1P3MC

Crystallographic studies of nucleosome core particles containing histone 'sin' mutants
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
107
structure length
107
Chain Sequence
AKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPKKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Structural protein/dna
molecule keywords Palindromic 146bp Human Alpha-Satellite DNA fragment
publication title Crystal structures of histone Sin mutant nucleosomes reveal altered protein-DNA interactions
pubmed doi rcsb
source organism Homo sapiens
total genus 31
structure length 107
sequence length 107
chains with identical sequence G
ec nomenclature
pdb deposition date 2003-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1p3mC00
5CP6B 5JA4A 5GSUA 5GT3C 3X1VC 1HTAA 1HQ3C 3WAAB 3MGPB 5B1MB 5DNNB 3LELA 2F8NA 5JRGC 1U35C 3WA9B 5B32B 3A6NC 2HUEC 1P3PD 1KX5B 1S32B 4YM6B 3B6FC 3C1CC 4Z5TD 3WKJD 5FUGB 5AV9B 4XZQD 1KX3D 3MGSC 2RVQC 2NQBB 4HGAB 4XUJA 4WU8B 3MGRC 1B6WA 3X1UD 4KHAA 1P3PA 4KGCB 3AZFD 3W97B 4J8VD 3REKB 1P3LB 3KWQD 4Z5TA 3KUYA 4XZQA 3LZ1D 4JJNC 3B6GB 4H9PB 5B40B 5AV8B 3C1BC 1P3GD 1P3AD 5G49B 2F8NB 5BNXB 3KXBA 1EQZD 4G92B 2BYKB 1M1AC 2HIOB 1ULYA 5AVBC 4UUZA 4WNNB 3AZFA 4J8VA 1P3BA 5B2JC 3AZJD 5AV6C 4G91C 3KWQA 5BNVA 5AY8D 2FJ7C 3W96D 5F99C 1M1AA 3AV2D 5BS7C 3O62D 3AZHC 1P3AA 1KX4D 3AV1C 1EQZA 4AWLB 5C3IB 3AZLD 1ID3D 4KHAB 3KSYA 3V9RB 1P3IC 3W98B 5AY8A 3AZND 3X1TD 2CV5C 1P3MC 3AZMC 4J8XC 4J8UD 3WKJB 4X23D 4XZQB 1KX3B 1TZYC 3WTPD 3O62A 3AV2A 4ZUXA 5AV5B 4H9NB 5BO0A 5DNMC 1KX4A 1H3OA 3WAAD 3AZMA 4WU9C 3AZLA 1ID3A 4CSRA 5DNND 4EO5C 3X1UB 3MGQC 3TU4D 3W99D 5B0YB 3LJAA 4UUZB 3AZNA 4J8UA 1P3KB 3MGPC 5B1MC 4X23A 3LZ1B 3WTPA 3RELC 3REJC 3MGQA 1P3GB 4QLCC 5CP6A 1S32D 5B32C 1P3AB 1ZLAD 3MNNC 3WAAA 3LZ0D 5CHLB 2AROD 3MGPA 4Z66D 5DNNA 2NQBD 3TU4A 4CAYB 5CPKD 3AZJB 4LD9C 1P3FB 5B32A 3WA9A 4WU8D 1M19C 5CPJB 3W96B 3AN2C 1KX5A 3AV2B 1S32A 3O62B 3W97D 4J8WC 4YM6A 1ZLAA 1P3LD 5BO0B 2AROA 5FUGA 5AVCB 5GT0C 5AV9A 2NQBA 1H3OB 3MVDB 5AV8D 3UT9C 3AZLB 5CPKA 4CSRB 4WU8A 5E5AD 5GSUC 3AZNB 3X1TB 1P34D 3AZGD 4KGCA 4X23B 3LELC 3W97A 4NE5A 3REKA 1P3LA 2NZDD 3X1SD 1A7WA 3B6GA 4H9PA 5B40A 5AV8A 4YS3D 5G49A 1TAFB 3TU4B 3W99B 5BNXA 1P34A 2BYKA 2HIOA 1BH8B 4WNNA 2BYMB 5B31B 3B0DC 2F8NK 3X1SA 4XUJC 4R8PD 3AZID 3W98D 1HQ3D 1ZLAB 5B1LB 5BT1D 3LZ0B 2AROB 4Z66B 5JRGD 4YS3A 1U35D 5AV5D 1P3PC 5CPKB 4Z5TC 3KUYC 4XZQC 1KX3C 3AYWD 5CPIB 3V9RA 4R8PA 3B6FD 5B0YD 3NQJA 3W98A 5B24B 2F8NG 3KXBC 3WKJA 1P3KD 1KX3A 3NQUA 5AV5A 4H9NA 3AZFC 4J8VC 1P3BC 3KWQC 1B67A 5E5AB 3AFAD 1P34B 4DRBA 3X1UA 3AYWA 3R45B 3AZGB 1P3GC 5B0YA 1P3AC 3B0CW 1P3FD 2NZDB 1N1JB 3X1SB 1P3KA 1EQZC 3LZ1A 1M18D 5CPJD 5B2IB 4E45A 1P3GA 3AZJC 4YS3B 2YFWB 3REHD 2L5AA 1F66D 3AFAA 5AY8C 5AVCD 5GXQD 3MVDD 1F1EA 3AV2C 4CAYA 3O62C 1P3OB 4ZUXC 4NE6A 3AZJA 1P3FA 3VH5W 1KX4C 4R8PB 3AZIB 3NQJB 5GT3B 1M18A 1HQ3B 3W96A 3AZED 5CPJA 5KDMA 3AZLC 1ID3C 3AZHD 3UTAD 5JRGB 5B0ZD 3NQUB 1U35B 3REHA 3LJAC 1F66A 5AVCA 3AZNC 4J8UC 2IO5B 2HUEB 2F8NH 4X23C 3MVDA 3WTPC 3AYWB 2PYOD 3B6FB 5CP6C 4J8XD 3AZEA 3X1TA 5B33D 3WAAC 5DNNC 5B31D 3TU4C 3WA9C 3MGRB 5B1LD 4NE3A 3AFAB 1TAFA 1KX5C 2PYOA 3W99A 1S32C 4YM6C 1ZLAC 2AROC 1BH8A 5AV9C 3RELD 1M18B 2NQBC 2BYMA 5B31A 3C1BB 5KDMB 4HGAC 5CPID 1WWIA 5CPKC 3REID 3MNND 5B24D 3REHB 5B1LA 4WU8C 1F66B 3LZ0A 3AZKD 4Z66A 5AVBB 5GXQB 4KGCC 4LD9D 5AV6B 3W97C 3REKC 1P3LC 3UTBD 1M19D 4KUDD 3AN2D 3B6GC 3AZEB 5B40C 4DRAA 5AV8C 5CPIA 4WV4B 4H9OB 4J8WD 3REIA 3AZHB 3UTAB 5B0ZB 5B24A 1AOID 1WWSA 3AV1B 5E5AC 3AZKA 4G92C 1P34C 2HIOC 5B32G 3UT9D 5B2ID 1KU5A 3UTBA 3X1SC 2PYOB 4KUDA 2CV5B 1P3MB 5E5AA 4J8XB 5B33B 3LELD 3R45A 3AZGA 1P3OD 4YS3C 1AOIA 2NZDA 3WTPE 1N1JA 5GT3D 4AWLC 3X1VD 4WU9B 5B2IA 5C3IC 4EO5B 2YFWA 4R8PC 3AZIC 3W98C 1R4VA 3A6ND 4WZSB 5BT1C 3WKJC 3RELB 3REJB 1P3OA 5AV5C 4XUJD 4QLCB 3REIB 3MNNB 3AZIA 5GT3A 3X1VA 1HQ3A 3C1CD 2IO5C 3MGSD 2RVQD 3AZKB 3X1UC 5JRGA 3AYWC 1U35A 5B0YC 4LD9B 2YFVB 3A6NA 3KUYD 3UTBB 3MGRD 1P3KC 4H9RB 1M19B 4KUDB 3LZ1C 3AN2B 3VH6A 4Z2MH 4NFTA 4ZBJB 4J8WB 3B6FA 3KXBD 3C1CA 1AOIB 5GT0B 3AFAC 3VH6W 3MGSA 4JJND 3UT9B 3C1BD 1JFIA 1P3BD 1P3FC 5JA4B 3MGRA 5GSUB 1M1AD 1M18C 3VH5A 3W96C 5CPJC 5AVBD 3LELB 5B2JD 5AV6D 3REHC 1F66C 4JJNA 5AVCC 2FJ7D 4H9SC 5F99D 3X1VB 5GXQC 3C1BA 3MVDC 3AV1D 1BH9A 3A6NB 3AZEC 3X1TC 1Q9CA 4H9SA 5AVBA 5GXQA 4ZUXD 3B0DB 3UTAC 5B2JA 5B0ZC 5AV6A 4XUJB 1P3ID 2FJ7A 2CV5D 5F99A 1P3MD 3AZMD 3C1CB 1TZYD 2JSSA 5BS7A 4H9OA 