2ZM5A

Crystal structure of trna modification enzyme miaa in the complex with trna(phe)
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
306
structure length
306
Chain Sequence
LPKAIFLMGPTASGKTALAIELRKILPVELISVDSALIYKGMDIGTAKPNAEELLAAPHRLLDIRDPSQAYSAADFRRDALAEMADITAAGRIPLLVGGTMLYFKALLEGLSPLPSADPEVRARIEQQAAEQGWESLHRQLQEVDPVAAARIHPNDPQRLSRALEVFFISGKTLTELTQTSGDALPYQVHQFAIAPASRELLHQRIEQRFHQMLASGFEAEVRALFARGDLHTDLPSIRCVGYRQMWSYLEGEISYDEMVYRGVCATRQLAKRQITWLRGWEGVHWLDSEKPEQARDEVLQVVGAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords tRNA delta(2)-isopentenylpyrophosphate transferase
publication title Snapshots of dynamics in synthesizing N(6)-isopentenyladenosine at the tRNA anticodon
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase/rna
total genus 92
structure length 306
sequence length 306
chains with identical sequence B
ec nomenclature ec 2.5.1.75: tRNA dimethylallyltransferase.
pdb deposition date 2008-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01715 IPPT IPP transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.140 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 2zm5A02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2zm5A01
1M8PA 3NHBA 4NYMR 4Q4HA 4WIAA 4OHYA 3TSOA 1U8ZA 1DAHA 4LYJA 3VKWA 3A1UA 4BUJA 4C0QC 1ESMA 4TMTA 5KDLA 2NIPA 4PPFA 1UDXA 2GZAA 4AKHA 1GOTA 4MRSA 1US8B 1DAGA 3A37A 2VP9A 3TUJC 3X2SA 1S1MA 1JNYA 2QMUA 3DOFA 4OK3A 5EJEA 4O2LA 1AKEA 3PQCA 3TGPA 4Q4JB 4ZKDA 3HR8A 3CH5A 1T4GA 3AF2A 3K0EA 4Q7JB 3IEVA 2GAOA 2ZI9A 3NVAA 1Z0FA 5CITA 3AF4A 5IT5A 4JL5A 1KYIA 4WW0A 1HT2E 1TNDA 3C15C 1VYVA 3KXIA 3B1VA 3MFYA 3HU1A 3VNUA 2ZUCA 2ZPTX 1KK3A 1DEKA 2PZGA 3AGPA 3SYNA 1YE8A 1TEXA 4CZ2A 3WNDA 2O0KA 3NXSA 4Q4AA 5HKKD 4A2QA 5DN6A 2FGKA 2YOFA 4A2PA 2REBA 3SHFA 3AVPA 5HKKA 4C9BA 2WJYA 1Q3TA 2GHIA 4Q7KA 4ON9A 1ZM7A 2BBTA 1XPRA 2YJTD 2YWFA 4DT1B 1BH2A 2CNWA 3B60A 4RFVA 3EASA 3QIAA 1L7VC 4B43A 4B48A 1MT0A 1YJ5A 2HT6A 2NPIA 2PJZA 1AN0A 2O5VA 5EP1A 2BMDA 2WJIA 4KAXA 1N25A 5TV2A 1G19A 2LWIA 3SR0A 1KSGA 2J0SA 4C0JA 1CR1A 1JR3D 1PVOA 1WA5A 1JR3A 1XMJA 2BCJQ 3VKHA 4GMDA 4Q7MB 3NEJA 1O3YA 4ACAA 4Q18A 4YMTA 2AL7A 3NEYA 4GOJA 3GFTA 1KZGB 3IQXA 5EXPA 4QJ3A 2ZRHA 1VTKA 1KJWA 4CEHA 2KWIA 5KPDA 1I4TD 1ZD8A 3N5CA 1XF9A 4M4SA 5J5CA 3BRWD 2HLDA 4HB2A 5AUOB 1H8ED 2FFQA 2HJVA 2QAGB 3G5UA 1VCIA 2NZ8A 3KKQA 1S2MA 3O8BA 4YDHB 5EE3A 1H8EA 1XEFA 2XSZD 1P73A 3F0TA 3K09A 3LLMA 1BOFA 3PIRA 4KYUA 4M1YA 4AC9A 5HR5A 4LJ8A 4C2TA 5J4VA 1MABB 1QDEA 1WDTA 2ZRLA 4TYNA 4RD4A 2J0UA 4KITB 1XXHB 4MRVA 4ITRC 3O8CA 1Z6TA 1FTSA 2FX3A 2FGJA 2W0SA 4NU0A 4XOIA 1KSHA 1J8MF 3V9PA 3PJRA 1SVOA 4FCTA 1L8QA 2VP0A 1AQYA 3SJAA 4PC1A 5E95A 2QPOA 2X2EA 2Q6TA 1EFRA 2XNSA 1S0UA 3GJ3A 1E2PA 3IDQA 1Z2AA 1NY6A 3QG5A 1AGPA 5FBWB 3BXZA 1G64A 2PMKA 3KQUA 4BE7B 5JRJA 4LYHA 2GRJA 1Q1ZA 3UANA 3ZD7A 4LYAA 1QF9A 2QEQA 2MMCA 1FX0B 2QTHA 2QT1A 2CMKA 2QG6A 4KFSA 3E70C 2AK3A 4OHZA 1II8A 4S35A 2W6JD 4E22A 4AY2A 2VRWA 1TQ4A 1UKZA 2BKEA 2ZRGA 5SZHB 4C0BA 1VCMA 1XCPA 4TQAA 5G41A 2P5TB 5B57C 3RVBA 1OH5A 4BZXA 4HB3A 1NY5A 2W6ID 4NMMA 4LK2A 1ZUIA 3PENA 4OJQA 1UM8A 2ZS8A 5E7MA 2VO1A 3EZ7A 1A4RA 4Q01A 3RANA 4JL6A 2W6IA 1XMVA 3HWSA 4Z1MD 5FBRB 4I1UA 2ZR9A 2JLXA 1FOEB 4DLYA 1C4OA 2G0NA 5FUVA 3GQBA 4B3FX 2QU8A 1WQ1R 1G3IA 4PZYA 1DO2A 3BD9A 2W58A 3QKRB 3SJCA 3KX2A 1RW4A 2BMJA 3AP1A 1ZIOA 3QPWA 4KSCA 4DLSA 2XOKD 4A6XA 3CNLA 3LX8A 1KI6B 2F43A 3P4XA 5FUXA 4JYBA 1HQCA 4B75A 2O0HA 2ZI6A 1GL9B 1KO4A 1KMHB 2N42A 3H4MA 1WBDA 1XD2A 1E9CA 5JZVA 5FPTA 4DSTA 4Z54A 4CEJB 4D4KA 1D9ZA 4EFNA 3LVRE 4RCYA 3SN6A 3IEUA 4CW7A 2CL6X 2NMVA 1FPMA 3WP1B 2ATVA 3U3OA 2NO7A 3OHMA 2WJJA 4R98A 5DGXA 4DB2A 4BFSA 4B71A 2C77A 5CB6A 2PCLA 4K81B 3IPYA 3PITA 2IYSA 3LA6A 1NVVQ 4W5WA 3EAQA 5KDOA 2QTFA 3A4MA 3RSLA 2ECKA 4G5GA 3EC2A 3K0AA 4DWJA 2TMKA 2CVFA 5CJ2A 5FOSA 3N2EA 4IEEA 2JLQA 1U99A 3CWZA 4PSAA 4ZCIA 1QRAA 2CE7A 3CF2A 1CRQA 1LV7A 1W4CA 2H5EA 2VPPA 3ADDA 2FN4A 3LBHA 1KI4A 4B76A 2V3CC 1ZAKA 1KDOA 2CCJA 2G77B 3P4YA 4TMKA 1H8HD 2HF8A 3AEZA 1KK0A 5P21A 2GJ9A 2YVUA 4E09A 3I8XA 3KQHA 4LJ9A 1WF3A 4RJLA 4AI6A 1GKUB 1Z0IA 4KFRA 4KVAA 1FL9A 2EFGA 1IXZA 4V03A 1Q21A 1M7HA 1W2GA 2H7VA 4C0KA 4BECA 1CLUA 2RKOA 1G18A 3EPLA 1R5BA 1ZMXA 2WWHA 1NLZA 4P32A 4BLOA 4F4CA 1WBBA 4LHXA 1QHGA 4TQUS 1FUUA 1BMFD 4XIGS 2AKYA 3KJIA 4BGDA 4X8HA 5FL3A 1N5LA 3FPAA 3L8YA 5IF9A 2BKUA 2F7SA 4IOLA 3ECCA 3ZGXA 4KU4A 2EWWA 2OE2A 4B6FA 3WHLA 4MGZR 3EC1A 4M22A 4JLOA 1GL7A 2ZETA 1IN8A 1NMYA 2QNRA 2ZVPX 5L3VA 3SQXA 3WRXC 5FTNA 2HT1A 1GVNB 2KBEA 4M9ZA 4EPTA 5KUTA 3CZQA 3T1OA 1X1RA 3RWMB 1KO7A 2IT1A 5SZIA 5AJYA 3R8FA 4QGGA 1E2IA 1JJVA 4KLZA 3ZVLA 3CR7A 2QM8A 1E4YA 4IOMA 5IK2A 1E1QD 4JBWA 3VHLB 3HR7A 1N6OA 2ZSEA 1Z83A 1AS0A 1TF2A 1E1QA 1E96A 3B9QA 1T0JB 3CX7A 1DG3A 3EZFA 4BFVA 1NMZA 1TQ2A 2IXGA 2A9KA 5KNBA 4WOPA 3D6TB 1BYIA 5E3HA 4ABYA 5FL7D 3D31A 2C95A 2GKSA 2PLFA 2XTMA 4FMCB 2V7QD 2PL3A 4ZPXA 2RGEA 4TMVA 1IY2A 4W9MC 4TLEA 3CWQA 3LXRA 3U4QA 4BZPA 3UATA 1R0ZA 1MO3A 1P4SA 4LPSA 2ZUBA 3CRW1 5KYKA 4R2IA 3PUVA 3QVVA 2X1VA 2ZEJA 2JDIA 4ESVA 1YR8A 2VF7A 2B8TA 1ZINA 3EA5A 2JLVA 2Z4RA 1IY0A 1K6MA 2CHVA 2BEKA 2Z43A 4LBVA 5JI3E 2D06A 4HZUB 