;  1BH9 A;  5BNX A;  4CSR A;  4H9R B;  4KGC A;  2ARO B;  1HTA A;  5JRG A;  3REL A;  2W8S A;  1KX5 A;  3WTP C;  4J8U B;  1T3U A;  1F1E A;  3LZ0 C;  3B0B A;  3AYW A;  3KUY C;  2FJ7 C;  2NZD B;  3UT9 A;  5GXQ D;  4H9P B;  4Z5T A;  4G92 B;  4UPK A;  5B2J D;  4KUD A;  2IO5 C;  4KGC B;  3B6G B;  1P3B B;  2YFW A;  4NE6 A;  4ZBJ B;  4JJN D;  4KUD B;  2RIQ A;  2NZD A;  4H9S C;  4WU8 A;  3UT9 B;  3C1B A;  3AZG B;  5BT1 D;  1P34 C;  2JSS A;  2DF4 C;  5CPI C;  4WU8 D;  2HIO C;  5GT3 C;  3C1B D;  2ARO A;  3AZM C;  3B6F A;  3KWQ C;  5B33 D;  3AZE D;  3O62 B;  1Z2C B;  5B2J B;  3AZK C;  4YS3 B;  2F8N K;  5B33 A;  5B24 B;  5JA4 A;  5B24 D;  3X1T A;  3AZM D;  2FJ7 A;  3W97 B;  3EPK A;  5AV5 B;  3WAA C;  5DNM A;  1P3P A;  4H9Q A;  5E5A B;  5AVB A;  3KWQ A;  4Z66 A;  3REK A;  1M18 A;  3MGQ C;  1P3K C;  5B40 C;  5B2I B;  5KDM B;  3AZI D;  4J8V C;  1P3F C;  4R8P B;  3R45 A;  4E45 A;  3UTB C;  1M1A C;  3MVD A;  5B2I C;  4J8V A;  1P3F A;  1P3K D;  3FDD A;  3AL0 C;  4XUJ C;  3AZM B;  1EQZ B;  1H3O B;  3MNN B;  5AY8 A;  3MVD D;  3TU4 B;  4J8V D;  1P3F D;  4LD9 D;  2RVQ C;  5CP6 B;  4H9R A;  4NE3 A;  3AZG C;  4WU9 B;  5AVC C;  2BG1 A;  5BNV A;  3KXB A;  3W99 D;  3W98 B;  4KUD C;  3WTP D;  3B6F B;  4UUZ A;  3WTP E;  5AV5 D;  3H0L C;  4J8X D;  3WA9 B;  3EPH A;  2ZY4 A;  2HIO A;  5C3I C;  3NQU B;  4ZUX B;  3A6N B;  1P3L A;  3MGS C;  4H9N B;  4J8W A;  5B0Z D;  3B6G A;  4ZBJ C;  2PYO A;  1KX4 D;  3AZF B;  3X1U A;  5CPI D;  4WU8 C;  4H9P A;  1WWS A;  3AFA A;  1R4V A;  5BNV B;  1HQ3 C;  1JFI B;  2Y2N A;  5AV6 A;  5JRG B;  3X1U D;  3REL B;  1KX5 B;  3X1S A;  2CV5 A;  3NQJ A;  5CP6 A;  4X23 D;  4JJN C;  3AZN B;  4DRA A;  5GSU B;  4JJN B;  3W97 D;  1EQZ A;  5BO0 B;  5BT1 C;  1P3G B;  2PYO C;  3W99 C;  3LZ1 B;  3MGR A;  3C1C D;  5B1L C;  3AN2 A;  5AY8 C;  3AZH B;  3KXB B;  5B1L A;  5B32 A;  5CPK C;  2VQR A;  3AZE A;  5B2I A;  1TZY C;  3MGP C;  5B40 D;  5AV8 C;  3WKJ B;  4J8X B;  3H0M C;  4DRB A;  3KUY D;  3B0D C;  4WV4 B;  5B1L D;  5DNM C;  4J8W C;  5GXQ C;  1P3A A;  5B33 B;  5B24 A;  3AZM A;  1P3M A;  3AYW D;  4WNN A;  5B40 A;  5CPK D;  4WZS B;  3LJA D;  5AVB D;  1W2E A;  3V9R A;  5B0Z B;  4XUJ D;  4YM6 A;  5KDM A;  5DNN D;  1AOI C;  4JJN A;  4YM6 C;  2L5A A;  3UTB B;  2JE5 A;  3REJ D;  4XUJ A;  5B1M D;  2F8N G;  5B1M B;  4X23 C;  4WU9 C;  2ZY2 A;  4H9Q B;  4M6B A;  5FUG B;  1KX3 A;  5GT0 C;  2J8P A;  3C1B B;  3AZJ C;  3AZL A;  5AV5 C;  2ZY3 A;  1S32 B;  1P3L C;  5B32 G;  2JCH A;  1S32 D;  4KHA B;  2RVQ D;  5BO0 A;  3AZL C;  2YFW B;  4R8P C;  4YS3 C;  3AZK B;  3X1T D;  4LD9 B;  5B2J C;  4G91 C;  5DNM D;  4CSR B;  1BH8 B;  5GT0 B;  4UUZ B;  3REI B;  4J8U A;  5GT3 B;  3AV1 A;  5AVC A;  4YS3 D;  2XD1 A;  3AZI C;  1P3O A;  2NZD D;  5CPJ B;  1P34 D;  1P3G D;  5GXQ B;  4J8W B;  2CWE A;  3B0C T;  3X1U C;  3AZI A;  3LEL A;  1U35 D;  3WA9 D;  5CHL B;  5CPJ A;  3REJ C;  3VH6 W;  5AV9 B;  5BS7 C;  1M19 C;  2YFV B;  1P34 A;  5G49 A;  5B31 G;  3O62 C;  3AV2 B;  3AV2 D;  1H3O A;  1U35 A;  5GT0 A;  3WA9 A;  5AV8 A;  5B31 A;  3UTB A;  3AFA D;  1M1A A;  3LZ1 C;  3X1V B;  1P3O C;  3MGQ D;  2Y2M A;  5B31 C;  5CPI B;  1BH9 B;  5BNX B;  5GT0 D;  3X1S D;  2CV5 D;  5FUG A;  3W98 A;  3MGQ A;  3W99 A;  3A1I A;  3WKJ C;  3AN2 C;  3AFA C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...