3MGSB 3AZHA 1P3PB 3UTAA 5B0ZA 3LJAD 5DNMD 3W99C 1JFIB 3AV1A 2PYOC 4H9QA 4Z5TB 3KUYB 5B33C 4WU9D 2LY8A 5B31C 3MGQD 3B0CT 1P3IA 3B0BA 3VH6T 5CP6D 2CV5A 1P3MA 3KXBB 4J8XA 5B1LC 5B33A 3LZ0C 5B1MD 3MGPD 1TZYA 4JJNB 4Z66C 3REJD 5DNMA 3AZFB 4J8VB 4QLCD 1P3BB 3KWQB 5B32D 3WA9D 4M6BA 5BNVB 4WU9A 1M1AB 1BH9B 1KX5D 3VH5T 5CPIC 3REIC 4YM6D 5B2JB 4G91B 5B24C 5AV9D 1EQZB 5B1MA 3RELA 3AZKC 3REJA 5F99B 2FJ7B 4QLCA 3MNNA 3UTBC 5AY8B 5GT0D 4KUDC 1BFMA 4H9QB 4Z2MG 4KGCD 4ZBJC 3AZGC 4ZUXB 3REKD 2YFVA 4LD9A 1AOIC 1KX4B 5B31G 1P3IB 2NZDC 3B6GD 4H9RA 1M19A 5GSUD 5B40D 3AZMB 3AN2A 1ID3B 5B2IC 1TZYB 4J8WA 2F8ND 3LJAB 5DNMB 5GT0A 2HIOD 4J8UB 2CWEA 4E44A 3WTPB 3UT9A 1P3OC 3MGQB
chains in the Genus database with same CATH superfamily
5CP6B 2ZY5A 5JA4A 5GSUA 2ZY4A 5GT3C 3X1VC 1HTAA 1HQ3C 3WAAB 2VQRA 3MGPB 5B1MB 5DNNB 3LELA 2F8NA 5JRGC 2Y2HA 1U35C 3WA9B 5B32B 3A6NC 2HUEC 1P3PD 1KX5B 1S32B 4YM6B 3B6FC 3C1CC 4Z5TD 3WKJD 5FUGB 5AV9B 4XZQD 1KX3D 3MGSC 2RVQC 3EPJA 2NQBB 4HGAB 3A1KA 4XUJA 4WU8B 3MGRC 1B6WA 3X1UD 4KHAA 2G5HC 1P3PA 4KGCB 2G5IC 3AZFD 3W97B 4J8VD 3REKB 1P3LB 3KWQD 4Z5TA 2DQNC 3KUYA 3FDDA 4XZQA 3LZ1D 4JJNC 3B6GB 4H9PB 5B40B 5AV8B 4UPKA 3C1BC 1P3GD 1P3AD 5G49B 2F8NB 2Y2PA 5BNXB 3KXBA 1EQZD 4G92B 2BYKB 1M1AC 2HIOB 1ULYA 5AVBC 4UUZA 4WNNB 3AZFA 4J8VA 1P3BA 1PZRA 5B2JC 5AV6C 4G91C 3KWQA 3AZJD 5BNVA 5AY8D 2FJ7C 3W96D 5F99C 1M1AA 3AV2D 5BS7C 3O62D 3AZHC 1P3AA 1KX4D 3AV1C 1EQZA 4AWLB 5C3IB 3AZLD 1ID3D 4KHAB 3P5JB 3KSYA 3V9RB 1P3IC 2Y2JA 3W98B 5AY8A 2Y2QA 2Y2GA 3X1TD 3AZND 2CV5C 3AZMC 4J8XC 4J8UD 1P3MC 3WKJB 4X23D 4XZQB 1KX3B 1TZYC 3WTPD 3O62A 3AV2A 4ZUXA 5AV5B 4H9NB 5BO0A 5DNMC 1KX4A 3EG5B 1H3OA 3WAAD 3AZMA 4WU9C 3AZLA 1ID3A 2BG1A 4CSRA 5DNND 4EO5C 3X1UB 3MGQC 3TU4D 3W99D 5B0YB 3LJAA 4UUZB 3AZNA 4J8UA 1P3KB 3MGPC 5B1MC 4X23A 3LZ1B 3WTPA 3RELC 3REJC 3MGQA 1P3GB 4QLCC 5CP6A 1S32D 5B32C 1P3AB 1ZLAD 3MNNC 3WAAA 3LZ0D 5CHLB 2AROD 3H0LC 4Z66D 5DNNA 3MGPA 2NQBD 3TU4A 4CAYB 5CPKD 3AL0C 3AZJB 4LD9C 3A1IA 5B32A 1P3FB 3WA9A 4WU8D 1M19C 5CPJB 3W96B 3AN2C 2Y2IA 1KX5A 3AV2B 1S32A 3O62B 3W97D 4J8WC 2DF4C 4YM6A 1ZLAA 1P3LD 5BO0B 2AROA 5FUGA 5AVCB 1T3UA 5GT0C 2Y2MA 5AV9A 2NQBA 1H3OB 3MVDB 5AV8D 3UT9C 3AZLB 5CPKA 4CSRB 4WU8A 5E5AD 5GSUC 3AZNB 3X1TB 1P34D 2F2AC 3AZGD 4KGCA 4X23B 3LELC 3W97A 4NE5A 3REKA 1P3LA 2NZDD 3X1SD 1A7WA 3B6GA 4H9PA 5B40A 5AV8A 2ZY2A 4YS3D 5G49A 1TAFB 3TU4B 3W99B 2W8SA 5BNXA 1P34A 2BYKA 2HIOA 1BH8B 4WNNA 2BYMB 5B31B 3B0DC 2F8NK 3X1SA 4XUJC 4R8PD 3AZID 3W98D 1HQ3D 1ZLAB 5B1LB 5BT1D 3LZ0B 2AROB 4Z66B 5JRGD 4YS3A 1U35D 5AV5D 1P3PC 5CPKB 4Z5TC 3KUYC 4XZQC 1KX3C 3AYWD 5CPIB 3V9RA 4R8PA 3B6FD 5B0YD 3NQJA 3W98A 5B24B 2F8NG 3KXBC 3WKJA 1P3KD 1KX3A 3NQUA 5AV5A 4H9NA 3F6TA 3AZFC 4J8VC 1P3BC 3KWQC 3EPLA 1B67A 5E5AB 3AFAD 1Z2CB 1P34B 4DRBA 3X1UA 3AYWA 3R45B 3AZGB 1P3GC 5B0YA 1P3AC 2FFFB 3B0CW 1P3FD 2NZDB 1N1JB 3X1SB 1P3KA 1EQZC 3EPKA 3LZ1A 1M18D 2UWXA 4WJ3C 5CPJD 5B2IB 4E45A 1P3GA 3AZJC 4YS3B 2YFWB 3REHD 2L5AA 1F66D 3AFAA 5AY8C 5AVCD 5GXQD 3MVDD 1F1EA 3AV2C 4CAYA 3O62C 1P3OB 4ZUXC 4NE6A 3AZJA 1P3FA 3VH5W 1KX4C 4R8PB 3AZIB 3NQJB 5GT3B 1M18A 1HQ3B 3W96A 2Y2OA 3AZED 5CPJA 5KDMA 3AZLC 1ID3C 2XD5A 3AZHD 3UTAD 5JRGB 5B0ZD 3NQUB 1U35B 3REHA 3LJAC 1F66A 5AVCA 3AZNC 4J8UC 2IO5B 2HUEB 2F8NH 4X23C 3MVDA 3WTPC 3AYWB 2PYOD 3B6FB 5CP6C 4J8XD 3AZEA 3X1TA 5B33D 3WAAC 5DNNC 5B31D 3TU4C 3WA9C 3MGRB 5B1LD 4NE3A 3AFAB 1TAFA 1KX5C 2PYOA 3W99A 1S32C 4YM6C 1ZLAC 2AROC 1BH8A 5AV9C 3RELD 1M18B 2NQBC 2BYMA 5B31A 3C1BB 5KDMB 4HGAC 5CPID 1WWIA 5CPKC 3REID 3MNND 5B24D 1W2EA 5B1LA 3REHB 4WU8C 1F66B 3LZ0A 3AZKD 4Z66A 5AVBB 5GXQB 4KGCC 4LD9D 5AV6B 3W97C 3EPHA 3REKC 1P3LC 3UTBD 1M19D 4KUDD 3AN2D 3B6GC 3AZEB 5B40C 4DRAA 5AV8C 5CPIA 4WV4B 4H9OB 4J8WD 3REIA 3AZHB 3UTAB 5B0ZB 5B24A 1AOID 1WWSA 3AV1B 5E5AC 3AZKA 4G92C 1P34C 2HIOC 5B32G 3UT9D 5B2ID 1KU5A 3UTBA 3X1SC 2PYOB 4KUDA 2CV5B 1P3MB 5E5AA 4J8XB 5B33B 3LELD 3R45A 3AZGA 2RIQA 2ZY3A 1P3OD 4YS3C 1AOIA 2NZDA 3WTPE 1N1JA 5GT3D 4AWLC 3X1VD 4WU9B 2Y2NA 5B2IA 5C3IC 4EO5B 2YFWA 4R8PC 3AZIC 3W98C 1R4VA 3A6ND 4WZSB 5BT1C 3WKJC 3RELB 3REJB 1P3OA 5AV5C 4XUJD 4QLCB 3REIB 3KFUG 3MNNB 3AZIA 5GT3A 3X1VA 1HQ3A 3C1CD 2IO5C 3MGSD 2RVQD 3AZKB 3X1UC 5JRGA 3AYWC 1U35A 5B0YC 4LD9B 2YFVB 3A6NA 3KUYD 3UTBB 3MGRD 1P3KC 4H9RB 1M19B 4KUDB 3LZ1C 3AN2B 3VH6A 4Z2MH 4NFTA 2JCHA 4ZBJB 4J8WB 3B6FA 3KXBD 3C1CA 1AOIB 5GT0B 3AFAC 3VH6W 3MGSA 4JJND 3UT9B 3C1BD 1JFIA 1P3BD 1P3FC 5JA4B 3MGRA 5GSUB 1M1AD 1M18C 3VH5A 3W96C 5CPJC 