4Q9JA 4DDWA 3GLFE 3DL0A 4DLXA 5JSZB 2GTPA 2YOHA 3QSYA 3K8YA 4WZ6A 1HA3A 1VKJA 3B1WA 4XVQA 1NVVR 1R2QA 1LNZA 2ZYVX 3QXJA 4GI7A 5GJBA 2PLRA 1W36C 4XH9B 4B2PA 3EZ2A 3IIJA 2NPFA 3RRMA 1J8YF 1IN6A 2PT7A 1KAOA 2GEDA 1BS1A 2IHBA 3O8DA 2DFNA 3CR8A 4IW3B 4URZR 1Z8FA 3OEEA 5EXSA 2C99A 4B74A 1M7BA 4PSVA 3AF3A 2VHTA 4NYJQ 1U2RA 3UPUA 3EG5A 2FEMA 3IQWA 4PR0A 3GLGA 2KJQA 2OEPA 3QXSA 4US0R 1E9BA 1VECA 2QQEA 1ZNYA 1ETUA 4B3XA 3REFA 1GL6A 2HYDA 3DO6A 1JEEA 4GRAA 1NRJB 2NO1A 3NBXX 4JLJA 3UIEA 4EQ6A 2ZJ8A 1W47A 3BAFA 4KFUA 1DTSA 1VHTA 1Z28A 3FFBA 3DVLA 3GLHA 1TU4A 2C2HA 4U5XA 4IFBA 2QPAA 4P3YA 2FSGA 3KL4A 3ZZ0A 3B9PA 2W00A 3MRSA 2A5DA 4IDQA 3G82C 3GJ6A 2WM9B 3BWDD 4DLRA 3ZVNA 3Q72A 2J9RA 4DCTA 2W0MA 4HUQB 1RPZA 4B35A 1Q1BA 5GJCA 1DVRA 5DH9A 4ASUD 4B47A 1E98A 1RYHA 1KZ7B 2WWIA 3VU9A 4TYPA 3KB1A 4V02A 1DAKA 3MUFA 2GF0A 2GK6A 3GJ0A 1GRNA 1UBEA 4RCZA 1EFTA 1KI9A 1UPTA 2BM0A 3MAAC 3I3SR 1E6CA 2A30A 2IYTA 2ERXA 2EQBA 5EE5B 2YWEA 4C0AC 1GDDA 1OFUX 5GJWC 2BWJA 4UXJA 4JS0A 3OFND 4PAQA 5CJPA 4D26A 2O8FB 2GZDA 3GFOA 2J1LA 1R5NA 4URXR 4CEIB 2GK7A 3I72A 4DEYA 2KI5A 2F55A 3KJHA 2J5XA 3RLFA 2CK3D 3NDBB 2XEXA 3TVTA 3U3JA 4JYCA 2AK2A 4AIIA 1TF7A 3IBYA 4HLUC 4ZO4A 5DE3A 1GP2A 3VU9B 1WRBA 2QTVB 2CK3A 2ZRJA 2BJWA 4HDCA 4Q1CA 3BBPA 3EXAA 1KDPA 1FTNA 3RS2A 3IKJA 1TQDA 4PPGA 3PG5A 1HURA 1N5IA 1ZBDA 3QPVA 2IA5A 2WJVA 2ZRBA 2GVZC 2G0TA 1NBME 2O8DA 4BFWA 3C5CA 2ERYA 1W0JA 4A82A 2W2VA 1TAGA 2WKQA 2ZE7A 2E87A 4PO9A 4PHTA 3SNHA 4KBFA 4ARZB 4L9SA 3U2QA 3FKSA 3KTAA 3ADKA 4O0MA 2IHYA 1R4AA 2ZS7A 3ZZTA 4PPQA 5JWRA 1S9DA 1Y3AA 2DWPA 4OI1A 3ASZA 2BM1A 3B82A 3QQ5A 4GT1A 2ZRMA 1KY2A 1F2UA 3M0EA 5JCPA 3OE7D 3SI7A 3LDAA 4PHFA 1MRNA 3VAAA 3OE7A 1OB5A 1QHNA 4QM6A 1B0UA 1YR6A 4NYJR 2O8DB 1PLLA 1CJMA 1OPXA 1RE0A 1GWNA 1QHHB 4XD7D 2F1JA 3BFXA 1R8SA 4MKHA 1E0JA 2WKRA 2GA8A 4XD7A 3LQRA 3SJBA 3V4FA 2G88A 5FBLB 3V00A 3CF6R 1J70A 5BN5A 2CHGA 3OF5A 3H1TA 5FPSA 4IRUB 4Q7LA 3U3RA 2KSQA 721PA 4I1SA 2R8RA 3NKVA 3QJYA 4LRWA 2K5UA 2WWFA 3KDSE 3C41J 1E2KA 2OESA 2QSZA 4C30A 4A15A 1AK2A 5AWFC 4FMCF 4HB4A 4GZMA 2ZR7A 1XTJA 2B6HA 1PUIA 3W90A 1ODFA 4H1UA 4B6EA 1E2NA 1KIMA 4PAOA 4TZ0A 2QT0A 1IBRA 2YHSA 3TE6A 4AWXA 3QKSB 1CU1A 4N0DA 4C0HA 4AKEA 1J90A 2WMOB 3LO5A 2R65A 1UADA 1PUJA 4AYWA 4V0ME 2IYWA 1A5TA 1U0JA 4C3ZA 3TSWA 4M0LA 4LBWA 2V6JA 3KXKA 3GJ5A 4D80A 3RDPA 3A58B 2F1HA 3LV8A 4WA7A 2OG2A 1H65A 2PCJA 1SVIA 3NWJA 4FCWA 5JCZA 4IHQA 1KI1A 2J7PD 4URUR 2E1RA 4LJ4A 3DDCA 4PHGA 2OBMA 2W83A 3R7WA 3LW8A 5H8WA 2J7PA 3E5HA 4UNPA 3THYB 1RRFA 3TJZA 5CLQA 1TEVA 1XEWY 3W3AA 3GFPA 4TL9A 1ZP6A 4NPHA 1E2EA 1SVWA 2H17A 2J0QA 4MYTA 4RZ2A 5CDFA 2GXUA 2KB0A 2ZR0A 1Z08A 4HLUA 4M2LA 1TTTA 4I1VA 3TMKA 1K5GA 4Q19A 2YC2C 4URYR 3ONWA 5KSYA 3PFIA 4ESHA 2NG1A 3WBJA 1ZNXA 4KVGA 4POAA 4TT3A 2PZFA 5D3MA 2UZ3A 1KI2A 3B1YA 4N3NA 4XWAA 4C7OA 2VHQA 3CNOA 2BJVA 1IXSB 2WWYA 3WNBA 1Z6XA 2OV2A 1G8GA 1E9RA 1S3GA 3K9GA 3R7WB 2ZYWX 2OLJA 1G5RA 3DMDA 2XXAA 2O52A 1ZIPA 1F2TA 4BPBA 4L4UA 1Z6GA 4TL8A 3IO3A 4IDHA 1HH4A 2VP5A 5DHAA 1X6VA 5BW8A 1JJ7A 4Q00A 1R0XA 3CUEF 4EJSC 2ZRAA 4BFUA 2F1RA 4W5JA 3U44A 1GKYA 3WP0A 1CR0A 1V43A 3WYGA 5DSZA 1JB1A 1ESNA 1SXJB 1ZUHA 4B73A 1GUAA 1U0HC 1JR6A 4JJKA 1G7RA 1UEIA 4IOJA 1BYUA 3BB1A 3MMPA 5D3MB 1CF4A 4TWZA 4C7OB 5ANRB 1ZYUA 1Q1EA 2OCAA 3UMSA 4WVFA 5LB2A 4UNSA 2OM2A 1VCNA 5AJVB 1D2NA 1T5IA 2JJ2A 3U7EB 4A8JC 1W7AA 1OE0A 4QJ5A 3RC3A 4D0LB 3TR5A 4EPXA 1OSNA 4QJ4A 1CKEA 2F3TA 2JLRA 2RHMA 5HZKA 4QM7A 4X8MA 4GOKA 3MLEA 4LV6A 5FOXA 2ZRIA 3U44B 4CDGA 1G3MA 2IYVA 4PHHA 5JFGA 1EXMA 1CULC 1E79D 2ZI4A 1NN3A 1WXQA 3THWB 2QP9X 4LJ6A 1VG1A 1W4AA 5L3QB 1E79A 1J7KA 2YOGA 1COWD 1IONA 1LTQA 3PEVA 1EFHA 3AUYA 1G8FA 3B8HA 4B2LA 1P72A 1OHHD 5GVRA 4QKQA 5L8VA 1N2CE 1XXHE 4LOAA 1XX6A 1IN4A 1Q0UA 3EA0A 4KO8A 3B13B 4OQFA 4EPYA 2ZXUA 1VYTA 4QGAA 3OIYA 2P65A 2HJGA 2ONJA 1W44A 4NONA 4Q4HB 5DNYB 1P9NA 5KPJA 2X8AA 1B23P 1G16A 2IBMA 3FMPB 5BYKA 3IUYA 4UNQA 4D2IA 3GLIA 2XNDD 4DCNA 4BFZA 1G21E 3WYFA 1W4RA 1P5ZB 5H68A 1XD8A 2QP3A 3JVVA 3ZDQA 2ZREA 1CBUA 4QHSA 2I1QA 3K70B 2EFEB 1XEXA 3IO5A 3ZYCA 1MOZA 5GADl 2PEZA 1QHIA 4JVNA 1RIFA 2GF9A 4JVMA 4A4DA 3E1SA 4JVSB 3T1TA 2WTUA 5EP3A 5K8TA 2F1IA 1GKIA 4L5BA 2C8VA 2IF0A 3QUSA 2OCBA 4PC3A 4MYHA 3H84A 4KBGA 5L3SA 3FHCB 1KNQA 1DAIA 3LD9A 2XX3A 2ZANA 2FOLA 4NBSA 4Q47A 4Q4AB 2WAXA 1QHYA 2ZSAA 2CE2X 4EFMA 4JIMA 3TAHA 4A1FA 5EXXA 1CTQA 2YWGA 3KFVA 2FZLA 3WY9A 3HP1A 1CJKC 2YWHA 3HU2A 4BASA 4BFXA 3U61B 5EXTA 4HAWA 1NG9A 1HE1C 1RJ9A 2EWVA 1G7CA 3SYKA 2FA9A 3QXCA 4GOXA 2JLZA 2ZRNA 2ZIAA 3RS3A 3ZVMA 1MO5A 5LD2B 2IW3A 2Q9CA 4NP6A 3F3YA 3LAWA 1ZCBA 2QA5A 2HCBA 2XSZA 3A1WA 3LX5A 2NO0A 2HXSA 4RD0A 4BEJA 4EJSA 1TADA 4HB0A 2LCFA 2JJ1D 4DJTA 1GZSA 3GJ4A 2OXRA 3MCAA 2DB3A 3THXA 2ZJAA 2CL0X 4DDVA 2OFWA 2RH5A 3OIWA 3Q9LA 1XRJA 1IY1A 3GCGA 4C4PA 5J4KA 4YMVA 3TQCA 2GVDC 4ZCMA 1FZQA 2ZE8A 1IHUA 2AHOA 3PEWA 4CIDA 3MSXA 1NVWQ 1Z5ZA 3H2YA 4M21A 5JMTA 5LPNA 2X2FA 4FD2A 1EWQA 3O47A 4PXAA 4CEHB 1G3RA 4LHVA 4R71A 5KHOC 4OJKA 5IRCD 2IS6A 4XSHA 3KJEA 4R2HA 5FFMA 2FWRA 3C14C 4LSGA 5FOTA 4A8JA 5LBIA 1OFHA 1GRRA 4MH0R 4FCVA 1JQJC 4HAUA 3HPQA 1DG1G 2W6JA 2ZSBA 3B2EA 3CKLA 5KU1A 1JEDA 4HZIA 2J0UB 2Q9BA 5FI1B 1OXXK 2GWHA 