2ZM5A

Crystal structure of trna modification enzyme miaa in the complex with trna(phe)
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
306
structure length
306
Chain Sequence
LPKAIFLMGPTASGKTALAIELRKILPVELISVDSALIYKGMDIGTAKPNAEELLAAPHRLLDIRDPSQAYSAADFRRDALAEMADITAAGRIPLLVGGTMLYFKALLEGLSPLPSADPEVRARIEQQAAEQGWESLHRQLQEVDPVAAARIHPNDPQRLSRALEVFFISGKTLTELTQTSGDALPYQVHQFAIAPASRELLHQRIEQRFHQMLASGFEAEVRALFARGDLHTDLPSIRCVGYRQMWSYLEGEISYDEMVYRGVCATRQLAKRQITWLRGWEGVHWLDSEKPEQARDEVLQVVGAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/rna
molecule keywords tRNA delta(2)-isopentenylpyrophosphate transferase
publication title Snapshots of dynamics in synthesizing N(6)-isopentenyladenosine at the tRNA anticodon
pubmed doi rcsb
source organism Escherichia coli
total genus 92
structure length 306
sequence length 306
chains with identical sequence B
ec nomenclature ec 2.5.1.75: tRNA dimethylallyltransferase.
pdb deposition date 2008-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01715 IPPT IPP transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.140 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 2zm5A02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2zm5A01
1CULC 3HDTA 1Z29A 2YC4C 3LQRA 1Z5ZA 4PQYA 4KO8A 3ICQB 4LYJA 1OXVA 2GEDA 3NG1A 2K5UA 4V0MA 1DADA 1SXJD 5L3RA 5HZKA 1P4SA 2F3TA 4LX0A 5J5CA 5EQTA 1NVUQ 1M2OB 1RZ3A 4LHVA 4HEJA 4DCSA 5DNYB 2YWHA 2QT1A 1VIYA 1W46A 4M1MA 4KFRA 3L2OB 4A0HA 4TL8A 3QXHA 1QVRA 4HDCA 1S2MA 4FWTA 4AYXA 4MKFA 4LHZA 1Z07A 2WJIA 1G6HA 3MLEA 1E69A 1YRBA 1EK0A 2X19A 1P73A 3IDQA 3JVUA 3X1WA 2UVQA 4KSCA 4A92A 2LWIA 3H1TA 2NO9A 3MG9A 4W5JA 3ZVRA 1DAEA 3QJYA 1IY0A 3VAAA 1I2MA 2YOFA 4F7WA 1AA9A 2CE2X 5J4LA 4N1AA 1EG7A 1AIPA 3EG5A 4TTQA 3OE7A 1E9EA 5LDDC 4PO1A 3A4NA 1E2GA 4JS0A 2J45A 3EA5A 2D62A 5E95A 2PEYA 1A4RA 1BKDR 2BEJA 4AYTA 5CYOA 2EFHB 1G5TA 3BB1A 2WWWA 2D06A 2DWOA 4OJQA 4EJSA 1VG0B 5BWMA 4QKQA 1SXJA 3U3JA 4D4JA 1FP7A 1G5RA 2WIBA 3SI7A 3LNCA 1GIAA 5FPYA 2C8VA 4GP7A 1XTRA 2VHQA 1UDWA 3CRW1 4OQNA 2HCJB 4EPYA 3GLIB 2JLZA 5GADl 3CR7A 5E3HA 1GG2A 4MGYR 1E99A 2MSEB 2PCLA 2C03A 2QAGB 4W5HA 3U61B 2VBCA 1XPOA 3PXGA 3W34A 4DUGD 4PPFA 1TF7A 4QM7A 2D4HA 4UNPA 3RLFA 1B23P 5B58C 2MMCA 2QE7D 3GD7A 4BFXA 4HZUB 2R6DA 3EIHA 2FDCA 1G3RA 3SE0A 1SVIA 2G83A 3I5XA 3CX7A 4GSYA 2O8DA 2VH5R 2EFEB 5AUQA 1YRAA 3FFAA 1N0UA 4MGIR 1OHHD 2FEOA 1E6CA 4BFUA 1XX6A 2IYRA 5EE3A 4DIEA 4KLZA 1LS6A 2MSCB 1GL7A 4QJ3A 4ZDJA 1ZP6A 3B1YA 1KO1A 4NYJR 3K70D 3RRMA 2ZYVX 3BXZA 4Q7MB 4DEYA 4DLUA 3U4QA 4NYMQ 1OYYA 3AF2A 4F93B 1KMHB 2F1RA 1MABB 1BOFA 4IDPA 4L4UA 1C9KA 2YC2C 1E2LA 3T5DA 3IIJA 1W36C 3C5CA 2QM7A 1VPLA 2IEZA 1GNQA 1EFHA 4DT1A 5FR1A 5EXSA 3K1JA 3AVXA 3VNUA 3U7EB 3EWAA 1R0WA 5AR1A 3SEAA 4F4JA 1EX6A 2FV8A 5FH9A 4C7OA 4G5GA 1UKEA 1G3MA 2ZE7A 3B78A 2FH5B 3K8YA 5C2JB 4BLOA 3MJHA 2J41A 3ECCA 2J5XA 1GL6A 1LW7A 5C1BA 4OQFA 3QXSA 3KKPA 4Q19A 4ZPXA 4LDJA 2ZUCA 1U94A 4BLQA 1I4DD 2JJ8A 3WRXC 4O2LA 5F3WB 5EUMA 3U5ZB 1G1MA 1D2MA 5TB5A 1ZJ6A 2Q9CA 4PAQA 3LVRE 4B2LA 3D8BA 2ORWA 1DO2A 4UJ3A 2FPKA 2I3BA 2BBWA 2AFIE 4KXFB 2FMXA 4MKIA 2D2FA 1ETUA 2KSQA 3TK1A 4EFLA 1G3UA 2YV5A 1E2FA 1YU9A 2ZUBA 1NMZA 2V1XA 4KHZA 1AQUA 5H8WA 4K46A 2XNSA 2ZJBA 5AUOB 2XITA 3K0CA 4FCTA 4LYFA 4FMDB 1NBME 1KIMA 1SVWA 3W6NA 3D3QA 2IYZA 3GLHA 3QBTA 5BW8A 3UMFA 5IT5A 1Z0AA 2GVZC 3AGQA 2FWRA 3QENA 2GRJA 3ZVNA 1FX0B 2FFHA 4UJ5A 1XRJA 5HE8A 2QP3A 1ZM9A 4DDVA 4G01B 4JLVA 5JJLA 4BUJA 3RS5A 2IXGA 1KZ7B 2A30A 1MRSA 1AZTA 1S3GA 2X77A 4O25A 2VP6A 2W58A 5HE9A 1BYUA 4M2LA 1FQKA 1N6NA 1Z6AA 1TQDA 4LBVA 1L4UA 3CUEF 4M1WA 2IT1A 4GBMA 2QUZA 3K70B 4IXNA 3LW7A 1M6NA 2P5TB 1MO6A 5JEEA 3W8RA 1IONA 2OCAA 2PZFA 2VF8A 4AKEA 2GJKA 1SQ5A 2Z83A 4IDNA 4K8OA 1N6KA 1SVOA 1SKYE 4LJ5A 1Z8FA 4O3MA 3BE4A 3KL4A 4EQ6B 2HXYA 5B57C 3CPEA 2V7QD 3FTQA 3K09C 1KHTA 2XTNA 1JECA 4ACAA 3ZJYA 2VIIA 4EFNA 1Q22A 4Q00A 2W2TA 1AJEA 4HAZA 1HQYE 3WY9A 2KBEA 2ZXUA 1XTJA 1N6RA 4WAUA 2GF0A 3QSYA 1L2TA 4GRAA 1IXSB 3ZDQA 1OXUA 4D25A 1NN1A 4UXHA 1MH1A 3CPHA 3OF5A 2JCSA 1GM5A 5SZIA 1DOAA 2QPOA 4XSGA 2ANBA 1AM4D 3N2EA 2OFOA 3V00A 4HLCA 5JI2E 2C78A 3W3AA 1NVVR 4JVNA 3MRSA 4BQSA 3H0KA 3TR0A 2GF9A 2XNDA 4AC9A 2C96A 2V54A 3T34A 4B44A 3FPAA 2RGXA 2F43B 4ASUD 1A82A 1OV4A 3MUFA 5UKDA 3THWB 2AKYA 2NIPA 1N6LA 3L43A 3UANA 4P4SB 3W6OA 4B76A 3QKUA 3A1UA 2O8BA 3ASZA 1P6XA 5KNCA 3RABA 2JEOA 1A5TA 3CWZA 2FE4A 3RS7A 5JI3E 2VSXA 1N5LA 1CS4C 3GEHA 4L8GA 3FOZA 4A2WA 3WNBA 1LVGA 3SN6A 3KJIA 2V7QA 2J7KA 2R65A 1XEXB 1XD8A 1CU1A 5JHGB 4B3DA 4V03A 1XPRA 4QXAA 5LPNA 4GP6A 1X1RA 2D3WA 2Z4RA 2PMKA 3ZYCA 1FTSA 2RGEA 1N5IA 5G3YA 5HR5A 1US8A 3MWKA 4PSKA 4JKYA 2ZVPX 3CRVA 3CH5A 2JJ1A 2CHVA 2ZAMA 4NPHA 4EFMA 2GVDC 2O8EB 2BJWA 3CF2A 3TIFA 2ZS9A 5CLQA 2VSFA 4ZCIA 3WXMA 3H86A 3AVYA 3GFOA 1JEDA 1TX4B 1P9NA 5L3SA 4UNQA 4FCVA 1Z2AA 2ZVQX 1RFLA 2DY1A 2DWQA 3K0AA 1Z0FA 3BC1A 4NYMR 3EZ2A 1AS0A 4LJAA 3ZVLA 4TN1A 3I72A 4ASUA 4HB2A 1K6MA 4IEEA 3RS2A 5ELXA 2BM0A 2XOKD 2ZUDA 4IRUB 3SBDA 3SQXA 1KOFA 4TSFD 4NMMA 4UNRA 4PANA 1H8EA 1UBCA 2ZYWX 3GPLA 3GJ6A 1ZNZA 3KKQA 1S4QA 2ZETA 4ZKDA 4LV8B 4PR0A 3WP1B 3EZ9A 2OILA 3TQCA 2OLJA 3IHLA 4I1SA 3TQFA 4C4PA 3TE6A 