2ZM5A

Crystal structure of trna modification enzyme miaa in the complex with trna(phe)
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
306
structure length
306
Chain Sequence
b'LPKAIFLMGPTASGKTALAIELRKILPVELISVDSALIYKGMDIGTAKPNAEELLAAPHRLLDIRDPSQAYSAADFRRDALAEMADITAAGRIPLLVGGTMLYFKALLEGLSPLPSADPEVRARIEQQAAEQGWESLHRQLQEVDPVAAARIHPNDPQRLSRALEVFFISGKTLTELTQTSGDALPYQVHQFAIAPASRELLHQRIEQRFHQMLASGFEAEVRALFARGDLHTDLPSIRCVGYRQMWSYLEGEISYDEMVYRGVCATRQLAKRQITWLRGWEGVHWLDSEKPEQARDEVLQVVGAI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords tRNA delta(2)-isopentenylpyrophosphate transferase
publication title Snapshots of dynamics in synthesizing N(6)-isopentenyladenosine at the tRNA anticodon
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase/rna
total genus 92
structure length 306
sequence length 306
chains with identical sequence B
ec nomenclature ec 2.5.1.75: tRNA dimethylallyltransferase.
pdb deposition date 2008-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01715 IPPT IPP transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.140 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 2zm5A02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2zm5A01
4LY6A 1XPRA 4U5XA 1FNNA 2AXPA 2GEVA 2ZRPA 3CX7A 4DCSA 2GVZC 3HJNA 3MAAC 3TQFA 4X8MA 3RS2A 2JLWA 3LX8A 3Q8XB 4GPTA 1J90A 1W36D 1E1QA 1JAIA 2GJSA 2H16A 2Q3HA 3I1FA 4HDQB 2ZSAA 4V02A 5CIQA 4OBEA 1TF7A 2JJ2D 1PZNA 3ADKA 3C4JA 2ZUDA 4FMDB 4DB2A 4TMTA 1W46A 1QG4A 4BECA 4EJSC 2CNWD 3ZZTA 3ZZUA 5KSZA 3KKMA 5FOXA 1GKIA 5HE8A 4N1AA 3I62A 4Z1MA 1G3IA 3RC8A 3W8RA 4GMXA 1OH8A 4Q4AA 2IS2A 1DOAA 2BBWA 5E95A 2ANCA 1AZSC 4TZ6A 4V0MA 2FPMA 2CLCX 1ZM4A 4MITA 1HT2E 3AF3A 2NPFA 2QG6A 3LQRA 5HCIA 1E2FA 4XH9B 5JMTA 5C46F 5D3MB 4AC9A 1CBUA 1DE0A 3AKCA 1Q1ZA 3CX8A 4HB3A 1F48A 2OM2A 4TYQA 4A4DA 2RGNC 3LXRA 4WXPA 1Z2AA 5B30A 1DPFA 3GEHA 5GJCA 1G19A 1WF3A 1ZNYA 3KXLA 2VP4A 5FPSA 3WNCA 1XWIA 2IYLD 3L8YA 4NP6A 5EP2A 2XTNA 3KTAA 4KSBA 4NU0A 3GP8A 2IYUA 3Q5EA 2ZRIA 4YMSA 3GJ0A 3L2OB 1O87A 3MLEA 2CHQA 4PHGA 4RD1A 3TK1A 2ODEA 3LD9A 3VR5A 4P4SA 1TQ6A 3FE2A 3HDTA 3K9LA 5B58C 2WM9B 4TTPA 1ZJ6A 2AFHE 3QOFA 4W5WA 2PCJA 2PT5A 1GRQA 1W0JD 3PVSA 3N5CA 5DI9A 1XD2A 5FOUA 3I4LA 1E9DA 2ZS7A 4W5JA 1CR4A 2NOAA 5H68A 2JLUA 1S3GA 1TTTA 1G18A 1TUIA 2ZR0A 3H84A 2CNWA 4WVFA 4RJLA 3KQKA 5DN6A 2NZ8A 1P9NA 3I92A 1VCOA 1DELA 4BGDA 3BORA 1L2TA 1ZD1A 3C7KA 1W4BA 1YRBA 2JGNA 2VRWA 1RJ9B 1IN4A 4DRZA 1IY0A 2DFLA 2QMHA 2QN6A 2ZRNA 3B6EA 1EWRA 2V8OA 3EARA 4IKEA 1KMHA 1TU3A 4FWTA 1E9BA 5FL7A 3NEJA 1UBEA 4LRWA 3SYKA 1Z06A 1T4GA 5EP1A 2ZJZA 4DC9A 2BEKA 5CB6A 3FVQA 2FNAA 3BERA 2NO6A 3KB1A 2MSDB 3B5JA 4QC2A 4C0BA 4UKDA 1YJ5A 2KB0A 2Z43A 2OFXA 4AWXA 2J7PD 2QGNA 3BC1A 3AVQA 4N0DA 3BJIC 2ZS8A 4Q7MB 1UKVY 3PUZA 1BKDR 2EFDB 4JT2A 1NMYA 3DM5A 4LHVA 1OHHD 4MYUA 2CLSA 3VU9A 1I4DD 2IEYA 2YOHA 4WAUA 3ZS8A 2PMKA 2VSXA 4LYAA 4Q47A 4EKDA 4BWYA 3X1ZA 2MSEB 4URZR 2BKUA 3DO6A 2IX3A 3TGPA 1DARA 2FEMA 1VECA 4QM7A 5LPNA 4Q4HB 2HV8A 4KYIB 5G40A 4RZXA 1EGAA 1IQPA 1M7BA 4NPHA 4NYIR 3BBPA 1XXHE 2YYZA 5DI3A 1RYHA 5FPTA 4EQ6A 3GJ4A 1FUUA 1WDTA 4F4IA 4A6PA 5KNCA 1PLKA 5KOYA 2EWWA 4BEBA 2ERXA 1H8HA 4JJZA 2G9NA 2ZSFA 4FWIB 4BLRA 4DDTA 1SZPA 1E9AA 2KWIA 4BFZA 4ABYA 4PFSA 3BB4A 3WBKA 1NVWQ 2MSCB 2IBMA 5JHHB 1ZRHA 2VP6A 3VMFA 3ASYA 4ZIRB 1T0JB 2YZ2A 5FBWB 2WICA 5LD2B 2ZR7A 3L43A 1HQYE 3OEHD 3TSOA 2GNOA 4D0NA 1P9WA 3U3MA 1X8KA 5CYOA 3LX5A 1M74A 4MKFA 1XD9A 1EFHA 1V43A 2QU8A 2P2LA 1W4CA 2JCSA 2AK2A 4EAQA 1Z6XA 2IYSA 2YWEA 4ARZA 1AIPA 2J7PA 4Z51A 2W6IA 2WSSD 1JXOA 1WXQA 2DYKA 1JI0A 1OHHA 3LBNA 3WYGA 1SKQA 1G3RA 2W58A 3W3ZB 1Z6AA 1P2VA 1SVMA 3DPUA 4O0MA 3HU1A 4ZDIA 1KAOA 4XD7D 4ZV4A 1LNZA 5KDOA 2BOVA 2XSZA 3RAPR 1RE0A 1UDWA 3R8FA 3QXSA 1XD8A 3D6TB 3HP1A 2XXAB 1MT0A 2WOJA 4MYTA 4WW0A 1ETUA 4ZCLA 1G8HA 2PEYA 3R7WA 5C2JB 4Q1DA 2OBNA 1G41A 2JLXA 1B0UA 2GEDA 1ESMA 1NBMD 1VPLA 4DSTA 1W1WA 2WIAA 3WMFA 1WE2A 2CHGA 3UG7A 2JJ8A 3CNLA 1AK2A 1OFIA 2G6BA 1E2LA 2HCJB 4DIEA 1OXTA 1R5NA 5CITA 2EU8A 1E2EA 1TQ2A 2WJVA 4R2IA 4BFSA 3Q85A 2JDID 2VP2A 2OLKA 4QRHA 2IWRA 1EFCA 3RWOA 1ZMXA 4M1YA 5DH9A 421PA 2DBYA 2YWHA 1Z3IX 5E3HA 2C99A 4LC1A 1DEKA 4D80A 4G5RA 2O8EA 1T8TA 721PA 5E7JA 2O8BB 4PO8A 4GFDA 4E5UA 2WSSA 2PLRA 3IPYA 4TMVA 5JWHA 2O8FA 4NHOA 1JR3D 2A3RA 4BQSA 4RD6A 3GLGB 1JEEA 2VO1A 4LJ5A 1T5LA 2QNRA 3THYA 1D9XA 1DAMA 1OV4A 3MCAA 5SZJA 1UEJA 1CULC 1CJVC 1E94E 1KI1A 2FOLA 3M4YA 5AJWA 1T3LA 4TTRA 3VNUA 1QDEA 1CR1A 2OXRA 1ANKA 3R9XA 2GXAA 3W90A 1OFTA 1KZGB 2FU5C 2OCPA 5EXXA 2WJYA 1UFQA 2JATA 3CF2A 3I8XA 5IT5A 4TN1A 1TADA 1VG9B 3GFPA 4HAYA 1QHNA 2ZJ8A 3AKYA 4JLNA 4FCWA 3SHFA 1W0KD 4JLMA 3CRVA 1XF9A 1PUIA 1KI7A 4IDHA 2QM7A 1RC8A 2EW1A 2ZVPX 4ZI2A 1DG3A 2JDIA 3NHBA 3OESA 2F43A 2V7QA 5GVSA 3SC3A 2IYVA 2WSMA 1P5ZB 1FTNA 1OIWA 3KQLA 1G3UA 4CGZA 1AJEA 4JVMA 3T35A 3F3YA 2NTYC 4PAMA 2WV9A 1QG2A 3C15C 2ZUBA 5H70A 1FW6A 2YJTD 2H1LA 4Q4JB 5KHOC 1L7VC 4NYMR 1OH7A 1IY2A 5FL3A 1LTQA 4PR0A 4RKEA 4OL0A 1XCPA 2XGJA 5K8UA 1VG8A 2GVDC 1KDTA 4A15A 4O3MA 3B78A 3AUXA 3AVVA 2OBLA 1ZM3A 1S96A 4HAWA 3GJ5A 4IXNA 4B6FA 3V9PA 4Q9KA 4PAQA 4B48A 1KO5A 3K53A 2WAXA 1Q1QA 2RGEA 2NZJA 2WMOB 