5AVBD 3LELB 2Y2LA 5B2JD 5AV6D 3REHC 1F66C 4JJNA 5AVCC 2FJ7D 4H9SC 5F99D 3X1VB 5GXQC 3C1BA 3MVDC 2Y2KA 4DQYB 3AV1D 1BH9A 3A6NB 3AZEC 3X1TC 1Q9CA 4H9SA 5AVBA 5GXQA 4ZUXD 3B0DB 3UTAC 5B2JA 5B0ZC 5AV6A 4XUJB 1P3ID 2FJ7A 2CV5D 5F99A 1P3MD 3AZMD 3C1CB 1TZYD 2JSSA 5BS7A 4H9OA 3MGSB 3AZHA 1P3PB 3UTAA 5B0ZA 3LJAD 5DNMD 3W99C 1JFIB 3AV1A 2PYOC 4H9QA 4Z5TB 3KUYB 5B33C 2XD1A 4WU9D 3H0RC 2LY8A 5B31C 3MGQD 3B0CT 1P3IA 3B0BA 3VH6T 5CP6D 2CV5A 1P3MA 3KXBB 2ZM5A 4J8XA 5B1LC 5B33A 3LZ0C 5B1MD 3MGPD 1TZYA 4JJNB 4Z66C 3REJD 5DNMA 3AZFB 4J8VB 4QLCD 1P3BB 3KWQB 5B32D 3WA9D 4M6BA 5BNVB 4WU9A 2J8PA 1M1AB 1BH9B 1KX5D 3VH5T 2JE5A 5CPIC 3REIC 4YM6D 5B2JB 4G91B 5B24C 5AV9D 1EQZB 5B1MA 3RELA 3AZKC 3REJA 5F99B 2FJ7B 4QLCA 3MNNA 3UTBC 5AY8B 5GT0D 4KUDC 1BFMA 4H9QB 4Z2MG 4KGCD 4ZBJC 3AZGC 4ZUXB 3REKD 2YFVA 4LD9A 1AOIC 1KX4B 5B31G 1P3IB 2NZDC 3B6GD 4H9RA 1M19A 5GSUD 5B40D 3AZMB 3AN2A 3H0MC 5B2IC 1ID3B 1TZYB 4J8WA 2F8ND 3LJAB 5DNMB 5GT0A 2HIOD 4J8UB 2CWEA 4E44A 3IP4C 3WTPB 3UT9A 1P3OC 3MGQB
chains in the Genus database with same CATH topology
5CP6B 2ZY5A 5JA4A 5GSUA 2ZY4A 5GT3C 3X1VC 1HTAA 1HQ3C 3WAAB 2VQRA 3MGPB 5B1MB 5DNNB 3LELA 2F8NA 5JRGC 2Y2HA 1U35C 3WA9B 5B32B 3A6NC 2HUEC 1P3PD 1KX5B 1S32B 4YM6B 3B6FC 3C1CC 4Z5TD 3WKJD 5FUGB 5AV9B 4XZQD 1KX3D 3MGSC 2RVQC 3EPJA 2NQBB 4HGAB 3A1KA 4XUJA 4WU8B 3MGRC 1B6WA 3X1UD 4KHAA 2G5HC 1P3PA 4KGCB 2G5IC 3AZFD 3W97B 4J8VD 3REKB 1P3LB 3KWQD 4Z5TA 2DQNC 3KUYA 3FDDA 4XZQA 3LZ1D 4JJNC 3B6GB 4H9PB 5B40B 5AV8B 4UPKA 3C1BC 1P3GD 1P3AD 5G49B 2F8NB 2Y2PA 5BNXB 3KXBA 1EQZD 4G92B 2BYKB 1M1AC 2HIOB 1ULYA 5AVBC 4UUZA 4WNNB 3AZFA 4J8VA 1P3BA 1PZRA 5B2JC 5AV6C 4G91C 3KWQA 3AZJD 5BNVA 5AY8D 2FJ7C 3W96D 5F99C 1M1AA 3AV2D 5BS7C 3O62D 3AZHC 1P3AA 1KX4D 3AV1C 1EQZA 4AWLB 5C3IB 3AZLD 1ID3D 4KHAB 3P5JB 3KSYA 3V9RB 1P3IC 2Y2JA 3W98B 5AY8A 2Y2QA 2Y2GA 3X1TD 3AZND 2CV5C 3AZMC 4J8XC 4J8UD 1P3MC 3WKJB 4X23D 4XZQB 1KX3B 1TZYC 3WTPD 3O62A 3AV2A 4ZUXA 5AV5B 4H9NB 5BO0A 5DNMC 1KX4A 3EG5B 1H3OA 3WAAD 3AZMA 4WU9C 3AZLA 1ID3A 2BG1A 4CSRA 5DNND 4EO5C 3X1UB 3MGQC 3TU4D 3W99D 5B0YB 3LJAA 4UUZB 3AZNA 4J8UA 1P3KB 3MGPC 5B1MC 4X23A 3LZ1B 3WTPA 3RELC 3REJC 3MGQA 1P3GB 4QLCC 5CP6A 1S32D 5B32C 1P3AB 1ZLAD 3MNNC 3WAAA 3LZ0D 5CHLB 2AROD 3H0LC 4Z66D 5DNNA 3MGPA 2NQBD 3TU4A 4CAYB 5CPKD 3AL0C 3AZJB 4LD9C 3A1IA 5B32A 1P3FB 3WA9A 4WU8D 1M19C 5CPJB 3W96B 3AN2C 2Y2IA 1KX5A 3AV2B 1S32A 3O62B 3W97D 4J8WC 2DF4C 4YM6A 1ZLAA 1P3LD 5BO0B 2AROA 5FUGA 5AVCB 1T3UA 5GT0C 2Y2MA 5AV9A 2NQBA 1H3OB 3MVDB 5AV8D 3UT9C 3AZLB 5CPKA 4CSRB 4WU8A 5E5AD 5GSUC 3AZNB 3X1TB 1P34D 2F2AC 3AZGD 4KGCA 4X23B 3LELC 3W97A 4NE5A 3REKA 1P3LA 2NZDD 3X1SD 1A7WA 3B6GA 4H9PA 5B40A 5AV8A 2ZY2A 4YS3D 5G49A 1TAFB 3TU4B 3W99B 2W8SA 5BNXA 1P34A 2BYKA 2HIOA 1BH8B 4WNNA 2BYMB 5B31B 3B0DC 2F8NK 3X1SA 4XUJC 4R8PD 3AZID 3W98D 1HQ3D 1ZLAB 5B1LB 5BT1D 3LZ0B 2AROB 4Z66B 5JRGD 4YS3A 1U35D 5AV5D 1P3PC 5CPKB 4Z5TC 3KUYC 4XZQC 1KX3C 3AYWD 5CPIB 3V9RA 4R8PA 3B6FD 5B0YD 3NQJA 3W98A 5B24B 2F8NG 3KXBC 3WKJA 1P3KD 1KX3A 3NQUA 5AV5A 4H9NA 3F6TA 3AZFC 4J8VC 1P3BC 3KWQC 3EPLA 1B67A 5E5AB 3AFAD 1Z2CB 1P34B 4DRBA 3X1UA 3AYWA 3R45B 3AZGB 1P3GC 5B0YA 1P3AC 2FFFB 3B0CW 1P3FD 2NZDB 1N1JB 3X1SB 1P3KA 1EQZC 3EPKA 3LZ1A 1M18D 2UWXA 4WJ3C 5CPJD 5B2IB 4E45A 1P3GA 3AZJC 4YS3B 2YFWB 3REHD 2L5AA 1F66D 3AFAA 5AY8C 5AVCD 5GXQD 3MVDD 1F1EA 3AV2C 4CAYA 3O62C 1P3OB 4ZUXC 4NE6A 3AZJA 1P3FA 3VH5W 1KX4C 4R8PB 3AZIB 3NQJB 5GT3B 1M18A 1HQ3B 3W96A 2Y2OA 3AZED 5CPJA 5KDMA 3AZLC 1ID3C 2XD5A 3AZHD 3UTAD 5JRGB 5B0ZD 3NQUB 1U35B 3REHA 3LJAC 1F66A 5AVCA 3AZNC 4J8UC 2IO5B 2HUEB 2F8NH 4X23C 3MVDA 3WTPC 3AYWB 2PYOD 3B6FB 5CP6C 4J8XD 3AZEA 3X1TA 5B33D 3WAAC 5DNNC 5B31D 3TU4C 3WA9C 3MGRB 5B1LD 4NE3A 3AFAB 1TAFA 1KX5C 2PYOA 3W99A 1S32C 4YM6C 1ZLAC 2AROC 1BH8A 5AV9C 3RELD 1M18B 2NQBC 2BYMA 5B31A 3C1BB 5KDMB 4HGAC 5CPID 1WWIA 5CPKC 3REID 3MNND 5B24D 1W2EA 5B1LA 3REHB 4WU8C 1F66B 3LZ0A 3AZKD 4Z66A 5AVBB 5GXQB 4KGCC 4LD9D 5AV6B 3W97C 3EPHA 3REKC 1P3LC 3UTBD 1M19D 4KUDD 3AN2D 3B6GC 3AZEB 5B40C 4DRAA 5AV8C 5CPIA 4WV4B 4H9OB 4J8WD 3REIA 3AZHB 3UTAB 5B0ZB 5B24A 1AOID 1WWSA 3AV1B 5E5AC 3AZKA 4G92C 1P34C 2HIOC 5B32G 3UT9D 5B2ID 1KU5A 3UTBA 3X1SC 2PYOB 4KUDA 2CV5B 1P3MB 5E5AA 4J8XB 5B33B 3LELD 3R45A 3AZGA 2RIQA 2ZY3A 1P3OD 4YS3C 1AOIA 2NZDA 3WTPE 1N1JA 5GT3D 4AWLC 3X1VD 4WU9B 2Y2NA 5B2IA 5C3IC 4EO5B 2YFWA 4R8PC 3AZIC 3W98C 1R4VA 3A6ND 4WZSB 5BT1C 3WKJC 3RELB 3REJB 1P3OA 5AV5C 4XUJD 4QLCB 3REIB 3KFUG 3MNNB 3AZIA 5GT3A 3X1VA 1HQ3A 