2ZM5A

Crystal structure of trna modification enzyme miaa in the complex with trna(phe)
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
306
structure length
306
Chain Sequence
LPKAIFLMGPTASGKTALAIELRKILPVELISVDSALIYKGMDIGTAKPNAEELLAAPHRLLDIRDPSQAYSAADFRRDALAEMADITAAGRIPLLVGGTMLYFKALLEGLSPLPSADPEVRARIEQQAAEQGWESLHRQLQEVDPVAAARIHPNDPQRLSRALEVFFISGKTLTELTQTSGDALPYQVHQFAIAPASRELLHQRIEQRFHQMLASGFEAEVRALFARGDLHTDLPSIRCVGYRQMWSYLEGEISYDEMVYRGVCATRQLAKRQITWLRGWEGVHWLDSEKPEQARDEVLQVVGAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords tRNA delta(2)-isopentenylpyrophosphate transferase
publication title Snapshots of dynamics in synthesizing N(6)-isopentenyladenosine at the tRNA anticodon
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase/rna
total genus 92
structure length 306
sequence length 306
chains with identical sequence B
ec nomenclature ec 2.5.1.75: tRNA dimethylallyltransferase.
pdb deposition date 2008-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01715 IPPT IPP transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.140 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 2zm5A02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2zm5A01
4ZDKA 2BDTA 2JJ8A 5KDLA 1T5IA 3IDQA 1EFHA 1I2DA 3KKNA 4LHVA 1M7HA 2V6IA 5J5CA 2FFBA 4KV9A 3CNNA 4B43A 1IXSB 2FFHA 1R5OA 2A5JA 4P31A 2XTZA 3QEOA 3DM5A 4IEIA 2OT3B 5IK2D 3L0IB 4LHXA 2JLVA 4UNSA 1GKUB 1E9CA 1R0XA 2XOKD 4Q01A 2XXAA 3VNVA 2QGZA 4EFMA 3PFIA 4Q03A 3LWNA 4Z8XA 1KIMA 4G5RA 4Q02A 2G77B 1LY1A 1E1QD 4U5XA 4UXHA 3HR8A 2QSZA 2AXPA 1NLZA 1E79D 3DZDA 1ZYUA 1EWQA 3LBIA 3N2IA 4IDPA 2QMEA 5G3YA 4LYFA 5JWHA 2ZI6A 3EW9A 4Q1CA 2OHFA 1WRBA 3DZ8A 3TAUA 3X1WA 3WNCA 1VG1A 4LJ9A 3OESA 3ZD6A 2AX4A 4URXR 3U2QA 4ZIRA 2IYXA 4E07A 5K8LA 3P4YA 1KK2A 2AD5A 4OK5A 2CCKA 1W0KA 1UBGA 2P6UA 4PHHA 1ZBDA 1N25A 4B2IA 4Q5IA 4XVRA 2WJIA 3QOFA 1FNNA 3VFDA 5GJBA 4I1OA 3GLHA 2KJQA 4AY2A 1PVOA 1OHHD 3FHOA 3NEJA 4RZXA 3GFPA 2AWNA 5HE9A 3NDBB 1X1SA 3EAQA 5EUQB 1RIFA 4II7A 1EFCA 1BO6A 1UFQA 2ZJOA 4JS0A 4D4LA 1MV5A 2Z83A 3QXJA 4PSVA 2JDIA 3DMNA 3EPLA 3ZGXA 4H9GA 1W47A 2WJYA 2VHTA 4GOKA 4PO9A 4XOIA 4JLDA 2IYWA 4LPKA 