4NONA 5AJVB 3LA6A 3NH9A 5G3YA 1S9HA 2ZRGA 3RSLA 3W5IA 3HR7A 1NRJB 3QBTA 3C41J 1IN5A 3RC3A 4XVRA 1N0UA 2UZ3A 1FMLA 5JRJA 5L3SB 4B3BA 3AVTA 2A78A 1XEXB 3A1TA 4Q1BA 3RRNA 8OHMA 1J2JA 4TYYA 1OFHA 1W0KA 3FMPB 3LXXA 1KMQA 4IEEA 5JRZA 5AUPB 1UJ2A 3PCRB 4V0KA 1KI3A 1XB2A 3IUYA 4I99A 1VHLA 3FPAA 3LFUA 4EFNA 2D62A 1N6NA 4CEHB 2VQSA 5J40A 1Z22A 5L3VA 2WIBA 1L4UA 1ODFA 4QGFA 4M21A 5EE0A 2JLSA 1W47A 4IEIA 1OFUX 1C1YA 2GJAA 1JBKA 3Q5DA 5D3MA 3U2QA 4Q18A 1RRFA 1W5TA 3DZ8A 3LDAA 4HYYA 1U0LA 2ZJ2A 3QQ5A 4HB4A 3P32A 2ZE5A 4US2R 4PZZA 3LVRE 3NH6A 5FR2A 4DCNA 3NC1C 2HYDA 5EE1A 4DLUA 1AN0A 1WP9A 1SVWA 2WWIA 1OKKD 4W7SA 2BM0A 2OEPA 4NCNA 3O8DA 1VCMA 2PJZA 5J4KA 1HQCA 3WYFA 3PEYA 2D06A 4JYCA 5J4HA 1XP8A 3TAHA 2FV8A 4FD2A 2BMJA 1R2QA 3QBVA 2O8DB 2GJKA 2ZRDA 2PZFA 1Q3TA 2ZSDA 1KK2A 4A82A 4BFVA 2FMXA 2QZ4A 5IDVA 5IHPA 1MKYA 4II7A 1MH1A 1X1SA 5EXPA 1TAGA 2ZE8A 1SVIA 1Z83A 1IONA 5DGXA 4NCJA 4D0GA 1OYWA 2XZPA 3A4NA 3OEED 2Q3FA 4ESHA 2G0NA 4NKRA 1S4QA 1RJ9A 5BW8A 2GAOA 2CLDX 4GNKA 2LKDA 2W2VA 4KJZA 2F3TA 4PC1A 3A6PC 2WWWA 4ESVA 1NG1A 2FFAA 4P4TA 4LUCA 1BYIA 1QZXA 2GK6A 3Q7QA 4MRNA 5SZHB 2REXB 4QOSA 5EE3A 2GCNA 1PLJA 2GJ9A 2Q9AA 3KXIA 3TSZA 3U4QB 1F6BA 1D6JA 2IW3A 1HUQA 4B34A 2YV5A 5B57C 2ZRCA 1TQ4A 4C0KA 1N6HA 3KQHA 1MV5A 4Q00A 3RS5A 2C2HA 4JLPA 2ATVA 3H2YA 4OK6A 3LVQE 5F9FA 1OKKA 2HLDA 4B3GA 1MOZA 1KY3A 1GKYA 1OLOA 2DR3A 2H18A 2WKPA 4FMCF 4DVGA 2EVWX 1XMSA 3EZ7A 4GDFA 4IHQA 4P4UA 2IXEA 2DWPA 4XOIA 3C16C 4RVCA 4KFTA 1J70A 4DLZA 1RRPA 1YZTA 4QFMA 3RS4A 1SXJE 4DSUA 1X8LA 4OQLA 3EX7C 2GTPA 4JLAA 3MWYW 3FHCB 3IEVA 4A2WA 1KJZA 3AF1A 1DTSA 2C95A 1NSFA 4KHZA 3U7GA 1TMKA 3FFAA 1G7RA 3ECCA 4IDNA 4M53A 3OE7D 3B1YA 3BH7A 2JASA 5FI0B 3DM9B 121PA 2RCNA 4KLZA 1A1VA 2TMKA 4KI0A 5FUYA 5A5GA 1AQYA 2VHUA 3AB3A 4FINA 4RFSA 5FOVA 1XJ0A 1XEWX 2CXXA 2WKQA 4I1VA 1U8AA 4ZIRA 5BN4A 2BMDA 1N0VC 5KPDA 1OB2A 4MRSA 3EW9A 2IS4A 1R0ZA 2NQ2C 4ERNA 4AYTA 5CB8A 3QY0A 3RRYA 2QL6A 4IOJA 2QTVB 2XNDD 3BIFA 1ESNA 5L3QB 1RPZA 3UMRA 1G7CA 5AUOB 2JJ1D 3NBZC 1Y3AA 2PX0A 2QE7D 3LQQA 3U3JA 1P2SA 3KFVA 1YHNA 4Q1EA 3ZQ6A 4V0LA 1PV4A 1CJTC 3I3SR 1DVRA 2DFKB 1NG9A 2VSOA 3AP1A 3HR8A 5CLQA 4F38A 4OHYA 5SZKB 1J8MF 3SJBA 4NYJQ 5KNBA 1KYIA 4Q66C 3UANA 3CPEA 3ZZ0A 4LBWA 1E96A 4X8HA 4BFYA 5E7MA 1KHTA 1E0AA 4XJXA 3EG5A 3B8HA 3FMIA 1YVDA 3ZS9A 2VP0A 4XIGS 4YXWD 2XJ9A 1WB9A 3B82A 1ZP6A 3AP2A 3RYTC 2XXAA 4YDSA 3CWQA 2QM8A 2JIZD 2GEUA 2C9CA 2Z4RA 4M1TA 2WWFA 4EIWA 4DXAA 1KI9A 3GD7A 3F0TA 3P27A 1YZQA 4J0QA 3OE7A 1LB1B 1M2OB 2Z6VA 5JEEA 1COWD 2IF0A 3PXGA 2P3SA 1W48A 2JLRA 5F3WB 4ZCIA 1UDXA 2EFGA 1Q44A 4MRRA 4OQXA 2WWHA 1U94A 1N25A 1JQJC 1NLFA 4GT1A 4NZYA 3FHTA 2J45A 3SHWA 2ZE7A 1II8B 2GAAA 3EXAA 1SQ5A 1AKYA 2UVQA 4FW9A 4GOKA 4DLYA 2FN4A 2V55B 2IK8A 2J41A 3CR8A 4OK3A 5JJIA 1XMIA 3BK7A 2ZU6A 1ZIPA 1GRNA 2JJ1A 4LI0A 1LV7A 4GBMA 4TLDA 4LJAA 2QE7A 3DL0A 2GJ8A 2Z5FA 3FKSD 1R0XA 2O8BA 4M1KA 2G88A 2O0JA 4M22A 4LSGA 4Q7KA 2J7KA 5CLLA 3WHKA 1X8JA 1DBSA 3A4LA 4GP7A 5A4JA 2XZLA 3FFBA 1JEDA 3THOA 3JZMA 3ZGXA 3GLGA 3B2EA 3B1ZA 1IXZA 1E3MA 2VLIA 5AJZA 2WOOA 4C7OB 4A6XA 3FOZA 1Q21A 4RZUA 4QNMA 1MABB 1UKYA 3ADBA 1LS1A 1XTRA 2JIZA 2C03A 5FOTA 4QGHA 1G7SA 1CR2A 4Q03A 5GJWC 1N6LA 1QBKC 1Z0JA 4URYR 1WBBA 4DLXA 4JZKA 1FL9A 2Z4SA 3D8BA 3CONA 1TEXA 5F9HA 1COWA 4ACAA 4O2RA 3LBIA 1K6MA 4POAA 4U02A 3VKWA 5JECA 4ZDKA 2WHXA 4GOJA 1C4OA 4HLUC 2OCBA 4NE2A 3KJHA 3KKQA 4ZKEA 3X1XA 3EC1A 3WNDA 2FH5B 1A82A 1ZAKA 2PCLA 2HF8A 1ZCBA 2XTMA 3CRQA 4KFUA 4OQNA 2DWOA 3I5XA 4JYBA 4ON9A 5JJKA 5TARA 4HDCA 1G6OA 4QGAA 3ZJYA 4OHVA 3FKSA 1W4RA 3K0AA 1CLUA 1ZC3A 4Q4JA 1ZNZA 2ZYWX 1XMVA 2PEZA 4TMKA 2QQEA 4IVQA 3BXZA 4DDWA 3T15A 1KO4A 2YINC 4XVUA 4AIIA 3LW7A 4EFMA 3K9NA 5KPJA 1E79D 3QSYA 2BVNA 4RFVA 1XFAA 4JT4A 3WYAA 5LD2C 2IHBA 4PZYA 5FI1B 2J5XA 4WA7A 3GJ6A 1BS1A 4URVR 5K8LA 2F6RA 3DHWC 4OQFA 5HKKD 1N6RA 3D3QA 2D2FA 5EQTA 1GNRA 2B7CA 1T3SA 3FWYA 1E2KA 4DIDA 3X1WA 4F93B 4L4UA 5L3SA 3AVOA 1XEXA 3CO5A 3PUWA 3QVUA 4V0ME 3AVPA 3K9GA 1GP2A 1IOZA 2ZSEA 3IIKA 3CX6A 4P0TA 5FTLA 3W5JA 1EFRD 2GBLC 5FTNA 2F1HA 2G0TA 4M8NE 2RKOA 2VHTA 4IFBA 5BN3A 5CIWA 3L0OA 3Q3JB 2BBTA 5KTYA 1N6OA 4CEHA 2A2ZA 1EFTA 4ASUD 4OQMA 2OO7A 1G4UR 3RS7A 4YQFA 5KSYA 2VHQA 2BMEA 1KAGA 3QPVA 5K8IA 1M7GA 2HT1A 5AJYA 3RS3A 1JNYA 3SBEA 2CJWB 2ZJBA 1Z0FA 2FX3A 3I32A 5F2EA 3K70C 3UMFA 1L8QA 1R4AA 2VP9A 1N3BA 1BOFA 2JJ2A 5JS8A 3D7MA 2R6CA 2J0SA 2H7VA 3ICEA 1IN8A 3NIBA 1KDRA 1XTIA 3VHLB 1E79A 521PA 5A0FA 2WZQA 3F5FA 4D2IA 1CJMA 2Q21A 2ZRAA 4MGZR 3RSOA 3GLFB 1JQLB 3KUDA 1KSGA 2C9OA 5FBVB 5KDLA 4P33A 3ICQB 1BO6A 4MKGA 3GLIA 2B8WA 4TZ0A 1E2JA 3PUXA 4E03A 3MGCA 2O8DA 2ZQ5A 3PQCA 4FXPA 3SJCA 3DKPA 4D81A 3DOFA 2YNMA 2UKDA 4HLCA 1NJFA 4PX9A 3KL4A 3G0HA 1R6BX 3PENA 3C8UA 4TL8A 2FPLA 3EIEA 4RKFA 1IXSB 4EPRA 5EUMA 2R6FA 4JLBA 3SZRA 3VTKA 5HCNA 1E1RD 1M8PA 1EFRA 1ZUNB 4F91B 1OT3A 3CF6R 1F3OA 2REOA 1PJRA 2X8AA 2F1IA 4DT1B 3GLHB 3UPUA 1S0UA 3QPWA 2DFTA 5TDHA 2JLQA 2ZUCA 3P4XA 4QKQA 1U0JA 4MRPA 2QP3A 5GJVC 4BUJA 4G1UC 2ORWA 3ZQJA 3TBKA 2IHYA 2EFHB 4MGIR 2V6JA 3VR6A 1S8FA 2FSHA 1PVOA 2DY1A 4LWZA 1XCGB 4E07A 3RANA 3MUFA 3S1AB 5FPYA 2GKSA 4Q7JB 2VHCA 1EFUA 4RD0A 4W5HA 4GZLA 1X1RA 4TLBA 1E69A 1AM4D 1NVXQ 2ZR9A 