3DPUA 4LY6A 2ZS9A 2RGNC 1UBCA 4FWIB 4M1KA 4FI3C 3EX7C 1IQPA 1ZM4A 1NVUQ 1ZU5A 2Z0MA 5FUYA 3CRQA 4A9AA 3RS4A 4JSYA 4Z1MA 4D0GA 5E7IA 3UKDA 3BK7A 1E2FA 4F92B 2OZEA 1V5WA 4FMDB 1GAJA 3EIHA 3F5FA 4MGKR 4MKGA 5JEEA 121PA 1XJ0A 2YNMA 5JWHA 2JLUA 2IS1A 3AKCA 2GJKA 1II8B 2XOKA 3Q3JB 5EP4A 1UKVY 4KFTA 5F2EA 3P1JA 2JJ8A 1OIWA 1QBKC 2ZYTX 1E3MA 2GJSA 3CPHA 4RY2A 1UJ2A 3GMTA 2WOJA 3EIEA 3PEYA 2Z5FA 1Z22A 1NMXA 3PUWA 1E2DA 1NNEA 5CM8B 3CX6A 4YXWD 2A5JA 2AFHE 3I32A 4NCNA 3LXXA 3W8RA 521PA 4URWR 1OYYA 1OXVA 4JLDA 1T91A 4U02A 2W2TA 3BE4A 3NC0C 1XPUA 2WWXA 1DS6A 4WZBE 4B44A 2H1LA 3IIMA 3AF0A 3KKOA 2EYUA 4CF7A 3HDTA 4RSGA 1O87A 4K46A 2V55B 2F43B 1OT3A 4W5HA 4NDZA 1EX6A 3FKQA 3P20A 3VR6A 1XTRA 4EIWA 1P2VA 2A3RA 2B21A 5GVSA 1XD2B 3U5ZB 3PR1A 4JL8A 5TVKA 2X19A 1ZW6A 1U8AA 3CPEA 4JLPA 2Z4SA 3AB3A 1JPJA 1XMSA 5B58C 1JAIA 2AN9A 5EE9A 2JLWA 3REGA 1WCV1 2J46A 4A0RA 2FE4A 3LVQE 3K0CC 2MSDB 2WZQA 3B6EA 1LW7A 3DM5A 1H8HA 4QBGB 2GBLC 2GDJA 1MO6A 2ONKA 3CBQA 1YR9A 3CH4B 5KTYA 4QHYA 2IK8A 2F9MA 3UXMA 4HUTA 2D2FA 2FPKA 4JLMA 3EIQA 2ZRCA 2YC4C 2BBSA 4JSTA 3E2IA 4IVRA 1CJVC 3AVQA 3K0AB 1G8PA 3BB4A 5E4FA 2NO6A 4JLAA 4O25A 2Q3HA 4A0GA 5AUPB 4WZAE 1ZNZA 1GNPA 4I1OA 4HI0E 1BMFA 2VSFA 3G0HA 2E9SA 2WIAA 3QF4A 4ZI2A 1P60A 2WSSD 1GITA 1KDRA 2WAYA 3QBTA 1L2TA 3CRRA 4LPKA 4Q02A 3T06B 1G3QA 2AR7A 1PJRA 4P33A 3R8CA 3RNLA 4CYMA 3BJIC 3WXMA 4DLTA 1QZXA 1F60A 2JASA 1XB2A 1OH8A 4XTRA 3GPLA 2JATA 2OHFA 2ORWA 2H92A 3NBYC 4FMBB 3WRYC 1N6PA 4QBHA 2CLCX 1TMKA 5KO2A 4MKIA 2GJ8A 3T35A 3CF0A 1JECA 1OW3B 3BH7A 3RAPR 5K8LA 5AUNB 1Z0AA 4TLAA 2J59A 3KKPA 2B8WA 2VTKA 1EX7A 3KB2A 4IVQA 2CCKA 2RGNA 4LV8B 3T5DA 2QY9A 4NKRA 5C18A 1G7TA 4P4TA 3QF4B 2O8BA 5KSPA 3EARA 2G1KA 4TMZA 5FL7A 5TMPA 3AVUA 1UKYA 2VA8A 1R8QA 2QE7D 2FPMA 2V7QA 2QP4A 5UKDA 2IUTA 4G3XA 3SHWA 2D7CA 2QE7A 4LJAA 2Z6VA 1P9RA 4NH0A 3X1DA 3GLGE 2JEOA 4M8NE 4B32A 1ZJ6A 2R44A 4D6PA 1A82A 5G3ZA 4M1OA 4Q9KA 1ZUNB 4O2RA 4QRHA 2GEVA 1S4QA 2IYLD 1IJFA 3HPRA 3LLUA 4ZIRA 2F9LA 3C16C 4ZDIA 1E0AA 2GAAA 5EE0A 2ZJOA 4TTQA 4V0LA 1KHTA 2A5FA 4US2R 1Q57A 3QNUA 4KLNA 2QMEA 4LGMA 4XWOA 2VL7A 1XCMA 2OCYC 3ICEA 5D3QA 8OHMA 2ZRPA 1T0HB 5JLJA 2O8BB 3MJHA 4B33A 1UKEA 1EG7A 3Q5DA 2FFAA 4P4SA 3TAUA 2VF8A 1UAAA 3U4QB 4KHZA 4XVUA 2IYQA 5AK0A 1J99A 2VP2A 4ZCLA 2CCGA 2PT5A 3I62A 2CLSA 2PMDA 2Y8EA 821PA 4LYFA 4NZYA 2ZYUX 3FHTA 5IHPA 3SC3A 3SDZA 2R6AA 3BFVA 4JLNA 3ZIAD 2PX3A 4LDJA 1E9DA 2V9PA 3IBGA 2R6GA 3WBKA 3ZIAA 1RRPA 2NOAA 3DHWC 1NL3A 1XTQA 3K0CA 1UBGA 1ZNWA 3QBVA 3EPJA 1OFIA 2GBLA 1CJUC 1JALA 1AJEA 3AGQA 1VCOA 4P31A 3GLGB 3RC8A 2GILA 4Q1AA 5JRZA 4TMWA 3RABA 3ADCA 4FN5A 5JI2E 1XMIA 3Q5EA 4OQNA 3VX4A 5C1BA 1QVAA 3KQKA 1Z07A 1XDBA 4LV5B 3U6KA 2UVQA 4TN1A 5DHFA 4BLRA 2AD1A 2WKPA 2UKDA 3NTUA 5G40A 4FMDF 2P67A 1OV4A 1S3SA 1MRSA 4BFYA 3QPUA 2ATXA 3GLFA 1KI3A 4L16A 2AFIE 4OYHA 2IXFA 3IGFA 2VSXA 3I5XA 2OBNA 4ASUA 2WOOA 1GFIA 4QHTA 4D81A 4Q66C 1WE2A 2ZSFA 1FMJA 1X1SA 1ZD9A 3SEAA 2NO9A 2WPDD 4LX0A 2OO7A 2VBCA 4JMPA 5C46F 3D7MA 3TVDA 3BH0A 2ZI5A 4DKXA 2ZM5A 4EQ6B 3ND9A 1E0SA 4MRPA 4TTRA 4B3CA 1ZU4A 3WYAA 4MQBA 1EGAA 3OAAD 3GLHB 4M9SA 4RD2A 4PANA 1DAEA 1ZRHA 4L9WA 1Z6YA 4CT4B 5DI3A 2R2AA 2VHUA 2IEYA 1VPLA 2ZJBA 1GM5A 2ZRDA 4BEBA 1OH7A 1UFQA 3OFNA 1M6NA 3I4LA 4OKSA 2OAP1 4X8OA 5H1YA 4G5SA 3SOPA 4KXFB 2ANCA 2LKDA 1YZUA 3P32A 3W8NA 1E1RD 1U81A 1LS6A 4LZZA 4JLBA 2H8KA 4IDOA 2HDNB 1SKQA 3HYRA 3CLVA 3RHFA 1G5PA 1N3BA 5FOVA 1HT1E 5EE1A 4F7WA 3MJRA 1HY3A 3CIOA 3EZ6A 3KKNA 4DLWA 2YV5A 2DWQA 1OB2A 3QY0A 3TK1A 4LHZA 3U7GA 3NBZC 1II9A 2BEJA 3U6BA 1YZGA 1LF5A 1P2SA 3IILA 1Z6AA 3LFUA 3QKUA 4J0QA 3AKEA 4PC7A 3NHAA 3FYHA 2KBFA 2PX0A 4P4UA 3SJZA 1XTSA 5HTKA 1JXOA 2FFHA 4DDTA 1N6HA 1U94A 2MMGA 5L3RA 1W5SA 2ZAOA 1CXZA 2C9YA 1NLFA 2QN6A 4QFMA 2BIFA 4QNRA 3B7GA 1M74A 4V0KA 4C0SA 3L0OA 3B5JA 1S8FA 4R9UC 1A2KC 1E9FA 1CEEA 1M2OB 2ZE6A 2C96A 2RMKA 3KXLA 2C5LA 2GXQA 5F9FA 1SKYE 4AD8A 1ONBA 4FIDA 5FUWA 1J2JA 1SHZA 1Z3IX 3PEUA 2CLDX 2J87A 2VIIA 1QHXA 3I8SA 4AYTA 5KSZA 4QOSA 5DYGA 3ZJYA 4EFLA 2J45A 2J0VA 3EWSA 2XZOA 2GCNA 1DOAA 4CT5A 3KTAB 4OQXA 2FNAA 1VHLA 1N5JA 2NTYC 3DKPA 1JI0A 3H86A 3OESA 2NQ2C 5KSOA 2O8CA 1YZNA 2A2ZA 3W6NA 3W6PA 2OBLA 4S2EA 4PQYA 1NBMD 2DPXA 1YVDA 2GXSA 4E5UA 1W36B 1F2UB 4BLPA 3R9IA 2CJWA 1NIJA 2REXB 2ZJYA 1NKSA 4HAZA 3W34A 2IYYA 3A8TA 3BFKA 2ZJZA 4FXPA 5B30A 3T1VA 2RGDA 3QEJA 1XTKA 5DIFA 4HDOB 2BVNA 4ERNA 1TPZA 5CDFE 1GNQA 3BERA 2FU5C 2WVJA 2ODWA 3SS8A 5C4GB 2ZAMA 4A0FA 1SXJE 3U60B 5FPYA 5EZ6B 1E69A 1W49A 2ZI3A 1NN5A 1RC8A 3QXHA 1UBFA 3IHLA 4BRUA 1G4AE 4U00A 4CVNA 1VDZA 3SE0A 4PQFA 4I4LA 3W9YA 1D9XA 1R10A 2ZTSA 4D4MA 2O8CB 3IHWA 1P2UA 4TYQA 1Z29A 1QG4A 3AKDA 1T9HA 6Q21A 4LCBA 4TLCA 4DXAA 3X1XA 1SZPA 1DO0A 2BC9A 2ZSDA 2OT3B 2P0EA 1GNRA 3RRNA 2OCPA 1FP6A 2NGRA 2KE5A 4TSFD 1SKYB 2OXCA 3GJ8A 1N5KA 2IWRA 1OIXA 4Q9IA 1C1YA 1XZPA 3B78A 3BOSA 4HAXA 5AJXA 1KK1A 4C2UA 2ZU6A 3C5HA 3M4YA 1AM4D 4Q03A 3SU8A 1RRCA 5EUQB 5B64A 3W3ZB 1PLJA 1KO5A 2GCOA 2D74A 3NC1C 2IEZA 2QAGC 4F4IA 2I1VB 1E9EA 3U3KA 4DHEA 4JBXA 2V6IA 4JKYA 1P7CA 3FMOB 2O8EA 4B3BA 5AUQA 1Q1QA 2AX4A 1Y63A 1BKDR 3D3QA 3WMGA 2BDTA 3AP3A 4MKFA 1HUQA 4GL2A 1OLOA 2GCPA 4UQOA 5CYPA 1DARA 5H70A 3JVUA 2DHRA 1OXUA 