3C1CD 2IO5C 3MGSD 2RVQD 3AZKB 3X1UC 5JRGA 3AYWC 1U35A 5B0YC 4LD9B 2YFVB 3A6NA 3KUYD 3UTBB 3MGRD 1P3KC 4H9RB 1M19B 4KUDB 3LZ1C 3AN2B 3VH6A 4Z2MH 4NFTA 2JCHA 4ZBJB 4J8WB 3B6FA 3KXBD 3C1CA 1AOIB 5GT0B 3AFAC 3VH6W 3MGSA 4JJND 3UT9B 3C1BD 1JFIA 1P3BD 1P3FC 5JA4B 3MGRA 5GSUB 1M1AD 1M18C 3VH5A 3W96C 5CPJC 5AVBD 3LELB 2Y2LA 5B2JD 5AV6D 3REHC 1F66C 4JJNA 5AVCC 2FJ7D 4H9SC 5F99D 3X1VB 5GXQC 3C1BA 3MVDC 2Y2KA 4DQYB 3AV1D 1BH9A 3A6NB 3AZEC 3X1TC 1Q9CA 4H9SA 5AVBA 5GXQA 4ZUXD 3B0DB 3UTAC 5B2JA 5B0ZC 5AV6A 4XUJB 1P3ID 2FJ7A 2CV5D 5F99A 1P3MD 3AZMD 3C1CB 1TZYD 2JSSA 5BS7A 4H9OA 3MGSB 3AZHA 1P3PB 3UTAA 5B0ZA 3LJAD 5DNMD 3W99C 1JFIB 3AV1A 2PYOC 4H9QA 4Z5TB 3KUYB 5B33C 2XD1A 4WU9D 3H0RC 2LY8A 5B31C 3MGQD 3B0CT 1P3IA 3B0BA 3VH6T 5CP6D 2CV5A 1P3MA 3KXBB 2ZM5A 4J8XA 5B1LC 5B33A 3LZ0C 5B1MD 3MGPD 1TZYA 4JJNB 4Z66C 3REJD 5DNMA 3AZFB 4J8VB 4QLCD 1P3BB 3KWQB 5B32D 3WA9D 4M6BA 5BNVB 4WU9A 2J8PA 1M1AB 1BH9B 1KX5D 3VH5T 2JE5A 5CPIC 3REIC 4YM6D 5B2JB 4G91B 5B24C 5AV9D 1EQZB 5B1MA 3RELA 3AZKC 3REJA 5F99B 2FJ7B 4QLCA 3MNNA 3UTBC 5AY8B 5GT0D 4KUDC 1BFMA 4H9QB 4Z2MG 4KGCD 4ZBJC 3AZGC 4ZUXB 3REKD 2YFVA 4LD9A 1AOIC 1KX4B 5B31G 1P3IB 2NZDC 3B6GD 4H9RA 1M19A 5GSUD 5B40D 3AZMB 3AN2A 3H0MC 5B2IC 1ID3B 1TZYB 4J8WA 2F8ND 3LJAB 5DNMB 5GT0A 2HIOD 4J8UB 2CWEA 4E44A 3IP4C 3WTPB 3UT9A 1P3OC 3MGQB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CP6 B;  5JA4 A;  5GSU A;  5GT3 C;  3X1V C;  1HTA A;  1HQ3 C;  3WAA B;  3MGP B;  5B1M B;  5DNN B;  3LEL A;  2F8N A;  5JRG C;  1U35 C;  3WA9 B;  5B32 B;  3A6N C;  2HUE C;  1P3P D;  1KX5 B;  1S32 B;  4YM6 B;  3B6F C;  3C1C C;  4Z5T D;  3WKJ D;  5FUG B;  5AV9 B;  4XZQ D;  1KX3 D;  3MGS C;  2RVQ C;  2NQB B;  4HGA B;  4XUJ A;  4WU8 B;  3MGR C;  1B6W A;  3X1U D;  4KHA A;  1P3P A;  4KGC B;  3AZF D;  3W97 B;  4J8V D;  3REK B;  1P3L B;  3KWQ D;  4Z5T A;  3KUY A;  4XZQ A;  3LZ1 D;  4JJN C;  3B6G B;  4H9P B;  5B40 B;  5AV8 B;  3C1B C;  1P3G D;  1P3A D;  5G49 B;  2F8N B;  5BNX B;  3KXB A;  1EQZ D;  4G92 B;  2BYK B;  1M1A C;  2HIO B;  1ULY A;  5AVB C;  4UUZ A;  4WNN B;  3AZF A;  4J8V A;  1P3B A;  5B2J C;  3AZJ D;  5AV6 C;  4G91 C;  3KWQ A;  5BNV A;  5AY8 D;  2FJ7 C;  3W96 D;  5F99 C;  1M1A A;  3AV2 D;  5BS7 C;  3O62 D;  3AZH C;  1P3A A;  1KX4 D;  3AV1 C;  1EQZ A;  4AWL B;  5C3I B;  3AZL D;  1ID3 D;  4KHA B;  3KSY A;  3V9R B;  1P3I C;  3W98 B;  5AY8 A;  3AZN D;  3X1T D;  2CV5 C;  1P3M C;  3AZM C;  4J8X C;  4J8U D;  3WKJ B;  4X23 D;  4XZQ B;  1KX3 B;  1TZY C;  3WTP D;  3O62 A;  3AV2 A;  4ZUX A;  5AV5 B;  4H9N B;  5BO0 A;  5DNM C;  1KX4 A;  1H3O A;  3WAA D;  3AZM A;  4WU9 C;  3AZL A;  1ID3 A;  4CSR A;  5DNN D;  4EO5 C;  3X1U B;  3MGQ C;  3TU4 D;  3W99 D;  5B0Y B;  3LJA A;  4UUZ B;  3AZN A;  4J8U A;  1P3K B;  3MGP C;  5B1M C;  4X23 A;  3LZ1 B;  3WTP A;  3REL C;  3REJ C;  3MGQ A;  1P3G B;  4QLC C;  5CP6 A;  1S32 D;  5B32 C;  1P3A B;  1ZLA D;  3MNN C;  3WAA A;  3LZ0 D;  5CHL B;  2ARO D;  3MGP A;  4Z66 D;  5DNN A;  2NQB D;  3TU4 A;  4CAY B;  5CPK D;  3AZJ B;  4LD9 C;  1P3F B;  5B32 A;  3WA9 A;  4WU8 D;  1M19 C;  5CPJ B;  3W96 B;  3AN2 C;  1KX5 A;  3AV2 B;  1S32 A;  3O62 B;  3W97 D;  4J8W C;  4YM6 A;  1ZLA A;  1P3L D;  5BO0 B;  2ARO A;  5FUG A;  5AVC B;  5GT0 C;  5AV9 A;  2NQB A;  1H3O B;  3MVD B;  5AV8 D;  3UT9 C;  3AZL B;  5CPK A;  4CSR B;  4WU8 A;  5E5A D;  5GSU C;  3AZN B;  3X1T B;  1P34 D;  3AZG D;  4KGC A;  4X23 B;  3LEL C;  3W97 A;  4NE5 A;  3REK A;  1P3L A;  2NZD D;  3X1S D;  1A7W A;  3B6G A;  4H9P A;  5B40 A;  5AV8 A;  4YS3 D;  5G49 A;  1TAF B;  3TU4 B;  3W99 B;  5BNX A;  1P34 A;  2BYK A;  2HIO A;  1BH8 B;  4WNN A;  2BYM B;  5B31 B;  3B0D C;  2F8N K;  3X1S A;  4XUJ C;  4R8P D;  3AZI D;  3W98 D;  1HQ3 D;  1ZLA B;  5B1L B;  5BT1 D;  3LZ0 B;  2ARO B;  4Z66 B;  5JRG D;  4YS3 A;  1U35 D;  5AV5 D;  1P3P C;  5CPK B;  4Z5T C;  3KUY C;  4XZQ C;  1KX3 C;  3AYW D;  5CPI B;  3V9R A;  4R8P A;  3B6F D;  5B0Y D;  3NQJ A;  3W98 A;  5B24 B;  2F8N G;  3KXB C;  3WKJ A;  1P3K D;  1KX3 A;  3NQU A;  5AV5 A;  4H9N A;  3AZF C;  4J8V C;  1P3B C;  3KWQ C;  1B67 A;  5E5A B;  3AFA D;  1P34 B;  4DRB A;  3X1U A;  3AYW A;  3R45 B;  3AZG B;  1P3G C;  5B0Y A;  1P3A C;  3B0C W;  1P3F D;  2NZD B;  1N1J B;  3X1S B;  1P3K A;  1EQZ C;  3LZ1 A;  1M18 D;  5CPJ D;  5B2I B;  4E45 A;  1P3G A;  3AZJ C;  4YS3 B;  2YFW B;  3REH D;  2L5A A;  1F66 D;  3AFA A;  5AY8 C;  5AVC D;  5GXQ D;  3MVD D;  1F1E A;  3AV2 C;  4CAY A;  3O62 