1W0JA 3U4QA 1Q22A 3KJEA 4TYNA 4Z8XA 1Q1BA 3SS8A 1R0WA 2YWFA 2RHDA 4AKEA 3TKLA 4A8JB 1KKLA 4HI0E 2GCPA 3THXB 1YZKA 3U3KA 2R9VA 4R98A 2H57A 5CYPA 2QBYB 4AG5A 4MRVA 4PHTA 4MGKR 1F2TB 5TY0A 2X19A 4BE7B 2KBEA 3V4RA 2VEDA 4RCZA 3B60A 4L16A 4FCTA 4RD2A 3V00A 1CRPA 1VG0B 1HV8A 4V0NA 3W9YA 4JJKA 1DAIA 4DCUA 1ZUIA 1S2MA 1ZM2A 1R5BA 3GJ7A 4RD4A 3WP0A 4PO1A 4YMTA 3MJHA 2PH1A 1IN6A 1WMSA 3AQ4A 4PSAA 2VF8A 4MGYR 3P1JA 4LJ9A 4OYHA 2HCBA 4LJ6A 1S9DA 5C1BA 4G3XA 1P75A 2YWGA 4DLSA 4DLTA 5JEDA 2BC9A 1W49A 2BBOA 1KSHA 2HT6A 2FFBA 5AUNB 1T5IA 4IW3B 2P6RA 3QG5A 3CKLA 3D31A 1ZD8A 1Z6YA 3WXMA 4B76A 3TVTA 1D2EA 1KI2A 1GAJA 3PV0A 1EK0A 4JMPA 1U8YA 5L3QA 5AJXA 4LV6A 1NL3A 3IBYA 1KY2A 3ZIAD 4HEJA 5B2ZA 3KQNA 1MRSA 1VKJA 1Q3HA 4G5GA 1A2KC 2A5YB 2GF9A 3EA0A 3UATA 3EPJA 2WAYA 4B35A 4XWAA 4I81A 4XSHA 5J4VA 5BQ5A 2KBFA 4WIAA 1C9KA 4TL6A 3TRFA 4EPTA 2O8CB 3G5UA 1A2BA 1W36C 3X1YA 3VR2A 3OEHA 4BRWA 1E4VA 3U61B 2DCUA 4IOLA 2ZJ5A 3BFKA 1AS0A 2CL7X 4FMCB 4PPGA 4EPYA 4C2UA 5J5CA 4BLQA 3DMDA 4NCIA 4A0RA 4US1R 1XTQA 1NMZA 2I3BA 1U2RA 3LH5A 1YR9A 1AKEA 2NO9A 3ADCA 3VR3A 3ZLJA 5C18A 1E2GA 3IIJA 5GVRA 1YU9A 2IEZA 3N2EA 3QJYA 1XX6A 2ZI4A 2QQ0A 2QPAA 3I73A 4KV9A 3RS0A 4BASA 3SJAA 4DWJA 1D8TA 2OV2A 3X1DA 1II8A 4NYIQ 1WQ1R 2F1RA 4XD7A 2QY9A 4I4LA 1VYUA 4Z8YA 5EZ5A 2E87A 4FIDA 1YE8A 1ONBA 3PUYA 2OILA 2OFOA 5FBRB 1FX0B 3CR7A 1U8ZA 1XZPA 2P6NA 2CMKA 4JLOA 3OAAD 3ZIAA 3AGQA 4D4KA 3ADDA 4HZIA 3UIEA 4K46A 3IBGA 4B3XA 1NBMA 2EFEB 4TSFD 1DAGA 3U6BA 2ZRMA 4HATA 1F2UB 5ELXA 1M34E 4ZCMA 3LO5A 1N6KA 3LNCA 1LF5A 4HSEA 1RVDA 3QKTA 4UNRA 1CXZA 1NBME 5H8WA 2CDNA 4C7OA 2AK3A 1XEWY 2KI5A 3ZH9B 2OCYC 2AWNA 2VSFA 4G5SA 2IYXA 1SVKA 1JXMA 3REGA 1G17A 1MABA 2WWGA 2ORVA 3UKDA 2ZI5A 3IGFA 3ZD7A 1ZVQA 3A4MA 4QGGA 2QP4A 1EXMA 3X2SA 2A5JA 4N3NA 4W9MC 1QHHB 2P65A 1J8YF 1OF1A 4PZLA 5KDDA 4OI0A 2G83A 4XWOA 2XZOA 2W00A 2J1LA 3FMOB 4PPFA 3TAUA 1LW7A 4IXMA 3R9IA 1UBCA 4KYUA 1GG2A 5CK5A 1NJGA 3NHAA 4C30A 2V54A 1E2QA 4BFUA 2QT1A 1JECA 4KBFA 1AA9A 2PLFA 2RGXA 1JR3A 3T5DA 1WBDA 2OUKA 4DLRA 3KQUA 3BS4A 1XDBA 1FP6A 2XJ4A 3WRYC 3EPLA 2P5SA 3CWZA 1RW4A 4JSTA 1NSTA 4B3DA 2GWHA 2ZI3A 4NCHA 1NLZA 3OAAA 2XITA 2ZRHA 2ZROA 3OHMA 2HYIC 4A9AA 3U3RA 1ZBDA 1G291 4CYMA 2XX3A 1NVVR 3BH0A 4TSFA 2DHRA 1XU4A 2QMEA 2XOKD 2ZRFA 2QMUA 4FCVA 4S2EA 4DEYA 1RRCA 1NNEA 5B64A 3SFZA 1I2DA 1X3SA 3EIQA 4QM6A 4AKHA 3SE0A 4JL6A 2F9MA 3CRRA 2B92A 1LF0A 5FTJA 5LBIA 2SHKA 1G7TA 5L8VA 1M1YE 2I1QA 5TXGA 4DCTA 4BZXA 1P60A 3LBHA 1G16A 5FTMA 4DDUA 3FKQA 4LJYA 1AGPA 3T5GA 3NEYA 1YQTA 1YR8A 2EQBA 1FMJA 3AGPA 1AS2A 1P7CA 2YC2C 1GL6A 1KK0A 2OXCA 1N0WA 3FB4A 1UPTA 1FUKA 1P9RA 2KSQA 4UJ5A 4WXRA 3ZDQA 3A1VA 2C98A 3MFYA 3H4MA 1H8ED 2D2EA 2QTHA 3K09A 1P61B 4HAZA 4JS0A 4P31A 3T61A 3SN6A 5CDFA 3TQCA 4BZPA 2BMFA 2O52A 3BOSA 3KZ1E 4DB4A 4KVAA 2HJVA 4RD3A 4QNRA 4XTRA 1DADA 1YR6A 4C2TA 4OJQA 4IFEA 5FFMA 3VKHA 3P26A 2QP9X 1K5DA 2XTZA 2IF2A 2XB4A 3K0FB 3MRSA 3TR0A 2G1KA 3PJRA 1SVLA 4TMXA 2L0XA 3AVXA 3GQBA 2CL6X 3OIWA 3OIUA 4M9SA 1HE8B 3NC0C 4P3YA 1E4YA 1H65A 3R20A 5CM8B 4QJ5A 5KSPA 2ZJOA 2ZVQX 4QHYA 3TSWA 2NGRA 1OJLA 2R65A 2CJWA 3GJ8A 2J0VA 4TQAA 4QL3A 5HPYB 4PSKA 2XOKA 4C4PA 1U81A 1XRJA 1KI6B 1QHXA 1HY3A 4B3FX 1JB1A 1E2MA 4EFLA 4M9XA 3UG6A 4YMVA 2G77B 5GJBA 2W2TA 3GLFA 2EYUA 2ORIA 4CT4B 2GCOB 4MQBA 1FQJA 3QF7A 2X77A 2ZRBA 2WWXA 1NN3A 2F3RA 2GDJA 4JVSB 5JWOA 1SXJD 4HZUB 4ZKDA 3R9WA 5DHAA 3EZ2A 2VH5R 1NLYA 1I4LD 3U6KA 3CM0A 3SOPA 3WBJA 5EP4A 4BLOA 2QT0A 1GL9B 4NYMQ 2GF0A 1KMHB 4D6PA 3WP1B 1KOFA 1H8EA 1KJYA 4LC0A 2IYRA 1F5NA 3GJXC 3O47A 2OHFA 5DYIA 3SQXA 2V3CC 4DT1A 3EZFA 3E70C 1GL7A 2P5TB 1VTKA 3GLHA 4LOAA 4PPNA 4PXAA 3SYLA 1N6PA 2GETA 1OYYA 1GZSA 2CE2X 3ND9A 1PUJA 2BBSA 3E1SA 4UNSA 3DDCA 4A0HA 4QJ4A 1GRRA 2AX4A 3RRZA 1XXHB 3S1AA 4DEXA 4G01B 4GOXA 3SFVA 1T91A 3K0CA 1PLLA 2WTUA 1GTVA 2ZITA 2VA8A 4Q4HA 1EX7A 3OIYA 5L3RA 2R2AA 2V1XA 1VIAA 4M2LA 2QORA 3WMGA 4XSGA 1GSIA 1XPOA 3IO5A 2ERYA 3PUVA 4AYXA 3BRWD 3LLUA 4RSGA 2BV3A 4TQ9A 1SKYE 3OEEA 3I72A 4A8JA 3THXA 1GDDA 1IJFA 5F98A 1BIFA 4YLGA 1II0A 1OXSC 3PITA 2I1VB 1P2TA 4QG7A 3NBFA 4FI3C 2QBYA 3CNNA 3KJIA 3RNLA 4HLDA 4U00A 3TUZC 1F2TA 2QAGB 1XJCA 3DZDA 1BMFD 5BN5A 2ECKA 4NL4H 3L0SA 2JAQA 3C5HA 1P6XA 4CIDA 1JJ7A 4KO8A 3QVVA 2OESA 2CCGA 1G9XA 1SHZA 3M0EA 3QEOA 1G21E 1QVRA 4Q48A 4D25A 4LPSA 5JZVA 2QPOA 4OI2A 1HEIA 4LZZA 3IIMA 2HJGA 1V5WA 4JIMA 3IQWA 1OSNA 2ZE6A 3H1TA 3K0SA 1MO3A 3UXMA 1QF9A 1E98A 2Q9BA 3LRPA 5AK0A 1VYVA 1Z6GA 5FTKA 3QKUA 4ZDJA 3DKVA 1OXVA 1FZQA 4PHFA 2C04A 3W34A 1R5OA 1G8FA 1W44A 5C4GB 3A36A 1XEFA 4AYWA 1KNXA 1WRBA 1XTJA 3K09C 3SDZA 4B71A 5KSOA 2FFHA 2G1JA 3IO3A 4GI7A 5FUVA 1FQKA 2K5UA 4PSVA 5JCZA 1UKEA 5JFGA 1P73A 1CP2A 1US8B 4BLPA 3EPHA 5AR1A 4C3ZA 1UBFA 3CPJB 3GEEA 3TW8B 1KJWA 5TVKA 4Y0AA 2CCJA 5CJPA 5BXQC 4DHEA 4IVPA 5JSZB 1G8PA 5FBLB 1E0JA 4E22A 5J47A 3A58B 2VYFA 1ZIOA 1Z8FA 5G3ZA 4URXR 2J0QA 4C0HA 2Z83A 2O8CA 1P72A 3M1IA 4HB2A 4MYHA 2N46A 1E9SA 2V9PA 2CL0X 2IL1A 1CF4A 4DLWA 2QRZA 2B7BA 5E7IA 2H8KA 3BH6A 5CM9C 4KXFB 1Z08A 5FH9A 2XNDA 3MSXA 4G5QA 4WZ6A 3RWMB 2JLZA 1SVOA 4TMWA 5J4YA 4R71A 4A1FA 3IHLA 3C5CA 3TLXA 1D5CA 4PTLA 1TNDA 2IYQA 2OAP1 2Z0MA 4UXHA 4CRWB 2BHRA 2AFIE 4QBGB 3U44B 2CK3D 