5HZKA 2EFEB 5C18A 4TQUS 3DEFA 2Z43A 4A0HA 3AF3A 4BASA 3PJRA 1E6CA 1V43A 2GBLA 3AQ4A 1IY0A 2NPIA 4WVFA 5KTYA 1X3SA 2G0NA 1OIXA 4C0LA 1KNQA 1Q3TA 4MITA 3A4LA 4FMCF 2OBLA 1FZQA 1XP8A 3KJIA 3N2EA 2DWOA 3QKRA 1JNYA 4EUNA 3UMFA 1A2KC 2J1LA 2QROA 2N1BA 5HTKA 1Z83A 5DLQC 1ESMA 1E9BA 1Z6GA 1OB2A 2ZAOA 3RRNA 5LD2B 2VF7A 2VHJA 1HT1E 2VHCA 5EXPA 3BH0A 4BLOA 2P65A 1UADA 3A36A 3TR5A 4KODA 3M0EA 3D7MA 4E22A 3BH7A 3NDPA 2I4IA 1LNZA 1FPMA 5AJVB 5DGXA 4CF7A 1XEWY 3PQCA 5FUYA 1O3YA 1Q20A 4A8JB 4U7DA 1MRNA 4C0AC 4BZXA 2ZETA 4JYBA 2BIFA 3AF2A 1QDEA 1W48A 3KFXA 4CEIB 1IXRC 2PH1A 1G3QA 1DBSA 2ZJYA 1H8HA 1E1RA 2VF8A 3SHFA 2FZ4A 2BBWA 3LDAA 4DSTA 5AJZA 4KI0A 3W3AA 3V9PA 4MRRA 3ZZ0A 4DDUA 4PANA 4EKDA 5F9FA 1NSFA 1SHKA 3AVTA 3LQQA 1DAEA 1XCMA 3K0CC 4TLDA 4B73A 3A1SA 3CF0A 2R6DA 1AS0A 3GJ3A 1DO0A 4YXWD 3AKEA 4JT4A 3HP1A 4IFEA 2FSHA 4NE2A 2H92A 4KSCA 1Z2CA 3LY5A 3MG9A 3ZDQA 4Q7LA 1NMZA 1ZD1A 4O0MA 4OQNA 3BB4A 2ZI4A 3EZ9A 2ZIAA 4PC7A 3TR0A 4D0LB 1YZQA 1GAJA 1ESNA 4NCNA 1GL9B 4LJ6A 4B3DA 1KO7A 3UPUA 2HYDA 1N5KA 1YZUA 1CR4A 1N3BA 2OAP1 4R2HA 4Q9LA 3VR5A 3FOZA 1I4LD 2NIPA 1XTIA 4JVSB 2XB2A 1ZINA 4G5SA 5ELXA 3FDIA 1UPTA 3U61B 4LWZA 1AA9A 3SJZA 3B9PA 4FMDF 4NKRA 3AVPA 2IA5A 3AH8A 3R9IA 1SVWA 1A7JA 3D3QA 2GZHA 4V0NA 4CEHA 4DLVA 1KI9A 3DL0A 3JZAA 4G01B 4AKEA 2XXAB 2JLZA 1QHGA 2FPLA 1PV4A 2VH5R 3CONA 2YINC 3DOEA 1J7KA 2ORVA 2W0MA 3QKUA 4TTQA 5FBQB 1G64A 1LF5A 1Z3IX 3U6KA 2WICA 5J4VA 3TGPA 3K8YA 1JR3D 2HLDA 2RMKA 4EPXA 1NNEA 1G8YA 3IIJA 2CDNA 4IVRA 4PAQA 5CLQA 3MUFA 1P73A 2V8OA 3FMFA 3VR2A 1Q1QA 1GFIA 5FPYA 4JL8A 4JVLA 4LHWA 1AZTA 4R7ZA 4YMTA 3K70D 3ICEA 3RANA 2P3SA 3ADBA 5FH9A 1E9DA 5KSYA 3T61A 5CITA 5F98A 4TZ6A 1IN8A 2BMJA 3G0HA 2WWGA 1RPZA 2ZTSA 1F2TB 4Y0VA 1E99A 5AWFC 3GLHB 2OILA 4EFLA 1UBCA 4M8NE 2VHQA 2ZRKA 2ZI3A 3IUYA 1QBKC 1P75A 4ASUA 1Z0KA 3OEHD 4PR0A 2QP4A 2QZ4A 3SJBA 2BOVA 1Z07A 1FOEB 1DAFA 5EZ5A 2QAGB 3ZIAA 1CR0A 2NO6A 5KNCA 4CEJA 3SBEA 3OF5A 621PA 1ZRHA 4M22A 1J90A 2WWFA 1IJFA 1TEXA 3P20A 1XMSA 4EPYA 1ZC4A 5M04A 2R6CA 3FVQA 2WPDD 2GDJA 4WOPA 3FHTA 4LZZA 1XD8A 2EWVA 2RGNA 3C14C 4Z51A 4OHWA 4Q1BA 2HYIC 2JLRA 1US8A 3QE0A 4OQMA 2RKOA 1Y3AA 4PZZA 1G20E 2ZITA 1U8YA 2AKYA 3LW7A 