4QJ5A 4U5XA 1WP9A 2GBLC 3L0OA 2F55A 2A5FA 5TY0A 2PT5A 1GSIA 3GLIE 1G8FA 2NZJA 4P4UA 1QHHA 2N1BA 3MAAC 2PMDA 2GKSA 2EYUA 1GILA 3F0TA 1CLUA 1I4TD 3O8BA 1VMAA 2WWIA 2Z6VA 1LTQA 4AKIA 4FW9A 3N70A 1U8YA 3I3SR 3FFBA 4YXWD 3K0AB 3HJNA 3FKSA 3QKSB 1S1CA 4Q03A 2H8KA 2XOKA 3CONA 3SQWA 1Q12A 1CRPA 1KZGB 3IUYA 4B6FA 1E2QA 3WMGA 3NBXX 2REOA 2REXB 2RHDA 1R6BX 3FE2A 1S96A 1RJ9A 3NDPA 4IW3B 4XVRA 2ZRBA 1ELOA 1W44A 621PA 4NONA 4TMTA 4BZPA 4DEXA 1KY2A 2W6JD 3ONWA 3MSXA 2WSMA 4DCVA 1G3IA 4Q1DA 2QTFA 3KUDA 2EQBA 4MYCA 5KOYA 2ODEA 1AKYA 1ANKA 1S8FA 4QHTA 4RZ2A 1LV7A 3RWOA 3KFVA 2FFAA 1Z0KA 4MYHA 3EW9A 3V9PA 3W6PA 3X1XA 4URZR 1C4OA 3AV0B 1T3HA 4KU4A 4IVRA 4C2TA 4CDGA 3GP8A 3THYB 3C14C 4MKHA 1J90A 1KO7A 4NE2A 1G7TA 4P32A 2HV8A 3QXJA 4KFUA 2JLRA 2PZEA 2NG1A 3KDSE 2ZSBA 1XB2A 1XMSA 2KB0A 4ZDKA 3G5UA 5HKKD 4YXWA 1R5NA 3BJIC 3BS4A 3FB4A 3DKVA 3WNDA 3IKJA 121PA 1OXXK 3VHXA 4ILEA 3O8CA 2QSZA 2AR7A 2ZRHA 5KSZA 2D74A 4R98A 1OW3B 2YKGA 1NMYA 5CJPA 4A8JB 3NIBA 2OV2A 4JT4A 1HH4A 4YMUA 1S1MA 1AN0A 2X1VA 4JYCA 5SZKB 2JDID 5CLLA 1GFIA 2W6JA 5J4KA 1ZYUA 2F9LA 5J47A 2GCNA 2IS1A 4DHEA 3UWOA 3F8TA 3FHTA 4LHXA 2YHSA 2I1VB 1AZSC 3DMDA 3T5GA 2W6IA 5GJBA 1FUUA 1JXOA 1NG9A 1KJYA 2QGNA 3UK6A 2OM2A 2QP9X 3HR8A 1EFUA 4M1SA 2CBZA 1NBMD 2VP0A 4B35A 3UKDA 4CF7A 3I1FA 1JALA 3U6KA 3ZD6A 3Q8XB 2R44A 3ZIAD 2R6FA 1XCMA 1RE0A 1KK0A 2AWOA 4HAUA 4PC6A 4WXPA 1CJKC 4PZZA 5A4JA 5HKKA 5GJVC 2OZEA 4D6PA 4C9BA 1FFHA 4P3YA 4LV6A 5JRJA 4XD7D 4US1R 1R8QA 2PL3A 4M9ZA 1R0YA 2JLYA 2WMNB 2CXXA 1X8KA 1RC8A 1G7RA 3AF1A 1W0KD 2OXCA 2WJJA 1RYHA 3IGFA 3LXRA 4DWJA 1XZPA 1T5IA 2JDIA 2VQSA 3NVAA 1CJVC 1VG8A 2J0QA 1EXMA 3T35A 3WRYC 1KI6A 3QI2A 1COWD 3KFXA 1IN6A 4M8NE 1P72A 4ON9A 3X1ZA 1WQ1R 3L8YA 5IHPA 2PH1A 3QOFA 3W5IA 3THOA 2FN4A 1DEKA 1ZM4A 1NBMA 4CEHB 4F92B 3GCGA 3I73A 8OHMA 1P61B 2W2VA 4HAWA 3IQXA 3VR3A 3B9QA 1ZM2A 2DFLA 3AF3A 3L82B 3GMTA 4V0NA 3QKRA 1IM2A 3SHWA 2DHRA 4LHWA 3IQWA 3BFXA 4M9XA 1KI2A 2G1KA 4IVPA 4WW0A 3HPRA 4Q18A 4DB2A 4DCNA 2XB4A 2HT1A 1ZNXA 4ZV4A 1NP6A 3EIQA 2BBOA 4XD7A 4DRZA 2W83A 3THXB 1W36B 4OHXA 3SC3A 5DI3A 3FMPB 1O87A 1E1QD 3QQ5A 3VR5A 4WXRA 821PA 4JSTA 3IIMA 3Q3JB 4JL6A 4OI2A 1W0KA 2OCYC 4Z1MD 1WXQA 2UKDA 4DSNA 2FZLA 2QQ0A 5FUWA 1ZC3A 3IIKA 4ABYA 721PA 1GWNA 2QGZA 1ZUIA 1IN8A 2OEPA 1KY3A 1S3SA 5DGXA 4XOIA 1FZQA 1KNQA 1W5SA 2GXSA 3WP0A 1COWA 5AJZA 4QBFA 5FTJA 4BFWA 3I8XA 2J0UA 3MCAA 3NBFA 4KBGA 4O0MA 5D3MA 1VHLA 1VCNA 4M53A 4RKFA 4A6XA 2WWYA 4CEIB 1KTVA 1E2DA 1OXTA 3PITA 3SYNA 3KQNA 1JAHA 4TYYA 1YZGA 2PX0A 1NMXA 2QQEA 4TL9A 4JBXA 5DLQC 5FOTA 2EFGA 1KGDA 2EVWX 4F4CA 1CEEA 1UJ2A 1Z2CA 2FU5C 4Q7KA 4JLDA 3ZQ6A 3ZD7A 2BV3A 3AKDA 2RGAA 3VR4A 1S0UA 1ZRHA 3ZGXA 1T91A 1JBKA 1RRGA 1CBUA 2XTMA 3Q7QA 1VIAA 4QL3A 4C0SA 2QTVB 1Q1ZA 1IJEA 1BS1A 1JXMA 2OFXA 3PEWA 3EX7C 1E1QA 4IXMA 4ZO4A 2GCOB 3K09A 4PQRA 4Z1MA 2FNAA 2VSOA 1E2HA 3BH6A 2PJRA 2OCBA 2WV9A 3T12A 2PJZA 1YR7A 4AKGA 4LK2A 3AQ4A 1EESA 1NY6A 2A7QA 2ZI3A 1SZPA 1CF4A 1E94E 1XZQA 5BXQC 4JLMA 5FTKA 4BLPA 4LYHA 2YWEA 3HYRA 3UMSA 3H2YA 2E87A 2DFNA 2FSIA 1W2HA 4AYWA 3TW8B 4I1VA 4G1UC 1P5ZB 4HUTA 2RKOA 1DTSA 5FL3A 2G9NA 3TSZA 3TBKA 1HEIA 3BOSA 3OESA 3FYHA 1YJ5A 1XD9A 1KKLA 1M7HA 2F7SA 3EZ7A 2CVFA 2GAOA 5DE3A 5BN5A 1QG4A 3AKEA 3IBGA 4HLDA 3PG5A 4LCBA 4JLNA 3EA0A 3E70C 4PC2A 5HCIA 5FBLB 4Q4HB 5HZHA 1HQCA 3LO5A 4CZ2A 1VG1A 1NN5A 1XJCA 3CRQA 3DOFA 4OHWA 3F3YA 3U6BA 1TUIA 4Q1AA 4EUNA 5AK0A 5JWHA 2V1UA 2CVHA 1G7CA 2CE7A 1V43A 1WBDA 1G7SA 1BO6A 1DBSA 3B60A 3BD9A 1D5CA 1GTVA 4DCTA 1II0A 4LOAA 2IYWA 4IOJA 3RS4A 1GDDA 4PFSA 3HWSA 4RZXA 3GLIA 2GHIA 1OFHA 3WMEA 2IUUA 2RGDA 1XEFA 3TMKA 2XTZA 4NCJA 5FUYA 4AD8A 4RD6A 2IYUA 1JNYA 1XFAA 3U7HB 5JHHB 2QAGA 3BGWA 5C4MA 3UMRA 4YMVA 3X1YA 1QBKC 2PT7A 3RDPA 4A8JC 1GP2A 2V55B 1Z6YA 3TUJC 4B48A 4D0LB 1ZINA 1JJ7A 1Z28A 4GDFA 2I4IA 1QZXA 3ZS9A 4D0GA 2FGJA 3BBPA 4A2PA 4FWIB 4HZUA 4URUR 2DB3A 4E03A 4TWZA 4CEJB 2ZSEA 3W8NA 3ZVMA 2O52A 2N46A 4IDQA 5JCZA 2AKAB 1X8JA 2AX4A 2A5YB 4Y0VA 2O8FA 1TTTA 3NDBB 1W4BA 1II8B 1T8TA 1DARA 3CF0A 3U7GA 2JA1A 3M1IA 4D4KA 2GILA 1P60A 2XXAB 4C0KA 1VYTA 4RD3A 1LF0A 1NVVQ 5FOXA 3PENA 1L4YA 1KMHA 4DSTA 1D9ZA 1MABA 1XD2B 2QMEA 2RH5A 3TLXA 5CM8B 4MRPA 1WE2A 3DOEA 1VKJA 4WZBE 4J0QA 4QM6A 2QNRA 4MRVA 1U9IA 4DC9A 1HURA 2VPPA 2GTPA 4GT1A 3SJBA 2HJVA 2WKQA 1OB2A 1E2MA 1NIJA 4QFMA 3ZZTA 4Z51A 1IN4A 3QG5A 4GMDA 2AK3A 2NQ2C 3VX4A 1TEXA 4V02A 4ZI3A 5JWOA 3GLFB 2A5GA 1E4YA 4TLBA 3ADBA 2C5LA 2C2HA 1KDRA 3OIUA 3AUYA 2QPTA 2BCJQ 4RD0A 3ETLA 1AGRA 1E9CA 3MJRA 3R20A 4TTRA 1FL9A 1I4LD 3PUWA 4N3NA 4B32A 3TR5A 3QEOA 2CNWD 3VTKA 1GZSA 1YZTA 2BWJA 2O8FB 1KYIA 5EE5B 1OH5A 4DB4A 1KJWA 1T6NA 1NJFA 1UM8A 4LV5B 2QROA 2ZRMA 3B8HA 4FD2A 2IX3A 3HU1A 3EPLA 1ZUNB 2WAXA 3LLUA 2ZI9A 1WDTA 1F6BA 3Q7PA 1DAIA 1X1SA 3P32A 5TARA 1YR9A 1IHUA 1DG1G 3VU9B 3JZMA 4MRRA 2PEZA 2GK7A 3OIYA 1JR3D 4RFVA 4TLCA 4NZYA 2FFQA 1F5NA 3Q72A 2B8TA 2OLKA 2P2LA 2IYLD 4JLBA 3RVBA 4DUGA 1Z63A 1BH2A 4G5RA 1NIPA 3K0FB 1D9XA 2ZRIA 4IHQA 1J2JA 2QE7A 4QOSA 4OI0A 4UNSA 4JBYA 3P26A 1FX0A 3SFZA 1Q21A 1N25A 2IYTA 3FMIA 4Q48A 2CNWA 2WWXA 1OHHA 1T4GA 3I5YA 3LQQA 1X6VA 4Q1FA 1AS2A 4X8HA 4MUAA 3R7WB 4ZCLA 3V4RA 3KJHA 4QGGA 3VR2A 4A4DA 1FMLA 1R5BA 1KO5A 