C;  1P3O B;  4ZUX C;  4NE6 A;  3AZJ A;  1P3F A;  3VH5 W;  1KX4 C;  4R8P B;  3AZI B;  3NQJ B;  5GT3 B;  1M18 A;  1HQ3 B;  3W96 A;  3AZE D;  5CPJ A;  5KDM A;  3AZL C;  1ID3 C;  3AZH D;  3UTA D;  5JRG B;  5B0Z D;  3NQU B;  1U35 B;  3REH A;  3LJA C;  1F66 A;  5AVC A;  3AZN C;  4J8U C;  2IO5 B;  2HUE B;  2F8N H;  4X23 C;  3MVD A;  3WTP C;  3AYW B;  2PYO D;  3B6F B;  5CP6 C;  4J8X D;  3AZE A;  3X1T A;  5B33 D;  3WAA C;  5DNN C;  5B31 D;  3TU4 C;  3WA9 C;  3MGR B;  5B1L D;  4NE3 A;  3AFA B;  1TAF A;  1KX5 C;  2PYO A;  3W99 A;  1S32 C;  4YM6 C;  1ZLA C;  2ARO C;  1BH8 A;  5AV9 C;  3REL D;  1M18 B;  2NQB C;  2BYM A;  5B31 A;  3C1B B;  5KDM B;  4HGA C;  5CPI D;  1WWI A;  5CPK C;  3REI D;  3MNN D;  5B24 D;  3REH B;  5B1L A;  4WU8 C;  1F66 B;  3LZ0 A;  3AZK D;  4Z66 A;  5AVB B;  5GXQ B;  4KGC C;  4LD9 D;  5AV6 B;  3W97 C;  3REK C;  1P3L C;  3UTB D;  1M19 D;  4KUD D;  3AN2 D;  3B6G C;  3AZE B;  5B40 C;  4DRA A;  5AV8 C;  5CPI A;  4WV4 B;  4H9O B;  4J8W D;  3REI A;  3AZH B;  3UTA B;  5B0Z B;  5B24 A;  1AOI D;  1WWS A;  3AV1 B;  5E5A C;  3AZK A;  4G92 C;  1P34 C;  2HIO C;  5B32 G;  3UT9 D;  5B2I D;  1KU5 A;  3UTB A;  3X1S C;  2PYO B;  4KUD A;  2CV5 B;  1P3M B;  5E5A A;  4J8X B;  5B33 B;  3LEL D;  3R45 A;  3AZG A;  1P3O D;  4YS3 C;  1AOI A;  2NZD A;  3WTP E;  1N1J A;  5GT3 D;  4AWL C;  3X1V D;  4WU9 B;  5B2I A;  5C3I C;  4EO5 B;  2YFW A;  4R8P C;  3AZI C;  3W98 C;  1R4V A;  3A6N D;  4WZS B;  5BT1 C;  3WKJ C;  3REL B;  3REJ B;  1P3O A;  5AV5 C;  4XUJ D;  4QLC B;  3REI B;  3MNN B;  3AZI A;  5GT3 A;  3X1V A;  1HQ3 A;  3C1C D;  2IO5 C;  3MGS D;  2RVQ D;  3AZK B;  3X1U C;  5JRG A;  3AYW C;  1U35 A;  5B0Y C;  4LD9 B;  2YFV B;  3A6N A;  3KUY D;  3UTB B;  3MGR D;  1P3K C;  4H9R B;  1M19 B;  4KUD B;  3LZ1 C;  3AN2 B;  3VH6 A;  4Z2M H;  4NFT A;  4ZBJ B;  4J8W B;  3B6F A;  3KXB D;  3C1C A;  1AOI B;  5GT0 B;  3AFA C;  3VH6 W;  3MGS A;  4JJN D;  3UT9 B;  3C1B D;  1JFI A;  1P3B D;  1P3F C;  5JA4 B;  3MGR A;  5GSU B;  1M1A D;  1M18 C;  3VH5 A;  3W96 C;  5CPJ C;  5AVB D;  3LEL B;  5B2J D;  5AV6 D;  3REH C;  1F66 C;  4JJN A;  5AVC C;  2FJ7 D;  4H9S C;  5F99 D;  3X1V B;  5GXQ C;  3C1B A;  3MVD C;  3AV1 D;  1BH9 A;  3A6N B;  3AZE C;  3X1T C;  1Q9C A;  4H9S A;  5AVB A;  5GXQ A;  4ZUX D;  3B0D B;  3UTA C;  5B2J A;  5B0Z C;  5AV6 A;  4XUJ B;  1P3I D;  2FJ7 A;  2CV5 D;  5F99 A;  1P3M D;  3AZM D;  3C1C B;  1TZY D;  2JSS A;  5BS7 A;  4H9O A;  3MGS B;  3AZH A;  1P3P B;  3UTA A;  5B0Z A;  3LJA D;  5DNM D;  3W99 C;  1JFI B;  3AV1 A;  2PYO C;  4H9Q A;  4Z5T B;  3KUY B;  5B33 C;  4WU9 D;  2LY8 A;  5B31 C;  3MGQ D;  3B0C T;  1P3I A;  3B0B A;  3VH6 T;  5CP6 D;  2CV5 A;  1P3M A;  3KXB B;  4J8X A;  5B1L C;  5B33 A;  3LZ0 C;  5B1M D;  3MGP D;  1TZY A;  4JJN B;  4Z66 C;  3REJ D;  5DNM A;  3AZF B;  4J8V B;  4QLC D;  1P3B B;  3KWQ B;  5B32 D;  3WA9 D;  4M6B A;  5BNV B;  4WU9 A;  1M1A B;  1BH9 B;  1KX5 D;  3VH5 T;  5CPI C;  3REI C;  4YM6 D;  5B2J B;  4G91 B;  5B24 C;  5AV9 D;  1EQZ B;  5B1M A;  3REL A;  3AZK C;  3REJ A;  5F99 B;  2FJ7 B;  4QLC A;  3MNN A;  3UTB C;  5AY8 B;  5GT0 D;  4KUD C;  1BFM A;  4H9Q B;  4Z2M G;  4KGC D;  4ZBJ C;  3AZG C;  4ZUX B;  3REK D;  2YFV A;  4LD9 A;  1AOI C;  1KX4 B;  5B31 G;  1P3I B;  2NZD C;  3B6G D;  4H9R A;  1M19 A;  5GSU D;  5B40 D;  3AZM B;  3AN2 A;  1ID3 B;  5B2I C;  1TZY B;  4J8W A;  2F8N D;  3LJA B;  5DNM B;  5GT0 A;  2HIO D;  4J8U B;  2CWE A;  4E44 A;  3WTP B;  3UT9 A;  1P3O C;  3MGQ B; 
#chains in the Genus database with same CATH topology
 5CP6 B;  2ZY5 A;  5JA4 A;  5GSU A;  2ZY4 A;  5GT3 C;  3X1V C;  1HTA A;  1HQ3 C;  3WAA B;  2VQR A;  3MGP B;  5B1M B;  5DNN B;  3LEL A;  2F8N A;  5JRG C;  2Y2H A;  1U35 C;  3WA9 B;  5B32 B;  3A6N C;  2HUE C;  1P3P D;  1KX5 B;  1S32 B;  4YM6 B;  3B6F C;  3C1C C;  4Z5T D;  3WKJ D;  5FUG B;  5AV9 B;  4XZQ D;  1KX3 D;  3MGS C;  2RVQ C;  3EPJ A;  2NQB B;  4HGA B;  3A1K A;  4XUJ A;  4WU8 B;  3MGR C;  1B6W A;  3X1U D;  4KHA A;  2G5H C;  1P3P A;  4KGC B;  2G5I C;  3AZF D;  3W97 B;  4J8V D;  3REK B;  1P3L B;  3KWQ D;  4Z5T A;  2DQN C;  3KUY A;  3FDD A;  4XZQ A;  3LZ1 D;  4JJN C;  3B6G B;  4H9P B;  5B40 B;  5AV8 B;  4UPK A;  3C1B C;  1P3G D;  1P3A D;  5G49 B;  2F8N B;  2Y2P A;  5BNX B;  3KXB A;  1EQZ D;  4G92 B;  2BYK B;  1M1A C;  2HIO B;  1ULY A;  5AVB C;  4UUZ A;  4WNN B;  3AZF A;  4J8V A;  1P3B A;  1PZR A;  5B2J C;  5AV6 C;  4G91 C;  3KWQ A;  3AZJ D;  5BNV