2CLSA 3QKRB 1AS2A 3CIOA 4IDNA 4FCWA 1OPXA 3U44A 1T0JB 4AD8A 1UEJA 2QGNA 3OFND 1KSHA 4HATA 4ITRC 3TMKA 3AP1A 1SXJE 4PPQA 1KI6A 2O8FA 1R0ZA 1G4UR 1G9XA 4HAVA 3K09A 1G7RA 1W4CA 1WCV1 2D7DA 2FFAA 4HB0A 3NC0C 4OKSA 2AWOA 2GJAA 1NJFA 3QQ5A 4Q19A 5D3QA 3LQRA 1W2HA 1XX6A 1E32A 3P27A 1LW7A 1ZC3A 2V54A 5IRCD 1E2LA 1G4AE 1RVDA 3FB4A 4HB2A 3RS7A 5JCZA 4PTLA 3WYFA 3NBZC 2HT1A 1Q12A 5HKKA 4Q9HA 2CXXA 2YOGA 4DRZA 1CLUA 3PIRA 5JJLA 2GXSA 5KDDA 2H5EA 4LUCA 1P9RA 4ZDJA 2ZEJA 4TT3A 3JZMA 5FPHA 1XBTA 3GEEA 2AR7A 3KL4A 4ZDWA 3K0FA 4OI1A 3QBVA 1W46A 5H68A 4GOXA 4IRUB 3RC8A 1AS3A 3IHWA 2IHYA 2IYSA 2QP3A 2I3BA 1EG7A 4JLOA 4JLKA 4LV6A 4F4CA 5L3SA 2O8DA 2F3RA 3AKCA 1QHNA 2C77A 4MGKR 3MD0A 5G3ZA 2GA8A 4EDHA 4IVQA 4RSGA 3SDZA 1GNRA 2ZSEA 1CRPA 1DADA 4CT5A 4M2LA 2G6BA 3CWQA 3BFKA 1CJKC 1HE1C 3BFXA 4KFSA 3ZLJA 2B92A 1HYQA 2ZQ5A 3I5YA 2V7QA 1RRCA 2WWHA 4KBGA 2NO7A 1Z6TA 3AVYA 4IOMA 4RZUA 3BRWD 1W5TA 2ZJZA 5LPNA 1TL7C 1DAHA 1TEVA 2QNRA 4BFXA 5DN6D 1FP7A 3LD9A 1MRSA 5DO9A 4WZBE 4RD1A 4RKEA 1ZNWA 1CEEA 3ND9A 2CL7X 4M9XA 5C46F 1E2KA 3RYTC 1GSIA 2AK2A 4X8MA 4US0R 4M1TA 4Q1DA 5KSZA 4C2UA 3I62A 1BIFA 5TDHA 2BM0A 4ESVA 3T12A 1NY6A 4DUGD 5K8IA 2QPTA 3VMFA 1GG2A 2Z4RA 4C7OA 2ZYUX 3K9GA 4FMBB 1KDRA 1ODFA 1OW3B 1CJTC 5FL3A 5TB5A 1GDDA 3EXAA 4ZKEA 4KHZA 4B44A 4EJSA 5FOWA 2BEJA 4MGZR 1VKJA 4MUBA 4FMDB 4B34A 3EPKA 2VP9A 2YWGA 3VR3A 4QBGB 2HJVA 4EPWA 1DAKA 2NZJA 2QE7D 1J2JA 3FMIA 2WTUA 1TF5A 3FGNA 5LBIA 3EA0A 2QPAA 1DS6A 1WF3A 1GRQA 4U00A 3LX8A 5LD2C 4B35A 3Q7PA 1NVXQ 2H16A 2XZOA 821PA 2ZUDA 4GP6A 3TVTA 1DG1G 2C96A 1R2QA 1GKIA 4JSYA 2IC5A 3WXMA 3OE7A 5CB8A 1IY2A 3R20A 3QXXA 3TJZA 2ZJ2A 4HLCA 4A2WA 4CIDA 4TMWA 3SOPA 4D25A 2GEDA 4WXPA 1EFRD 3AF4A 4M9QA 4XTCS 2WSMA 1GZSA 1NG1A 1ELOA 3CNOA 2IXFA 3AGQA 2RH5A 2EYQA 4Q7KA 3X1DA 3U60B 4S35A 1LFDB 1PUIA 221PA 3IPXA 4D4MA 4IJMA 4NBSA 5J40A 1FW6A 3X1YA 1U0LA 4RD6A 1FUKA 3A1UA 5AJWA 3BWDD 1S0UA 3C4JA 3UWKA 4EPVA 3THYA 4ARZB 3NBFA 4A4DA 2W00A 2BJWA 1ZNYA 4QOSA 5KYKA 4RZ2A 1DARA 1J70A 1QHSA 2D4HA 4IOJA 3U44B 2BMFA 2W6JA 2CVHA 4OBEA 1XTSA 4WAUA 1KSJA 3Q9LA 4FWIB 4E5UA 4PPNA 2ZJ5A 2O8FB 1KI6B 1P2UA 4YMSA 2MSEB 3V00A 2AL7A 1XEFA 3BBPA 2CLCX 4QNMA 3QI2A 3RAPR 