3QG1A 2BDTA 1HTWA 2CL0X 1HA3A 1R7RA 2ECKA 2ERYA 1UKZA 3E2IA 3HPQA 2VLIA 4R2IA 3NH9A 4L5BA 1F2UB 2CK3D 3DO6A 3H4MA 1J7KA 1SVKA 4DCUA 4Y0AA 5JEDA 4EQ6A 3AVOA 4OL0A 4PO9A 3G0HA 2XB2A 5FOWA 4DDUA 2WICA 2ZR0A 4C0JA 1R4AA 3KKOA 1PLKA 3P20A 1UKVY 1DPFA 1F60A 4GOXA 3CIOA 4WA7A 1WRBA 3A8TA 3LWNA 5LBIA 3WHKA 4E09A 1TAGA 2OUKA 2E9SA 5EE1A 3CRMA 3AVVA 1N6OA 1E2PA 4RY2A 3AP3A 5LB2A 1XWIA 3LBNA 1T3LA 3GQBA 5CB8A 4Q7LA 1XTKA 4B71A 1OJLA 4BRUA 1VECA 3B82A 4WBSA 2C9OA 4KITB 3BWDD 1P9WA 4RJLA 2ZRJA 5TV2A 3ZZUA 2FPLA 3P4XA 3O8RA 1NSFA 1QF9A 1TQ6A 1OB5A 1TU3A 2F43A 1CTQA 2P5SA 3C41J 2RGNC 3KJGA 3TNFA 5A0FA 3RHFA 2ZYUX 4PHHA 3THWA 5C4GB 4P4SA 2JJ2D 5K8LA 5JMTA 4XTRA 3T1VA 3UPUA 2QENA 4C0AC 5K8TA 5EE0A 3LBHA 1YZNA 1JAIA 1RIFA 3RC8A 1N3BA 2HYIC 2BOVA 5EZ5A 2HJGA 1DS6A 1GRNA 1ZM3A 3NC1C 1XEXA 4OHVA 3LD9A 4LJ7A 5A5GA 4MRNA 3GLGB 4LJYA 2G3YA 1PLLA 2RB4A 5AWFC 4WVFA 3CM0A 4NYIQ 5FPTA 5JSZA 2FSHA 4WZ6A 4ARZA 1W1WA 4JVLA 2O8EA 4EPWA 1UKYA 1GNPA 1VCOA 1ZU4A 2YNMA 4TT3D 3REFA 1N0WA 2OT3B 4XSHA 3EPHA 2X2EA 1OPXA 1QHGA 1SULA 2QRZA 1IN7A 2WZQA 4E22A 1E2JA 4Q9IA 3L8ZA 3TGPA 3K9GA 1KNXA 4JLKA 3QE0A 1U0JA 2Z43A 5BQ5A 4OHZA 1GKYA 1N6PA 3REGA 4JIMA 1XPUA 1OXSC 2LKDA 2ODBA 4NTZA 2QG6A 4OK3A 1KO4A 2YINC 4IOKA 5FFMA 4Z54A 3U3OA 2JJ2A 3LRPA 4LPSA 4TMWA 5KHOC 3W3ZB 4A82A 1ODFA 2RGGA 4KSBA 5F9HA 4KYIB 4DLSA 2O8CB 3JVVA 3CBQA 2WHXA 3CZQA 3DL0A 2CLDX 4I81A 4HATA 2ZU6A 3QPVA 5FI1B 4FMBB 4JZKA 2ZRKA 2VYFA 2C9YA 2A9KA 4KCGA 5G3ZA 4F91B 1P3JA 3EXAA 5KUTA 4DBLC 3QPWA 4Q4AB 2QBYB 3DDCA 1DAGA 2WWGA 2J7PD 3M0EA 4DDWA 2IEYA 5H68A 1QHIA 2FA9A 4PXAA 4TT3A 4A2QA 5IRCD 4Q5IA 2GXUA 4X8LA 3QPUA 4JSYA 3B1WA 1G4AE 5DYIA 5FPHA 2DCUA 4B3FX 3QF4B 1IXRC 3KUCA 3QNUA 1UEJA 5CK5A 3QKSA 4DXAA 2AXPA 4GMXA 1RRCA 2EW1A 2YOGA 2IW3A 3QBVA 4JLAA 3OHMA 1Z6GA 3X1DA 1M74A 3A1VA 4BLRA 3SS8A 1CRQA 4B43A 2QA5A 1W2GA 2HF9A 4NCKA 2ZPTX 3PUYA 4JLOA 4CRWB 1BYIA 3LDAA 3MGCA 1A2KC 4BFVA 1UBFA 4CGZA 1SHKA 3DM9B 2PBRA 2ZJZA 4V0LA 4QGFA 2IHBA 1IOZA 2ZE6A 5DHFA 3QVUA 5GJWC 4B3XA 5EP2A 1OIXA 4URXR 1EWQA 2J7PA 5J40A 3CWQA 4F38A 4HAVA 3EZ6A 4Q4LA 3U60B 4XVQA 4QBIA 4DVGA 2QZ4A 3THYA 2P65A 1N5KA 4AK9A 2RCNA 1Z0JA 2WPDD 4G5OA 2JAQA 2NO1A 2LCFA 3FHCB 2BCGY 3X2SA 3QEJA 5BN3A 1YKSA 2EWVA 3DMNA 4QHYA 3A1TA 3WHLA 3G82C 4KV9A 3GLFE 1LFDB 1ZD8A 1YR8A 1AQYA 3CX8A 1E0KA 4Z8XA 1J8YF 4TSFA 1YHNA 4HDQB 4A8JA 4B3BA 2WOJA 3HP1A 2P6RA 2ZJAA 1E32A 5JZVA 1EFTA 3T61A 2J0SA 4JYBA 4HSEA 2ASEA 2J9RA 4YMWA 3P27A 3PUVA 1F2TB 1LY1A 1KI4A 1JQLB 2G88A 3AEZA 4HUQB 5HCNA 2C99A 1IBRA 1G8YA 3NH6A 1XP8A 3RWMB 1KKMA 3AB3A 1FNMA 3HU3A 2C77A 3SBEA 2QMOA 4BFYA 4MGZR 1LS1A 2AL7A 5B2ZA 5KSYA 1IQPA 1GAJA 4JLPA 1K8RA 3KB1A 2KE5A 3ZQJA 2ZQ5A 1P9RA 4EPTA 2H17A 2IYYA 2V6JA 4KLNA 2J46A 1OH7A 1VDZA 4FMCB 2IXEA 1A2BA 4BLSA 4BZXA 1OIWA 1Z06A 1NLYA 4MUBA 3T1OA 3C15C 3TUIC 5E7MA 1CR0A 1XDBA 2L0XA 1SGWA 4JVSB 4IFBA 2KBFA 3KQHA 4EKDA 1Q3TA 1W36D 2BIFA 3DPUA 1T3SA 2W2XA 1FMJA 1Z6XA 3Q85A 3SR0A 4KFSA 1Q20A 3PV0A 1LB1B 1YE8A 5TVKA 4TZ6A 3PQCA 2WTUA 4I1UA 3GEIA 1EX7A 1Z6TA 3IBYA 2YWGA 3KX2A 4U02A 5SZJA 4CT4B 1IAQA 4B3GA 4ZDWA 1Z83A 2F6RA 4NYIR 5JS8A 2QRNA 1SVLA 2HCBA 4Z8YA 1E9BA 2JLSA 1U90A 1XMIA 5HTKA 2IWRA 4CEHA 1ZCBA 4K81B 3BORA 3T1QA 5H70A 4PC3A 2AK2A 4DIDA 1OFIA 2FF7A 3FDIA 4CYMA 2YZ2A 4FN5A 4A6PA 1G18A 4US2R 4NU0A 1R10A 3TH5A 4TLAA 2ZYTX 5FOUA 5JCPA 1H8HD 3MD0A 2AXNA 4UNNA 3SU8A 3GFPA 3AVTA 5JJIA 2P0EA 3FWYA 4PC7A 1PV4A 1T8UA 1C1YA 1G19A 4BECA 4DLXA 3U7FB 4BPBA 1G20E 4PPNA 2GESA 3THXA 1ZIPA 1P7CA 5CYPA 4MYTA 1Y3AA 2ZJ2A 5EXTA 5G41A 4V0KA 3T06B 2G0NA 3IEVA 2Q9AA 3UG6A 5JBQA 1KK2A 3VNVA 1KMQA 2AN9A 2ORVA 2XSZD 5HPYB 3MWYW 4RVCA 2ZJYA 3LVQE 4D26A 3KXKA 3R9IA 3TKLA 3RRNA 1P2VA 1KDPA 4PTLA 2LKCA 4RD2A 2W00A 1NI3A 4ITRC 3I8SA 2JLUA 3U3KA 1SVSA 3KTAB 4G3XA 4TYWA 4HLUC 2HYDA 2OBMA 2BBSA 1AKEA 4LPKA 4NBSA 5D3QA 5ANRB 1X86B 2IYQA 4OBEA 3AH8A 5CB6A 1CR1A 1YZKA 1UF9A 2GJ8A 4TYNA 1TF5A 1PVOA 1JEEA 1KSGA 1P75A 4PX9A 3N2IA 6Q21A 1UFQA 1YVDA 4CEIA 2EFDB 3B85A 1Q57A 2OO7A 2YYZA 2NZ8A 2E1RA 3ZIAA 5DH9A 3TUZC 1H8HA 5DSZA 5EXPA 3EIEA 2V3CC 1JR3E 1G21E 4D2IA 3K0CC 4JT2A 4G5SA 5FBQB 2CHGA 4KAXA 5C18A 4OKSA 3ZH9B 3GLGE 1N5JA 1OLOA 1PJRA 3L0IB 3NKVA 4IVQA 4M9QA 1WA5A 1GVNB 3LV8A 3ZZ0A 3WYAA 2XSZA 2GCOA 4G0NA 4Q47A 3SJZA 2AFHE 2QORA 2YOHA 3IILA 3VFDA 2BBTA 2HDNB 1GITA 2F9MA 2QPAA 5JRZA 1XXHB 1W49A 2ZI4A 4CIDA 1TL7C 4IDHA 1ZC4A 4IDOA 3U44B 2IYSA 4B74A 2BKEA 4UXIA 2JLQA 5JJKA 3NWJA 2ANCA 3GJ3A 3NHBA 5G40A 4OYHA 1XEWY 1M1YE 5K8UA 3TVDA 1CP2A 3UIEA 3IO3A 4NKRA 1KI8A 1HT2E 4OQLA 1PLJA 3OAAD 3K9HA 2FGKA 2XZPA 3C8UA 2ZI5A 2B7BA 2QMHA 4XH9B 2P6UA 3KZ1E 4W5WA 2Q6TA 5FBRB 5F9FA 2QL6A 3K0SA 4JJZA 1Z0DA 1W0JD 4URVR 2VP4A 3B1XA 3OIWA 4H1UA 1A7JA 3VHLB 2ATXA 2NPIA 1HE8B 4S35A 4QNRA 1AS3A 3I32A 4NL4H 4M9SA 1E0JA 1XCPA 2CDNA 1CJUC 1ESMA 1P2SA 4GFDA 5CIQA 4AURA 1DAFA 4Q4HA 1GOTA 3I4LA 1VYVA 4ZIRB 3RANA 5JECA 3MWLA 2ZM5A 2CCGA 4URWR 2VL7A 2YJTD 3V4FA 5DI9A 2C9CA 2WVJA 2Z0MA 3GJ0A 2UZ3A 3RAPR 5TMPA 1NF3A 3CX6A 3FHOA 3SDZA 1TQ2A 2BKUA 4MITA 2CHQA 2OHFA 4QHSA 3RNLA 1QVAA 2I1QA 3OAAA 4LUCA 2XX3A 3A58B 1FP6A 2FPMA 3B6EA 4PC1A 3OZXA 5P21A 2ZRLA 4GOKA 4FMCF 3FVQA 1SKQA 1MO5A 1HY3A 2QN6A 2NPFA 