A;  5AY8 D;  2FJ7 C;  3W96 D;  5F99 C;  1M1A A;  3AV2 D;  5BS7 C;  3O62 D;  3AZH C;  1P3A A;  1KX4 D;  3AV1 C;  1EQZ A;  4AWL B;  5C3I B;  3AZL D;  1ID3 D;  4KHA B;  3P5J B;  3KSY A;  3V9R B;  1P3I C;  2Y2J A;  3W98 B;  5AY8 A;  2Y2Q A;  2Y2G A;  3X1T D;  3AZN D;  2CV5 C;  3AZM C;  4J8X C;  4J8U D;  1P3M C;  3WKJ B;  4X23 D;  4XZQ B;  1KX3 B;  1TZY C;  3WTP D;  3O62 A;  3AV2 A;  4ZUX A;  5AV5 B;  4H9N B;  5BO0 A;  5DNM C;  1KX4 A;  3EG5 B;  1H3O A;  3WAA D;  3AZM A;  4WU9 C;  3AZL A;  1ID3 A;  2BG1 A;  4CSR A;  5DNN D;  4EO5 C;  3X1U B;  3MGQ C;  3TU4 D;  3W99 D;  5B0Y B;  3LJA A;  4UUZ B;  3AZN A;  4J8U A;  1P3K B;  3MGP C;  5B1M C;  4X23 A;  3LZ1 B;  3WTP A;  3REL C;  3REJ C;  3MGQ A;  1P3G B;  4QLC C;  5CP6 A;  1S32 D;  5B32 C;  1P3A B;  1ZLA D;  3MNN C;  3WAA A;  3LZ0 D;  5CHL B;  2ARO D;  3H0L C;  4Z66 D;  5DNN A;  3MGP A;  2NQB D;  3TU4 A;  4CAY B;  5CPK D;  3AL0 C;  3AZJ B;  4LD9 C;  3A1I A;  5B32 A;  1P3F B;  3WA9 A;  4WU8 D;  1M19 C;  5CPJ B;  3W96 B;  3AN2 C;  2Y2I A;  1KX5 A;  3AV2 B;  1S32 A;  3O62 B;  3W97 D;  4J8W C;  2DF4 C;  4YM6 A;  1ZLA A;  1P3L D;  5BO0 B;  2ARO A;  5FUG A;  5AVC B;  1T3U A;  5GT0 C;  2Y2M A;  5AV9 A;  2NQB A;  1H3O B;  3MVD B;  5AV8 D;  3UT9 C;  3AZL B;  5CPK A;  4CSR B;  4WU8 A;  5E5A D;  5GSU C;  3AZN B;  3X1T B;  1P34 D;  2F2A C;  3AZG D;  4KGC A;  4X23 B;  3LEL C;  3W97 A;  4NE5 A;  3REK A;  1P3L A;  2NZD D;  3X1S D;  1A7W A;  3B6G A;  4H9P A;  5B40 A;  5AV8 A;  2ZY2 A;  4YS3 D;  5G49 A;  1TAF B;  3TU4 B;  3W99 B;  2W8S A;  5BNX A;  1P34 A;  2BYK A;  2HIO A;  1BH8 B;  4WNN A;  2BYM B;  5B31 B;  3B0D C;  2F8N K;  3X1S A;  4XUJ C;  4R8P D;  3AZI D;  3W98 D;  1HQ3 D;  1ZLA B;  5B1L B;  5BT1 D;  3LZ0 B;  2ARO B;  4Z66 B;  5JRG D;  4YS3 A;  1U35 D;  5AV5 D;  1P3P C;  5CPK B;  4Z5T C;  3KUY C;  4XZQ C;  1KX3 C;  3AYW D;  5CPI B;  3V9R A;  4R8P A;  3B6F D;  5B0Y D;  3NQJ A;  3W98 A;  5B24 B;  2F8N G;  3KXB C;  3WKJ A;  1P3K D;  1KX3 A;  3NQU A;  5AV5 A;  4H9N A;  3F6T A;  3AZF C;  4J8V C;  1P3B C;  3KWQ C;  3EPL A;  1B67 A;  5E5A B;  3AFA D;  1Z2C B;  1P34 B;  4DRB A;  3X1U A;  3AYW A;  3R45 B;  3AZG B;  1P3G C;  5B0Y A;  1P3A C;  2FFF B;  3B0C W;  1P3F D;  2NZD B;  1N1J B;  3X1S B;  1P3K A;  1EQZ C;  3EPK A;  3LZ1 A;  1M18 D;  2UWX A;  4WJ3 C;  5CPJ D;  5B2I B;  4E45 A;  1P3G A;  3AZJ C;  4YS3 B;  2YFW B;  3REH D;  2L5A A;  1F66 D;  3AFA A;  5AY8 C;  5AVC D;  5GXQ D;  3MVD D;  1F1E A;  3AV2 C;  4CAY A;  3O62 C;  1P3O B;  4ZUX C;  4NE6 A;  3AZJ A;  1P3F A;  3VH5 W;  1KX4 C;  4R8P B;  3AZI B;  3NQJ B;  5GT3 B;  1M18 A;  1HQ3 B;  3W96 A;  2Y2O A;  3AZE D;  5CPJ A;  5KDM A;  3AZL C;  1ID3 C;  2XD5 A;  3AZH D;  3UTA D;  5JRG B;  5B0Z D;  3NQU B;  1U35 B;  3REH A;  3LJA C;  1F66 A;  5AVC A;  3AZN C;  4J8U C;  2IO5 B;  2HUE B;  2F8N H;  4X23 C;  3MVD A;  3WTP C;  3AYW B;  2PYO D;  3B6F B;  5CP6 C;  4J8X D;  3AZE A;  3X1T A;  5B33 D;  3WAA C;  5DNN C;  5B31 D;  3TU4 C;  3WA9 C;  3MGR B;  5B1L D;  4NE3 A;  3AFA B;  1TAF A;  1KX5 C;  2PYO A;  3W99 A;  1S32 C;  4YM6 C;  1ZLA C;  2ARO C;  1BH8 A;  5AV9 C;  3REL D;  1M18 B;  2NQB C;  2BYM A;  5B31 A;  3C1B B;  5KDM B;  4HGA C;  5CPI D;  1WWI A;  5CPK C;  3REI D;  3MNN D;  5B24 D;  1W2E A;  5B1L A;  3REH B;  4WU8 C;  1F66 B;  3LZ0 A;  3AZK D;  4Z66 A;  5AVB B;  5GXQ B;  4KGC C;  4LD9 D;  5AV6 B;  3W97 C;  3EPH A;  3REK C;  1P3L C;  3UTB D;  1M19 D;  4KUD D;  3AN2 D;  3B6G C;  3AZE B;  5B40 C;  4DRA A;  5AV8 C;  5CPI A;  4WV4 B;  4H9O B;  4J8W D;  3REI A;  3AZH B;  3UTA B;  5B0Z B;  5B24 A;  1AOI D;  1WWS A;  3AV1 B;  5E5A C;  3AZK A;  4G92 C;  1P34 C;  2HIO C;  5B32 G;  3UT9 D;  5B2I D;  1KU5 A;  3UTB A;  3X1S C;  2PYO B;  4KUD A;  2CV5 B;  1P3M B;  5E5A A;  4J8X B;  5B33 B;  3LEL D;  3R45 A;  3AZG A;  2RIQ A;  2ZY3 A;  1P3O D;  4YS3 C;  1AOI A;  2NZD A;  3WTP E;  1N1J A;  5GT3 D;  4AWL C;  3X1V D;  4WU9 B;  2Y2N A;  5B2I A;  5C3I C;  4EO5 B;  2YFW A;  4R8P C;  3AZI C;  3W98 C;  1R4V A;  3A6N D;  4WZS B;  5BT1 C;  3WKJ C;  3REL B;  3REJ B;  1P3O A;  5AV5 C;  4XUJ D;  4QLC B;  3REI B;  3KFU G;  3MNN B;  3AZI A;  5GT3 A;  3X1V A;  1HQ3 A;  3C1C D;  2IO5 C;  3MGS D;  2RVQ D;  3AZK B;  3X1U C;  5JRG A;  3AYW C;  1U35 A;  5B0Y C;  4LD9 B;  2YFV B;  3A6N A;  3KUY D;  3UTB B;  3MGR D;  1P3K C;  4H9R B;  1M19 B;  4KUD B;  3LZ1 C;  3AN2 B;  3VH6 A;  4Z2M H;  4NFT A;  2JCH A;  4ZBJ B;  4J8W B;  3B6F A;  3KXB