4HLUC 5KHOC 1KAGA 3E5HA 4M4SA 2J41A 2RHMA 2PMKA 1N5JA 2A30A 2GZAA 1UDWA 5B30A 2GEUA 3K1JA 2ODEA 2WWYA 1BKDR 4I99A 1N6RA 3WMEA 3QNUA 3TW4A 2ONKA 3SFZA 4XSGA 4AKGA 1T8UA 4ON9A 4MYHA 1IN6A 4D26A 1MABB 3GLGA 1Z8FA 4XSHA 2RGBA 1JB1A 3RC3A 5KSPA 1PLJA 2IEZA 2HF8A 5FOVA 3LBHA 3VHLB 4DSOA 4NMMA 1SGWA 1NN1A 3R8FA 1Z2AA 1IN4A 1YE8A 2P2LA 2XB4A 3AVVA 3CF6R 1MT0A 1HURA 4BQSA 1NMXA 1KI4A 5L3SB 2AXNA 3RNLA 4A82A 3U7GA 2O8DB 1LS1A 3VHXA 1NG9A 4GBMA 4TMKA 2BBSA 1F60A 3ZH9B 1M2OB 5G53C 2ZR0A 5BN5A 4CDGA 2GJKA 1R5BA 4M9SA 1SKYB 3CWZA 2CEAA 3VR1A 3OEED 4Z8YA 5EE0A 4DB4A 4PC1A 1W1WA 4K81B 1ZM9A 4RFSA 2QT0A 1W0JD 2FU5C 4QM6A 2IS2A 1E0KA 1KSFX 4C30A 1KMQA 2W6IA 3KJGA 1T0HB 2QA5A 2H1LA 3EWSA 4HZIA 5DSZA 2J0UA 2CMKA 5DI9A 3X1ZA 2GCNA 1NLFA 3ZVNA 2PT7A 4DHEA 1FX0B 2VPPA 2QAGC 2WMOB 2ZJ8A 3GJ6A 3SBDA 2W83A 3QENA 4A6PA 5JI3E 4QBFA 4BPBA 2LKDA 2ZE5A 1GKYA 4L8GA 4A0RA 2R65A 2IYYA 1JXMA 2OEPA 4Q48A 4C7OB 3M4YA 5HCIA 2WIBA 2AN9A 1OFTA 1Z63A 4LGMA 3Q3JB 5FPKA 4BFTA 2GBLC 3RWMB 1SVMA 2A5YB 1L7VC 2F9LA 2P67A 4B6EA 4JLBA 2BC9A 3OIVA 4XD7D 1SVLA 2XGJA 5L3QB 3WRYC 2WHXA 2ZS8A 1SXJD 4B3FX 1MOZA 3GJ4A 2EVWX 2GZDA 1R6BX 4JL5A 1NBME 3PUZA 1QHYA 4ZCLA 1VIYA 2ZS7A 4FINA 1F48A 4M1OA 2WMNB 2WAYA 1KO8A 2GNOA 4LDJA 4O2LA 5EP1A 1CR1A 3PEUA 1MH1A 4M1WA 4G5QA 3VR6A 2CL0X 3P32A 1A2BA 2CK3A 2WKRA 3DHWC 2ZXUA 1JQJC 3OAAA 5DISB 5KUTA 1VDZA 1OKKD 1U8ZA 4YMWA 3UMSA 4PFSA 1YRBA 1Z0JA 4HDCA 3BC1A 1G7TA 3ZZUA 4AWXA 1XMIA 3B5JA 1U90A 1IXZA 3ND8A 2VP0A 2RGCA 2YVUA 2PZFA 3GD7A 2HF9A 3TSZA 5CM9C 4F93B 1IY1A 2ZE8A 4DWJA 3THYB 4FIDA 2QORA 2WWXA 3K0SA 1JPNA 1YHNA 3Q5EA 5LB4A 5FBLB 3O47A 2WIAA 3IKJA 4OI4A 5D3MB 3WRXC 5J4YA 4MDFA 2JA1A 2GF9A 3UWOA 1SKQA 5CDFA 1TU3A 2C04A 2F1IA 5JS7A 4G0NA 3W6OA 1XFAA 1CKEA 1XZQA 4ZDIA 3JVVA 2MMGA 3LO5A 1HV8A 4KYUA 3U6BA 1KI8A 3AP3A 5EXTA 2Q21A 2A3RA 1IAQA 3ADCA 3SJCA 4Y0AA 3GEIA 1CRQA 3U7FB 2CCGA 3E2IA 1G3MA 3L0OA 4NDZA 2W2XA 1TQ2A 3WMGA 5TV2A 1G5PA 1NL3A 2DBYA 2CHQA 2W2VA 1KHTA 3JVUA 4IEEA 4JZKA 1OFIA 3LH5A 1Z5ZA 1KMHA 1MR3F 3UATA 1GTVA 3NC1C 4NP6A 3BIFA 5IK2A 1VG8A 3A37A 5E7JA 1RYHA 1Z0IA 2XOKA 3M6AA 2JJ1D 1ZUIA 4HAUA 4B47A 1SZPA 1VYTA 5TXGA 3MSXA 3FYHA 4IW3B 4ACBA 1E1QA 2BHRA 