4PC6A 1LVGA 1P6XA 5FR2A 1HV8A 1ZM9A 4QNMA 2ANBA 1KY3A 2QENA 5FPKA 2GESA 3WMFA 2AXPA 2QQ0A 3I61A 2V1UA 2GCOB 4D4JA 1IM2A 1DAFA 1SGWA 1G8HA 3RS0A 3H0KA 4KJZA 5FH9A 4JJZA 4OI0A 1U98A 2RGXA 3AVTA 2B92A 2QAJA 3TUZC 2IYZA 4B3DA 1HYQA 3FMIA 4DIEA 2WBLC 4K8OA 2ZJ2A 3MWKA 5FBQB 3ZZUA 5JHHB 2BOVA 3LNCA 3K0SA 1SHKA 2D7DA 2XXAB 1YR7A 4QGFA 5AJWA 1F2TB 1XNJA 1US8A 2P5SA 4OHVA 5EP2A 1F6BA 3GLIE 4KYIB 4D82A 1CR4A 2ZROA 4Q4JA 1DADA 4RKFA 1NF3A 4NL4H 4F38A 1SVMA 1EESA 1XD9A 4YQFA 2Q3FA 2HF9A 3SZRA 3A4LA 1G4UR 3BGWA 3VR5A 4EPRA 2R9VA 1YU9A 1D6JA 2A5GA 2BHRA 1Z06A 1HEIA 3BORA 3A1SA 5C2JB 2OFXA 3K0FA 1LF0A 2Q3MA 2EFCB 3T61A 5AJZA 1FQJA 1COWA 3L2OB 3C4JA 2G9NA 1U0LA 3L43A 4G0NA 4D0NA 1JR3E 3U3MA 3AVYA 1JQLB 4UJ3A 4UXIA 1OHHA 3MD0A 4ZKEA 3RRYA 3KFXA 4B3GA 2ZI7A 1E2QA 3K70D 3K9HA 1W5TA 1I2MA 3T5GA 4BQSA 4DT1A 5JBQA 5HE9A 1W4BA 5FTMA 2D2EA 2VHCA 5DI9A 3GP8A 1VYUA 1DE0A 3KUCA 3VNVA 4NCIA 1KI8A 1T8UA 5FTKA 5FPHA 5FTLA 5J47A 2XNDA 2ASEA 4AURA 3BH6A 3SFZA 1Q44A 5G53C 1G41A 4LC0A 3T34A 3AUXA 3R20A 421PA 1OFTA 4MITA 2XAUA 2LKCA 4LWZA 3RS5A 4DUGD 3WMEA 1XFAA 2GJAA 5DN6D 3K0FB 4U7DA 3GJ7A 4LC1A 4DUGA 4GDFA 1KOFA 5M04A 2VEDA 4RZXA 5TDHA 4F4JA 4TZ6A 5BN3A 2V4ZA 1E94E 1S96A 5CK4A 2CNWD 3F8TA 3FOZA 5DYIA 1X3SA 4QG7A 1FP7A 2XZLA 4OQLA 5HE8A 4HLCA 1Z2CA 2EYQA 2HEIA 2QAGA 3GLIB 1P3JA 4IOKA 1I2DA 2XB2A 3QENA 1E2HA 3EPHA 1G6OA 1P61B 2QZ4A 2XJ4A 4PO8A 4XSGA 4A92A 2A78A 1FNMA 4BLTA 1XP8A 3I73A 4JT4A 1ANKA 1MABA 1ZC4A 4DLZA 1G8YA 2WHXA 2AWOA 4LHWA 3CO5A 1XEXB 2EFDB 5DISB 3I92A 1XXHA 3A1VA 3IIKA 4KI0A 4JLKA 3BS4A 4TQ9A 3N2IA 4DVGA 3LH5A 2ZUDA 4R7ZA 2G3YA 1AZTA 3U7HB 2FSHA 2RGCA 2WWWA 4RZ3A 2AWNA 3QG1A 5SZJA 2P6NA 1CIPA 4BLQA 2Z83A 5F3WB 1TF5A 4D4LA 3B1ZA 5L3SB 1X8LA 4G5QA 2JJ1A 2HLDD 3X1YA 3ZS9A 1FQKA 3CPJB 3SQWA 4O3MA 1P75A 1I4LD 4BLSA 1Q12A 3FHOA 1FX0A 4MYUA 2AXNA 2WSMA 4JT2A 1KJZA 3EZ9A 3AP2A 2FEOA 4OK6A 3TBKA 2ODBA 4ACBA 3R9XA 4Q21A 4TLDA 4WAUA 2ZU0C 2RGBA 3VHXA 4M53A 1RJ9B 1RYFA 2PEYA 2RGAA 2A5YB 4AG5A 4Q1FA 5EZ5A 4YLGA 4US1R 1N0UA 1F5NA 2WWGA 3EW9A 4E03A 5TY0A 1I4DD 3OZXA 5FOWA 4IDPA 3AV0B 2QUZA 3KQNA 4JZKA 1EFRD 4EJSB 1N6IA 1WB9A 1C9KA 1N0WA 1GG2A 3FDIA 3THXB 3A6PC 4AG6A 3UG6A 2W2XA 3QKRA 4MUAA 1N6NA 5JJIA 2Q0HA 3TKLA 1Q3HA 4HLQB 4OBEA 4DEXA 2VP6A 4NE2A 4UXHA 2DFLA 5FOUA 621PA 4ILEA 5E7JA 2CDNA 5FBVB 1KI6A 2GNOA 4F91B 4ZDJA 4PPNA 3TW4A 4GNKA 4OI2A 1YKSA 3CRVA 1KMHA 1OKKD 1AIPA 2CHQA 2XJ9A 4Q1DA 1ZVQA 5KNDA 3ASYA 1X8JA 3VQTA 4OHXA 3SBEA 1OKKA 3QF7A 4DLVA 2ORVA 1NJFA 1E9AA 2OFOA 4TLBA 1XPOA 4CEJA 3UMRA 1R0YA 1W46A 2IUUA 4A8JB 5SZKB 2OAQ1 1NSFA 3HYTA 4Z8XA 1LY1A 3HJNA 1KAGA 1R0WA 3PV0A 2ZRFA 5B2ZA 4NCHA 2XTNA 1CRPA 1PV4A 4MRNA 3Q7QA 4DSUA 3DMNA 3K1JA 2FG5A 3CNNA 1OJLA 2NZJA 4Q4LA 1PZNA 4Z51A 2PZEA 4YXWA 4FINA 4M1WA 4ZDWA 4RKEA 3KJGA 3LBNA 1BIFA 2CXXA 3L0IB 3N70A 5J4HA 5LDDC 1N6LA 3FE2A 1R6BX 2IUSA 4ZI3A 4LJYA 1FW6A 2O0JA 4FW9A 3QVUA 4LBZA 4XTCS 1YRAA 1G7SA 2F6RA 5JS7A 1GIAA 1GRQA 1Q20A 4F93B 2IL1A 5CLLA 5KDDA 2FSIA 3TH5A 2QMOA 1E32A 2ZITA 4KODA 4KSBA 5TB5A 3W6OA 2YYZA 1VMAA 4OK5A 4GBMA 3RSOA 1ZM3A 2L0XA 4N0EA 3SYLA 3VR4A 4AK9A 1A7JA 3LBIA 1IXRC 3ZH9B 2A7QA 2RB4A 3ETLA 1K5DA 5IDVA 1ZCAA 4LBYA 1TQ6A 3C7KA 2GEUA 1AZSC 1SVKA 1UDWA 3KKMA 2GXAA 3OIVA 4IDNA 3QOFA 2QI9C 4M1MA 1JAHA 1E9SA 3U7FB 3R9WA 4DCVA 4MGYR 1UF9A 4BWYA 4GMXA 3J81k 3MGCA 3D8BA 4YDSA 1XJCA 3ZLJA 1GTVA 3DZDA 5KOYA 1G291 3NH9A 1VG9B 2QORA 4EPWA 1DPFA 3K9NA 3PCRB 4NHOA 3CM0A 1M1YE 3NG1A 3WHKA 3Q8XB 1XTIA 1D2EA 2WIBA 1FFHA 2G83A 3I5YA 2JGNA 1MH1A 2F3RA 2WSSA 1RRGA 4FWTA 5F98A 2C78A 4TL7A 1FNNA 2FF7A 3OIUA 4UNNA 1BO6A 4JVLA 5AR1A 4NTZA 2WICA 3TSZA 2AKAB 1RFLA 1ZC3A 4L15A 1NI3A 4RFSA 4Q5IA 3W5JA 1E2MA 4PC2A 2H57A 2BBWA 3GEEA 2JLSA 1P62B 1E0KA 4GPTA 1KTVA 2P2LA 5CIQA 4CGZA 1CJTC 3Q85A 1GILA 5EQTA 3O8RA 2ZE5A 1G9XA 5CM9C 5BQ5A 4N1AA 1KMQA 4DB4A 4G1UC 3V4RA 4GFDA 4RD6A 1JPNA 4EAQA 1OXTA 1GSIA 3BIFA 3LRPA 5IK2D 4AKGA 3JZMA 4II7A 1D5CA 2WV9A 1MR3F 1KKMA 5JWOA 1L4YA 2IF2A 3NBFA 1N6RA 4DRZA 1IAQA 2EU8A 3TRFA 3ICQB 4HZUA 4G5RA 4OHWA 2EW1A 3RYTC 3LY5A 5JSZA 4Y0VA 5A0FA 4TYWA 4RFSB 3RRZA 2GETA 4AKIA 1OF1A 3NH6A 4NYIQ 3IPXA 1NIPA 3FWYA 3UG7A 1QHSA 3AM1A 4GP7A 4HLDA 3BB3A 3K53A 3CZPA 2C03A 3PVSA 2JAQA 3LWNA 5DO9A 4OL0A 4UJ5A 3CRMA 1G6HA 4QXAA 1NLYA 1KSFX 3GLHE 4X8LA 3ZVRA 1DAMA 1RVDA 2WJGA 3PUZA 2JDID 1T5LA 3JZAA 4B2IA 1W2HA 4A6PA 2PH1A 1NVXQ 1YHNA 2V8OA 2C9OA 3LQQA 4WXPA 2FZ4A 1D8TA 3A1TA 3FMFA 2C98A 2VYFA 1CS4C 2QPTA 5BXQC 2VH5R 3MWYW 2QMHA 3FB4A 4ZIRB 3DM9B 2R6FA 3MWJA 2J3EA 2YZ2A 2DR3A 2R6CA 5KNCA 5JHGB 4H9GA 2XGJA 1VG8A 1YQTA 4YMSA 2IX3A 5J40A 3CX8A 3GJXC 3OEED 3PXGA 2I3BA 4ZDKA 2IXEA 4DSOA 2JA1A 1NG1A 5TXGA 1AKYA 4BFTA 4HUQA 4P4SB 1CP2A 5FI0B 3T15A 4ZV4A 2OSBA 221PA 4IVPA 3L8ZA 1KGDA 4TYYA 1XCGB 1Z47A 1SVLA 4IFEA 1S9HA 1WP9A 1EWRA 1R7RA 3CONA 4QC2A 4UKDA 4V0OA 1G3UA 3VR2A 1KK2A 1T3HA 1X8KA 2DY1A 1OH6A 2EFHB 1FMLA 2DCUA 3W5IA 1YZKA 1LB1B 2BBOA 3CW2A 2D3WA 4JBYA 3GD7A 4M1TA 3QI2A 2RHDA 3B85A 1IN7A 4A0HA 2WJHA 1WMSA 4MUBA 1E2GA 2I4IA 2RAPA 1K8RA 4PZZA 1XWIA 1KSJA 3TQFA 3UWOA 1A2BA 4BZQA 4QBIA 1W1WA 3AVXA 1XU4A 1ZM2A 1Z0KA 1VIAA 2WPDA 3FFAA 1YZLA 3VFDA 1G20E 1TL7C 3GEIA 2O8FA 1MKYA 1W0KD 2OUKA 4L8GA 