4C0HA 2ONJA 1W0JA 2A3RA 3CNLA 4TMZA 2D7DA 2MSDB 1Z0IA 4ZCMA 3A1SA 4TQAA 2ZJOA 5H1YA 1P2UA 1GUAA 2CLCX 1QHSA 2B8WA 4B3CA 2W0MA 4GNKA 1KAOA 4LC0A 4C0LA 2ODWA 4YC7A 2ZI6A 5LD2B 1NG1A 2NO6A 4Q9KA 4E5UA 1B0UA 1CXZA 3SZRA 4D4MA 2ONKA 4CW7A 1M34E 2WSSD 3B5JA 4CEJA 5FPSA 1MT0A 4AIIA 4PHTA 3B9PA 4XWKA 1E0AA 1G4UR 3B7GA 2KJQA 2G77B 5JS7A 1G64A 2WBLC 3S1AB 2WKPA 1II8A 1TEVA 4BRWA 1FNNA 2GETA 2BMFA 3BIFA 4L9SA 2OAQ1 4LBZA 4D0NA 3ND9A 2XXAA 3AVPA 2SHKA 2R8RA 4P31A 1TADA 1QHYA 4RFSB 1J8MF 3T15A 1XD2A 2BM1A 1S9DA 3U3MA 2CJWB 4LBYA 3ZS8A 2NO0A 2GJSA 3P4YA 4RCYA 4TYQA 5G53C 4IKEA 1E0SA 1FOEB 2ZS8A 2EYQA 1WBBA 4MDFA 1OE0A 3DZDA 4PQFA 1DAMA 4JJKA 2H1LA 1KO8A 5EUQB 2ZS7A 4LJ6A 4IEIA 3R9WA 3L0SA 1PZNA 2XAUA 3GLFA 5KPDA 2V9PA 1RW4A 3UXMA 3AF0A 5J4HA 2C98A 2WSSA 2B21A 1N2CE 3SFVA 2XJ9A 2ZRPA 2GBLA 2OXRA 1Q3HA 3LY5A 4UXJA 5J4YA 3BAFA 1MR3F 1GRQA 3LX8A 5KO2A 1TPZA 4PHFA 5DYGA 3A37A 2IF2A 1NNEA 2JIZD 1E96A 3CLVA 2G6BA 3TSOA 5KDOA 1XBTA 4I1OA 2J59A 4TTPA 2IL1A 1E98A 1OF1A 1UBGA 1ZD1A 1W4CA 2PLFA 3NXSA 1NN3A 1R8SA 4POAA 4LJ4A 5CM9C 4TQUS 1LF5A 2ZRGA 1M7BA 1XEWX 1DG3A 2WM9B 5DN6D 3WNCA 3BFKA 4Q4JB 1JJVA 3RYTC 2R6GA 2J0VA 4LJ8A 5FTNA 3VU9A 2ZITA 3GJ7A 2JGNA 3KQLA 2HEIA 2ZI7A 4NCNA 2RAPA 3D6TB 4M22A 2ZAOA 1MO4A 1PUJA 1SHZA 3BERA 4NCIA 4BEJA 3SHFA 3KQKA 4RKEA 2VHJA 2R9VA 3ADCA 1DELA 1HV8A 3N5CA 4BZQA 2ZIAA 4GL2A 3K0FA 4GPTA 3WYGA 4ARZB 1U2RA 3AKYA 3NC0C 5JLJA 2HLDD 2H57A 2ZSFA 4PPQA 1GRRA 1JPNA 4Q9HA 4QRHA 1HT1E 3AGPA 1RRPA 4I4LA 2BJVA 5FBVB 4TLDA 3Q5DA 1U99A 2JIZA 4BEBA 1XMJA 1KDOA 3VKGA 3OFND 2UZIR 3R7WA 1AGPA 3RC3A 4NCHA 3BK7A 3LAWA 4Q1CA 3SNHA 3LXXA 3TSWA 4GOJA 3TW4A 5EP4A 4BFTA 1Q1QA 2O0KA 2O5VA 5J4VA 4MGKR 1G17A 2WKRA 3B1ZA 3BB3A 5DHAA 2GEVA 3SOPA 5DN6A 2VTKA 2ZROA 3IO5A 1UEIA 5TDHA 4B75A 1F2UA 2IA5A 3AKCA 4TLEA 4PAOA 4G5QA 2FZ4A 4HI0E 4EAQA 5KU1A 1J70A 2QTHA 1W4AA 3A4LA 3PVSA 2VA8A 4M0LA 5FTMA 3R8FA 2Y8EA 3I61A 1EFRD 1R0ZA 1E9FA 4EJSB 2VP2A 2WAYA 1E9AA 4MA4A 1SXJB 1F48A 1T5LA 5KDLA 4A36A 1Z08A 2KI5A 1ZCAA 3ADDA 1JI0A 3A4MA 1EWRA 3AVQA 2HLDA 2ATVA 4M1YA 5B64A 1XTQA 3KKNA 5KSPA 1NL3A 5FBWB 4IOMA 3PEYA 4KFTA 3I92A 3QF7A 3ICEA 1FTNA 5E7JA 4GZLA 3BH7A 1LNZA 4AI6A 2YVUA 4ZKEA 4DJTA 2D7CA 4E07A 5IDVA 4TZ0A 3OFNA 3A6PC 1XTSA 2FX3A 2DFKB 2GCPA 4B47A 1A1VA 4Q9LA 2VHCA 3LW8A 1YQTA 3C5HA 2JLXA 1N0VC 4TMVA 4FCWA 4D81A 1KI3A 1W48A 3C16C 4OJKA 2OE2A 5GVRA 4C30A 4EPVA 2ODNA 3I62A 3WMFA 2X8AA 1GKIA 1TU4A 2WJGA 4LJ9A 5EXXA 5FI0B 1FQJA 2J87A 2BMDA 2GK6A 2FEMA 1KSJA 2O8DB 1XXHE 3CKLA 1UBEA 4GI7A 4H9GA 1JR3A 1EFRA 2A78A 3LA6A 3VR6A 1NLZA 3BFVA 5EJEA 3U3RA 1E1RD 1MO3A 2V8OA 2TMKA 4DLTA 2XZLA 3ZLJA 5AUNB 3GLGA 3C4JA 4HLUA 4C2UA 3SYLA 2GEUA 2ZRNA 1TQ4A 1XMVA 2ZEJA 2A5JA 2V6IA 5DO9A 5GVSA 1IY1A 2MMGA 3U4QB 4A9AA 1Z22A 4OK5A 1J99A 3M4YA 1KI7A 4FIDA 3EASA 1MOZA 3VX3A 4YLGA 1GL9B 5B30A 1OH8A 2ZJ8A 3CW2A 1P2TA 2CEAA 2NO7A 4LC1A 4NHOA 4TL7A 4NH0A 3VR1A 4PPGA 3KQUA 4R9UC 3UATA 4DT1B 1OFUX 4HAXA 1DO0A 2GZDA 3AF4A 3W9YA 5KYKA 4KI0A 1YZQA 2QM8A 1G9XA 4L16A 3GEEA 4EIWA 4PZYA 4C7OB 2CK3A 2H18A 3FMOB 2O8CA 4ESVA 2VEDA 4JMPA 3FKQA 4DLYA 1Q44A 1UDXA 2EWWA 4M1OA 4A1FA 4LSGA 1OT3A 1ZU5A 4X8MA 3IEUA 2CMKA 4WOPA 5LD2C 2OG2A 4KVAA 3SYKA 1E1RA 1KSHA 1TMKA 1X8LA 4BFSA 2WOOA 4ESHA 5AJWA 1FPMA 4HB3A 1WF3A 2GWHA 4Q4AA 5SZHB 2QBYA 2IS6A 4LHYA 2XNDD 2ZSDA 4MKGA 4TYPA 3H84A 2ZREA 1YR6A 2OCPA 3GJ8A 5FPKA 2HXSA 4Q1BA 2VHUA 5KDDA 4OI1A 3VQTA 4JVMA 1HUQA 2Q9BA 4MYUA 3BH0A 1E9DA 3RS0A 3LBIA 4CT5A 2PX3A 5FR2A 3NEJA 1IN5A 4LZZA 1NLFA 3QF4A 3NBYC 3LH5A 3VKWA 4KVGA 2NGRA 2QEQA 2J1LA 2Q3FA 3AP1A 4KODA 1EFCA 2NTYC 3DEFA 2GXQA 1II9A 1ZAKA 5KSOA 4Q1EA 521PA 3GLHB 2VO1A 4DLRA 2GNOA 2IWHA 2ZR9A 3O47A 2JJ1D 3AP2A 1D6JA 2GJ9A 4LYAA 1XU4A 1NJGA 4QGAA 1V5WA 2RHMA 4RCZA 2OESA 3D7MA 1ZD9A 1BIFA 1M8PA 2CCKA 3QUSA 4DLVA 2NMVA 1QDEA 4S2EA 4BWYA 4ZI2A 4YONB 4XTCS 1U8ZA 1RVDA 4DDTA 2N42A 3TJZA 5CITA 1HE1C 2ZRFA 2F1HA 3PEVA 4R2HA 5BYJA 1QRAA 2B6HA 1QHXA 4FXPA 3D31A 4TMKA 1RRFA 2JASA 1Q1EA 1CJTC 2AD1A 5FOSA 5KNBA 1H8ED 1OYWA 3M6AA 1CR4A 4A15A 4B2PA 2GA8A 1G291 2IS4A 1CIPA 4W9MC 221PA 2B92A 2R6AA 3JZAA 2FSGA 2JLVA 4YDHB 1U0LA 3WYFA 3DKPA 3CF6R 5F2EA 2IHYA 2GZHA 3IHWA 4HB4A 1D8TA 3WBJA 4RZUA 5DISB 5CDFE 3MFYA 2O0HA 4XWAA 1XJ0A 3K0EA 2CCJA 3PR1A 4KBFA 4HUQA 1F2TA 4YMTA 5AJXA 1IY2A 3PEUA 5AJVB 1E2EA 1T0HB 4MRSA 3OIVA 1TF2A 2BHRA 3K9LA 1ZW6A 4DZZA 4UQOA 2DR3A 4JLJA 3VMFA 5L8VA 5KPJA 3AM1A 3FKSD 3B13B 4YQFA 5EP3A 3P1JA 1O3YA 2OSBA 4LRWA 1FUKA 1MKYA 2H7VA 2IUSA 3OEED 1NVXQ 4II7A 1NSTA 4TMXA 4IJMA 2QAGC 2GZAA 2O8BB 1UPTA 1NKSA 1SVMA 2FSFA 2QP4A 3QXXA 1ZNWA 3GJ5A 2RMKA 4OI4A 1VG9B 2O0JA 2Q0HA 4BGDA 1DE0A 2QMUA 2BMEA 4I99A 4FI3C 4V0ME 2WJHA 3CR8A 1W7AA 5DIFA 3VKHA 4JBWA 1E79D 4P33A 5E7IA 3GJXC 1US8B 4DLWA 2C95A 3TRFA 4YMSA 1QG2A 2HUPA 4LWZA 1E4VA 4EJSC 1RPZA 4H1VA 4IFEA 3B2EA 1SXJC 3KB2A 2R6CA 1MRNA 4JL8A 1PUIA 2QAJA 1GKUB 5E4FA 5L3SB 5EE9A 1U98A 2BMJA 1N6IA 3PJRA 1T0JB 2R2AA 3KXLA 3EC2A 2H92A 2ZRCA 3PIRA 1JPJA 1E3MA 2OBLA 3TVTA 1XTIA 3NBZC 4QC2A 4C0BA 2ZRAA 1ZM7A 1L7VC 2P6NA 2F1JA 3OEEA 5GJCA 3RRYA 4B2IA 3F5FA 1KI9A 4GZMA 1U9IC 4HAYA 4B33A 2IXFA 4U00A 2G0TA 1OSNA 2GJAA 1XJQA 1R5OA 2EFCB 2WPDA 3WBKA 5TXGA 5IF9A 4X8OA 