3BXZA 4DLRA 1W7AA 2GKSA 1E79A 5CIWA 4IDOA 5J47A 1G5TA 4LCBA 2QTFA 4QGAA 2XZLA 2GXQA 2OSBA 1CTQA 1NSTA 4OJQA 1WBDA 3WNDA 2GCOB 2R44A 4NCKA 3D6TB 1M8PA 3BH6A 5EP4A 3VX4A 2ZRAA 1R5NA 4LBVA 3A1VA 4DLTA 2QU8A 3KB1A 5AJXA 4YONB 2D3WA 5CLLA 5CYPA 4QGFA 3GLIE 2GXUA 4GPTA 2FEOA 4M1SA 4Q7JB 4HAWA 4ABYA 4IXMA 1QHIA 4UKDA 1VYUA 3SFVA 1E9SA 3B78A 2XITA 1OE0A 2DWQA 3HPQA 2OCBA 2GTPA 3WYAA 1VG9B 1H8ED 2VTKA 1ZJ6A 2GK6A 1OHHA 3LRPA 1WBBA 4TMXA 4UNQA 3ZVRA 1N5LA 4KO8A 4NCHA 5A5GA 2KWIA 5IT5A 3E1SA 2PJRA 1SHZA 4NH0A 1Z6XA 3LVRE 1AQUA 5CK4A 4C9BA 1TQ4A 2ODNA 4M21A 4NU0A 1W36B 3DMDA 3AVWA 2J0UB 3AUXA 1TNDA 1N6PA 1DELA 5FUVA 4D4JA 1OV4A 4NL4H 1S3SA 4OHYA 1R0WA 3PITA 3QPVA 2RGGA 1ZUNB 3KUCA 3T5GA 5JJKA 1N6NA 1C1YA 2FPKA 2Q3MA 4XTRA 1B0UA 4P32A 2JJ2D 1KK0A 4D6PA 1HE8B 1BOFA 2JLUA 4NONA 1IOZA 1Q1ZA 4BRUA 2JLXA 1A4RA 2V9PA 2RGNC 2CE2X 1II9A 4WBSA 1X8JA 721PA 5CK5A 3RS2A 2DY1A 4M1YA 2DFTA 3CR8A 2EFDB 4HAYA 4C2TA 3B2EA 1OH7A 1XXHE 3THWB 2CL6X 3ZZTA 1JECA 3SR0A 1YJ5A 3IILA 4P4TA 1G19A 1Z0FA 3NH9A 1VPLA 3A58B 2AHOA 5KSOA 3DDCA 4QNRA 4E09A 3AKYA 4BWYA 1ZM7A 4WA7A 4F4JA 2EW1A 2JLSA 3DM9B 3P1JA 3HYTA 1H65A 1D2NA 2MSDB 1E0SA 1G16A 4DIDA 3MFYA 1OH6A 1NKTA 2ZU0C 2KSQA 1OXXK 1XB2A 3IQWA 1XTQA 4C0QC 2GWHA 3NEYA 4KXFB 3SC3A 4A15A 4B3GA 2NMVA 2IX3A 3IEUA 4KLNA 4V0OA 4KU4A 1F3OA 1EGAA 2QMHA 4RCYA 2C8VA 3FHCB 1NN5A 2C2HA 3ASYA 2QM7A 4YXWA 1QHHA 2G1KA 3K0AA 3KTAB 1IONA 3WHKA 4EPTA 1A1VA 4OK6A 4OI2A 4ESHA 4PAMA 1RJ9A 2OLJA 3KKOA 4GNKA 2G3YA 1NI3A 4XJXA 4TTPA 2C95A 3MJHA 1BYIA 2YC2C 1J8YF 4BEJA 4D0NA 2ZANA 4Q9KA 5L8VA 1ZMXA 3RDPA 1Q57A 4M9ZA 2RGAA 3OIWA 5DHAA 1GNQA 1Q1EA 2QTVB 3BB3A 2DWPA 2NZ8A 3GJ5A 2F3TA 4PSAA 3W90A 1WP9A 4D2IA 1XMJA 3DKVA 1P9NA 1G7SA 1RRPA 5FUWA 2YV5A 3QPUA 2HXSA 3R7WA 3J81k 1U9IC 2J59A 3UKDA 4YQFA 5C4GB 2Z4SA 2QM8A 2FSIA 4QJ4A 3RHFA 2HT6A 4QL3A 3SHWA 4Q4HA 1KI7A 3TNFA 5KNDA 2RCNA 2WJHA 2BV3A 4X8HA 3TUJC 4FD2A 1VHLA 2B8WA 4FXPA 1CJVC 5SZKB 5CB6A 5DH9A 1N6OA 4LJYA 4PC2A 4KJZA 1JR3A 3SE0A 2F1HA 3KXLA 2JIZD 4IFBA 4OYHA 4EQ6A 4F92B 1XPRA 3NXSA 3CR7A 1JAIA 2EYUA 2A2ZA 3GLFA 2RAPA 1VTKA 3B1ZA 5EE1A 2WVJA 2YWHA 4QBHA 3W34A 1GP2A 4G5GA 1NBMD 4TWZA 2CVFA 2A5GA 3VR4A 4D80A 