D;  3C1C A;  1AOI B;  5GT0 B;  3AFA C;  3VH6 W;  3MGS A;  4JJN D;  3UT9 B;  3C1B D;  1JFI A;  1P3B D;  1P3F C;  5JA4 B;  3MGR A;  5GSU B;  1M1A D;  1M18 C;  3VH5 A;  3W96 C;  5CPJ C;  5AVB D;  3LEL B;  2Y2L A;  5B2J D;  5AV6 D;  3REH C;  1F66 C;  4JJN A;  5AVC C;  2FJ7 D;  4H9S C;  5F99 D;  3X1V B;  5GXQ C;  3C1B A;  3MVD C;  2Y2K A;  4DQY B;  3AV1 D;  1BH9 A;  3A6N B;  3AZE C;  3X1T C;  1Q9C A;  4H9S A;  5AVB A;  5GXQ A;  4ZUX D;  3B0D B;  3UTA C;  5B2J A;  5B0Z C;  5AV6 A;  4XUJ B;  1P3I D;  2FJ7 A;  2CV5 D;  5F99 A;  1P3M D;  3AZM D;  3C1C B;  1TZY D;  2JSS A;  5BS7 A;  4H9O A;  3MGS B;  3AZH A;  1P3P B;  3UTA A;  5B0Z A;  3LJA D;  5DNM D;  3W99 C;  1JFI B;  3AV1 A;  2PYO C;  4H9Q A;  4Z5T B;  3KUY B;  5B33 C;  2XD1 A;  4WU9 D;  3H0R C;  2LY8 A;  5B31 C;  3MGQ D;  3B0C T;  1P3I A;  3B0B A;  3VH6 T;  5CP6 D;  2CV5 A;  1P3M A;  3KXB B;  2ZM5 A;  4J8X A;  5B1L C;  5B33 A;  3LZ0 C;  5B1M D;  3MGP D;  1TZY A;  4JJN B;  4Z66 C;  3REJ D;  5DNM A;  3AZF B;  4J8V B;  4QLC D;  1P3B B;  3KWQ B;  5B32 D;  3WA9 D;  4M6B A;  5BNV B;  4WU9 A;  2J8P A;  1M1A B;  1BH9 B;  1KX5 D;  3VH5 T;  2JE5 A;  5CPI C;  3REI C;  4YM6 D;  5B2J B;  4G91 B;  5B24 C;  5AV9 D;  1EQZ B;  5B1M A;  3REL A;  3AZK C;  3REJ A;  5F99 B;  2FJ7 B;  4QLC A;  3MNN A;  3UTB C;  5AY8 B;  5GT0 D;  4KUD C;  1BFM A;  4H9Q B;  4Z2M G;  4KGC D;  4ZBJ C;  3AZG C;  4ZUX B;  3REK D;  2YFV A;  4LD9 A;  1AOI C;  1KX4 B;  5B31 G;  1P3I B;  2NZD C;  3B6G D;  4H9R A;  1M19 A;  5GSU D;  5B40 D;  3AZM B;  3AN2 A;  3H0M C;  5B2I C;  1ID3 B;  1TZY B;  4J8W A;  2F8N D;  3LJA B;  5DNM B;  5GT0 A;  2HIO D;  4J8U B;  2CWE A;  4E44 A;  3IP4 C;  3WTP B;  3UT9 A;  1P3O C;  3MGQ B; 
#chains in the Genus database with same CATH homology
 5CP6 B;  2ZY5 A;  5JA4 A;  5GSU A;  2ZY4 A;  5GT3 C;  3X1V C;  1HTA A;  1HQ3 C;  3WAA B;  2VQR A;  3MGP B;  5B1M B;  5DNN B;  3LEL A;  2F8N A;  5JRG C;  2Y2H A;  1U35 C;  3WA9 B;  5B32 B;  3A6N C;  2HUE C;  1P3P D;  1KX5 B;  1S32 B;  4YM6 B;  3B6F C;  3C1C C;  4Z5T D;  3WKJ D;  5FUG B;  5AV9 B;  4XZQ D;  1KX3 D;  3MGS C;  2RVQ C;  3EPJ A;  2NQB B;  4HGA B;  3A1K A;  4XUJ A;  4WU8 B;  3MGR C;  1B6W A;  3X1U D;  4KHA A;  2G5H C;  1P3P A;  4KGC B;  2G5I C;  3AZF D;  3W97 B;  4J8V D;  3REK B;  1P3L B;  3KWQ D;  4Z5T A;  2DQN C;  3KUY A;  3FDD A;  4XZQ A;  3LZ1 D;  4JJN C;  3B6G B;  4H9P B;  5B40 B;  5AV8 B;  4UPK A;  3C1B C;  1P3G D;  1P3A D;  5G49 B;  2F8N B;  2Y2P A;  5BNX B;  3KXB A;  1EQZ D;  4G92 B;  2BYK B;  1M1A C;  2HIO B;  1ULY A;  5AVB C;  4UUZ A;  4WNN B;  3AZF A;  4J8V A;  1P3B A;  1PZR A;  5B2J C;  5AV6 C;  4G91 C;  3KWQ A;  3AZJ D;  5BNV A;  5AY8 D;  2FJ7 C;  3W96 D;  5F99 C;  1M1A A;  3AV2 D;  5BS7 C;  3O62 D;  3AZH C;  1P3A A;  1KX4 D;  3AV1 C;  1EQZ A;  4AWL B;  5C3I B;  3AZL D;  1ID3 D;  4KHA B;  3P5J B;  3KSY A;  3V9R B;  1P3I C;  2Y2J A;  3W98 B;  5AY8 A;  2Y2Q A;  2Y2G A;  3X1T D;  3AZN D;  2CV5 C;  3AZM C;  4J8X C;  4J8U D;  1P3M C;  3WKJ B;  4X23 D;  4XZQ B;  1KX3 B;  1TZY C;  3WTP D;  3O62 A;  3AV2 A;  4ZUX A;  5AV5 B;  4H9N B;  5BO0 A;  5DNM C;  1KX4 A;  3EG5 B;  1H3O A;  3WAA D;  3AZM A;  4WU9 C;  3AZL A;  1ID3 A;  2BG1 A;  4CSR A;  5DNN D;  4EO5 C;  3X1U B;  3MGQ C;  3TU4 D;  3W99 D;  5B0Y B;  3LJA A;  4UUZ B;  3AZN A;  4J8U A;  1P3K B;  3MGP C;  5B1M C;  4X23 A;  3LZ1 B;  3WTP A;  3REL C;  3REJ C;  3MGQ A;  1P3G B;  4QLC C;  5CP6 A;  1S32 D;  5B32 C;  1P3A B;  1ZLA D;  3MNN C;  3WAA A;  3LZ0 D;  5CHL B;  2ARO D;  3H0L C;  4Z66 D;  5DNN A;  3MGP A;  2NQB D;  3TU4 A;  4CAY B;  5CPK D;  3AL0 C;  3AZJ B;  4LD9 C;  3A1I A;  5B32 A;  1P3F B;  3WA9 A;  4WU8 D;  1M19 C;  5CPJ B;  3W96 B;  3AN2 C;  2Y2I A;  1KX5 A;  3AV2 B;  1S32 A;  3O62 B;  3W97 D;  4J8W C;  2DF4 C;  4YM6 A;  1ZLA A;  1P3L D;  5BO0 B;  2ARO A;  5FUG A;  5AVC B;  1T3U A;  5GT0 C;  2Y2M A;  5AV9 A;  2NQB A;  1H3O B;  3MVD B;  5AV8 D;  3UT9 C;  3AZL B;  5CPK A;  4CSR B;  4WU8 A;  5E5A D;  5GSU C;  3AZN B;  3X1T B;  1P34 D;  2F2A C;  3AZG D;  4KGC A;  4X23 B;  3LEL C;  3W97 A;  4NE5 A;  3REK A;  1P3L A;  2NZD D;  3X1S D;  1A7W A;  3B6G A;  4H9P A;  5B40 A;  5AV8 A;  2ZY2 A;  4YS3 D;  5G49 A;  1TAF B;  3TU4 B;  3W99 B;  2W8S A;  5BNX A;  1P34 A;  2BYK A;  2HIO A;  1BH8 B;  4WNN A;  2BYM B;  5B31 B;  3B0D C;  2F8N K;  3X1S A;  4XUJ C;  4R8P D;  3AZI D;  3W98 D;  1HQ3 D;  1ZLA B;  5B1L B;  5BT1 D;  3LZ0 B;  2ARO B;  4Z66 B;  5JRG