4F4IA 3HU2A 1MV5A 1WCV1 2OBNA 1GNRA 3UWKA 3IPYA 2G1JA 3QXCA 3U2QA 4URYR 1U8AA 1ZMXA 1VYUA 2DPXA 1SXJE 4L9WA 4ZDIA 1E79A 4LY6A 1W5TA 3CRRA 1NVWQ 1NRJB 2AWNA 1TNDA 2W6ID 4YDSA 3LX5A 1T9HA 4FMDF 2XEXA 5FUXA 5JWRA 4Q01A 1KAGA 4PSVA 1TUEA 4B34A 1QHHB 2H5EA 2WIAA 1BMFD 4PHGA 3Q5EA 5AJYA 4C0QC 3KTAA 3MWJA 4B6EA 5AUPB 2C04A 5L3QA 4PO8A 4AG6A 2FFBA 1W4RA 1VTKA 2WJVA 3KXIA 1OIVA 3R9XA 1Q0UA 3L0PA 1CJMA 1RKBA 5CIWA 3DZ8A 3J81k 2QSYA 3UG7A 1JR6A 2HT6A 3FMFA 2WJYA 4W7SA 4US0R 4BLTA 3FGNA 4XWOA 4N0EA 1RJ9B 3HYTA 2QU8A 2REBA 2VF7A 2ORIA 4OK6A 3KJEA 3BRWD 1D2EA 1KK1A 1FW6A 2IBMA 5LB4A 1UAAA 3C7KA 3CH4B 4IOLA 2Z5FA 3LLMA 4OQXA 4PAMA 4B73A 4DSOA 3CB4A 2CLSA 4ERNA 3ND8A 1HYQA 1ONBA 4QGHA 4HDOB 5K8IA 3QY0A 1L8QA 4QBGB 1VCIA 1BMFA 2J3EA 4MDEA 5FOVA 2CL7X 4RD4A 1XXHA 5IK2D 3EPJA 1EGAA 3NTUA 3K70C 4TQ9A 2X2FA 1K5DA 5EP1A 5L3QB 1G8PA 3DVLA 4M21A 3U44A 3PUXA 1W47A 5F98A 1OKKD 3RSLA 1CKEA 4AWXA 3KKMA 2IUTA 4UKDA 4BFZA 4Q02A 2XGJA 4M1TA 4Q21A 4DKXA 3RSOA 2RGBA 1G3QA 1OH6A 1R0XA 5CK4A 1E2NA 5C46F 4P0TA 2AD5A 4QBHA 1X3SA 2B7CA 3Q9LA 1ZIOA 1KSFX 4FINA 3GJ4A 2A2ZA 2FOLA 4R7ZA 421PA 4BE7B 2CL6X 2ZR7A 2IYXA 4RD1A 1NY5A 2PZGA 1ZUHA 2WWHA 3EC1A 3A1WA 2IC5A 1H65A 4PSAA 3PFIA 4Q9JA 4JL5A 1I2DA 4QG7A 4C3ZA 2FG5A 3TAHA 2XZOA 3SJAA 4HYYA 4D82A 1XF9A 3EARA 2DWPA 3E5HA 1DAKA 5CJ2A 4EPXA 4ZIRA 1JQJC 4MQBA 4D4LA 1KDTA 1Q1BA 1UADA 5FTLA 5IK2A 2W0SA 2QI9C 2PCJA 1VHTA 4DLZA 2V4ZA 2WWFA 2VRWA 4AY2A 1G8HA 1OKKA 2IF0A 3EWSA 3ADKA 2ZSAA 1R2QA 4CVNA 3OEHD 1G16A 1F3OA 4KJZA 3B1VA 3RS3A 3W5JA 2BC9A 2GDJA 3CPJB 3GLHE 1CR2A 1P62B 2QY9A 2HF8A 2VHTA 4A0RA 4XJXA 1Z47A 4N0DA 3MMPA 2ZE8A 3PUZA 4NDZA 1AK2A 1DVRA 5FUVA 2RGNA 2Q3MA 4OHYA 4XIGS 1IJFA 3IPXA 2Z4SA 4D80A 5KTYA 1U0HC 2ZANA 2VP9A 2DFTA 5FL7D 1KI6B 2F3RA 2OFWA 2P3SA 1KJZA 4WZAE 1YZLA 5JSZB 2EU8A 2ZRDA 5BYKA 3EPKA 1Z3IX 1ZNYA 1ESNA 1E2IA 4HZIA 4MH0R 4LGMA 3QIAA 4OQMA 4HB0A 2ZE5A 2H16A 2JATA 1IXZA 2A5DA 4P4TA 5L3VA 4NYJQ 1KI1A 4AG5A 5BN4A 1JB1A 2IK8A 3QKRB 3A36A 4O2RA 4KYUA 2PLRA 4R71A 2GAAA 3CO5A 3NHAA 1DAHA 3E1SA 4Q66C 4V0OA 3K9NA 1VCMA 3S1AA 2YWFA 2RGCA 3SJCA 3W90A 2AHOA 4QNMA 3TAUA 4Q7JB 5M04A 1M7GA 3OEHA 4DSUA 1D2NA 1ZBDA 3CNNA 3RRZA 1KK3A 4WIAA 4A0FA 1WB9A 2R62A 4ACBA 5DI3B 2GXAA 3T1TA 4RFSA 3ASYA 3AVUA 2DYKA 2OAP1 2CJWA 2DBYA 3CZPA 3NEYA 4HLQB 5JFGA 3HR7A 4JKIA 4AKHA 2P67A 4L15A 1RYFA 1SKYB 2BVNA 4RSGA 1Y63A 5FL7A 4TL6A 3O8DA 1E9SA 4M4SA 3PCRB 1G41A 4EDHA 3K53A 3LFUA 2J0UB 4PZLA 1ZVQA 2Q21A 1G5PA 1G6OA 1NKTA 5EZ6B 1WMSA 5D3MB 2QT0A 4QJ4A 5CDFA 4EPRA 4U7DA 2WMOB 3DHWC 3QKTA 2IS2A 1E9RA 2ZU0C 2ZJ5A 3QVVA 4A0GA 2NOAA 3BB4A 2D2EA 1XNJA 1N6HA 2ERXA 1E2KA 2Q3HA 3CNOA 1NN0A 1K5GA 3AVWA 2VP5A 3GFTA 2KWIA 1OFTA 3R8CA 2IYVA 4LBWA 1S9HA 2F1IA 4LI0A 2ZTSA 1U81A 4XVUA 3EZFA 1QHNA 4Q4JA 2BEKA 3EAQA 4M1KA 2XJ4A 2JLWA 4BASA 3DM5A 1XCGB 5KNDA 3AUXA 3OE7D 4NP6A 2FJUA 4RZ3A 1YZUA 1G8GA
chains in the Genus database with same CATH superfamily
4Y9DA 4Z2MG 4ZT3A 2YC4C 3I42A 4V0MA 3PJFA 4LHVA 4RM2A 3LUHA 1U1CA 4V0SA 4AYXA 5AVCD 4QDJA 1RYDA 3IDQA 3ZVRA 3KUYD 3BULA 3ZDYB 2YOFA 4F7WA 4NNOA 4ZOLF 4XFKA 3LG2A 3EA5A 1R5JA 4D3XA 4OJQA 4MP8A 1IMJA 1G5RA 1Z12A 1E3JA 3DF7A 4EW1A 3HBMA 1T1RA 5JARA 4U2BA 3MBOA 3Q8KA 3CR7A 1D2AA 5C7LO 3TLMA 3CLSD 4X23B 3L18A 5A7GA 1SC3A 2E4ZA 3UOGA 4W99A 2E5WA 2QOEA 4GF5A 1ACMA 3MGSD 5IUJC 2FSVC 2RC6A 2BKXA 2VH5R 1UPBA 1XX6A 4GOOD 3ZR4B 4O2BA 4DAEA 1U65A 2X5JO 3VOAA 5K0BA 1UBMS 3QRWA 3LZDA 5ITZA 4OGLA 3CE9A 3EY4A 1RI3A 5DOVA 1O97C 5FR1A 4RV4A 1RAGA 4J2TA 5GSUD 3OLQA 1EX6A 2ZE7A 4CQMA 1B73A 4RLQA 2HWXA 1ABBA 3DDHA 4BLQA 1BRMA 2X0JA 2Z3VA 4KYVA 4XZQC 3BRCA 3O4VA 2Q9CA 4PAQA 3FCUB 2BI8A 3D8BA 1JDTA 1NQAO 3DCIA 3DE6X 2QMQA 3EVNA 2DT5A 5B12A 3PKIA 5MGNA 2YV5A 4Z0NA 4NOLA 2D5LA 4PLWA 1LBEA 3PNYA 3ZBPA 4XYEA 1UQTA 3P8ZA 3ODGA 4ZYYA 2YNMD 1NM5C 3DV9A 3RS5A 4LE0A 2W58A 3Q3CA 3KWQD 1MBZA 1F7VA 4OTZA 4QDZA 4D4GA 2W4MA 4ZV9A 1BXZA 3EDOA 4NHEA 2GYVA 4UBNA 1R6AA 1UJ5A 4U8HA 2BG1A 4H7FA 1QQ6A 2FUKA 3D4OA 4A8PA 1BN7A 4W7IA 2J30A 1HR0B 3MINB 3QPCA 5SZIA 4ENVA 4XSGA 2ANBA 2OY0A 2OFOA 4HLCA 3TLZA 2C4WA 3N8NA 1E2UA 4AC9A 2RGXA 1NHGA 3PDJA 2I2XB 4H9RB 5KNCA 1A5TA 5AW6A 2D5AA 4L8GA 4A2WA 1T9KA 1NZDA 5JHGB 1X1RA 5CH3A 4A8TA 3PLRA 1US8A 1X7HA 1QO0D 1DKUA 2GKOA 2QXYA 3BTVA 1P9NA 4UNQA 1ECBA 4H9OA 1QX3A 3HN7A 3WKJB 3HUDA 4LJAA 1I6WA 3IAS6 2JEYA 4I5FA 4NMMA 4P84A 3A7EA 2B5WA 4YUYA 1R9JA 4JQCA 3IIIA 3IHLA 4YRJA 1PFGA 3L0OA 2PT5A 4AF8A 4J8VD 3GLIE 2V58A 3ZNOA 5IC4A 3F5MA 3HCNA 2VC2B 3B6GA 4HNGA 5E8RA 3O8BA 3FKSA 2XOKA 1Q12A 3B48A 3RU7A 1QANA 3WRWA 1KY2A 3MSXA 5KOYA 2ODEA 1AKYA 3RWOA 1I0IA 3HGQA 4DCMA 2HA3A 4TLMB 5GY7A 3NYWA 3RAGA 3HO6A 1BAPA 1UXIA 3JXEA 4P32A 5HQ3B 1XLTA 4DMFA 3ESQA 5CG1A 2QRUA 1IFXA 4ZVUA 4OXXA 5I7EA 1OXXK 5D8DA 1U31A 1DRWA 4C7MA 1CZLA 2F9LA 4BTLA 1K0FA 4DHEA 3AJAA 2FSVA 2RHWA 4CDNA 5CFQA 3DR5A 4GECA 3PFBA 1FUUA 4AP5A 4JGGA 3FSEA 1WAMA 3K9FC 4HXEB 2AWOA 3FOAA 2IODA 1I3OA 1A27A 4XZ3A 4ETWA 4C9BA 1P3BB 1IULA 5IJAA 3NNDA 4CM8B 1URPA 1X8KA 3OVMA 3WGLA 5AH0A 1RYHA 2JDIA 2IZ5A 1L5ZA 3X3HA 3RQIA 3OU6A 2HW8A 1QXSA 2EJWA 5EHXA 3FPFA 3X1ZA 4AUNA 1W1IA 2FN4A 1H3NA 1SBNE 3IQXA 4CLOA 2FP3A 3N5KA 4GPZA 4HDNA 3DPSA 1WVIA 3IMCA 3BFXA 