2J46A 1U0HC 2GA8A 4GRAA 4LYHA 3VFDA 4BFXA 2MMGA 5KU1A 4ZPXA 4B74A 1G5RA 2OSBA 2B6HA 4H1UA 1MR3F 4JL5A 1EX6A 2GXSA 2BJVA 1M6NA 5JS7A 2VL7A 4OK5A 3TR5A 4KLNA 4YXWA 3RRMA 1WCV1 1FX0A 3GLGE 4UNPA 1ZINA 4PAOA 3TNFA 2OBMA 1EG7A 2PBRA 1E1QD 2A5DA 3VR1A 1WA5A 2QUZA 1F2UA 1GNPA 2EWVA 2QI9C 1RKBA 3O8BA 3CB4A 4UNNA 4KBGA 3ZD6A 2ZSBA 2EYQA 1AGRA 2PJRA 3PG5A 2QGZA 1JAHA 3QXHA 4OHXA 4Z1MD 1RRGA 1J99A 3SU8A 1KDOA 3W3AA 4ZI3A 2C77A 2ZTSA 4C0JA 2FG5A 5DLQC 3LV8A 3ZVRA 5UKDA 1Z5ZA 3CLVA 2IT1A 2J87A 1QHHA 2PZEA 1E9RA 2E9SA 3UWOA 2NO0A 1GFIA 2IYTA 4JVLA 4A8JC 4AI6A 3W6OA 2OAQ1 4A2QA 1ZYUA 3L0IB 2ATXA 1CIPA 3CH5A 2NG1A 2A9KA 3KXKA 3SR0A 2ZS9A 3HYTA 1F60A 3QXXA 3IQXA 1Q1EA 4L15A 2BKEA 2AR7A 4D4MA 2WPDD 1TQDA 1GNQA 2LCFA 3HU3A 1SVSA 2YKGA 4N0EA 1IN7A 2GHIA 5JI3E 2IYYA 4IDQA 3B9PA 4DKXA 3A1UA 4G5OA 4PC3A 2DFNA 1OXUA 2QSZA 3EZ6A 3SJZA 5IRCD 1NKTA 2ZI9A 4TMZA 4BLTA 1JJVA 5JWRA 1HA3A 4ZDWA 4OI1A 1E0KA 1QHSA 1OPXA 2GXQA 4XTCS 3QKRB 4Q9JA 1E2PA 2RMKA 4L8GA 3TVDA 3QEJA 4PO9A 5DN6D 3VQTA 1Z28A 1DO0A 3E2IA 1Z29A 5DYGA 1ZC4A 1G3QA 2Q6TA 3B1XA 3CRW1 3AF0A 1VMAA 4AKGA 1UAAA 4LHYA 5DE3A 5EE5B 2CBZA 3AEZA 3CZQA 4MA4A 2MMCA 4XVQA 5EE9A 1Z0IA 3T06B 4KFRA 1D2NA 4PQFA 2AKYA 2ZYUX 3MWJA 4B75A 1R0YA 4EPXA 1E9CA 5FL7D 2O0KA 1G3MA 5SZIA 4M1MA 4WZBE 4NMMA 4TYPA 3FMFA 3TH5A 1CR0A 3K0FA 3EC2A 3OZXA 3WMEA 1Z0DA 2VIIA 2DWQA 4OJKA 2WPDA 4M1SA 3J81k 4ZO4A 4Q21A 1ZUHA 5HKKA 4LGMA 1VHTA 2RGDA 1NN0A 2OCAA 1TX4B 4HAUA 3BWDD 3DEFA 3W6PA 2JLVA 2FE4A 1JALA 1SULA 3QG1A 5LB4A 4KITB 3GLIE 3HWSA 2YOFA 621PA 1I4TD 4DSOA 1QRAA 4LX0A 2C5LA 5AWFC 2X2FA 1KI6A 3DOEA 4MYCA 1TUEA 3NXSA 4LJ8A 2O5VA 1H8HD 2H92A 3GPLA 1G64A 1OW3B 1KNQA 1XBTA 4LV5B 2GCOA 2PX3A 2A30A 2WKRA 2FA9A 4CEIB 4Q1FA 4MKHA 3U3OA 3QIAA 4ASUA 4HZUA 3ZYCA 3O8CA 1U99A 2VPPA 1Q0UA 2QEQA 2RGGA 4NH0A 3QUSA 6Q21A 2YOGA 2H5EA 3IKJA 1FPMA 4PC7A 5AUQA 1T0HB 3AUYA 4B2PA 1CS4C 2J0UB 2LWIA 1OE0A 4JLVA 4KFSA 1E9FA 3HPRA 1QHGA 4YONB 3VX3A 1Q12A 1LS6A 3GFTA 2FPKA 2RGCA 3NBYC 1N6IA 1IM2A 2OT3B 1KI4A 3B1WA 2JLYA 2W6ID 1N5IA 4M9QA 4CVNA 4X8LA 2OFWA 4C0SA 2HXYA 2IXFA 4Q9HA 3KX2A 3V4FA 4GL2A 1NIJA 1XXHA 1SXJB 1G6HA 1GIAA 3VR4A 1GWNA 3U7EB 5JCPA 1SKYB 2WJIA 4KU4A 2XSZD 1W2GA 2F7SA 1IAQA 2GILA 4A0FA 1ELOA 4F4CA 2W83A 3BFVA 2FSGA 5D3QA 1T8UA 3B9QA 3GEIA 3NKVA 3QXJA 5DNYB 3G82C 1E1RA 1W5SA 2QMOA 1J7KA 4NCKA 4LHZA 1HTWA 1ZM9A 1ZW6A 2ZM5A 2Y8EA 1W2HA 2J9RA 2O0HA 4OI4A 4Q5IA 1L4YA 2J59A 3T1TA 3BB1A 2ZXUA 1QVAA 4C0LA 1XPUA 1NMXA 4KSCA 2XB2A 4RFSB 1FOEB 4Y0VA 2AD1A 2QAGA 4HUQB 3RLFA 3NBXX 3THWB 2BWJA 4AG6A 2NPIA 4JLDA 3CRMA 3U5ZB 4D4JA 5BWMA 4EJSB 4L5BA 3IPXA 4TLCA 4M1WA 2FDCA 5P21A 4UNQA 1RYFA 2IYWA 3KKOA 1IY1A 4Z54A 1GUAA 3DVLA 4D26A 3W8NA 3MWLA 3PEUA 4D0LB 1XTSA 3R8CA 3MJRA 2HF9A 1LVGA 2X2EA 3GJ3A 3E5HA 4QHTA 3VX4A 2EFCB 3IILA 4CEJB 2QPTA 3VNVA 3TUIC 1Q20A 3QF4B 3UMSA 4LYFA 1KO1A 1BYUA 1GKUB 4UJ3A 4U7DA 4JVNA 3HU2A 2IWHA 3U7HB 4F4JA 1G4AE 1II9A 3KKPA 1S1MA 4Q19A 4LBYA 4HAXA 4TT3D 2R8RA 4TTQA 4TWZA 4CDGA 3GFOA 3P4YA 5FOSA 5JHGB 3PEWA 1JPJA 3EA5A 4HB0A 1E2NA 1K8RA 4H1VA 3U60B 3RHFA 2ZJAA 4IJMA 3F8TA 4GZMA 1YZGA 2VTKA 1US8A 1UBGA 2I4IA 4M4SA 4B3CA 2ZAOA 3BE4A 1G1MA 1N5JA 1T6NA 1UM8A 2GRJA 2R6AA 4GSYA 1EWQA 3K70B 1FFHA 2NO1A 2FEOA 3LWNA 5FR1A 1KSJA 1P62B 3FGNA 3EAQA 3TW4A 5JSZA 5FBQB 3SBDA 1LFDB 1NF3A 1DS6A 3EWSA 1VG1A 3WNBA 4A0GA 4C0QC 4V0OA 3BB3A 4E09A 2V7QD 2CE7A 3AF4A 3K9HA 3A1SA 2REBA 1VIYA 4DCVA 1A7JA 3GMTA 4QHSA 4DDVA 4AKIA 1N5LA 1ZD9A 4JKYA 4RCYA 4FMDF 4CZ2A 2ASEA 3OIVA 3RVBA 4AURA 2WBLC 2YHSA 2HUPA 3P20A 3QNUA 3BAFA 4L9SA 3LAWA 2FWRA 3ZVMA 1G5TA 3PR1A 4G0NA 1CU1A 1CKEA 2W0SA 3U44A 3QKSB 2GZAA 5DIFA 2VF7A 1Z0KA 2AXNA 3K0EA 4JBXA 4TT3A 2CVFA 3AF2A 2F55A 5LDDC 1VYTA 1R10A 4B47A 2A7QA 1EESA 4CF7A 1GM5A 4LBVA 3BD9A 1YZLA 2QROA 4Q9IA 1CJKC 4B44A 3OF5A 1U9IA 1T3HA 3AKEA 3B13B 4RZ3A 3NG1A 4JBYA 1MO5A 4QBFA 1GILA 2YVUA 4OHZA 5DHFA 1RFLA 4BEJA 221PA 3A37A 1UEIA 2JEOA 4PQRA 1KKMA 3Q7PA 4PPQA 3EZ9A 4HAVA 1NI3A 2A5FA 5E4FA 2RAPA 2XEXA 2BIFA 4JKIA 4YMWA 4MUAA 4YDHB 4TL9A 2B21A 4LJ7A 4FN5A 1B23P 4PHHA 4NBSA 4URUR 1G5PA 2WJJA 1ZCAA 4X8OA 3A1WA 5G41A 3EWAA 5BYJA 4A36A 1KI8A 1UF9A 3C14C 1D2MA 1E9EA 4P32A 2E1RA 4Q1CA 5GADl 2NIPA 2OE2A 4I1OA 1G8YA 1JR3E 3KFXA 3Q72A 3ASZA 1OIXA 3T1OA 3SNHA 1DAEA 2ZU0C 4F7WA 5K8TA 1TU4A 3K0AB 2HXSA 2IUSA 1N2CE 3SYNA 1MRNA 2R62A 5ANRB 1G8GA 1S3SA 3ZVLA 1ZU4A 4JLKA 3JZAA 4Q02A 4RZ2A 1DAHA 1NN1A 4OKSA 4WOPA 5M04A 1QHYA 2QAGC 1QHIA 2NMVA 5C4MA 1U98A 2GZDA 4ACBA 2CHVA 2ZIAA 4A2PA 5HZHA 5HE9A 2B8TA 2ODNA 2RGBA 3B7GA 4A92A 1ZU5A 3QENA 5H1YA 5TMPA 3NDBB 2BCGY 4BFTA 5HZKA 2D7DA 1NIPA 2D4HA 4MUBA 4EUNA 5DISB 4IOMA 1KDPA 4Q4AB 2XAUA 3PEVA 2DB3A 3ND8A 3AVUA 1IJEA 3T1VA 1E99A 5KNDA 3VAAA 2ZI6A 2QAJA 4QJ3A 5TB5A 3AP3A 4CT5A 2Q0HA 4HLQB 2ZJYA 3K1JA 1TEVA 3QKRA 3AM1A 1TF2A 3CUEF 3IDQA 2FZ4A 4YC7A 2GESA 3M6AA 4BLSA 3FDIA 2BEJA 3L8ZA 4H9GA 1XMJA 5JI2E 2BJWA 4C9BA 3NTUA 1HE1C 2Q3MA 3CNOA 3ETLA 5CDFE 3U7FB 3KTAB 2FGJA 4F92B 2D7CA 2UZIR 1OH6A 1Z0AA 2ANBA 4BPBA 1M7HA 3T34A 4CW7A 4IDPA 2GK7A 4Q7LA 4R9UC 4K81B 2WJHA 2N1BA 3HYRA 5HTKA 4P4SB 1D9ZA 1U90A 1DO2A 2CEAA 1Y63A 1KTVA 4DSNA 1W36B 5EXTA 1YZNA 2J3EA 4TL7A 1CEEA 4BRUA 3FHOA 2ZETA 