D;  4YS3 A;  1U35 D;  5AV5 D;  1P3P C;  5CPK B;  4Z5T C;  3KUY C;  4XZQ C;  1KX3 C;  3AYW D;  5CPI B;  3V9R A;  4R8P A;  3B6F D;  5B0Y D;  3NQJ A;  3W98 A;  5B24 B;  2F8N G;  3KXB C;  3WKJ A;  1P3K D;  1KX3 A;  3NQU A;  5AV5 A;  4H9N A;  3F6T A;  3AZF C;  4J8V C;  1P3B C;  3KWQ C;  3EPL A;  1B67 A;  5E5A B;  3AFA D;  1Z2C B;  1P34 B;  4DRB A;  3X1U A;  3AYW A;  3R45 B;  3AZG B;  1P3G C;  5B0Y A;  1P3A C;  2FFF B;  3B0C W;  1P3F D;  2NZD B;  1N1J B;  3X1S B;  1P3K A;  1EQZ C;  3EPK A;  3LZ1 A;  1M18 D;  2UWX A;  4WJ3 C;  5CPJ D;  5B2I B;  4E45 A;  1P3G A;  3AZJ C;  4YS3 B;  2YFW B;  3REH D;  2L5A A;  1F66 D;  3AFA A;  5AY8 C;  5AVC D;  5GXQ D;  3MVD D;  1F1E A;  3AV2 C;  4CAY A;  3O62 C;  1P3O B;  4ZUX C;  4NE6 A;  3AZJ A;  1P3F A;  3VH5 W;  1KX4 C;  4R8P B;  3AZI B;  3NQJ B;  5GT3 B;  1M18 A;  1HQ3 B;  3W96 A;  2Y2O A;  3AZE D;  5CPJ A;  5KDM A;  3AZL C;  1ID3 C;  2XD5 A;  3AZH D;  3UTA D;  5JRG B;  5B0Z D;  3NQU B;  1U35 B;  3REH A;  3LJA C;  1F66 A;  5AVC A;  3AZN C;  4J8U C;  2IO5 B;  2HUE B;  2F8N H;  4X23 C;  3MVD A;  3WTP C;  3AYW B;  2PYO D;  3B6F B;  5CP6 C;  4J8X D;  3AZE A;  3X1T A;  5B33 D;  3WAA C;  5DNN C;  5B31 D;  3TU4 C;  3WA9 C;  3MGR B;  5B1L D;  4NE3 A;  3AFA B;  1TAF A;  1KX5 C;  2PYO A;  3W99 A;  1S32 C;  4YM6 C;  1ZLA C;  2ARO C;  1BH8 A;  5AV9 C;  3REL D;  1M18 B;  2NQB C;  2BYM A;  5B31 A;  3C1B B;  5KDM B;  4HGA C;  5CPI D;  1WWI A;  5CPK C;  3REI D;  3MNN D;  5B24 D;  1W2E A;  5B1L A;  3REH B;  4WU8 C;  1F66 B;  3LZ0 A;  3AZK D;  4Z66 A;  5AVB B;  5GXQ B;  4KGC C;  4LD9 D;  5AV6 B;  3W97 C;  3EPH A;  3REK C;  1P3L C;  3UTB D;  1M19 D;  4KUD D;  3AN2 D;  3B6G C;  3AZE B;  5B40 C;  4DRA A;  5AV8 C;  5CPI A;  4WV4 B;  4H9O B;  4J8W D;  3REI A;  3AZH B;  3UTA B;  5B0Z B;  5B24 A;  1AOI D;  1WWS A;  3AV1 B;  5E5A C;  3AZK A;  4G92 C;  1P34 C;  2HIO C;  5B32 G;  3UT9 D;  5B2I D;  1KU5 A;  3UTB A;  3X1S C;  2PYO B;  4KUD A;  2CV5 B;  1P3M B;  5E5A A;  4J8X B;  5B33 B;  3LEL D;  3R45 A;  3AZG A;  2RIQ A;  2ZY3 A;  1P3O D;  4YS3 C;  1AOI A;  2NZD A;  3WTP E;  1N1J A;  5GT3 D;  4AWL C;  3X1V D;  4WU9 B;  2Y2N A;  5B2I A;  5C3I C;  4EO5 B;  2YFW A;  4R8P C;  3AZI C;  3W98 C;  1R4V A;  3A6N D;  4WZS B;  5BT1 C;  3WKJ C;  3REL B;  3REJ B;  1P3O A;  5AV5 C;  4XUJ D;  4QLC B;  3REI B;  3KFU G;  3MNN B;  3AZI A;  5GT3 A;  3X1V A;  1HQ3 A;  3C1C D;  2IO5 C;  3MGS D;  2RVQ D;  3AZK B;  3X1U C;  5JRG A;  3AYW C;  1U35 A;  5B0Y C;  4LD9 B;  2YFV B;  3A6N A;  3KUY D;  3UTB B;  3MGR D;  1P3K C;  4H9R B;  1M19 B;  4KUD B;  3LZ1 C;  3AN2 B;  3VH6 A;  4Z2M H;  4NFT A;  2JCH A;  4ZBJ B;  4J8W B;  3B6F A;  3KXB D;  3C1C A;  1AOI B;  5GT0 B;  3AFA C;  3VH6 W;  3MGS A;  4JJN D;  3UT9 B;  3C1B D;  1JFI A;  1P3B D;  1P3F C;  5JA4 B;  3MGR A;  5GSU B;  1M1A D;  1M18 C;  3VH5 A;  3W96 C;  5CPJ C;  5AVB D;  3LEL B;  2Y2L A;  5B2J D;  5AV6 D;  3REH C;  1F66 C;  4JJN A;  5AVC C;  2FJ7 D;  4H9S C;  5F99 D;  3X1V B;  5GXQ C;  3C1B A;  3MVD C;  2Y2K A;  4DQY B;  3AV1 D;  1BH9 A;  3A6N B;  3AZE C;  3X1T C;  1Q9C A;  4H9S A;  5AVB A;  5GXQ A;  4ZUX D;  3B0D B;  3UTA C;  5B2J A;  5B0Z C;  5AV6 A;  4XUJ B;  1P3I D;  2FJ7 A;  2CV5 D;  5F99 A;  1P3M D;  3AZM D;  3C1C B;  1TZY D;  2JSS A;  5BS7 A;  4H9O A;  3MGS B;  3AZH A;  1P3P B;  3UTA A;  5B0Z A;  3LJA D;  5DNM D;  3W99 C;  1JFI B;  3AV1 A;  2PYO C;  4H9Q A;  4Z5T B;  3KUY B;  5B33 C;  2XD1 A;  4WU9 D;  3H0R C;  2LY8 A;  5B31 C;  3MGQ D;  3B0C T;  1P3I A;  3B0B A;  3VH6 T;  5CP6 D;  2CV5 A;  1P3M A;  3KXB B;  2ZM5 A;  4J8X A;  5B1L C;  5B33 A;  3LZ0 C;  5B1M D;  3MGP D;  1TZY A;  4JJN B;  4Z66 C;  3REJ D;  5DNM A;  3AZF B;  4J8V B;  4QLC D;  1P3B B;  3KWQ B;  5B32 D;  3WA9 D;  4M6B A;  5BNV B;  4WU9 A;  2J8P A;  1M1A B;  1BH9 B;  1KX5 D;  3VH5 T;  2JE5 A;  5CPI C;  3REI C;  4YM6 D;  5B2J B;  4G91 B;  5B24 C;  5AV9 D;  1EQZ B;  5B1M A;  3REL A;  3AZK C;  3REJ A;  5F99 B;  2FJ7 B;  4QLC A;  3MNN A;  3UTB C;  5AY8 B;  5GT0 D;  4KUD C;  1BFM A;  4H9Q B;  4Z2M G;  4KGC D;  4ZBJ C;  3AZG C;  4ZUX B;  3REK D;  2YFV A;  4LD9 A;  1AOI C;  1KX4 B;  5B31 G;  1P3I B;  2NZD C;  3B6G D;  4H9R A;  1M19 A;  5GSU D;  5B40 D;  3AZM B;  3AN2 A;  3H0M C;  5B2I C;  1ID3 B;  1TZY B;  4J8W A;  2F8N D;  3LJA B;  5DNM B;  5GT0 A;  2HIO D;  4J8U B;  2CWE A;  4E44 A;  3IP4 C;  3WTP B;  3UT9 A;  1P3O C;  3MGQ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...