4M9XA 1U35C 5CA1F 3D7NA 1QU2A 4H60A 5A3QA 1NP6A 4A03A 1GN9A 3QY9A 4EENA 4OLAA 5ADHA 1JFIA 2R1VA 2WSLA 1FZQA 1NM5A 1COWA 5AJZA 4MWDA 5AVBD 4QPNA 1YFKA 2IXBA 2NACA 2IV3A 4Q3AA 4NEQA 1YZGA 3MQFA 2Y2MA 4JLUA 2PH7A 1E59A 3N8GA 2R7AA 4IQ4A 5CDHA 2XTMA 2QTVB 1Q1ZA 2E7ZA 5IAKA 3PEWA 3TI7A 4C08A 5KVSA 1IPEA 1WHTB 2FN7A 4RVGA 4PFKA 3AQ4A 1NY6A 5BXQC 2C7RA 5C51B 2YWEA 2DFNA 4I1VA 4MQFB 1HG1A 4TWBA 3OG9A 4LISA 4CIXA 2QVZX 3EZ7A 2AFVA 4DG5A 2ZIEA 5BN5A 3AKEA 3IBGA 1KZ1A 1W0CA 4CLRA 2ORED 5AVJA 3UXYA 1BROA 3K5PA 5TMDA 5HBRA 1J2EA 3L6DA 1T9AA 4YO7A 1RHJA 2EBFX 4QSHA 3ZCVA 5CD1A 2J4CA 3PI6A 1C3LA 4CM1A 3AT1A 4E6EA 2WINI 2II6A 1CNEA 3SIWA 5CP6A 4I8IA 4IIHA 4DRYA 4WADA 3ZLUA 3MGRD 3SVZA 2Z08A 3DLTA 5I7HA 2ZZMA 5JMWA 2YN4A 4JJ4A 3UK1A 1FUEA 4E03A 4L7QA 4TWZA 3REJA 4Y18A 3G79A 1SU7A 4ZHQF 1FLNA 2G9VA 5ALSA 1C4XA 1RACA 2OP1A 3H8WA 1JG1A 5HZMA 1TJ5A 3WIDA 4YM6C 4X1OA 5A62A 1VRWA 5ADWA 3K05A 1KZ4A 3SHVA 5I7SA 1I7NA 1I94B 4BFCA 3AUYA 1HFKA 2MWMA 3QEOA 1YZTA 4TRRA 2O8NA 2AEFA 1T6NA 1UM8A 3QZUA 2DMRA 4F3TA 3D3NA 5K3AA 1BWPA 1HGXA 2WTNA 1P45A 3B0DB 3W79A 2HQSA 1ZVMA 2YQZA 4NZYA 2WY2D 4REQB 2OLKA 5HP4A 1EUZA 4LD9D 2Q5IA 3KSAC 5JDCA 4NE6A 1X6VA 3LP6A 2XB8A 3UFBA 1EFVB 1HZJA 2E89A 1N75A 3I01M 5AV6A 1I2ZA 5AV5A 3V2HA 4EQ6A 2EEZA 2W42A 1R4AA 3P20A 3U37A 4KGCB 3KU4A 1WRBA 3QMVA 1IHPA 3AVVA 3MC1A 5EJ9A 3KWLA 2XA2A 3GQBA 4OF4A 4B71A 4JENA 1EUYA 2FPLA 3S1SA 5T3UA 1NSFA 5BNTA 3UGQA 5C4GB 2JZCA 3GZJA 3KAPA 3ED5A 1ZQ1A 5DTRA 1VBMA 1LPOA 5FNVF 2PWBA 3AO0B 4MRNA 1VFPA 4PQGA 3F7OA 4N5HX 2O8EA 1N0WA 1YBMA 3E27A 3GGPA 1DBIA 2YXEA 4B46A 3K9GA 1UK6A 3IQIX 2XUGA 1IOLA 2Y68A 1TPYA 5C81A 3OZIA 2ODBA 3AM3A 5E0KB 3CLTD 1ESZA 5EJGA 2BKAA 4UHHA 4LDAA 1H2FA 2O8CB 4GVPA 5FI1B 1E4EB 3GZ4A 3DFFA 3PVCA 3ZE8A 3UUGA 1QHIA 2PYOB 4CFZA 4LVOA 2F3UA 3P0FA 3ZDCA 3KSUA 4KO4S 4KUDD 2Q9UA 3K31A 3G8BA 4RW0A 4CFYA 3A1VA 2HF9A 4NCKA 2B36A 3KK0A 2J85A 4BFVA 2QTCA 2VFAA 3D6VA 1R1DA 2ASVA 3DKKA 3QU4A 1ZK4A 3O9VA 1Z0JA 2JAQA 1T4CA 2BFFB 2OCIA 3FUWA 4CF3A 3X2SA 5BSTA 3VMMA 2DUWA 4W1PA 2NO5A 3TOVA 3UOAB 4MNTA 1J8YF 3KR0A 4HDQB 3TEMA 3WOHA 4JYBA 2JGDB 2BI4A 2J9RA 1IBRA 2KX7A 3RWMB 2QMOA 4MGZR 1GAJA 1SUBA 5L4NA 3GA5A 5BNWA 2FPGB 3W5AA 2WTMA 3A1DA 2IYYA 3H7AA 2O7QA 3OI7A 1VDZA 1N2CB 2IXEA 5LXTB 1SGWA 2C2YA 4RHCA 3KQHA 1TJ3A 5IJXA 3C7AA 5HKBA 1H3EA 1W36D 1PV2A 3KR2A 3G0DA 5I9TA 4L2IA 1EX7A 4XB1A 4MCIA 4QOEA 5JS8A 5LNK6 4ZUXD 4K81B 1JDBC 5DF1A 4F97A 3L7AA 2AXNA 3V80A 3SU8A 2F2AC 3JQFC 3WK7A 3U7FB 3EEOA 3CVOA 3U80A 1ZIPA 4DJ5X 3ZGZA 4JT9A 3NAZA 1RBYA 2AG8A 5GPBA 3U4IA 4YFYA 3WGZA 2GZSA 1VMDA 3WAAA 1L5HB 4DR4B 1IC6A 2WQZA 4RCVA 4RD2A 3F7MA 4G3XA 2V7VA 2B4AA 3ILVA 4W5OA 1TF5A 5LA6B 4YPFA 3FUUA 1J09A 1Z7WA 5JQGF 1YBFA 2ZY4A 1K2WA 5AVOA 5IAGA 3GVPA 3KLNA 5GXQB 3L0IB 1JHAA 1UZNA 1BMTA 5DM70 4MVWA 3HCPA 3W8FA 4MVJG 4DQVA 4LRSB 3K5HA 2OVBA 3MJSA 3AY7A 4Z4CA 5GGYA 3ST7A 3D5QA 4R83A 4GOND 2NT3A 3JASB 4U0KA 5CBPA 4AUKA 3GPDG 3C6ZA 2DLNA 5EXEA 4RJIA 2EW8A 1CP2A 3WFZA 2FGKA 4LZOA 3F6RA 5F9FA 3L05A 5AVXA 2C4VA 3R77A 4DHWA 2UUCB 2BH2A 4G4IA 2XIJA 3A6DA 4MB6A 2P2NA 4B6QA 4F2HA 4ZQGA 2QG9A 2W2QA 5G49B 2JHPA 4HFNA 4R7GA 1E9VA 1H2XA 3EIOA 2IYNA 5K0NA 2UZ3A 2ODQA 5JSKA 3HP4A 5CDYA 3C6BA 4DA6A 2PGOA 3ZQUA 3OZXA 1EP9A 3UB4A 1H85A 3NTXA 2A3RA 1KH1A 1QE5A 2IDMA 1ZG3A 2QD3A 5KWSA 4G89A 2HF7A 2OXEA 3B7GA 2OUIA 3CEAA 2WKPA 2JRCA 5CPKB 1BH8A 1BVYF 3ND9A 5KOHB 5IUKC 1E5XA 5GONF 2JAXA 2R8RA 3I1IA 5A4IS 1XD2A 2JI7A 2NO0A 3NIGB 3JALA 1AC5A 4DUPA 4IEIA 1N9KA 3C74A 5BVGB 1P1CA 4JLSA 1GQRA 1W52X 4BCDA 2VDWA 5TC4A 2BEVA 3TSOA 3VJRA 5AWFC 3NXSA 4W8HA 1JKJB 2ZRGA 2HKIA 3ZDDA 2PQ0A 4QULA 1GU0A 4FZJA 3T5TA 3M3HA 1G9TA 1FBNA 2R6GA 1TGVA 1P0FA 2ZI7A 1PWHA 1H0SA 4QLAA 5IJ9A 2XT6A 2R9VA 4MR9B 3WYGA 2RSLA 1BG6A 3EVEA 1A98A 5LU8A 3AJ8A 3R23A 4RPKA 5K9ZA 3FOBA 4BLVA 2VK4A 1XMJA 5EP4A 4HZGA 3EQ9A 5DHAA 4H9NA 1E7WA 2WEKA 2YWCA 2Y0CA 5KU1A 3LWZA 3OETA 3I61A 4HTFB 4OYLA 3VR6D 3DLCA 2I29A 1WL8A 4FDMA 1PU2A 2H51A 3VR0A 5E7JA 3ZJTA 4CSRB 2W8BB 2F2TA 4BVEA 4KIWA 1K6JA 2FB9A 3C16C 4OJKA 2GK6A 1AKRA 5ESXA 2QX9A 5HIJA 4H9GA 3KQPA 1EFRA 3U5TA 2B4QA 4YMGA 4GR5A 3WK9A 5MN5A 1C14A 1E1RD 4C2UA 3SYLA 2ZWMA 2PFSA 1F5SA 5DO9A 2OOSA 1CWUA 2MMGA 1LLUA 1HOXA 5CU7A 1QKKA 4YLGA 4EL5A 3V2UA 4LG1A 1SG9A 4KW7A 4PPGA 1OFUX 1N34B 5DTJA 1A5SB 1UDXA 1ZISA 3IEUA 5JADA 3HG7A 2H2WA 3RFVA 4HB3A 2ZSDA 3MWGA 5DWVA 1W5EA 4YMLA 4G8BA 3HCOA 2A8YA 4NULA 2Q9BA 4PTZA 3BH0A 1TEZA 1P3IB 4KODA 1FDTA 5FWAA 2QQFA 2XNKA 4JD5A 3AUFA 2G28A 4II3A 3RRXA 4UU0A 5HS6A 3RHSA 4JUIA 5IAJA 1PK8A 4UE2A 4MW7A 2NVOA 2BYTA 3MGPA 2B92A 1N92A 1X8XA 2PGXA 4GP9A 4J8UB 1PV1A 2FYTA 1U0LA 1JSCA 1DT3A 1LA2A 4OQZA 2HUNA 4YFVA 3BWBA 2ISSD 4YRMA 3RGWS 2VK8A 3QU9A 4D3FA 1X74A 5CG2A 3C3XA 4I0WB 1ZW6A 2R7MA 3C87A 5L8VA 2CKDA 5BS7C 4RTSA 1IB6A 1NSTA 2EG9A 2PRYA 5C5EA 4IIFA 4R5MA 1TAHA 1EGVB 4J0DA 1JHPA 4QDOA 1FFGA 2R6CA 1QR2A 3OQIA 3PJRA 1UAGA 1J20A 2ID9A 1U2GA 5E5AB 5PNTA 3BEDA 3L7DA 4GZMA 3W2TA 4Z7JA 4X8OA 4AJEA 3EY9A 2OBNA 1TCCA 4BNDB 4BMOB 1SXJE 3W05A 4CNBA 2VQ6A 4ZOCA 1WV1A 1PG0A 3EDMA 4H0NA 1PD0A 5AJYA 2X8JA 3PZRA 4JB2A 3O38A 2FWMX 5DCYA 1HE5A 1QV7A 1RKBA 3DZ8A 3J81k 3TQRA 4BGIA 1RC1A 4CM3A 3OOSA 