1RZ3A 2QGNA 4CEIA 2IS2A 4GSYA 1W0KA 3TIFA 3X1ZA 2VLIA 1NP6A 3OAAA 5FR1A 4YMUA 2FPLA 2UZIR 3RS7A 4NCJA 3M6AA 3CB4A 1JXMA 5K8UA 3QEOA 4NCKA 1NN0A 4HDQB 5CYOA 1RKBA 3VR1A 3GLFB 4I81A 4QBFA 4PFSA 2QL6A 5JECA 4LJ7A 4A2WA 1E1RA 2WMNB 3C8UA 3VTKA 1IOZA 4EDHA 4RD3A 1IJEA 5G3YA 1DELA 1QVRA 1AGRA 3GEHA 2BMEA 2IYUA 1Z63A 4PX9A 5C4MA 4Q1EA 1W48A 2IYRA 2XITA 4ARZA 4XWKA 2DWOA 3UMFA 2EVWX 1TUIA 2HCJB 2H18A 4C0LA 1Z0DA 1F48A 1E2JA 4Q9LA 4NYIR 3DEFA 1N6KA 1R5OA 5DI3B 1OXSC 1NN1A 2DFKB 2ODEA 1YZTA 4EKDA 2JLYA 1SXJC 2BV3A 2RGGA 4PSKA 1D2MA 3L0SA 3A36A 2D4HA 1TU3A 2YINC 3NIBA 3L82B 1VIYA 1T3LA 2VSOA 4URVR 4WXRA 4PAMA 4LUCA 4MGIR 1TX4B 2FSFA 1EK0A 4B34A 2P6RA 4DLUA 4PZLA 4EPVA 1JBKA 1AS2A 1W0JD 3AVOA 4MA4A 4MRRA 3VKGA 1QHHA 5LB4A 4MDEA 2XTZA 4TMXA 2N1BA 1XJQA 2QROA 3P26A 1KDTA 4GP6A 2IWHA 2N46A 4RD1A 3FKSD 4A36A 1X86B 4PTLA 1LFDB 2DFTA 5JJKA 4CRWB 1T6NA 4HSEA 5CB8A 3TUIC 3MWLA 4DCUA 1W36D 3AF1A 1KO1A 4P0TA 4DDUA 5HCNA 1II0A 1U9IC 2HYIC 1U90A 3FTQA 2FH5B 4PQRA 4TTPA 4DSNA 5J4YA 3I1FA 4Y0AA 2REOA 5HZHA 1KJYA 2J41A 2PBRA 3T1QA 4MYCA 3ZQJA 3ZS8A 2AD5A 1T3SA 1OYWA 3QKSA 4Q1BA 4E07A 1G17A 2IYXA 4IEIA 1P2TA 1F3OA 3TLXA 4RVCA 1KI7A 2JCSA 4XJXA 1NBMA 5ELXA 4UNRA 2ORIA 4M9QA 2QRZA 4MDFA 1M7GA 1A1VA 4LI0A 1E2LA 2P3SA 2DBYA 3SFVA 2CEAA 3Q7PA 4NYMQ 3AKYA 5BYJA 1T8TA 3OEHD 1QG2A 2GZHA 3TR0A 1SULA 4D25A 4DCSA 3OEHA 4Z8YA 5A5GA 3MG9A 3KUDA 4LJ5A 4YONB 1P9WA 1YZQA 2HXYA 2HV8A 3K70C 5EUMA 1LS1A 2DYKA 3FGNA 3NDPA 1E99A 3THYA 3KQLA 2X77A 1HE8B 1AA9A 2Q21A 2QGZA 1UEJA 3PUXA 4KCGA 3DOEA 5BWMA 1NKTA 5J4LA 1M34E 2Q9AA 4BRWA 2PJRA 2CJWB 2J7KA 1VG0B 5JS8A 1XZQA 2MSCB 4IJMA 2MSEB 4G5OA 4LHYA 2QRNA 2V54A 3ZD6A 3UK6A 4EUNA 2XZPA 3AVWA 1OIVA 2QM7A 5A4JA 4TSFA 1CR2A 5HPYB 1TUEA 1KNXA 4IXNA 4QGHA 1KO8A 4WBSA 2BCGY 3T12A 4JKIA 2RCNA 1XBTA 2VQSA 3AVVA 2JIZD 2H16A 4AYXA 2SHKA 3FVQA 4HEJA 1U8YA 4W7SA 3EPKA 1FUKA 1MO4A 4HYYA 2JIZA 5JEDA 3QKTA 3DKVA 5LD2C 4HATA 2C9CA 1Z0JA 4I99A 4KV9A 2CBZA 1SXJD 2VHJA 3UWKA 3AQ4A 3PUYA 3TW8B 1ELOA 3S1AA 1SXJA 4V0MA 4TL6A 4TT3D 5CIWA 3SBDA 4DBLC 3TNFA 2QBYA 1G5TA 2OILA 4M1SA 3K9LA 4GZLA 4Q9HA 3BC1A 3HU3A 2P6UA 4HAYA 1NJGA 2CL7X 3RWOA 3ADBA 1PLKA 5JJLA 2FMXA 1XEWX 2IS4A 3THOA 4DZZA 3QXXA 3B1XA 2G6BA 2IC5A 4M9XA 2V1XA 2FV8A 4OI4A 1MV5A 3KZ1E 4PO1A 4V0NA 1EFCA 3ND8A 4HAVA 1ZD1A 2C04A 5BN4A 3VMFA 4YMWA 3DZ8A 2R6DA 3K09C 5GJVC 1HQYE 5TARA 5K8IA 2ODNA 2O8EB 2VP4A 4IKEA 1G1MA 2ZQ5A 4Q48A 3M1IA 1E4VA 2B7CA 5DLQC 2OLKA 2XB4A 3WNCA 1HTWA 4XVRA 2QSYA 3VR3A 5F9HA 2G1JA 1YRBA 2ZVQX 1NSTA 3S1AB 4DIDA 2B7BA 3EWAA 2HUPA 1KKLA 1U9IA 2QBYB 3THWA 1N0VC 4QL3A 1IN5A 1SVSA 5L3QA 5CK5A 3A4NA 1SQ5A 1AQUA 2CVHA 2FFBA 5FTJA 2FDCA 3X1WA 1DBSA 2FJUA 4JLVA 1Q22A 3L0PA 4DC9A 3QE0A 3VX3A 4IXMA 3LW7A 3P27A 3ZQ6A 2D62A 2JJ2D 1EFUA 3AH8A 4G01B 4OQMA 4YC7A 1S1CA 2ZRKA 2ZJ5A 1AS3A 2BMFA 4RZUA 4H1VA 2YKGA 1L4UA 2R62A 5HCIA
chains in the Genus database with same CATH superfamily
2BE9A 3RGGA 1WXGA 4AKHA 1JNYA 2CFSA 4JGIA 3QEMB 1IPFA 3GH1A 1M18A 3LC0A 1QHEA 1HT2E 1TNDA 5JNRA 3VRHA 3VNUA 5IAAA 1X7YA 4IICA 1Q2XA 3TGWA 3RW9A 4KO2S 4C9BA 2WJYA 3WQHA 2YJTD 3N07A 4ZAGA 2C9BA 3ROQA 3DTVD 1W87A 3EBPA 3ICOA 2QKYA 1CETA 1ULUA 3FCYA 2NQBD 5BN3B 1U3VA 3I9LA 2FPGB 1MJGM 1XG5A 1YMUA 3RYFA 3ETNA 2UV8A 1XF9A 3BRWD 3P5SA 2HJVA 1OOEA 2P6OA 1XEFA 3OX2A 3L07A 5ICCA 4C0WA 3N6RA 1W4LA 3MOGA 2FX3A 3KYCB 1GPNA 5JRJA 3UANA 3ZD7A 3EGXB 2EAUA 4MJ7A 5E2IA 2AXQA 1X7XA 1EHIA 4M6BA 1WUJS 4KXMA 1JEYB 1BHO1 3TNJA 2YNMD 5FUXA 2F43A 3H0EA 1KO4A 4RWEA 2P40A 4YJFA 2XRFA 4D96A 4C6HA 4QXRA 5AHRA 4DSTA 1U9ZA 4EFNA 3A06A 3IEUA 3LM8A 1U2TA 4MV7A 4MW9A 3ROPA 1ONOA 4UHEA 3T1YB 4LTMA 4XX0B 2PRIA 5JATA 3AEXA 1HE4A 3CF2A 2WA2A 4J7CA 4B76A 3REHA 2YVUA 3EYWA 1D2AA 4JP3A 4WOKA 1D6SA 1Q21A 4IXTA 1L3IA 1K3TA 1NLZA 2GPWA 4JXJA 2WG0A 4WZBA 4RVOA 1FUUA 1IG0A 4U3JB 4XIGS 3PI7A 4BGDA 5KJCA 3I5MA 2PYIA 3A9WA 1DSSG 2C61A 2ON6A 1ECCA 2YQ4A 3VBCA 3ICWA 4G4IA 1E2IA 4O1MA 3ORYA 1FLAA 3DNPA 5CDUA 5D5HA 3ZUGA 4MV3A 1DG3A 3AETB 3EZFA 1TQ2A 5KNBA 3HA2A 1P7ZA 5FL7D 2GKSA 2XTMA 1HYEA 3T5BA 3WTPD 3GRAA 3FPHA 5T3UA 2VT7A 1DFGA 1WMAA 1MO3A 1P4SA 4LPSA 3CRW1 5B32D 3GEMA 3CLSD 1X7HA 2P2NA 3U3XA 5A2QA 1CZOA 1WULS 4DDWA 2JF0A 3I1IA 4DPMA 1W36C 1JVSA 1T4CB 2FZEA 2HOQA 5JY6A 4KO1S 3WAKA 1Z8FA 4K3VA 3BSFA 4D46A 4J0DA 3UPUA 1LDNA 4FJ1A 1V11B 4LD9D 2HCTA 1ZNYA 1DAPA 2Y2IA 1OC2A 2F8LA 1UBLS 3DO6A 5C7YA 4EQZA 4MV6A 3FFBA 3I5UA 1RVV1 3KL4A 4G8CA 4QT4A 4IDQA 4RXMA 5IFKA 3ZV7A 2J9RA 1Q1BA 3GLGB 4ASUD 1T5BA 3KBOA 4I6GA 2PUWA 3E35A 2EZUA 3IT2A 2WUDA 3RT1A 3FSGA 1M5RA 2COUA 3AI2A 1A9TA 1SCBA 3HY4A 4D26A 3E3OA 2DULA 5DNMB 2AZ4A 5E5AA 2F3PA 1YH3A 5ELMA 4JYCA 1ADCA 4HLUC 2DUUA 2YRFA 4E1AA 3NHPA 1J9ZA 1M2OA 2OHOA 1AO0A 3IKJA 3E5NA 1HURA 1G20A 3B3JA 4A82A 3GV0A 5B2EA 2FUKA 1HOTA 3AZOA 1PNOA 2IELA 4REQB 3KTAA 3GXOA 1Q77A 4L6CA 1WIWA 1ONNA 1P3MC 5A06A 5FF9A 2BYMB 3K9BA 4FYIA 1JEQB 2JGDA 1PLLA 1RE0A 1KFEB 1E0JA 1GLNA 3LQRA 4W8OA 5HM8A 4Q7LA 4YJ3A 2KSQA 3TW6A 4WFJA 2K5UA 2VHVA 3ZCPA 3V8EA 2IYNA 1AK2A 1P3AA 1ODFA 5HILA 1DAOA 2Z5GA 4K6HA 4WUTA 1M1NA 1AKNA 2F3UA 3TSWA 1WW3A 3GJ5A 4D80A 3EFOA 3K9WA 4KDFA 5IULC 3TD2A 3WGMA 2ZB8A 1BSVA 3V7WA 4HMOA 1FP1D 3LW8A 3TJZA 