1RIFA 2G3YA 4KAXA 2QTFA 3REFA 4B43A 2ZRJA 4B2IA 1XD2B 3AKDA 2C8VA 2IYZA 3QXCA 2P6UA 5EP3A 3EASA 1KZ7B 5HR5A 2P67A 3I61A 4Q1AA 1XTKA 4TLAA 2HLDD 4HDOB 2H17A 2IS1A 4C0AC 1VCNA 2AD5A 2QA5A 3GLIB 4MDFA 4Q4LA 2W2XA 1NY6A 3TUJC 3W6NA 1XJQA 2RHMA 3CZPA 3O8RA 3GLFE 2D74A 1HURA 4YMUA 4NYJR 3TJZA 3KB2A 4R7ZA 1S1CA 4FMBB 3SEAA 5KUTA 1Z07A 1GOTA 2HEIA 1SHKA 4WZAE 5FUWA 1G20E 2CVHA 4ITRC 4B32A 3MG9A 1OXXK 5FPKA 4K8OA 4PC2A 2FFQA 2WWYA 4IVRA 4HUTA 1R8QA 2RGAA 4CEIA 4URWR 2ZREA 1E2IA 5FUXA 4WBSA 3VKGA 4EPVA 4EPWA 1UADA 2GZHA 1U9IC 3GLHE 2WMNB 3OFND 3VU9B 1LY1A 4UXJA 2PZGA 1NKSA 2W0MA 2IUUA 1Z63A 3IEUA 1NVVQ 3FYHA 4DZZA 2J0UA 2VHJA 1CRQA 3JVVA 4UQOA 821PA 2C96A 1BH2A 1KSFX 2AL7A 5DI3B 2AN9A 3A8TA 4EQ6B 1KO7A 5JBQA 2RB4A 1GVNB 2ONKA 1Z47A 3B1VA 3L0PA 5DO9A 4D4LA 1OH5A 4PC6A 1TPZA 4M0LA 2QENA 4HLUA 5FOWA 2PL3A 1SXJA 4B33A 4AY2A 3CF0A 3TMKA 5DSZA 2LKCA 4B73A 1CTQA 5JLJA 3AH8A 1AQUA 3LY5A 4EDHA 2R44A 4TYWA 1VCIA 2ZYVX 1R8SA 2R6GA 3GCGA 3CH4B 3RABA 4GP6A 2WJGA 5J4LA 1IHUA 1YR7A 2ZEJA 2P0EA 4QBHA 3JVUA 2FGKA 4NTZA 1KIMA 2Q9CA 1UKZA 1X86B 3K70D 2VP5A 2VBCA 4I1UA 4ARZB 3CIOA 2F1JA 3N2IA 4PQYA 3LLMA 4OHWA 3THWA 4HUQA 4LDJA 1IBRA 4B2LA 1NVUQ 1TL7C 3N70A 3OFNA 5G53C 4EJSA 2CCKA 1X6VA 2NO7A 5LB2A 2IS6A 4US0R 1Z2CA 3QPUA 4XWKA 4Q01A 5BYKA 3MD0A 4LYJA 5FPHA 1K5GA 1E2HA 2BM1A 1P4SA 4LCBA 1AZTA 3BGWA 3CBQA 5EUQB 3T1QA 2QSYA 2KE5A 1VDZA 3LW8A 3AV0B 1MO6A 2ZRKA 3UK6A 4CEJA 4Q9LA 3CPHA 5EJEA 1T9HA 3QF4A 3R7WB 4AK9A 1YRAA 1HH4A 4JLJA 5KYKA 4R2HA 4ILEA 2W6JD 3PFIA 1HT1E 2GBLA 2RGNA 1O3YA 2AKAB 2OG2A 4LJ4A 3SQWA 2V1UA 3I8SA 3RDPA 4PANA 4DLVA 4DJTA 1BMFA 3L82B 4UXIA 5CJ2A 2YC4C 2V6IA 3WRXC 3NDPA 3ZVNA 3NWJA 1ZNWA 2GXUA 4IRUB 4LPKA 4DBLC 2OZEA 4KCGA 4LBZA 2OLJA 4TLEA 2ZYTX 2HDNB 4JSYA 1YKSA 1JPNA 2ONJA 1AS3A 4DUGD 1ZM7A 1Z6TA 2O8EB 1FP7A 2X1VA 1NP6A 1XNJA 3WY9A 1N5KA 5IK2D 2QRNA 3EIHA 1E32A 4GMDA 2R6DA 3MMPA 2DPXA 2O8FB 3KUCA 3K8YA 3AVWA 2FZLA 1XCMA 3BFXA 2BCJQ 2FF7A 1MO4A 2XNSA 4L9WA 5JJLA 3EPKA 4LK2A 4LHWA 3THYB 2IXGA 1A5TA 4NDZA 4BZQA 1SGWA 5IF9A 2BDTA 2FJUA 3FTQA 3TIFA 1KGDA 2IC5A 1E2DA 1FTSA 3H86A 1NN5A 3KJGA 5CK4A 4TQUS 3ONWA 4O25A 3VHXA 2ODBA 1JR6A 2FSIA 1OB5A 4O2LA 3WHLA 2N42A 4KVGA 2W6JA 1E0SA 2F9LA 3QKSA 1KK1A 2ZI7A 3T12A 4V03A 3I5YA 2RH5A 1E6CA 2ZRLA 3QI2A 3QE0A 4QXAA 2WVJA 4I1SA 5EXSA 1KK3A 4RY2A 2ZAMA 3KKNA 1KO8A 1W4AA 3HPQA 2D3WA 3H0KA 2V4ZA 3NVAA 1XZQA 4IDOA 4JBWA 3K0CC 1RZ3A 3PIRA 1FNMA 1NY5A 2ZANA 3KDSE 4IOKA 5EZ6B 5KO2A 2F43B 1P2UA 2PMDA 2C9YA 3TE6A 5TV2A 1ZNXA 3B85A 1A4RA 1DG1G 1HYQA 4QBIA 4M9ZA 4MKIA 2KJQA 4DUGA 2AHOA 2JA1A 2C78A 3MWKA 2IUTA 3Q9LA 1OIVA 4BFWA 4LV8B 5IK2A 3CW2A 1CJUC 1I2MA 4LHXA 1P3JA 2ZPTX 4M1OA 4MH0R 1IXRC 1GITA 1DAKA 1DAFA 3DMNA 4S35A 3IHWA 3SI7A 1SXJC 2CK3A 1TF5A 2PT7A 2FSFA 4KODA 3AVYA 2IA5A 1W7AA 2A5GA 4D82A 2AWOA 2ODWA 1Q57A 4MDEA 3UWKA 1YZUA 4JL8A 4B6EA 1R7RA 4AD8A
chains in the Genus database with same CATH superfamily
1IY9A 3WDMA 5KJCA 3BM5A 3GWZA 1IBLB 4ZJYA 5LDHA 4KUDA 3COZA 3QUTA 1ZGAA 3ZZTA 3I23A 4PG6A 3A9WA 5FOXA 3WI7A 3FFWA 3IELA 3VPBA 3JQCA 3P9CA 5ALIA 1O8CA 4L28A 3MTBA 1UMDB 4UTRA 4ETMA 3HXKA 1AQIA 1L7DA 4KRXA 4A4DA 4Q9DA 3U7IA 5GJCA 1G19A 3K8OE 3KTAA 4MPRA 3GP8A 1URPA 3INRA 1JW9B 5AW3A 5ULLA 3DCJA 4FSHA 2WM9B 4YP7A 3PVSA 2AROB 3QK7A 3FCXA 3CNHA 3L41A 4EHNA 3ZE7A 1L2TA 1P2GA 3C7KA 2EC5A 2FZEA 3EYWA 1UK7A 3VVCA 3PFWO 1C7RA 5FA8A 1I2AA 4OJTA 3U4AA 3CTMA 2HIOD 1KMHA 4FWTA 3MAJA 1T4GA 4L95C 1DX4A 2FNAA 2V7PA 1B73A 3WWPA 3PRJA 5D00A 2HIAA 2AI3A 3ZV3A 3WLHA 4WAUA 4ETIA 4MIOA 5J5AA 3TLGB 4Q4HB 2J85A 5B1LA 4CQMA 2IV7A 1HBJA 4HNQA 3UTAB 1F8YA 3P7MA 2GZMA 1U7UA 3R8XA 1T0JB 1P9WA 1L1FA 3GGGA 1I6LA 4MKFA 1NVKA 2AEMA 2PGAA 2PSFA 4F1KA 2QLFA 2HAEA 3U0BA 3KZVA 1QLHA 2IHKA 3QM1A 2P1DA 1I80A 3I76A 3USES 4OG2A 1MT0A 2FSSA 5FO1A 2PBZA 3R7WA 2FLWA 2GEDA 1QQ5A 1AK2A 2G6BA 1K7XB 2OGZA 4IBOA 1E2EA 3ESZA 1JYEA 4BX2A 3NQ41 1ZHFA 4WASA 4BNTA 1OWMA 3TOXA 4JBHA 4PRZA 2JCVA 3KL2A 5DHTA 4V1CB 4TTVA 1KFKB 4Y2TA 4MW1A 4YXFA 1Q50A 2GLXA 2H51A 4YUZA 1Z8NA 2A3RA 3S6JA 4DQXA 5MN5A 3SY8A 1JIQA 1DUIA 2VBFA 1CJVC 1E94E 1KI1A 3M4YA 1QDEA 4ZICA 3ETJA 3UCFA 2VJMB 4JN6B 5E1OA 2ZJ8A 3JVDA 1ECGA 3PRHA 4GLJA 6REQB 3WZ2A 2V7QA 2VEOA 4EO5B 2YJ4A 3F3YA 2EW2A 3PGXA 1PJ2A 4QTUB 3KR9A 1IAVA 4A15A 3AVVA 1ZJYA 4ZZ0A 1KQOA 1KO5A 3FRIA 4O2AA 2NZJA 3RSLA 1U7OA 2OO5A 3C41J 1GRCA 5LP6B 4EA8A 1XEXB 3MW8A 2OVBA 2HN9A 1E3TA 1F66B 3OO0A 3LFUA 1ST3A 2VQSA 3T7CA 3RYHB 1ODFA 5EE0A 4D5GA 2JLSA 3F74A 4HNHA 1V8BA 3U2QA 1RRFA 4OHKA 1YA4A 3P32A 3NH6A 4BB0A 5F1YA 2O23A 1CUUA 3RBZA 4GBGA 4OAOA 2WG0A 3QMWA 5IJ0B 5CD1A 2HFKA 4RH0A 4IKPA 5CUQA 3IQIX 3O6VA 2G36A 3VPFA 4AIRA 2IH4A 1KQPA 5LMNB 3VYWA 3A6PC 3RCBA 5T6MA 3TW0A 1MUUA 1I3NA 1TQ4A 1MJFA 5B31A 3OZTA 1FXUA 1UKCA 4FMCF 2BT4A 1ZVVA 5CH8A 4GDFA 1K9SA 3C16C 1XLTC 4BV8A 2BGMA 7GPBA 2UAGA 3N1UA 3FHCB 4NABA 5E6SA 2NUAB 3BXXA 1T9GR 3K3PA 1GJRA 2GAJA 4DUYB 1A97A 2BFBA 4YAFA 2FF5A 2TMKA 5FUYA 2VHUA 3OKAA 2B61A 4L1KA 4XGQA 1J09A 4H3KB 3K15A 4MB6A 4RHTA 3QY0A 5ICCA 3DJYA 1XZIA 3AETA 2VCYA 4Z5TA 3ZQ6A 1PV4A 4IX9A 4EB0A 5B7NA 2R3SA 4QWWA 1MC4A 1TO1E 5JRGD 2VP0A 4PLZA 4QOEA 4CM6A 3FCYA 3O83A 4L07A 3G59A 1J8DA 5L40A 3PDCA 5KQGA 