2NO0A 2OBNA 4BUJA 4Q4JA 4JJKA 1Z6AA 2VP4A 2BKEA 1E94E 3FKSD 1XCPA 2X8AA 4NCJA 1EFTA 4NTZA 1MKYA 2F1JA 2YWFA 2VRWA 3UXMA 3CH5A 1VCMA 4BFYA 4DEXA 5H8WA 3EG5A 2J46A 1Z0AA 3OEHA 4OQLA 2FG5A 4ZIRB 2GAAA 1COWD 4GL2A 3T1OA 4A9AA 2CNWD 2YC4C 1OFUX 4TMVA 3FTQA 3QY0A 2A7QA 5A4JA 4B74A 1N6HA 4LJ5A 4TL7A 2XNSA 5DYGA 1UBEA 2IUUA 4L9WA 1HQCA 1DOAA 3VU9A 3NH6A 4UXJA 5EE5B 1AJEA 4KLZA 2WPDA 3A6PC 2QI9C 3C16C 4PX9A 1GILA 3LV8A 3R9XA 2BKUA 5BXQC 2OESA 2PT5A 4B76A 3PEWA 1RKBA 5FI0B 4RCZA 1SVSA 4GZMA 5KPJA 2ZSAA 3AF0A 2VP2A 1XEXA 3HDTA 3OFNA 4DC9A 5JCPA 1T3LA 2H8KA 2WJJA 2UZIR 2XEXA 2JCSA 2Y8EA 3CPJB 3PG5A 1CULC 4GRAA 2QEQA 5KNBA 3B1VA 4V0ME 2H7VA 2G83A 1W5SA 3NBXX 1FQJA 3K9LA 3KJEA 4MRNA 5FPSA 1G3IA 1XZPA 4LJAA 1JJVA 5H70A 4Q1EA 3CUEF 4QHYA 4XWKA 1MO3A 2GVZC 1RC8A 1BYUA 4LX0A 1P2SA 5KPDA 5JHGB 2P0EA 3CRRA 3O8RA 2O8CA 2BVNA 1E9FA 2ODWA 1EX6A 2P5TB 1M74A 2Q6TA 1FP6A 1LVGA 2FF7A 4JLAA 4HZUA 4B71A 1VMAA 2QRZA 3PENA 3ZJYA 1HQYE 4JBXA 3D31A 4WZAE 3PUWA 4PXAA 1E9EA 3TSOA 1KZ7B 4FMCB 1PLLA 1L4UA 5E3HA 4KITB 2PEYA 3CM0A 3F5FA 4B6FA 4B2LA 3GFOA 1RJ9B 4IDHA 2DR3A 4LC0A 1E4VA 4ZI3A 2PCLA 5G41A 4CGZA 3L0PA 2RGDA 2XNDD 2WSSD 1F2UA 2WOJA 3P26A 1GM5A 3MJRA 2QAJA 2Z5FA 5SZJA 4US2R 4EIWA 4TLBA 4MKIA 4WXRA 3I32A 4MH0R 3LVQE 3PEVA 3WP1B 2ZRMA 5IF9A 3U7EB 4URVR 3I4LA 4DCTA 1E2GA 4L5BA 4V0KA 5A0FA 5DN6A 2YYZA 4BLPA 1O87A 4BLRA 3L43A 3R7WB 3UG6A 2VBCA 5JWRA 4C4PA 1E2NA 1XTKA 3H0KA 1B23P 2XJ9A 1UKVY 1YR9A 4HUQA 3QF4A 4B3XA 4BLSA 1XD2A 2V1XA 3C5HA 3GPLA 3ADDA 4QG7A 1J8MF 4F38A 1W36C 4Q4HB 2FMXA 1KI1A 2OLKA 3CRQA 1UKEA 4DUGA 3K0CA 3V4RA 4XVUA 1Q21A 2IXEA 2OM2A 1YZLA 5JSZA 2VO1A 1N6IA 4J0QA 4QJ5A 2ZRJA 3ZVLA 1S1CA 2E87A 2IS6A 3AVQA 3QUSA 2IUSA 4YDSA 4CEHB 1VCNA 3LNCA 1ZW6A 4DLYA 1CS4C 1DTSA 4LBWA 4I1SA 1FQKA 2QE7A 2DFLA 421PA 3GLFB 3K70B 1SQ5A 1Q0UA 4Q66C 4QXAA 4OK3A 1AKEA 3T06B 1XJ0A 1IN7A 4MRVA 4TSFD 2R6AA 2X2EA 3QKSA 4MA4A 3H1TA 3KQUA 4PPFA 2G1JA 2VHUA 1XMVA 4Q4JB 4F7WA 1G8HA 4R9UC 5TY0A 1T8TA 4K8OA 2A9KA 3NG1A 3B9QA 2NGRA 2ASEA 2O0HA 4NPHA 4DKXA 4Q4AA 1IM2A 1EFRA 2BBTA 2R6GA 1P60A 1D2MA 2ZVQX 1G291 4A0FA 1GRNA 4KYIB 5TVKA 4DIEA 4LSGA 1G6HA 2IYVA 2VQSA 4P3YA 4Q4LA 4XVQA 3AKDA 1KSGA 3WBJA 