5JAQA 3DFMA 5I7EA 1JNXX 3L18A 3ESZA 5DIZA 1I36A 2I2CA 3F90A 4I1VA 2PX6A 3W4IA 2HU5A 2NG1A 4II3A 3AJAA 2B35A 4PLWA 3RVRA 4E31A 2W98A 4JNCA 3CEAA 1FS5A 2VYVD 1Y42X 1DT3A 2O52A 3DAGA 4V3BA 1PUXA 4ZJPA 1E3IA 3CUWA 1QJCA 3Q5GA 3TQIA 3MGPC 3E9YA 3RJ5A 3LT2A 2OO5A 4B73A 1T1EA 3OC6A 3OUZA 3CX3A 1GSOA 1IWBB 4V0QA 4P86A 1ZYUA 3MT8A 4FTWA 5BYBA 1W7AA 1MXFA 3GAZA 2UUCB 3AFGA 2F1OA 1CULC 2QP9X 4MB2A 3LKBA 5AI4A 3V8MA 4W1RA 3C3CA 1P72A 1UBOS 2ZXUA 4DIUA 1EVEA 4Q4HB 1EK2A 2RC6A 3W96D 1EHYA 4G84A 2XNDD 3G7NA 3L93A 3MC1A 4ALIA 2I1QA 2P4HX 2ADOA 2P7HA 3CVYA 1PRYA 5GADl 5AW2A 2PEZA 2IF0A 4G67A 4GG1A 1L5LA 1RNLA 1BDJA 4YCNA 1B41A 2G40A 3HJCA 2VR1A 4EITA 1QRDA 3HSSA 5B31D 4I9FA 5ALUA 1ID3C 4I9UA 1SCKA 3C6ZA 3OO1A 2HXSA 4ODIA 3DTVB 2ACEA 4LRXA 4FFOA 3ZDXB 4S24A 2YWCA 1IHUA 5A62A 1H9AA 5G0VA 5KTRA 5JDIA 3OOJA 4ZEWA 5FFMA 1C2TA 3NDJA 2G5HC 1ZGBA 2XKKA 1MCZA 5KU1A 2H5JA 1IOLA 1OXXK 3N3AC 2J8PA 4R2MA 2Z0MA 1U8EA 3DA8A 1OZFA 4D0GA 3UKDA 3GGSA 1GKLA 5JEEA 2QU7A 5JWHA 5I9LA 2JLUA 2GJKA 1DX6A 2BGMA 1FZTA 1EPUA 5LLDA 4AQ7A 1B2RA 4KQFA 4YXWD 4EH1A 1WU7A 2JBWA 2AI1A 4JLDA 2GTHA 5JSKA 4KQGA 1Z39A 2P11A 3KXBA 4KIWA 4M1EA 3ENQA 2HF2A 1JAIA 4M60A 2FE4A 1E1CB 2WU0A 2ONKA 2L2QA 1YR9A 2NXWA 1SHTX 1N1DA 4PE5B 2BBSA 4IVRA 4IIJA 3IKTA 4TMYA 1P31A 2DHQA 4J91A 3FUXA 3AZJD 1ZNZA 3UOAB 1EINA 2QWXA 2OB2A 1QH1B 4CBVA 2XBUA 5JANA 5COAA 3LPAA 4ZUXA 1MVOA 4CYMA 4EGAA 1A96A 2ZFUA 3NBYC 4FMBB 3O3OB 4I6EA 3WRYC 1WAMA 2YIMA 5ALNA 3Q2KA 2IP1A 4NFHA 1SC3A 4P4TA 4L3VA 4PNZA 2A4KA 5CB4A 2G1KA 4UQPA 4RDCA 3EULA 1K2WA 3RC1A 3AZMD 1V8FA 3WMXA 5FFNA 2R44A 5H5JA 3O1IC 2ILVA 4O33A 5T6MA 5G3ZA 5EPEA 4PVDA 1EWVA 2HC9A 4KRXA 1EZZA 2D5BA 3N8KA 3QOXA 3I05A 2C20A 2JD0A 1M1YB 3LUKA 4P4SA 1HMPA 1I4WA 1Q16A 1XZKA 3WTPB 4WFKA 3U4QB 4BQFA 3UHFA 4ZBJB 5B32B 2FYTA 4LDJA 3ZIAA 1NZDA 5LXTA 3SVZA 1BWSA 4FDTA 1QVAA 2OZLA 3ADOA 4BE9A 1S3SA 1G5HA 3QPUA 1N2BA 3GLFA 2VSXA 4D81A 5HZMA 2JKZA 1Y8RB 4FEEA 4B3CA 4M9SA 2Q6VA 4R3UC 2ZJBA 2ZRDA 3QITA 2HUNA 5LMNB 2P90A 2X0FA 3A2MA 5EG5A 3OCCA 3LQKA 2HDNB 1G60A 2C1ZA 3HYRA 1YDMA 3NT5A 5IJ0A 4F7WA 5HGXA 3CIOA 1O4WA 4DC1A 3BTOA 3SJZA 1RI3A 4I8DA 4GQIA 3S6JA 3EBLA 2ZYIA 4JQCA 5BPHA 5JAHA 5B0ZB 4J1TC 1AE1A 1C0PA 2C5LA 2GXQA 2JKYA 1AZWA 3FWPA 4TSKA 1MEJA 4G89A 1NF9A 2Y6UA 2GFQA 5KHAA 1KTIA 2MT9A 3GVIA 3C4VA 1JI0A 1KYXA 3PLAE 5LIRA 3NPAA 1LD3A 1PR3A 3N2YA 1URPA 4S2EA 4ZZ3A 5DWDA 2PWBA 3VC7A 1MC4A 4RA6A 2X58A 3WLEA 4OLJA 2QW0X 1TPZA 1V26A 3BERA 5DNNB 2DBRA 1LWNA 1PN3A 2ZAMA 3F67A 4ZAXA 3O93A 1DDOA 2QTRA 1PGNA 4PQFA 2XXBA 5BQXA 2O8CB 2JFPA 3BWXA 4MV1A 1WQ4A 2ZSDA 2OT3B 4LGVA 4AU1A 4OQPA 4YS6A 3D81A 3AHDA 1M75A 1LGYA 4CDRA 3P9QA 3UBTA 1OPRA 4DY6A 9MHTA 3R3WA 3A04A 1DQRA 4UTXA 1OUMA 2ZIEA 2AX4A 4WLVA 3I37X 1HUQA 2OXTA 3RE1A 5EIHA 3GOQA 1RR6A 5CYPA 4B8WA 2KPOA 3HM2A 3FTEA 3UENA 3N0VA 1ZFNA 2HSWA 1P19A 1UC9A 3CVVA 4OTZA 2A8YA 5B40D 3GGOA 3TLYA 1YR7A 2D2XA 1F2TB 4OHVA 1M34B 2C5GA 4ZD6A 3ECAA 4Q4JA 1NF3A 4F3KA 4HJRA 3VDQA 1IY9A 1QKIA 3C70A 1N1EA 5AJZA 4TLLB 2BFCB 1F66D 4WKPA 4DG9A 4P4LA 2VHCA 4LKRA 5FTLA 5J47A 5AW6A 4QFCA 421PA 3AZLA 2VXOA 4RBNA 4HGPA 3V2HA 1XFAA 5FNVB 3QOWA 4DG5A 2JCBA 4O4LA 1JHPA 3DDZX 2X86A 3IR5A 1FF9A 1G6Q1 4JDPA 2HEIA 2Q1YA 3W96B 2B6NA 3C7AA 1XN4A 2A78A 3DE0X 2OOKA 5BMVA 4TQ9A 1AZTA 2YXNA 3UAGA 2G9UA 4BNLA 3LF2A 1X8LA 1L3CA 4YAJA 2DQSA 4YRLA 2MR6A 5KYUB 3H4IA 5HKBA 4G0YA 4PN3A 1KJZA 3ULKA 3R9XA 1U6KA 5IBRA 4EYQA 1RYFA 1MLDA 4LJRA 5B31B 2FAXA 1RPTA 3AXTA 3VH6T 3D6NB 4IDPA 2Y6VA 4LG1A 1T2NA 1RXWA 3THXB 4JLSA 2G4LA 1D7AA 1I0LA 4WK0B 2D1SA 4OBEA 5FOUA 5FBVB 1NA5A 3GN1A 1TC2A 1NX9A 1I5OA 3WLHA 1Q2UA 4LYDA 4H7JA 3IP5A 4YCLA 1PV4A 3D6VA 1DUSA 3M3DA 3ZBTA 5TMDA 1RWQA 3GZNA 4G6ZA 1PZNA 3KUYA 5EIWA 1IVNA 2HBQA 1EB9A 4HXEB 1XF1A 2W8BB 1DKLA 1QV7A 2O0JA 1PWEA 3B2QA 4F93B 1SG9A 1A72A 1ZVMA 2JVIA 1WKVA 3ILVA 4F86A 2G8NA 3GRVA 4CMBA 2L0XA 4JBHA 1OFGA 1LNSA 1GUZA 2J07A 2RB4A 2BMWA 2NTJA 3U0VA 1E60A 2PN1A 4IDNA 4QXMA 4M1MA 3ORHA 4LISA 2I7VA 2XW6A 3NATA 4Q0MA 1EUDA 4J9UE 3ZJVA 3NHFA 2YJNA 3JYQA 4MVXA 1T1RA 2X9NA 4NJEB 5IEBA 3O62C 4V0SA 1M1AD 5FNVF 3VJMA 4BO7A 4PC2A 2QTZA 1RHJA 4N47A 1RS0A 5HP4A 3QPCA 1C8LA 5IAOA 2ZE5A 4Y6GB 3Q1LA 4QTUB 4Z3DA 2WV9A 1MR3F 4K1XA 3GGDA 4BNIA 4D3XA 4Y2JA 3QVKA 2PLAA 3AV2C 1TLFA 2POCA 1RQ2A 1U7TA 3H7IA 4GP7A 4YV2A 3LL4A 2PWAA 3KELA 5DO9A 3CRMA 2WU8A 5A7FA 5FYQA 3MGSC 2B9EA 5AKJA 4YHHB 1GCIA 3F46A 1VIMA 2IXEA 1RJGA 4GVXA 3TM4A 2OBXA 1AXRA 4BFTA 1JHUA 4IVPA 5E9QA 4PWZA 4QC2A 3IYLW 1RE1A 4NENB 3T1HB 1SXIA 5AM5A 3I1JA 1IN7A 2GF2A 2J33A 2RAPA 2P8JA 1K8RA 3Q3EA 5CHYA 4BZQA 2NADA 4CV0A 2C3UA 3VH4A 3T3NA 3D7NA 5DCYA 1ZBQA 3HZOA 2OHHA 2W4IA 3MTGA 3WZ2A 4CQMD 3BJEA 5HNKA 4NCKA 3UXEA 5CYOA 1F1EA 1I4OA 1F2DA 4A2WA 1E1RA 3HA3A 2PWPA 1EFVA 2A1IA 1EE9A 1GZUA 5M29A 4XWKA 5K0BA 4IUDS 4RHYA 5T67A 1V2HE 5EIOA 1N6KA 1E20A 1I94B 3FRJA 1YL5A 3HSYA 5T4HA 2Z95A 4AO7A 2OK8A 2YINC 3L6CA 1HDYA 4PZLA 3VKGA 2P9JA 3QX8A 3L04A 1KDTA 4EL0A 3E9CA 5AI6A 4B79A 4CLHA 1F06A 5CB8A 3AZIC 3X1TA 5GOZA 2WD7A 2LDBA 4KGCC 4PBSA 3IDZA 4EA7A 1KQOA 1EX1A 2G67A 1FRFS 5F5LA 1PTKA 3FG9A 3OJFA 1Q91A 4MDFA 1I4EB 3SFVA 3V6MA 2PMBA 3KUDA 2YS6A 1BD4A 2DYKA 4LEIA 1BGVA 1FLDA 1IDN1 1YIAA 