4ZCIA 4X62B 3DAYA 1VLHA 1RT9A 1U94A 5EA2A 1PGQA 3KYCA 3ZGOA 2Q07A 3A6NB 4DLYA 1TA9A 3DL0A 4MI6A 2O0JA 2PGXA 4PQEA 4U2EA 3IAEA 2EZ8A 4YRTA 3JZMA 4OUDB 4RV5A 1N4AA 1NVGA 3LFHA 4MJ7A 1HPLA 1MABB 2OKGA 4IHKA 4AFNA 1ZZEA 1WNTA 1FL9A 5L45A 1EFDN 4QU5A 4A23A 2JLAA 2PYIA 3KUUA 4ACAA 5ESRA 3NLLA 1HOTA 4ENQA 3A04A 3F90A 4YJ2B 3P2EA 1YTUA 4H9QA 5CXSA 1XZDA 3OEYA 4QGAA 3WS7A 1ZC3A 4XKJA 4WV4B 2CUKA 3CGWA 4NICA 1QH1B 4H6XA 4ZEOA 2BVNA 1ZO8A 2RKBA 1JDVA 5J5VA 4N39A 5ARCA 5CPJA 4TWBA 3D3QA 1KX5D 5L7YA 3QFFA 1VXOA 3THSA 3C3AA 4RESA 1E2KA 3X1WA 4YCNA 1F14A 4REQA 5FTLA 1GP2A 2AV6A 2RIQA 2GBLC 2O0MA 3EPPA 3QGMA 2P77A 5KI6A 4EMTA 4Q7QA 5HIMA 1YH3A 3GQBB 1G4UR 2NU8B 1QKKA 4DREA 1Z0FA 4N3BA 3HCPA 1KDRA 2AZ4A 1SHJA 1M2KA 3R1IA 4D2IA 1CJMA 3FBGA 1KSGA 4AO7A 1F2VA 1W5EA 2JFGA 4R1PA 4E03A 1XMQB 4B09A 4WZAB 5L7WA 1G20B 2JCBA 1Y1TA 5HF6A 5BW4A 3W98C 4INPA 4BN4A 5EUMA 2VDMB 1B43A 3ZU6A 1YA6A 2R4UA 2UVPB 2O7NA 1D8AA 1Y1RA 3ZQJA 1KP9A 5L95A 3TBKA 3RM3A 2DRIA 3ROGA 1CY4A 2LVBA 4BC1A 1E69A 4OEHA 3BMOB 3FNGA 2RHDA 2Z8YM 4KN5A 4MHSA 3QOXA 4IDBA 4A8JB 4OKNA 1Q84A 4I8XA 4MRVA 3O31A 3Q7TA 2NZDC 4PYIA 1E60A 1IN6A 4BIIA 5EJ7A 3IV6A 1V11A 4G3XA 4PGHA 2VWHA 3FPLA 4KWCA 4B76A 3K72B 2JFQA 3GT3A 1T8RA 2IDZA 3KLOA 4DNPA 3Q0TA 3S55A 5B2ZA 3WLMA 3GUYA 4ZYUA 1QLJA 1N2EA 3K8QA 1N9GB 5BQ5A 2BGRA 3E9YA 3TRFA 1JS1X 5HUQA 1N0IA 2CSUA 3N8NA 1V9SA 1XDDA 4C2UA 5CFRA 1P91A 4O4LA 3DMDA 5FLEX 3LZ0D 3OM8A 1N3LA 1EH5A 1WZEA 4DQVA 3EXG2 2EARA 4QREA 3ORQA 2F1RA 2FR1A 2D1SA 3LKBA 2HPHA 1F0KA 5CEJA 2PQMA 4RE6A 5H8WA 3BMNA 3O1HB 4W1PA 4BNZA 2AWNA 4NR0A 5J2TA 1CW2B 2VOEA 1BS9A 1M73E 3C39A 5KDDA 3C3XA 3H8WA 3MGBA 4XWOA 2J1LA 2R6R1 2QYHA 4W1RA 3H4TA 3ZG6A 4Y1RA 3LLVA 1QTNA 2X13A 4KV7A 3AERB 4CTOA 1HLFA 2RK3A 4KUHA 1NW3A 4B8YA 1ZXBA 4KACA 4DKJA 2ERCA 1GHTA 3EIQA 4QM6A 4GC5A 4HEA6 3PX2A 3UT5B 4JP3A 2VDLB 5C3MA 1AGPA 1YR8A 1ISIA 5G0VA 2R8ZA 3JALB 1JN0A 1N0WA 1FUKA 1H8ED 5K20A 3WTPC 1SCNE 3W5SA 3REIA 3EODA 1PX2A 3IXLA 3OCWA 1E4YA 1ID3B 3G2HA 5CM8B 3RROA 3F1LA 5HKLA 4Z86A 3Q88A 2Y2NA 4MR9B 4YHBA 3FUCA 4HYEA 4ZALA 2ZSHA 3QMMA 3EHEA 2G77B 4M55A 5CGQB 2EYUA 5KZMB 4L4SA 2L17A 2X77A 1VMIA 1VPTA 4LD9B 4GUDA 3WBJA 3EGXA 3FGPA 4BLOA 2QT0A 1GL9B 2QX9A 1KOFA 4MPTA 1FF9A 2YN4A 4LKOA 3BE8A 4BJHB 1ZIXA 3GLHA 3R6GA 3RVPA 1T2DA 1XYYA 3B20A 3VGJA 5HMMA 4Q3KA 4Z4GA 1GPKA 2I67A 3RT7A 5AV8C 4F2WA 3DMPA 4CMCA 5KQSA 5JD5A 3OEEA 2E4UA 3N8DA 1PJ3A 3H17A 5F98A 3AONB 2B78A 1J39A 1LPOA 3NX4A 3G6WA 5JS6A 3S2ZA 4LDNA 1U7DA 2O07A 3W4JA 8GPBA 4CAYA 3VSAA 3RJTA 3LRPA 3QPAA 4AKTA 2WJZB 2N3ZA 1FZQA 4PHFA 1Z5VA 1KNXA 5T3UA 5FUVA 5ER9A 1D7AA 1US8B 1VBFA 5DHRA 5AVVA 5TVKA 1VRCA 4MZDA 2VYFA 4C0HA 3W96D 1P72A 1STOA 2FKNA 2XDWA 1RKVA 3BH6A 4PLWA 2JFXA 5JMOA 2C8JA 4HFNA 4UXHA 3HY6A 3U44B 4X94A 3H1FA 4BFXA 3WB2A 2QN8A 2YY5A 2GXSA 3KE9A 3IP5A 2E85A 4YXWA 3TCXB 2PD3A 5JCJD 3AUJB 3S99A 4GLLA 5K0FA 3VR1A 1WA5A 5SY9A 1X15A 3N9IA 2CMFA 4UTXA 2ZWMA 2A9OA 3BZWA 2GEKA 4AZ0A 1W1UA 2EYQA 5JAMA 1GYRA 4OHXA 4XB1A 3SU8A 2C77A 4LGCA 5FI5A 3WVNA 5UKDA 1DHRA 2PZEA 3A9TA 1XRSB 4JVLA 2IXAA 1WTCA 3WFJA 5KOHA 3OCJA 4AY5A 3KNZA 4BO7A 5EPUA 3BK1A 4R1OA 4BVEA 2RBEA 1F60A 4IX1A 1QS0B 4C1NA 1ZN7A 4Q7EA 1SVSA 1IN7A 4C06A 1XOIA 4ZOLB 2I2CA 2ZXFA 1EK5A 2ZI9A 1JJVA 2GXQA 1GTL1 4AJPA 5CPID 5DN6D 2ZY3A 1NRXA 3PX3A 2PWPA 1XAHA 1Z0IA 2JD1A 1I1QB 1PWEA 2AKYA 1IOLA 3TLMA 4EPXA 4X20A 3LXMA 4ZGBA 4MJLA 3ESAA 1ZMOA 3HYSA 3VDNB 3WKEA 2VIIA 3TMAA 4L9RA 1YHZA 2RGDA 3T7KA 3W6PA 4DIMA 4HR7A 2H1IA 3B6GB 3HY4A 3WA6A 2Y1CA 5C34B 3SQOA 3D7RA 1MJGM 3O94A 4RV9A 1QNLA 1S7CA 4E30A 4TRNA 3VX3A 5IT4A 3WLEA 2C5FA 1LS6A 1CNEA 3HJBA 1ISJA 2YHUA 1EDEA 3A14A 1XZBA 1SXJB 1ORIA 4XUJC 2ZM6B 2IPNA 2QJFA 3BFVA 1W5SA 4ZT5A 1Y1SA 3HUUA 3PWZA 4MQMA 2DHDA 1L4YA 3D8NA 5EG5A 1GQFA 3B9RA 5HOQA 2B4KA 4G0PA 5I7AA 2AD1A 5FUBA 4JLDA 4D4JA 3KAKA 3A9SA 1BE6A 4D26A 5A3SA 3JQGB 5LKAA 4O4HF 4F3YA 5DJ5A 4QHTA 2O50A 1KO1A 2QZZA 2VXCA 1II9A 4QVIA 4Q19A 4RYDA 4TZKA 3VA7A 3PEWA 3P94A 4LY0A 2Y1OA 2AJLI 3CKKA 1P3MA 1YB4A 1YZ3A 4UBIA 2FI1A 3FGNA 2OCIA 1QOPB 1NVMB 2BGIA 4FGUA 4TTSA 2AJCA 2QTGA 2GFHA 4DDVA 3AJ9A 3EUWA 2UZAA 2NU7A 2J3DA 3P20A 4PFJA 4L85A 1JDBB 4TT3A 3F8WA 3MJDA 5C8YF 1Q11A 4CF7A 3T1YB 2QVLA 3CW9A 2Q2NA 3AWIA 2CV0A 4JBYA 2OHVA 4OHZA 2YS6A 3AEQA 3QEKA 5ALPA 4GBJA 1KKMA 2BW0A 4BMNA 2PYOA 4MUAA 4LJ7A 5GINE 3BHMA 4LZJA 3ZBPA 3J80A 3FPGA 2OE2A 1LH0A 3B6MA 3L7YA 4RPIA 3GU3A 3K0AB 4D45A 1HFKA 1MRNA 2BM9A 1G8GA 3E9CA 2A33A 3INNA 5IG2A 4G0MA 2VQ3A 2NXCA 3ESRA 4ACBA 1O97C 4BFCA 3ADPA 5TMPA 3HDYA 2XYPA 2GCEA 4RM2A 1E5DA 3F4BA 1IJEA 5DM60 4KRFA 2Y6VA 4OBWA 2QAJA 3AJAA 1BJKA 4JENA 4R2XA 4HRVA 4AJNA 2EX4A 1QRUA 1P34C 4Q93A 5KAMA 2EHDA 2V0GA 3WHPA 3L8EA 1AN9A 1R6XA 2GK7A 3HFSA 3EZLA 4P4SB 1DO2A 1YJQA 4TL7A 4GYWA 2ZETA 2FR8C 3WWDA 3REFA 3H9EO 3NYQA 3P5BA 4JITA 1C1DB 4Q1AA 5ADUS 1QCCA 3E1GA 2YQ4A 3BRQA 1E64A 2XKAA 4PG5A 3IKVA 1YMVA 4WZAE 1G20E 3PTZA 3G8DA 2HX1A 4O5AA 2WWYA 3OZ7A 5HF9A 3B51X 4RGQA 4UQOA 2AG6A 2PYDA 3TRIA 2BGUA 1M1AC 5JASA 4FZJA 4H9NA 3NHPA 3HVKA 4WXEA 3TMKA 1DG9A 4EJFA 1CTQA 3BZUA 4HNUA 4BNMA 2CMGA 2HIOB 2FPPB 2ZOSA 2E18A 4QBHA 4NTZA 4I1UA 4OHWA 3THWA 2NT3A 2PKQO 4RLFA 5CNIA 2CCKA 2PSHA 