3VU9B 2BM1A 1IQPA 2X2FA 3CNLA 5UKDA 2H18A 4UXIA 4AURA 4BLTA 5EJEA 3WYGA 1S3GA 3CKLA 3EARA 5FBVB 2QQEA 4A8JC 1ANKA 1W44A 2GEVA 1MO4A 2FEMA 2ATXA 3H2YA 3QXCA 4CEJB 4B3CA 1DAIA 5GADl 4MRSA 1QHXA 2HCJB 4B75A 2QP9X 3GMTA 3I92A 1XEXB 4POAA 3QPWA 3A8TA 4GFDA 1E2IA 3GJ7A 1U0JA 4JJZA 3ZYCA 3T1TA 4LI0A 4TTRA 1YZTA 3VTKA 3AVOA 3LXXA 3KKMA 3B7GA 2J7PD 1KO1A 1A5TA 2OCPA 4JT2A 3WNBA 1R4AA 5F3WB 1US8B 2ZRLA 4R71A 2CCJA 3HJNA 2O8BA 1ZIOA 1IBRA 2A5FA 2ZS9A 5SZHB 5JFGA 3ASZA 3TUIC 2J5XA 1UF9A 2VP6A 4LYHA 2FN4A 3N5CA 3RS4A 3AEZA 3L8ZA 1M7BA 1N0VC 1FNMA 2QPOA 1E0AA 1YR6A 1KK1A 3UIEA 2F55A 5FTJA 1IHUA 4M1KA 4EPRA 1GITA 5EP3A 1LS6A 3O8CA 2PJZA 4JYCA 2JASA 1ZAKA 3KKQA 1XF9A 3LBNA 2YHSA 2P6RA 1VYVA 3DVLA 2ZAMA 4L4UA 3EIHA 4KBFA 5E4FA 3GLHE 1P62B 2PCJA 2REXB 4MKGA 2JLWA 3BGWA 5KOYA 4D4KA 1FTNA 5JECA 3L8YA 2QMUA 3LA6A 4NYJQ 4D82A 2B7CA 1SULA 5JJIA 3K9NA 1ZM3A 1UAAA 4MYUA 1II8A 3C5CA 4TYYA 2BMDA 3AV0B 2GJ8A 3OEEA 3K0FB 1II0A 2FOLA 1K5GA 1YR7A 1RYFA 4B32A 2BBOA 2ATVA 5AR1A 4IVPA 1NN0A 1YZNA 1TQDA 4KFUA 1ZD9A 1W0JA 4UJ3A 2JGNA 3CX8A 1RZ3A 3MMPA 2FV8A 3B1WA 3LFUA 1OXSC 3CRW1 5JZVA 3NHBA 2ZE6A 3B82A 4FI3C 5FFMA 1U0HC 4C0KA 4ZO4A 1U94A 2OO7A 2Q3FA 1KI2A 1HT2E 1RRFA 1G7CA 1FMJA 3BORA 4PQFA 3A1TA 3PVSA 5E95A 4WIAA 3AB3A 4UNRA 2R8RA 1K5DA 3ECCA 4R98A 5DI3A 3OZXA 5FBRB 5FBWB 4JBWA 4CRWB 5C1BA 4NHOA 2ZE7A 3IQXA 3D8BA 1TMKA 2NO1A 2PZEA 4URUR 4HLDA 3EC2A 2WBLC 2XSZD 3K0EA 3KZ1E 4OI0A 4PQYA 1HH4A 4P33A 1X8KA 3TAHA 4XD7A 4BZPA 1Z28A 3MRSA 3M1IA 1SXJA 4AYWA 1OYWA 4BE7B 3TUZC 5FOUA 3MWKA 5E7MA 1PJRA 3KQLA 1L4YA 1Y63A 3F0TA 4I81A 1X8LA 3QKSB 3RSOA 2F9MA 1TUIA 1FFHA 1F5NA 3RWOA 2PLRA 4PHFA 3P4XA 3W8NA 5DYIA 2E9SA 2EFCB 4RKFA 4DZZA 1TADA 4EJSB 4Q18A 3SS8A 4G3XA 2ZRPA 5JS8A 4Z1MD 1K8RA 2RGEA 1M34E 5FI1B 2IF0A 4Q4AB 2F7SA 2IYZA 3FKQA 1OKKA 2V6JA 1NIPA 1UM8A 2QENA 2AFHE 2ZRCA 1Z22A 3PUYA 4QRHA 1SVKA 1NP6A 2ZRHA 2H57A 4ILEA 5EZ6B 5SZIA 3CRVA 3ICQB 4M1MA 1XD9A 1G8GA 2REOA 4TMZA 3MGCA 3I72A 5FTLA 3IO3A 3IBGA 2WWIA 1CP2A 1T5LA 521PA 4OHVA 3BK7A 1D9XA 5BW8A 1AK2A 4GP7A 4WW0A 5F2EA 1XU4A 1N2CE 4IHQA 5AJYA 4OHZA 4LC1A 2BEKA 1EFUA 3KX2A 1KOFA 5AK0A 4BFUA 4LHZA 4AI6A 1V5WA 3CF2A 5EXSA 3CX6A 5GJCA 3G82C 