2I6UA 3EGXB 1NRIA 3WHIA 1Y8AA 5DNNA 3VPBA 1ZMTA 5G1NA 4JCOA 4O4LF 2YIDA 1MJHA 1SCAA 2FEAA 4D42A 4CIYA 1A5AB 2M6KA 5EP1A 3K2BA 5JG7A 1G8PA 3PUXA 3UPTA 4X85A 1QDLB 3KKMA 3DEIA 3QE3A 1P74A 3DMGA 3ROFA 1L3IA 3JSXA 1HLGA 2FOLA 2IVFA 2ZIFA 4J3JA 1L4GA 4G8DA 1NY5A 2C5BA 3NLLA 1I3LA 4JL5A 2A1TS 3FSGA 4KIJA 1Z5NA 3C1BB 2V4ZA 3ZVKA 5AIAA 5B1LD 4HXGA 4CVNA 3ZE9A 1NASA 3PUZA 4D80A 2GRUA 2IU6A 1X13A 1KVSA 3ORHA 4CXMA 4RMJA 1KJZA 4ISCA 2QRJA 3X1UC 1ZN7A 3VC1A 5DOZA 3R3JA 4HB0A 1HYBA 4CTNA 2BFDA 3H0CA 5BN4A 1MDFA 2O2HA 3NHAA 4X1IA 2P4HX 4X41A 1D2NA 2FQQA 2AUTA 2OFPA 4DIKA 5JFGA 4JKIA 4GQBA 2BVNA 2M6SA 1RNLA 4MQ5A 2BONA 3JRXA 3LFUA 4K0RA 5C8YA 1AY0A 4ZOEA 1BE8A 5EZ6B 1J0AA 4K9KA 3DQQA 1E9RA 1NYTA 4JUBA 1FLDA 2D2EA 1R27A 2O6LA 3GFTA 3ILHA 3QBEA 2WWVD 3T9FA 1PJBA 5JSYA 4BASA 4DA0A 4C6TB 4L57A 4HH1A 4WK4B 3K7EA 3O2SB 3KOMA 1B43A 4LDNA 2F3TA 2HLPA 5EMKA 1IPHA 4FGJA 3LTNC 4R8RA 5BNIA 4A0HA 5K4GA 1QVRA 5MN4A 1S2MA 1Y5LA 5IXJA 5KOJB 3X1WA 2L17A 1UBHS 5IKOA 2FMFA 3DJYA 4G67A 3NONA 5J4LA 1E2GA 5E95A 1BKDR 5BWMA 2D06A 2J4FA 3EISA 5FOQA 5AHRA 3S7TA 3U3JA 3PNOA 4FR2A 3GLIB 1MAUA 5K3SA 4OHCA 3PQ3A 3AV1B 4TTTS 3W34A 4YCJA 2QX8A 2JFFA 1N0UA 1P3OB 3TZBA 5DZSA 4KLZA 3UN1A 3AZJC 4N54A 3TF5A 4Z9FA 4LECA 3RIGA 4H3SA 3T5DA 5AVCB 2NSYA 4JC4A 5FH9A 2J41A 3NWBA 1E3WA 1OXKB 4ZCQA 3QELB 3ESRA 4ZEVA 2OM6A 3IC5A 5CB0A 4O29A 2YL2A 3U4GA 5AY8D 1RVV1 4KXUA 3TK1A 1E2FA 4IAOA 4WV3A 3IP7A 2ZJBA 5BW8A 3O90A 3MGSB 1PYOA 4JLVA 3W1WA 1I14A 1LBTA 4E15A 1CF2O 1TQDA 3NJ4A 2PL1A 3BWEA 1WCXA 3W99A 1MB4A 2OCAA 3GGJA 4KQGA 3SP1A 3KL4A 1G0OA 1P4JA 1BFDA 2AEMA 4MW0A 3L6UA 4FWBA 4UVIA 1QIIA 1JE0A 3A2LA 3N2EA 3ZTWA 2SKDA 5TQ0B 2C78A 2XYGA 1PBNA 1KJJA 3QU2A 1A82A 2UVPA 3BE6A 1XLVA 1PJZA 4KH0A 3WGTA 4BQPA 2V7QA 1USUA 5F9MA 4JP2A 3OEYA 4CCYA 3FNBA 5HR5A 3AHGA 2D1YA 2UXCB 2BJWA 5CLQA 3AFNA 5B4UA 3LHDA 1HFEL 2WDZA 3FH0A 3KQWA 3WJAA 3ENWA 3KWQB 4H0CA 5BNXA 1UQUA 4X00A 1W34A 3H3FA 4NE9A 3GJ6A 4A1OA 1ZNZA 2QHXA 3C4QA 4HVLA 3C1UA 4DMGA 2WE8A 2Q6VA 2WT8A 3PHHA 4Q1VA 3OX2A 1QVZA 5A9TA 3MMZA 2W6QA 3EMVA 5H81A 3HJNA 2B0JA 3CONA 1JBQA 2RHDA 4YAWA 2AROA 3Q7TA 3U26A 5EMJA 2W6JD 1S8FA 4QHTA 4RZ2A 2GD2A 4WNIA 3GP8A 4NE2A 1GYPA 4KQHA 4CLDA 3QXJA 5BN3B 3VH6T 2NXEA 2ZJ7A 1D0IA 3L5KA 3JPWA 3FLAA 4BNMA 4CV0A 4RPJA 4ERXA 3FTPA 2QGFA 4XYGA 3FHTA 2I1VB 2VJQA 1Z8NA 1TTQB 1JXOA 1KJYA 4UTOA 4BNZA 1Z6PA 1NBMD 4UBJA 3UKDA 5SICE 1MZPA 3QM1A 2EG5A 1CZNA 1RE0A 1KK0A 4L8YA 2F3SA 1VLHA 4MUGA 1VJDA 2AFIA 1F2DA 3RUDA 1KI6A 1IN6A 1MC8A 3KT3A 1SRRA 3DDZX 3KSZO 4G0MA 3HPRA 3DF9A 2J5BA 3KT6A 3VR4D 3EIQA 2BBOA 5DLPA 4I66A 5AI5A 4TXHA 2HZ7A 5BSEA 2BELA 2UKDA 4DV5B 1ZC3A 4HMQA 1EA7A 2E82A 4Y1FA 1SUIA 4WESA 3HJFA 3N6RA 2E4VA 2JJYA 5BV7A 4PINA 1VYHA 2D2IA 3I9LA 1YBVA 2EFGA 2RARA 2RDMA 2EVWX 4KREA 2I9PA 5KQLA 2FEKA 3IOBA 4B7CA 1LK0A 3ZQ6A 2YYAA 3B1FA 1CBUA 2I9KA 4RELA 3VU1A 4W8GA 1CUZA 4UCFA 5JS6A 3QMWA 5B37A 1CF4A 1GFSA 4G1FA 4FN4A 1KRXA 3UMSA 3H2YA 2QVBA 5C1PA 4AYWA 3TW8B 4IV5A 4DTCA 3CPSA 2FFFB 5ARCA 2F7SA 2ADMA 4RTKA 2X0FA 2PKQP 4MO9A 4XQEA 2ZWIA 4J29A 5B1MA 3U6BA 5KYXB 5AK0A 1SBHA 1G7CA 1II0A 3AZFA 2WABA 1Z6ZA 3HWSA 3KB6A 3LBAA 4RQUA 1A7WA 3WTPD 5AI6A 4HK4A 1VB5A 3UKOA 4RD6A 2WD7A 4KAAA 3L7LA 2VDUE 4JI2B 4NJOA 1GL3A 4GDMA 1NSYA 3K1YA 4WCFA 2ZKIA 4YJ3B 3BMQB 2DWCA 3GH3A 1QZXA 1YS7A 5ALNA 3W8NA 1X3LA 4BNGA 1Z2OX 1OMOA 1H2AS 4G56A 3BMOA 1P60A 4CKYA 3PENA 4O63O 1CF9A 1KYYA 5DHSA 2NT4A 5K3FB 1HURA 5JD5A 1OB2A 1G42A 3UJCA 3WIUA 4A73A 5ALZA 1PFKA 4LY0A 4JJ8A 4RD0A 1FL9A 2ZPAA 6REQB 2IOQA 3VTKA 2Z95A 2X41A 4YRFA 2N0SA 4FD2A 1Y5IA 3ACDA 3T4UA 5CT4A 3RHZA 1TECE 2YUTA 2AT1A 3ZZNA 3NPMA 1MA3A 2ZB7A 3I6BA 1TYCA 4BVLA 3HABA 2IYLD 3ESZA 5F3DA 4PO3X 1NIPA 3HVJA 3AZHA 5EN4A 4D9BA 2YBEA 4EUHA 4XFDA 3TL2A 2XTJA 2JAUA 3OIGA 4F1WA 1TCAA 3VNAA 2WA2A 3QFTA 1E58A 2Y2GA 1RHUA 3N75A 3X44A 1UKZA 2CK3D 4Y0AA 3UTBC 2HSWA 2BE7A 3P71T 4XGNA 2YS7A 1IH8A 2WICA 3OKAA 2H54A 1N8SA 1K4MA 1FP4A 4K2HA 1J56A 1JHMA 3V4LA 5T8KC 3TMYA 3G89A 2C9OA 3AFOA 4KE7A 2DP4E 3KJGA 5BMOA 3AUUA 1P3FD 2W6NA 4NV0A 3TXXA 1SCKA 4C3UA 4KNYA 2HJGA 2OQRA 4UM9D 1I33A 4W5QA 4K3UA 1OOEA 3LELD 1ZMBA 3REFA 2Y0EA 3RW9A 5KNBD 2GERA 1OPXA 1EIWA 3GG9A 2WZQA 4JX8A 4UD6A 4BX3A 2X8WA 4LRXA 1OFUA 2YINC 3Q7IA 5KHOC 2QN1A 4A82A 3JQBA 2ADOA 3KE9A 1PJ2A 4O4JF 4WY2A 2BD0A 3G1TA 2PYIA 3AY0A 4LN1A 4FT2A 4HATA 4Z66B 2VYFA 1NBIA 2G4LA 1NJ5A 4OP1A 3M0EA 3NHFA 3N28A 3BRQA 5JRGD 4XRRA 1RP1A 1T0IA 1ESEA 3D2CA 3EAFA 2DCUA 1WKCA 4HQNA 3QKSA 3BL8A 5E4YA 3QBVA 3R0JA 4JLAA 2MT9A 3RTAA 4AQDA 1U0TA 1W2GA 2JJMA 3JZDA 2LDXA 4GEKA 2ZJZA 3COWA 4YUWA 5DHFA 1O95A 3K4PA 2J7PA 4G24A 3EZ6A 2QX7A 4QBIA 3THYA 1L7BA 5I01A 4NMHA 2JVJA 4C4XA 5JV5A 4QJBA 1VI5A 2NO1A 2NV2B 3BIXA 5HKAA 1Q1GA 2EF0A 4EI8A 4BMZA 4AICA 1RI2A 3R4CA 1X7XB 2SNIE 3M2TA 5F1OA 4DMKA 1QKIA 3HU3A 1NW3A 2E1PA 3ASUA 2FZWA 4RF4A 3C8MA 3ZWWA 3CNQS 3WTPE 4BLSA 1RAFA 3Q1KA 1N1EA 2BF4A 2KBFA 4KUDB 4N65A 4ZVVA 4V1CB 4YLYA 2HUEC 2BIFA 1P0PA 1M5RA 3SR3A 4X97A 4U02A 5SZJA 4PC3A 4UMVA 5HF9A 2AZDA 1Q95A 2MSWA 3VDMA 3FWYA 4ESOA 4Y2HA 1DFIA 1Y3HA 3VNVA 2XYVA 5HPYB 3NRCA 3BILA 1LK5A 3P96A 1BKSB 4NBSA 4JVOA 3ENQA 4N6GA 5F2OA 1KSGA 4PX9A 3STYA 3ETEA 2J6HA 1IXKA 4FQ7A 