4OLFA 1E2HA 4R9RA 1MB9A 1BHSA 4Y6PA 2YYYA 3HB0A 2KE5A 1VDZA 3EN0A 5EXEA 1ZMRA 4CODB 3NWPA 3UWDA 2Y2QA 5K3DA 2FWMX 2GBLA 2AKAB 2VZ0A 4ARVA 1MB4A 2Y2KA 3D4OA 4I4IA 4MP6A 1KU5A 1ZA1A 3SEZA 4KHPB 1M19A 4V0SA 1ZW1A 3HADA 4FEAA 3R7FA 1X7DA 3D7NA 1D1TA 1WABA 5JD4A 4KE8A 2QRLA 2QRNA 3KYDB 2QKYA 2QTRA 3JZIA 5EESA 1HSZA 1KWGA 4HMQA 3JQ6A 3VDXA 2YHBA 5F77A 4RA9B 4XM2A 3RVJA 2W6JA 2OVFA 5EXSA 4CLOB 2B6NA 5JAHA 1QGYA 4DC0A 1TFUA 2FAXA 5LNK6 1A4RA 3KFUG 4CBVA 4YAOA 5EHXA 4P08A 4PGMA 1I2MA 2YXDA 4MH0R 3ICWA 1HE4A 3CUSA 4C7JA 2QV7A 4RKYA 1XPRA 2I62A 4MEAA 1V39A 4YUYA 1NI4B 5EGSA 4UMEA 3AZLA 4HFMA 5DKFA 4YRLA 3K0BA 2AE2A 1QG4A 3HNPA 3T1HB 1LBEA 3ZU2A 1E5VA 1CJCA 2IS2A 2XT9A 3PNQA 2C20A 3ZY2A 1PIWA 4F85A 2NXWA 5DTRA 3CE6A 3UFXA 2XXBA 5H02A 4FJ0A 1Q1ZA 1XWIA 4FNGA 5EQDA 4NBUA 4DG8A 5JDIC 2JLCA 3WMXA 5CBPA 2Z09A 1HDRA 4JWTA 1N8SA 3VR5A 5B58C 1QIMA 3MN1A 2W2LD 1G18A 4U4AA 3OCXA 4LKRA 3TZKA 3C7AA 3JTMA 3DBRA 2PWZA 3TX2A 3CQ9A 1VE7A 2BEKA 4BQIA 1SWVA 3GYGA 2QGNA 2E1PA 1ZXLA 2BF7A 3PC6A 4U63A 3RVKA 1PDVA 3DO6A 1LWOA 3IUPA 4L73A 3GFVA 4Y6OA 3WL8A 5IN5A 3ICOA 4BLRA 3OC6A 1K3UB 3EGVA 2YBDA 1UP7A 5LD2B 2DZDA 1TYBE 2P2GA 5BR4A 4NBNA 4KUDC 1W4ZA 1RAAA 4XIYA 4C4AA 1YI0A 1Z6XA 2Q3BA 4NNJA 3LFTA 3DF9A 2J3QA 3CB2A 3ZGVA 9GPBA 2GFIA 4KRGA 1W581 4XD7D 5T41A 2ZY2A 3PC3A 4I8DA 1JHZA 2AC2A 3RWBA 5LZ2A 2TMYA 1B0UA 4YRCA 1VE5A 2P9FA 1RQPA 5IM4A 5CITA 4L3WA 4R2IA 4KXNA 4FYVA 3QYJA 5CX1A 2DBYA 3WWOA 3RSGA 4DIBA 4BP9A 5T8KA 1ND5A 3A28A 1XCOA 3Q1KA 5JWHA 1YU6A 1L4EA 5JRGB 2ZYSA 1UEJA 3F1KA 4DV3B 1NYRA 2VSQA 3VI3B 3C7CB 1GRVA 5IT5A 5GMOA 3A0UA 4NDAA 4ZI5A 3D7SA 3CRVA 3LL4A 3DYVA 3AV1C 2HPVA 3KJFA 4IDHA 4MV6A 4X92A 5BOSA 4QX6A 5B1LC 2IYVA 5C7LO 1F9EA 1OIWA 1WPRA 2WV9A 3TGLA 2ZZNA 3IAS1 2YXNA 4RKEA 4MV7A 3NEPX 1WB6A 4MO9A 1MRZA 4N54A 3NHWA 2RGEA 3NQJA 5G3YA 1S9HA 4RNCA 2X6QA 3G7UA 2PD4A 1V16B 3FMPB 1KMQA 1KI3A 1VKOA 3FPAA 3I2JA 2J9GA 1AHNA 2ARKA 4B0OA 1OR8A 1XFDA 1LX6A 3UOWA 2X14A 1WHTA 4XYLA 4Q0MA 5BR7A 4XVCA 1MIHA 3LELD 3UGKA 1UOOA 2PJZA 1JWAB 2YCLA 5GONB 3PEYA 1VKRA 1KX5B 4R8RA 4D99A 2BEWA 2GLTA 4JYZA 1OYWA 3DAFA 4NX2A 4ZT6A 5AM5A 1RQGA 3H2IA 3TTXA 3IVCA 3MGQA 4PC1A 2GK6A 2FUG1 5EE3A 2GCNA 3Q4GA 3NYRA 3KLPX 3KQHA 1TGVA 3W79A 1KY3A 2RB5A 1ODCA 3R44A 1GKKA 2EVWX 4WJ3C 4IHQA 2IXEA 4IUCS 4A91A 3ITKA 3PRKE 2DPGA 5CW2A 2EEPA 1SXJE 3VBEA 3RK1A 3Q7SA 1G7RA 1XMXA 3B38A 2EF0A 4BO0A 1RJWA 4KI0A 3UMMA 5A5GA 2YVLA 3AB3A 3EHDA 4D46A 2NV6A 3R0XA 5KYUB 4UMDA 1OLUB 3P9NA 4ZQBA 1XCBA 3DBLA 2WAAA 1G8JA 3GIDA 1B41A 2QUHA 2CJFA 2C4KA 5CXUA 2DFKB 2Z2ZA 4BS9A 4YCBA 3W5BA 3MWGA 5SZKB 3C8DA 3OCZA 4OXXA 3A6ZA 1P39A 3RTCA 1N2BA 3DTTA 2NQBD 4EZIA 3AFNA 3DV2A 3ZS9A 1ZP6A 5U4QA 1P3FD 1PYOA 2Y0CA 3GD7A 5HUJA 4YM6D 2QRJA 1J0EA 5B3KA 5BVHB 3GRYA 1Q44A 4GT1A 3DOIA 3GPDG 5ECWA 3NVKI 1DCKA 5DTJA 2EJBA 1FIUA 4LJAA 4M3NA 3CCFA 1R0XA 4OSOA 4AF8A 3MGSA 4Q7KA 1XNGA 2QVBA 1NJ8A 2ACEA 3FDJA 1JKXA 1O6ZA 1N1MA 3DO8A 2JZOA 1OFUA 4F9FA 1XTRA 2C03A 2F3SA 1PE0A 3E23A 2F3PA 5B31C 3LZ0B 1HOXA 3LCUA 3CUVA 4WXHA 3UWPA 4OB7A 2EX1A 1E3WB 1MH9A 3HBAA 3LDFA 3WJ2A 1Q92A 2BONA 1HQDA 3UA3A 1TJYA 1PGJA 5BO5A 1CLUA 4FFVA 4H08A 1P1JA 3DDZX 2QRKA 2PFGA 2R7AA 1C30B 5EZYA 4E0BA 3QSYA 1ID3D 3BD8A 1EVYA 2B7CA 3RYFB 2QJWA 5E5AA 2IYPA 5TPWA 4YJHB 4D8VA 4G86A 4Y2XA 4CIBA 4L4UA 4DXDA 5L3SA 5LXTA 3B1FA 4P7GA 1HT3A 3DJFA 2QLNA 4W7IA 4RGYA 4W4TA 3AR7A 2A2ZA 3VH5T 2C1ZA 3JRWA 1AQJA 3OC0A 4NBVA 3ONVA 3JQBA 4LD9D 3DFFA 3RS3A 2ATCA 4EKYA 3KUYB 5F2EA 3O95A 1VLVA 1YCGA 9LDTA 1RM3A 1P5HA 3F5FA 3NWBA 5A9RA 1JQLB 3ZCPA 5KVVA 4HKTA 2PS1A 3VSEA 3FMGA 2RHOA 2YNMA 4PX9A 4AJKA 2BP7A 5E9AA 3SZRA 1E58A 2FXVA 1M8PA 3AHEA 2P6OA 2FEKA 3PLAE 4DT1B 4WNYA 3UPUA 1QMPA 4F96A 3HL0A 4QKQA 4G1UC 5DHSA 4MGIR 2FSHA 4CCAA 2GKSA 1Z38A 1SU8A 3NHFA 3HEAA 1WDLA 1RBYA 2F8MA 3SS8A 3OHPA 4QPJC 4HI0E 2YDYA 4JSRA 4R98A 5F7ZA 2WMYA 2Y4OA 4Q16A 5M29A 4QRIA 1BGXT 5CD9A 4MGYR 1KJ8A 3HC7A 1ZVJA 3PFKA 4NJMA 2HCBA 4A0QA 1O95A 3L8MA 5CPJC 1KSHA 2HT6A 4AZTA 3MS4A 2WLTA 3VZCA 2UZ0A 3KOWA 4EGCB 4M7WA 4OL9A 1D2EA 5CRIA 4J07A 3WOHA 3AHIA 4LV6A 4B4KA 1YACA 2QR3A 4KOAA 1AK1A 4JLSA 1CNFA 3O5AA 4YGXB 4FMCB 4MCAA 5JMWA 4XD2A 2B99A 3IERA 5MDHA 3LH5A 3KO8A 4GP9A 1YR1A 4KXLA 3RS0A 1C3XA 3QVWA 3JYLA 4NOJA 5I3CA 1QP0A 4UUMA 2YHAA 1YE8A 4E31A 1XZPA 1N32B 1ACJA 3ADDA 4I9HA 3D7LA 1NBMA 1X7XA 1F2UB 4YACA 2J3KA 3LNCA 1T4MA 2RI0A 3W96B 1SVKA 4CTMA 2QP4A 1CHNA 5K3OA 1VMEA 3TOZA 2AR9A 1PFQA 2W4IA 2AIRA 1WBDA 1UR5A 2HLHA 4R3WA 3BWEA 3HABA 5GT0B 2I4RA 1ZCJA 4NCHA 2EEZA 1YB6A 4FHCA 3R45B 1EHYA 3FCUB 3LSYA 2DF8A 2CL5A 4FCVA 3JYOA 5B4VA 4IIBA 3E81A 4JI8B 4JJGA 2FRDA 2SHKA 1VB3A 2DTDA 2Y2OA 4NSNA 3PNMA 2IOQA 1X9GA 1YDGA 5A5EA 5KC9A 5KOJB 2VXBA 3UJAA 3B6GD 1XA0A 2KSQA 4QODA 2QTHA 3IULA 3AFGA 3KZ1E 1BWSA 2X4IA 3DFUA 2XTZA 3TR0A 2RDMA 1KH1A 2B37A 3F46A 3IIEA 4JK3A 4F84A 2CB0A 1KI6B 2PE5A 3JYQA 5CPIB 1NXPA 4GKAA 1OUMA 1TMGE 3L92A 4MR8B 4EH1A 1CY6A 5IUKC 1SXJD 2C4WA 4ENWA 3CM0A 3K0HA 5EP4A 1UC5B 2WINI 3O21A 2B9VA 1W52X 1ZUNA 2JK1A 4ZUXA 3AZHA 3AZND 1VTKA 1UPBA 3E3LA 2X58A 4OB6A 2YV3A 1MOPA 1SQGA 4G01B 3EZYA 4K40A 2ZITA 4LY3A 1TAUA 1U7TA 1W30A 2WKSA 4AYXA 4KLAA 2Q0XA 3PLRA 4RSGA 1QR2A 2WJ4A 1LV8A 4BVFA 