2Q21A 1RWNA 3B6FA 3H5IA 3KLMX 2PJRA 2G5CA 3PB3A 2V54A 3UK6A 3W97C 5A6VA 1OIVA 3V8BA 1R74A 3U4GA 2VRCA 2K2QB 3OQJA 4D8WA 5TGTA 2FZWA 1ZH8A 3BMNA 3F5SA 1QGZA 3QVMA 1KX3C 3K4PA 2UYGA 3RRJA 2WUFA 2O7SA 3ZE2B 3ZK9A 4TT3D 4YAGA 1U4NA 4EW2A 5EUCA 1YA4A 4R8PC 4B4VA 3W5DA 3NAZA 4LDPA 2DPMA 3DZ8A 5GJVC 2O8EB 2VP4A 4Q48A 1M8JA 4LF8B 3PC2A 1SUEA 3FVRA 1NJ8A 2J5QA 3OA0A 5DBEX 2GN0A 2W6MA 4BV8A 3KT8A 2PQ2A 4V38A 2QVZX 2VDRB 3L0PA 2X22A 2Y1OA 1PK8A 1GPH1 3EDCA 1CRWG 5A9TA 1W1IA 1XO1A 4QNNA 1U8ZA 5ALWA 2R6JA 2HHAA 4EF4A 3D0KA 4L76A 1JZSA 4MLCA 3DBHB 1L7QA 2JIOA 3IJRA 4QJIA 1TKRA 2ZBQA 1ULZA 4Y2TA 3NGXA 1KYIA 3NR2A 1FUIA 4F71A 2WDPA 4L22A 2C9DA 4YJHB 1P34B 4MWSA 3NBMA 5FXMA 2D1FA 3RF6A 3EXFB 4J2HA 5LLTA 1K97A 4Z66A 2CC2A 1XQYA 3AU9A 3L7CA 1KSGA 4X3CA 2JK1A 1U6JA 5E1BA 1JR3A 3TFQA 2BCJQ 3NEJA 4Q18A 1ZD5A 2MYUA 3SIPA 3WYCA 4M0UA 4QJ3A 2WAOA 4PRYA 2FFQA 1N34B 5CLGA 1YL6A 2SKEA 1RYZA 2XSZD 1NUAA 3F4KA 4YCSA 3BEOA 3KETA 1JG2A 2GFHA 4BP3A 4V0RA 1Z7EA 3WK4A 1AQYA 2Q6TA 4ZVSA 1K6IA 1D2CA 5IKPA 2AK3A 2QVLA 1A27A 5LA6A 1CUSA 5KZMB 4C0BA 1KX4A 1Y3FE 2P41A 4AT1A 4LK2A 2P9FA 2R2GA 3T8YA 4YO8A 1WBJB 1VL1A 4EKIA 1NW7A 1NATA 1RW4A 4KSCA 4D3DA 4E2XA 3MVDB 1U7PA 1GL9B 4XX1A 2XNJA 2NMVA 1W4ZA 4P81A 2GM4A 4KH0A 2VDQB 5CBPA 4EJ2A 4QOIA 2I6FA 1MTZA 1QBGA 2HY7A 3AJ8A 3W05A 1NW5A 4M0CA 5IXSA 1U99A 2QIOA 1GUBA 2VTBA 1CUDA 3ZC3A 1IN1A 3RFXA 1KK0A 2QVXX 3Q88A 2ZUVA 4RJLA 4FYMA 1Z0IA 2V0GA 2RKOA 4Z2MG 1D2RA 6REQB 1EFLA 2QJOA 3RTAA 5ECWA 1XOIA 2IPAB 2HW8A 1IN8A 1ZGJA 5KX5A 3MHPA 1TKAA 2PM8A 2HRDA 1KO7A 1BXRB 5SZIA 3A9RA 4QYTA 3WLOA 2OHGA 1AUVA 3FZEA 4ALNA 3ZH2A 4B85A 3PGMA 3QYJA 4BFCA 3TPCA 3V7UA 3BIJA 4WBNF 1HK7A 4CLXA 1TIKA 4S1OA 3OKAA 3UQYS 2V7QD 3T41A 3ST7A 2PL3A 4EHDA 2VNHA 4QQ8A 2RK3A 2VF7A 5KAPA 4E21A 1UM9B 1PAUA 4Q9JA 1KEEA 2GTPA 5DM4A 1JDBB 4OOFA 3TNYA 5F33A 5FBKA 1DINA 3IIJA 2PSDA 2NP6A 3RTEA 2VJMA 4PSVA 1U2RA 2QN8A 3VDMA 3RIHA 1VECA 3AZFC 3C1TA 3IAS6 4B3XA 1WQ3A 2X2PA 1EJ0A 1NHWA 1JEEA 5HJEA 2GUWA 1NRJB 4KFUA 2XUHA 3F6CA 3A27A 4IFBA 4P3YA 2FSGA 3BHNA 5EWLA 3MRSA 1AZLA 3KB1A 2X14A 4Y18A 4ZT2A 2D3TA 4QOJA 1GRNA 4RCZA 1PJQA 5HBGA 2MHCA 4TS4A 1EXNA 3AFMA 4HN9A 3WLMA 3G8BA 4R9SA 3W3AH 2A0YA 1SJ9A 3VU3A 1YK1A 3D3WA 4R1NA 3SS9X 4ZO4A 4ND5A 2ZRJA 4L95C 4AW9A 3DYBA 2UZ0A 1AOIC 5LKAA 3PJDA 1X92A 4CQMB 1YRHA 3H1PA 1NQTA 2YFVB 1Z6PA 3LZCA 1ZISA 4RS4A 1HDCA 1TAGA 2AF3C 3SNHA 4BO0A 1YBFA 2EJBA 1P3FD 2FFJA 1YT5A 4O2AA 1QU3A 1QP4A 2ZZNA 1F2UA 4XZ3A 1H9BA 3TN7A 4XE5A 3ZD8A 1E5LA 4GE3A 4LMPA 4X91A 4RQAA 2BI7A 5B4TA 3OLYA 4V1CI 1NBOA 2V9ZA 1PJ3A 3HB5X 1H23A 2PVCA 4Q34A 4QUGA 5LYJB 3GA7A 1WV1A 3K9CA 4E5MA 4B6EA 3KLNA 1L4BA 4IF6A 3AONB 5JR3A 2WMOB 1ARZA 2R65A 3T9CA 1CJBA 4LF5B 2Q3CA 3X1SA 1XDUA 1Y98A 1PF7E 3LNTA 1IM5A 1T2VA 1J6UA 5I01A 3G8DA 4IHQA 5BUZA 4UBLA 2J5RA 4RF2A 1TM2A 1GPWB 2O8VA 5JH7B 1QCZA 4PLFA 1DMRA 1JP7A 2UZ3A 2H6EA 4BNNA 4DMRA 3DMDA 3NHJA 1CQIB 5J1SB 3OVMA 3IMCA 5I3ZA 3IUJA 4FQ7A 3HCFA 3VHQA 1V43A 1XKLA 5J63A 4QIHA 2H1WA 2X0KA 1AMNA 3K73O 1DMSA 3ABIA 4OB8A 3CISA 5BN4B 1Y1LA 4OFXA 1VGQA 2GD2A 4DMFA 4HSGA 4AX8A 4CDGA 2BSQA 5L9AA 1PWZA 3AG5A 1C0IA 4DLNA 1OR8A 2NU7B 1COWD 1V5IA 1VDMA 3MGQD 1GO2A 1OHHD 3BCSA 3RROA 1VYTA 2IU3A 2N75A 1ZKMA 4WLEA 2E4WA 1WOMA 4YGXB 4DGQA 5M3BA 3EAFA 4ZI7B 3H9EO 1ZL2A 4L3WA 4CG3A 1MOZA 2R7KA 3C0KA 4IDCA 1QAOA 4YS3B 5C8DA 1Z13A 4EY3A 5L3SA 3AF6A 2FOLA 4DHWA 2EGUA 1YBHA 1PL8A 2JFXA 5EXXA 2A1TS 1I01A 2I2XB 2CF5A 5EXTA 4E08A 1UBJS 4G5XA 3SC2A 4JIGA 4P7JA 3RS3A 5LYJF 3CLHA 4RD0A 1MZPA 4DJTA 4D3ZA 3Q9LA 3T95A 1XXLA 1PW7A 4LX8A 4KPGA 4YMVA 2B8EA 4RORA 3E7FA 1UCFA 4TN5A 4P84A 1Y8CA 3SJ7A 4HZIA 1T1SA 4KIGA 4LY6A 5HJ7A 1UP6A 3GLKA 4MUHA 4Y2UA 3HYNA 1B0ZA 3R44A 3LZ1D 4B84A 5JH7F 4Z49A 4D9NA 1GAJA 3EIHA 3F5FA 4L4SA 4WEQA 1XJ0A 4ESEA 2VK8A 4AWLC 5KMGB 1D5WA 3HU5A 4RY2A 4DYDA 3EIEA 5DFAA 3U4AA 3T7IA 3NTRA 1ESCA 1VBFA 1RMTA 3ZGOA 4F6RB 1TO1E 3LPDA 4IM7A 4F1WA 1HI9A 4EENA 5BORA 3AF0A 3EXIA 3EODA 1PCXA 1O87A 1JMKC 2V55B 3HI6A 2GSWA 2X19A 1MC5A 3AB3A 3TLBA 3N05A 1G8PA 5DW0A 2Z8YM 2W90A 2WTMA 1VKOA 4RTPA 4ZI7F 4LMAA 5AV8D 1F8XA 1QZXA 3FYUB 3CF0A 1NSYA 3KDPA 4H7DA 4NFLA 2VTKA 3I2KA 4BWGA 2NZWA 1BMQA 2FQ1A 5ITSA 3BRSA 3TNDA 4D4HA 1Y1TA 4DG8A 5UKDA 2D7CA 1TTQB 3SLGA 4OXQA 1M2GA 1Y7HA 3DFIA 3OQNA 3LLUA 3G5TA 3AHHA 1D4AA 2DVMA 3QNUA 3NT2A 3QKIA 4P3NA 2BFNA 4H27A 2Q3DA 4ENTA 4GEKA 1X2EA 5ICMA 4RA9B 3A0UA 3CU5A 2FHSA 2CFCA 1NLUA 3I0MA 2PMDA 2J48A 3MM4A 5K0SA 3BFVA 3AV3A 2V03A 5KOHB 2D2IA 4I5FA 5JI2E 4CGYA 3Q5EA 1R0LA 5BQPA 4GC5A 2AD1A 1GFZA 1UIMA 3LDFA 4IDDA 4B7UA 4CUZA 2XDAA 2IXFA 4QHTA 3PT9A 2XUKA 2NO9A 3I3OA 4ZMBA 2OO7A 1FMFA 1JT9A 3CSUA 3D7MA 1S89A 5DNMD 4IFTA 4DKXA 3O2NA 2EG5A 2COEA 1PV1A 2V6BA 4TOIA 1J4AA 4X8OA 1JJBA 4KXFB 2B5VA 1DB3A 2RHOA 3TLGA 3ROMA 1VJ1A 4RLQA 5LUBA 4WKOA 2PS9A 5D3KA 4UOQA 3UHJA 3AKEA 2GNPA 1PFKA 2X13A 4YGYA 3U7JA 1O95D 4JJ4A 1QG6A 4M9RA 1CXZA 2QJRA 4C29A 4UPVA 4CI0B 2FQQA 5AHWA 4C0SA 5HQTA 1G6KA 4YBZA 1FFYA 2WNSA 4YJGB 4J8UB 5FUWA 1J2JA 4X23C 2J87A 2WYUA 3PLNA 4I36A 1S8AA 3VR0A 2CYAA 5E9WA 2RONA 4OQXA 2NTYC 1P3FB 1NBMD 2WMDA 2CJWA 2JI6A 3TLKA 2HMTA 2RGDA 3OZRA 3SYRA 4RE5A 2G25A 3TAXA 3MGKA 3SE0A 4Y9UA 3WWYA 3MJ4A 