3UJAA 1JN0A 3FFTA 4KQJA 4S1WA 4YVFA 4HNRA 4D2IA 4KMOA 3TR6A 1P3AD 3FVTA 1VSVA 1UP4A 1JLRA 1HT3A 2ZY2A 3PGVA 2YOHA 3UVEA 4FOSA 5L45A 1W49A 4FX2A 1GLGA 4ZUXB 1OV6A 4L5AA 1JKFA 5AKLA 1HTTA 1QYIA 4OQLA 3QVSA 3TBHA 4K6HA 1V1MB 3NQUB 2MJLA 4ND5A 2TECE 3ITKA 2AMLA 4WLVA 2C4KA 1P1FA 4BQOA 1JKMA 5A4KA 1WQ4A 1V4VA 2DUNA 5IEJA 1JHVA 2FPMA 1EUDA 4FMCF 4K6OA 4MINA 4L4ZA 1P2UA 3HM9A 4RMNA 2IY9A 3RS9A 4P3KA 4XWKA 4J8PA 1QV9A 3X2EA 4TX1A 4FILA 4L9SA 4D0NA 2ATEA 3VH5T 1UT8A 4PG5A 4TKZA 3E58A 5CPIC 2DECA 4LBYA 4EWLA 4IKEA 4YLEA 4MDFA 1Y7TA 1WBBA 5ALEA 2H1LA 4YPOA 4WU9A 2QTWB 4DPLA 5JCJD 3B6GC 3AFAB 4AS1A 4ZYVA 1ZMOA 5KO2A 5DNDA 5BUZA 1YD7A 1RFGE 5CPFA 5AM3A 1V3UA 4FYYA 3IQFA 4B82A 1AZLA 4B3IA 3RYTC 3GJ7A 2HF2A 1T4BA 3SHFA 4R1NA 3EHEA 3DZBA 1XLTC 1GRRA 4Q9HA 1VHWA 4EFDA 2V65A 1KJ9A 1PGJA 3I2GA 3BB3A 5AV8D 5FNZA 4OHFA 3UMYA 1XF1A 5TDHA 3PZBA 4QWWA 3AJ9A 3PPYA 3JD2A 4D3YA 3V1TC 5CFLA 4MR7A 2VTBA 1UMBB 1O6ZA 4EBBA 1JV2B 2B99A 1SXJB 1F48A 4OBWA 1R0SA 5KKCA 3UM9A 5FBWB 4IOMA 1BS2A 1M73E 4PCUA 5DHQA 3BH7A 3Q6IA 4E6PA 3JAKA 5J2UF 1N0VC 1M19D 1UC8A 4E5NA 4LJ9A 3WKBA 1G21A 1LC0A 2VQ3A 4TV8B 2BGMA 4BB0A 3U3RA 1MO3A 3TZCA 3GLGA 4DV1B 2HSGA 4J0JA 2ZEJA 3MS7A 2EC5A 4J2HA 2PXCA 4LZNA 4WKPA 4FIDA 2ZJ8A 1ISSA 4EH1A 5CR9A 4NE5A 3BWCA 4KGZA 2GZDA 5CH5A 1FX1A 4KI0A 3OQMA 5F99C 1W85A 3EHDA 3UT6A 2ZBQA 2H85A 1KSHA 3SDSA 1MQ9A 4MR8B 1N3YA 1SB9A 3MXOA 1YA4A 3AWIA 4Z0HO 3GRUA 2DBRA 3R2JA 4LZJA 4ZQIA 5AVSA 5FR2A 3AV2B 2DQZA 3IDOA 4OQEA 4DPKA 3I28A 3KCNA 1XTTA 3HCEA 4PE5B 3INGA 3SHQA 2OESA 2NPOA 3N2LA 1EM6A 2AC4A 2EL7A 1QRAA 1XDUA 1RRFA 4JWKA 3SMQA 1GNLA 4C3OB 3GRZA 5CLHA 1E7QA 2O0HA 3C7DB 3H2BA 4YMTA 5ALFA 1L5RA 1L7OA 1TLTA 4NQRA 3GAFA 3LPDA 3TZKA 4OB7A 5CP6C 3P1JA 1O3YA 2OSBA 3TNLA 2IUSA 1K8XB 1UPTA 3IVXA 1SVMA 5CPIA 5JE8A 3REJC 3R45B 5B2ID 5E2BA 1KJQA 3GJXC 2VJMB 1BX3A 2P40A 2OAGA 4IFEA 2ZSKA 1DP4A 4YQZA 2GH1A 3BK2A 5L3SB 5EE9A 4DQYB 3UY4A 2ZRCA 3ETCA 3G5AA 3T3MB 2VDLB 2ZRAA 1UBUS 1CERA 1THZA 1WCV1 1ZH2A 3JQGB 2O05A 5AKEA 2Q4DA 2PMWB 3L7KA 1TUEA 3RFFA 3TFWA 4B6EA 1XT6A 1OY1A 2HJHA 2QNIA 1K0UA 2HIOB 1KWGA 2HMYB 1DFHA 1D03A 2PX5A 4OOFA 5I5GA 4BLTA 4H1TA 1KK1A 4AY6A 4IQFA 2FP4B 3QV1A 2V5VA 2YJ4A 3EN0A 3DO8A 1USKA 1HOTA 5JDCC 2LP4Y 1EIZA 1R66A 3AZMD 4GPAA 3UT9B 1BHQ1 1PX2A 1RWXA 5LC1A 5FOVA 4B8WA 2CJFA 3HSSA 5CT8A 2IIQA 2AR0A 1I5OA 4DKXA 3RSOA 5AV6C 5AV5C 3JYLA 1X3SA 3OURA 1ZOOA 4TWRA 4DNXA 1IQUA 3DE4X 2ZR7A 3UWDA 4W9NA 3EC1A 4LZWA 5KIAA 1I2DA 2J9FA 3SF8A 5CJ2A 2C97A 1IVYA 1JEQB 1VHTA 1OAAA 2CB0A 2IF0A 3G68A 2GFHA 2BZSA 3ISVA 3J81A 2GDJA 1MF7A 4Q3LA 1AK2A 1YASA 1T5OA 5F99A 1Z4KA 2DFTA 3KTOA 1YZLA 3O84A 4QG3A 3E9DA 5THQA 3UMMA 2X7XA 2HO5A 4JQZA 1JB1A 3QEAZ 1PFYA 2P4SA 3A36A 1VJCA 1DAHA 2PKQO 3IEKA 1JNXX 1M7GA 4A0FA 2WJ4A 4K3VA 4DOMA 4OLJA 3GYBA 5AJTA 3HKEB 4ER6A 1NZJA 2QPLA 3PCRB 4EDHA 3PXEA 5LIPA 2J0UB 1C2YA 4MRMA 3LHFA 3LY7A 5C37A 4DUZB 3E3MA 3GW8A 1K27A 3V1MA 3QVTA 5JNWA 2ERXA 1GGHA 3L5OA 3UC9A 2WTEA 1CE8B 4AJ4A 2WYIA 3AUXA 1CJCA 4KRXA 4NBUA 3L93A 3HDTA 3H9GA 3ICQB 4EEKA 4KLRA 1MXHA 2BYKA 1RZ3A 4DA4A 3IUSA 4RZIA 3D0RA 4HDCA 1EUCB 2EOAA 4LHZA 4Z4FA 3ONEA 3JVUA 3T6KA 4G5FA 2H7XA 1G4HA 4IUCS 3A4VA 2J45A 3LCVB 3WICA 4AYTA 2WV7A 1G5TA 1P3GB 5B2JA 1NURA 2ZIXA 2C8VA 3ACCA 4HL6A 2GK4A 1J0EA 5GADl 4MUNA 2B3TA 4XYLA 4K8RB 2QJFA 4P3OA 4KE9A 2ZUUA 4GLFA 5EHNA 3TINA 3RLFA 2D4HA 3AR6A 3X1VD 2L42A 3E9ZA 3PJEA 4H6VA 3G5TA 2J9XB 4R1LA 2NM0A 3VH3A 2HHCA 4N82A 4D92A 1E6CA 4L73A 3ZWKA 1QONA 4WBNA 3R3ZA 3AZID 2MSCB 1ADCA 1XV5A 1JG3A 1G38A 5JVDF 4NX2A 4XPIA 4FYWA 3AF2A 4IDPA 3ZD9A 1XZHA 1ZCZA 2MTBA 3WAAC 4FYIA 1BJRE 2M6LA 1H69A 1XNGA 4LQCA 1IE3A 3MJHA 4EBFA 1V5FA 5EZSA 4M1EA 5A3VA 2Y92A 4LXYA 2NZUG 3V4OA 1JH9A 4F9FA 1DO2A 3INTA 5IG2A 1E3QA 2RGUA 2ZUBA 3G0GA 5C31A 4C2BA 3W2IA 6LDHA 5FJIA 3W6NA 4XUCA 2FWRA 1R15A 5H82A 4UJ5A 2IXGA 2GBPA 1L1QA 1XR3A 5IBCA 2Q2OA 1QGAA 4IIUA 1JHDA 2ACEA 1NGSA 4RO0A 3RRFA 4M1QA 2LBPA 1PNVA 1LDYA 4PLYA 3DNMA 4MW9A 2YFVA 3TB6A 4LRUA 2H48A 3ZHRA 3RYFA 1YI8A 3K9BA 5KX5A 2UWXA 1QKJA 1X7YB 1HDEA 3OKFA 1RLUA 2VBIA 3MUFA 1XWWA 1U7ZA 4YRLA 2ZKLA 4R8VA 4JHXA 5KYUA 3GDHA 3AETA 2LIPA 2NSDA 2J7KA 3O9ZA 5G0TA 3RVOA 2PMKA 2CHVA 3A6GA 5HRUA 1XRNA 4ZGWA 1T4DA 3R3UA 2RHHA 2DY1A 3AZGD 3K0AA 1M54A 2WAOA 1UDAA 2G4CA 3ZWBA 1I01A 4LNAA 2ZYWX 3GPLA 1O6FA 4Q6WA 3FFWA 4C4PA 2IHNA 4PLHA 2FQYA 2JS7A 3FYUB 5B32B 1ZWLA 2PMDA 1CEXA 5BW5A 2NN3C 1QPZA 3LBYA 3NBXX 3WA9D 2REXB 4IW3B 2XT9A 3R0QA 3KBBA 1Z5OA 2NTEA 5CAEB 3KUDA 2YV3A 1JEOA 1TYEB 3A9RA 3Q15C 1Z0KA 3V9PA 2JKZA 4BO6A 3C14C 4CBVA 1TT5B 4KXYA 2P9FA 4ZMSA 1XQ1A 3MTGA 4UPDA 2NG1A 3KDSE 3BS4A 2AR7A 3ZE0B 2FDRA 1S1MA 1HI9A 4FFPA 2X0KA 2W8ZA 1ZYUA 2EARA 1PNOA 1YKFA 3VYRB 3F8TA 3GF4A 4HDRA 6GPBA 2W6IA 4L3OA 3UK6A 1XMPA 4QXRA 2C5GA 2W2NA 4ZP1A 3U16A 4LV6A 5TJ9A 3G2PA 1O0CA 5JNUA 3VR5D 4ZOLB 3T3DA 4DRAA 2OXCA 2WJJA 3ESYA 2J3LA 1G0NA 3ND6A 3X43A 3PUKA 3T35A 4UAJA 1TA9A 2O4UX 2YMQA 1ZM4A 4GPBA 4EM6A 4IIGA 3E5NA 1P61B 1NRWA 3L82B 4V0NA 1YC5A 1KI2A 4WW0A 4AJPA 2IHJA 2YRXA 1KEPA 1KX3C 2P9QA 3O8QB 3VV2A 1WXQA 1EM8A 4MQEA 1QRRA 721PA 1GWNA 1CG6A 2WVHA 5DGXA 1KNQA 3TNJA 2GXSA 2I8LA 2HDWA 4QBFA 5B2FA 5DLEA 1QGED 5DU2A 5EJ4A 5AKYA 3RREA