1SOMA 4E45A 2Y1KA 3SNKA 3CEJA 4FHDA 4TKVB 1P7PA 4Z4FA 2FETA 3KV1A 2OXEA 4KO8A 4BVHA 4C0XA 3CZCA 3SYTA 3M0EA 3LO8A 2F8NG 3MCVA 3RO7A 4LPSA 4BTEA 5HFAA 2H6EA 5F23A 3UXMA 2G09A 5FTKA 3HXPA 1WRBA 3ZWMA 2GTHA 2I80A 4MV5A 1Y4AE 3REIC 4Y6SA 1FFWA 4MVWA 4E7OA 4NBRA 3HA3A 1CF4A 3NKLA 3AJRA 3PFBA 3USCS 1LA2A 3PDWA 2J67A 3WB0A 4XUEA 2GM4A 3PC2A 2VT3A 2FZ5A 4R51A 4GI5A 4R71A 4J76A 2Y76A 4WXYB 2NSYA 3NJ4A 4H7JA 1P0FA 3B7PA 3A05A 1AU9A 1OGJA 1HMYA 4RJKA 4EHAA 3QQPA 4N12A 1MR3F 2QUKA 1EX6A 1T1IA 2AUTA 5EUBA 5CFMA 1W75A 4UNPA 1B4DA 2IOYA 2RD2A 3K9CA 1ZLXA 2PBRA 2QHXA 1FTGA 2DUUA 4B7ZA 1W35A 5A5FA 4X63A 1NURA 1BGVA 1A9OA 2POCA 4QXPA 4OQZA 1KOLA 4JT8A 1AGRA 1CUAA 4F3RA 3A7DA 1YAHA 5I9IA 5K4GA 5K5EA 1E6EA 3CS3A 3V1YA 5FORA 4J4HA 4C0JA 3OIFA 1C7QA 5FT9A 1KHHA 1BJTA 4DRXA 4MI1A 4UPVA 4CU5A 4FT2A 5FBKA 1QYVA 4N49A 3HZZA 1WMAA 5JSHA 2Q3EA 1D0VA 4D4MA 4NPCA 3SYMA 5JMPA 1WKBA 3IPCA 1X1CA 2FVYA 1QHSA 3KJXA 4PO9A 1Z29A 2ZIXB 2JF0A 3NRJA 2J4CA 2MMCA 1I36A 2HW8A 3FWZA 3NHJA 3DMTA 4OMDA 3ZIUA 3KTFA 2O2HA 3PK0A 3KQMA 4Q21A 4BX8A 4FOPA 1VHTA 4JI1B 3C6XA 1KRXA 1JAXA 2GPBA 5TEWA 3BSSA 2X2FA 3IDOA 3H05A 1Y9AA 3KZXA 5JR3A 2ZXEA 3GPLA 5IKOA 4JJ8A 2PX3A 2GA9A 1JX6A 2ZB4A 3MBOA 1M0TA 4K0KB 4G0OA 4F6RB 6Q21A 4ZVPA 3ZLBA 2X1MA 1VBNA 4LWQA 1Q12A 4N8DA 1QO0D 3B1WA 1DRKA 2O48X 2RGYA 4MB2A 1NUQA 4M9QA 4MDYA 4IFIA 3ZVKA 1Q7CA 1L8AA 3UV3A 3R4VA 3AV1A 4I5EA 1P1KA 4WKNA 1N92A 1NLUA 1ZD2P 4YJ3B 2V8BA 4FGLA 2YWBA 3VZDA 4YV2A 1S2LA 2F59A 4IGEA 5C51B 1EZ1A 1HTWA 2ZM5A 3BB1A 3V42A 1VOTA 4LOLA 2MSWA 3B2NA 3HQ4O 4RDIA 4FS3A 2ACWA 4FD3A 3FTNA 4GPEA 2WTAA 2F1KA 1GT6A 3STHA 3AN2C 4JU8A 4IHJA 1ZN2A 2ENUA 5BXYA 4MQFB 3V9RA 2ONCA 4DLPA 3IUJA 3HXOA 1O89A 3FNHA 5H59A 1PTJC 1XDSA 2VTKA 1CY0A 4LDAA 1P3KB 1Y0BA 2ZAOA 1CY2A 3REKD 1D4OA 1BHQ1 1LFDB 4CUZA 3J7TA 1Z5PA 4C0QC 2P2DA 3DDNA 1XYVA 3PFGA 3G0BA 3OI7A 5FA6A 3W8EA 2JHGA 3IB6A 2JG3A 3VR0A 3K0EA 3CGGA 1NUUA 3HUTA 3ZNNA 4Y2JA 4K6KA 2FW7A 3HUFA 3TLZA 2FJPA 1IK6A 4NBSA 1ZCAA 5A9TA 3EWAA 5BYJA 2VRBA 1ESZA 5I7HA 1O4VA 5L9AA 3NOQA 3C1UA 4F7WA 1GPYA 1VL2A 3C3WA 1EP3B 4PZ0A 4WOPA 4QD3A 5F2OA 3PGKA 1YS4A 5HE9A 2B8TA 2YRFA 4HADA 4BFTA 4ZEMA 2GRAA 4O8CA 1KDPA 3ND8A 2HSJA 1E99A 2Q0HA 4ZFNA 3L4JA 3IMGA 1TEVA 3QKRA 5COBA 2FEWB 3I09A 5DT2A 3A1DA 4MP3A 3ER6A 4F92B 2WU3A 3I2KA 3G0OA 1M2WA 3ZYZA 1P3MC 1KTVA 4PLGA 1NE7A 4B43A 4H3VA 4PM4A 1B6RA 3LL7A 5BMOA 2L19A 3GAAA 5JQGA 3DHEA 3FM9A 4KK4A 4KDFA 3WRWA 1Z07A 2EX0A 4HH4A 3MG9A 1F8FA 4LC9A 4IIXA 1E2IA 1T9GS 2WE7A 1NLMA 2W2NA 2AN1A 1A9PA 2PRYA 2W6MA 1A5ZA 2HLNA 3QLEA 3CT6A 4NFHA 1N9ZA 2DSNA 2PYOC 1Q7EA 1Z47A 4B6QA 3L0PA 3G0CA 4RJIA 4C76A 2OXIA 4RABA 3OA0A 3AH8A 3OPYB 3ZTYA 4BQRA 1R8SA 1ABEA 1MJGA 3LK6A 1YR7A 3LZCA 1C14A 3SKVA 5JW6A 2IHJA 3LBYA 1EP9A 3OFNA 5FUGA 3HWRA 3MC1A 4D79A 5LB2A 2IS6A 4Q01A 1W87A 1ZSVA 3ROKA 3FIJA 3QF4A 4AK9A 2DAPA 2HHLA 2Q1SA 3RQSA 6ABPA 1FX1A 1T0BA 2QD3A 3SQWA 1MAVA 1Y6ZA 4U6NA 4G63A 4DJTA 4DCJA 1B42A 2I7TA 1H9BA 3O8NA 1T26A 4U0KA 4UU1A 3PJEA 3MMPA 2DPXA 3FNBA 4NCXA 4LE2A 4TTIA 4L9WA 5JJLA 3FYUB 4YQZA 1C0KA 3TS1A 4QFDA 3N53A 3MYYA 2FSIA 3W7AA 5CFPA 4O4HB 3G9XA 1NUTA 1H22A 3K0CC 4M8IA 3PF8A 1GZ4A 1TUBA 3IJEB 4M9ZA 3PQFA 5BN1A 3O62D 4P5EA 2AHOA 3FZGA 5ES4B 2IUTA 3GJQA 1GITA 3G88A 5E6RA 3VPXA 3K1YA 1G0NA 1W7AA 1QOQB 2QX6A 3UWKA 4UBNA 1JKFA 4HQ0A 2AN3A 3EDCA 2GEVA 4DCSA 2A86A 3LX8A 3TU4B 3PXXA 3I1FA 1RBQA 4V02A 3FH0A 4QTTB 3ADKA 4E4YA 4TYMA 3NDRA 4XX0B 3B0BA 1OGYA 4N1AA 1QF7A 1FP1D 2ANCA 1AZSC 5ELMA 1EFVB 4S0XA 4WXMA 2COUA 1XAIA 3Q0EA 1XQYA 4AO6A 2HWUA 4OSEA 4FZ5A 4F4HA 1AGXA 1XV5A 3L8YA 5CCDA 2HJHA 4FDUA 1H3FA 2O6HA 2EOAA 4U7FA 2CHQA 3LD9A 5DHQA 1Z13A 1M19C 4X60A 1V45E 3M2PA 3IBFA 1D0IA 5F7JA 1ZJ6A 3DDUA 1FFXB 4GWLA 4W5JA 1S3GA 3VOBA 3H84A 4RJLA 1GUDA 3KSYA 2B0CA 3H16A 1TRKA 1XRLA 1MBZA 3DLAA 1T0IA 1KDYA 5AK3A 2HL6A 1E9BA 3C1TA 3NEJA 4CNQA 1Z06A 2ZJZA 1EFPA 1OXMA 4FLMA 3DNPA 2NO6A 3IR6A 2GSDA 4OHBA 3LELB 4M6BA 1JEQB 1NMYA 4LHVA 1J9ZA 1I4DD 5FO0A 4BJ5A 5E3IA 3U3XA 1SQ0A 4KXMA 1VL0A 4EQ6A 1MEEA 3MTGA 3VO1A 3W77A 2WABA 1ZVKA 1L4BA 3ZHVA 3EULA 3Q6IA 5FBWB 5I01A 4DRYA 1GQYA 3AZLC 3V7FA 3SIWA 1F2DA 4UVDA 3FN4A 2W6IA 1VA4A 4YP0A 5DNND 3WLNA 1IHXA 3TEMA 2ZT5A 1Z6AA 4M8LA 3FCOA 2XSZA 4FFNA 4MGHA 4TROA 4EI2A 3R8FA 5F1OA 2A59A 2GBFA 1CVLA 4WW0A 4QUIA 3C1CC 4Q1DA 5G49A 3PXEA 4EITA 3DTYA 1HM5A 2GN9A 2H7YA 4YLYA 1NP7A 4NBLA 3VPDA 1Z4QA 4EYQA 3H7AA 4DNFA 3RWOA 421PA 1J8FA 3E9MA 4O63O 1CPYA 2YVAA 721PA 2V7UA 3HBFA 1LLDA 1MXHA 5BWNA 1HGXA 1Y4ZA 3GFQA 3LG2A 2EZ4A 5JD6A 4FZRA 1OBOA 2NQBB 4XIFA 5ADHA 1FVFA 5FLYA 4D9BA 2H63A 1P3FB 1ANKA 1M34A 3R9XA 3VXKA 1OFTA 3CF2A 3B7WA 4YM6B 1VG9B 3P0IA 2MCFA 6CHYA 1RWPA 2NZUG 2MR5A 1C8BA 5ECDA 1CUEA 3ZE8A 5GVSA 3Q9UA 3RHSA 4DR7B 3N2GA 1G3UA 4J0FA 5EJ4A 2PUAA 2Q9UA 3S8EA 2PA0A 3QEMA 5H70A 3SS9X 5EC8A 3VYUB 4PR0A 3W2EA 3RAJA 3AT1A 2XNJA 3CLRD 3MHPA 3SX4A 4BOYA 4ZHQF 3HR7A 3KUYD 4XVHA 5ITWA 1FMLA 1IVSA 2GARA 4MV9A 4Q1BA 1QH8A 2DXIA 4EZEA 1Z17A 3IUYA 4I99A 4EECA 4LXHA 1T4CB 3KXBA 4LCJA 3UTDA 1DRWA 1R74A 3ET4A 1R16A 1EGMB 4IEIA 1R4MB 1C1YA 1T13A 1JBKA 5D3MA 1T1RA 1CLEA 3I6YA 5C1PA 3IMKA 2ZJ2A 4US2R 2AEEA 2PUFA 4DCNA 2Y9PB 3DBIA 3OZBA 2BM0A 3B48A 4BZZA 2G5CA