1XRMA 2X0IA 2IZOA 4ALMA 4OUDB 2VH1A 4TLCA 5HMLA 3MTQA 3CEPB 3A1KA 2ZJ3A 3JQ7B 5AJXA 1PWHA 3C5HA 1Z5VA 1T5TA 3ESQA 2AJ8A 3ABSB 1YQXA 3GRFA 4XDZA 3RFFA 5J2TA 1MRZA 5CP6A 3PSHA 4XM2A 2GLUA 3M2PA 2P7IA 3I2YX 4LMRA 1HV8A 2CVOA 1DCMA 3SEZA 4Q3DA 2V1UA 5B4VA 2CJXA 2QAJA 2IYZA 1GV1A 1V37A 1O0BA 4RACA 3LFHA 1P0PA 5THXA 3VR3D 2O48X 4J3NA 5AO9A 2UAGA 3PF8A 1NVTA 4KRFA 3LBAA 1WUYA 2BGTA 5AVCD 1YFKA 3QNWA 4B4WA 3F96A 4QREA 1OLSA 2HI0A 2HF9A 3BGWA 2OYCA 1T36B 4NEQA 2PT6A 1Z35A 4C4SA 3RRYA 1HNWB 4HRXA 1CUHA 1W5TA 1I2MA 4W7HA 1QLJA 1PJTA 5BOSA 2H2GA 1Q3KA 1NQWA 4UMEA 3OC0A 3I1YA 3LHDA 3FBTA 5DX8A 4UUOA 1EB8A 4AWBA 1VFNA 3AUXA 2XAUA 4WNAA 3CPSA 2GJAA 4FDMA 3GJ7A 3H9UA 3T7CA 3N5KA 3MGQB 3DVAB 5KDMA 2XMRA 2WV7A 1X3SA 4BBAA 1M6YA 2DPGA 3TD9A 2QTCA 1HYBA 5K6AC 4OQLA 2A33A 1L5KA 5KYNA 2AWOA 1RFGE 4YMGA 3CO5A 3T7SA 4UD2A 4PGHA 3LH5A 3U7HB 2RGCA 3IJ5A 1Y82A 4N8EA 1Y1SA 1HF3A 4RTSA 5CPIB 4K9OA 1Y4ZA 1JTEA 2C54A 3WIVA 1FX0A 1NULA 4WQMA 1ISSA 3O31A 3AQIA 2QZPA 3QUAA 1B8VA 4PIPA 1TE2A 1E8NA 4Q1FA 4MCIA 2PSHA 1NQOA 4PR3A 3FIJA 4UUBA 4QYIB 1GG2A 1T6YA 2YWJA 4HLQB 1IU9A 3DBVO 1Z7GA 4F91B 2I6SA 4ZDJA 1KVRA 5CU7A 1OKKD 2CHQA 4F8YA 3VQTA 2CZCA 2A0WA 2RBEA 1PJBA 4FEAA 4D9EA 1ZGGA 4OX9B 3WDLA 5TT0A 1L7AA 3PV0A 1NVGA 1R0WA 3D7KA 2PH7A 3B36A 3IJPA 1WY5A 2BZ0A 3W8EA 1OI7A 1LZKA 1SHJA 2NZDC 5IVPA 3A10A 4RXUA 3LZ1B 3K9QO 5EHXA 4DM7A 3DLHA 1F8UA 5JS7A 4FGUA 5KDDA 3TH5A 2QMOA 4OK5A 2H4JA 3REID 3BIWA 2X9LA 2A0FA 3HFJA 4MW0A 4QD3A 4J4HA 2EZ4A 1R18A 1JAHA 3RBXA 4DA8A 1Y8QA 4RTRA 4A2CA 2OR3A 1G291 3NH9A 2C00A 3M4XA 2WIBA 4PQEA 5F98A 1V8DA 4TL7A 1GFSA 1PE0A 4XZQC 5EVJA 2CXNA 3AIMA 4RLHA 5GGXA 3EF0A 3ZV4A 1A5ZA 3SK0A 4DA6A 2B34A 4RD6A 1CERA 5FO1A 4CWAA 5JWOA 4YACA 5AV8B 2TECE 3BULA 5SY9A 4G5RA 4AB1A 4I46A 4AKIA 2FVXA 2AQKA 2E48A 4LOIA 5ALVA 2X8JA 2JEZA 2ZUWA 1XMQB 4O8CA 1QC5B 4B09A 2OUIA 4V2IA 1MHTA 1H2HA 2VNSA 3OZTA 4N8SA 4ZT6A 3TU4A 4D5GA 4KYVA 5C1PA 3RK1A 3LKDA 4D4IA 1NVDA 4MLPA 4LQLA 3WGHA 3GVXA 6YASA 1E3EA 1VPWA 3T15A 1FJXA 4YFYA 4HFMA 2QRVB 2RARA 1XCBA 5K0ZA 4Y2XA 2QYTA 4MVJG 1MB4A 1JR4A 1V4BA 3GVPA 3TIFA 3WLKX 4ANFA 2VLIA 1P7VA 5FR1A 5A7GA 3M6AA 2DH6A 1JXMA 3FZYA 5AV9D 1KS9A 4MS3A 3ZE1B 1I0IA 2ATCA 3QHQA 1W48A 1HKUA 3H2IA 5FAXA 4C0LA 4HNAA 5B0ZD 1N9GB 1UFVA 4BC0A 2PA3A 4IS2A 2O2XA 4E1VA 2O7NA 3U3ZA 3KWMA 3CJRA 4H9SC 2VRNA 4G92B 2GLXA 4TMXA 1UH5A 2QR2A 3Q98A 2P62A 1X86B 4PRZA 2VOEA 4UU7A 2GK4A 2C7BA 3PJEA 4DCUA 4M0KA 1KO1A 5EMNA 1A8IA 2PYDA 4NC9A 4MPJA 1Q1AA 5EJ5A 3OY7A 3T0FA 5DNND 2WSYB 2IYXA 1NRIA 4OB6A 3IKVA 2PXXA 4G9GA 3ZG6A 1HLDA 3ROTA 3CF4A 4DCSA 4UVHA 4B83A 4AJIA 1VZ2A 4IFIA 2CUTA 1T2UA 3NDPA 4WRRA 3PUXA 3DOEA 3MRXA 4GYKA 5JS8A 3O4IA 2JLBA 1QTIA 5ER6A 4HS4A 4OUKX 4RABA 3JASB 3ZNQA 4AYXA 4WLUA 5CA1B 1T15A 4XB2A 1IWOA 1F1JA 3HCNA 2BDEA 4I99A 2YW9A 2CBZA 5EWJA 4M36A 4R9VA 4DBLC 5FLEX 1AKQA 2CL7X 3OF2A 2ENWA 2CNKA 1OA0A 5KKCA 4Y7CA 5CCEA 2WABA 1A4IA 1XPJA 4IIHA 3KZNA 4IG4A 1G1MA 2YXPX 1BXGA 2RKBA 4XVRA 3UC9A 1JFVA 4CAYA 2QX6A 5FPQA 4LGCA 1NPTO 3RVDA 3SZUA 1Z2DA 4L6AA 2D62A 2JJ2D 1N7JA 5AXAA 5CVTA 3HP7A 2R62A 2PKYX 4OJTA 5B2IA 3ND5A 2YHUA 5KYGA 5KDLA 4ENWA 4HPWA 4ZQFA 3TUJC 5T8KC 1T3TA 3QH4A 3LY9A 1ONSA 4ZKDA 1M0WA 5EJAA 5AVCB 1KAEA 3NYQA 4WW0A 3MFYA 1KK3A 1M66A 3RS9A 2ZUUA 4IV5A 2RBKA 4A2PA 3H8JA 5IEJA 4S1WA 1PJ4A 2GHIA 1USVA 3HHPA 3HRKA 2GBGA 1Y3IA 1GV0A 2HT6A 5KQLA 1Q0HA 1NM5A 3SZ3A 3MRVA 1G19A 4C0JA 3K1AB 4XJTA 1BX3A 1WZCA 2XWJI 1D09A 2NQTA 3RYHB 2FP3A 4X61A 3PC7A 3GFTA 4BO2A 1EGVB 3EGXA 2YY7A 3V8NA 1K4YA 5EE3A 3K09A 3PIRA 1BOFA 5J4VA 2WU1A 2Q2WA 4N3GA 2JI4A 5IJZA 4MRVA 1T3ZA 1CYDA 3KYBA 4NMWA 3EGOA 4XOIA 2XUAA 5G0SA 1EQ2A 1NW6A 3SJAA 3I58A 1JEYA 2QPOA 4JJGA 1AGPA 3I04M 3IBFA 1LVUA 4AY2A 5CA1F 4MW5A 2QZZA 2DRIA 1Z4PX 1TVKA 3IH5A 1VA4A 2IGBA 3AOEC 2BZ1A 3EZ7A 4ZEVA 5EJ6A 1WB6A 2HNBA 3D6UA 1XKTA 1YQDA 1VZ3A 3DBRB 4G5FA 3M9XA 1KI6B 2B1JA 1KAMA 4DCPA 4YPOA 2I80A 1E9CA 2JBHA 4MUGA 2YASA 2OG1A 4CW7A 1FPMA 4FNOA 4X00A 4BP1A 4C21A 4DWJA 3N8NA 3K2IA 1EDOA 4LZJA 4U3JA 2JLQA 3NFRA 3AL3A 4QOEA 1YS9A 3AEZA 5DRTA 5BP7A 2JS7A 3NBQA 3AHGA 4D45A 4AI6A 3B6GA 3Q0TA 4V03A 5CVEA 3JAMA 2ZB4A 3REIB 1K0FA 4P0QB 3E7DA 3WYBA 4ZOCA 3VBEA 1GPKA 1N5LA 1V3TA 1ZPDA 1JSRA 2EWWA 4B6FA 4M22A 1GL7A 2HLPA 1M2JA 3UT6A 1Z5PA 3RWMB 4BNVA 3R8FA 1FW8A 4AIRA 4CMEC 2NNLD 5FLXA 4RL6A 2PGOA 3CX7A 4NBRA 3KVYA 3EJWA 2IBSA 3D31A 5FO0A 1CNEA 1WNTA 2RCYA 4TLEA 3CWQA 4U7FA 1YFJA 3W6ZA 3VZQA 2B82A 1C4WA 5GP1A 3TBHA 4DV1B 3KHTA 1UC5B 3S29A 2CUNA 1J56A 1XVLA 4H7IA 3VOTA 1FS4A 2FDXA 3U7QB 5GJBA 3EZ2A 3LHSA 3UTBA 3PHIA 4UATA 3VZBA 2FW7A 4PR0A 3GLGA 1H4VB 2J5BA 3IUBA 2HFKA 3KOYA 1CSEE 4NXNB 3SHOA 3NBXX 3UIEA 2R6HA 3JYNA 5B2JD 5EL0A 1G5QA 3LPCA 1F1BA 4YIHA 5T4BA 4DCTA 1RPZA 4B47A 1Z7BA 1Y3DE 1GLGA 1BH8B 4B4OA 3OKCA 3KHUA 2BM0A 3IHKA 2XE6A 2YFQA 2QZ9A 4J1QA 4V1CB 1XU7A 4MA0A 1XQ9A 4REQA 4QARA 3ZLBA 2K2WA 2Z56A 4HDCA 4GWGA 2JC3A 1KDPA 1BMDA 1TQDA 4NV0A 4ERXA 1Z2PX 1LPSA 2IA5A 5AV9B 4HQNA 4JI4B 4ECEA 4Z5TC 4YRJA 1BNCA 3TPFA 1SOMA 2WP8J 2RC5A 2Z3ZA 3U2QA 4OP3A 4XQEA 3B82A 3FYDA 2AFIB 5K1ZA 1OB5A 3T7AA 1CJMA 2A67A 4JEMA 1R8SA 2E4XA 3C3YA 3GG9A 4ZP1A 3TIXB 1ULSA 1EHCA 2I3GA 4LRWA 1CDOA 1FU4A 4MIEA 4I4IA