5JRZA 4G1UC 3VQTA 1R10A 2W58A 4TN1A 2ZSBA 4A1FA 2ZUBA 2WJVA 1E2DA 2O8BB 4BLQA 2IWHA 4V0LA 3FPAA 3E70C 4OJKA 4AG6A 1CU1A 2DFKB 1KK3A 1KO4A 2UKDA 2ZJBA 3AGPA 4DLUA 5EP2A 5EUMA 4H1UA 6Q21A 4NZYA 1U99A 2GRJA 5J4KA 3U5ZB 1LB1B 2JJ1A 2OG2A 2QTHA 1KDTA 2L0XA 2ZRNA 3TSWA 2O52A 2FPMA 4IKEA 1P61B 1G3RA 2GJ9A 4HUTA 4BECA 2Q9BA 3QJYA 5LB2A 1VCIA 1X6VA 3DO6A 5F9HA 1E2MA 1L8QA 2Q9AA 2HDNB 3BERA 3HU2A 1R8QA 3U3RA 4KVAA 4L15A 1TF7A 2IYUA 1WXQA 3KXIA 4ACAA 2VL7A 3TRFA 1TF2A 2ZJAA 1KDOA 2LKCA 2VLIA 3BS4A 4TLAA 1E2QA 5KDOA 3L82B 3GLGB 3BFVA 5HE8A 3NVAA 1JQLB 1M7GA 3U3OA 1GWNA 4W5JA 1X86B 3FMOB 2R9VA 4RD2A 3Q5DA 2GAOA 2GESA 2FSFA 4HLQB 4F91B 1H8EA 4MGIR 1ZCAA 4O3MA 3K70C 2QY9A 4MGYR 4DSNA 2GJSA 3TE6A 1GNPA 5FL7D 2J9RA 4DLSA 2LWIA 5EE9A 3GJ0A 4HLUA 5H1YA 3QG1A 2OFWA 3SNHA 4JLPA 2PL3A 1TAGA 1Z6YA 2OAQ1 3R9WA 3W6NA 3B6EA 3TQCA 4NYIR 2XAUA 2X19A 4FW9A 2IYLD 2R6FA 3MCAA 2YWEA 3OHMA 4PO8A 5ANRB 4HSEA 5HZHA 1G3UA 2NQ2C 5JHHB 1EX7A 1ZCBA 2F6RA 3HYRA 1OXTA 4QC2A 4GOJA 1QVRA 1JEDA 4KSBA 3GQBA 3I3SR 1P7CA 3SI7A 2ZM5A 3CZQA 4M0LA 2ZUCA 4RFSB 1ZNXA 1FTSA 2RHDA 3IHLA 4FCTA 5DI3B 5EQTA 4C0SA 1QF9A 5EXXA 2WKQA 3ADKA 2CJWA 3TIFA 4DLXA 2JJ2A 2VSFA 4LY6A 4A92A 4TLCA 4Q1FA 2J45A 3KB2A 2OCYC 4PO1A 3AVUA 1OH8A 4TL8A 3ZS8A 2G88A 2EFGA 4GMDA 4PC6A 2CHGA 1OFHA 3CB4A 1JEEA 1SXJB 2QN6A 4A36A 1P72A 1G1MA 1TX4B 2OBMA 4V02A 4AYXA 3KQHA 5K8TA 1P3JA 2DHRA 5KO2A 1D8TA 2B8TA 5FR1A 1HY3A 5K8UA 2PLFA 1HEIA 1YR8A 2DCUA 4DBLC 4NYMR 2HCBA 3REGA 4GT1A 1Z06A 1F2TA 2IF2A 4HDQB 2AK3A 2YKGA 3SQXA 1OIVA 2QG6A 1G5RA 2IHBA 4TL9A 4CYMA 4MDEA 4IDQA 4JBYA 5JWOA 3Q8XB 2P5SA 2QBYA 1IN5A 3AUYA 2QAGA 2ODBA 3T34A 1RFLA 1W0KD 3K09C 1ONBA 5FTKA 1SKYE 2GETA 1VCOA 3VKHA 1G41A 1W4RA 2O5VA 5JEEA 3IIMA 3W5IA 2KI5A 1U8AA 3GJ8A 1P5ZB 1PZNA 1D5CA 4HB3A 1U81A 2VYFA 1G8FA 2OXRA 2ORWA 5BQ5A 3TQFA 2C78A 4MUAA 3B85A 3RRZA 4DCSA 1JR6A 3CO5A 1YZGA 4KFTA 1DE0A 1EWRA 2ZRGA 1DAMA 2JDID 2W2TA 3WBKA 4ERNA 4LJ8A 1XJQA 4CT4B 4EFNA 3W3ZB 2Z6VA 4DLWA 4KFRA 4URWR 2FFQA 1G21E 3HPRA 3UANA 3BB1A 4WZ6A 1NRJB 2OCAA 2IL1A 1G8PA 1XRJA 2ANBA 1EXMA 2XTMA 2FX3A 4W9MC 1M1YE 2DPXA 4AKIA 4AIIA 2F1RA 1G17A 5G40A 1N0WA 1E4YA 121PA 2KE5A 4QM7A 1KI3A 1E3MA 4JKIA 3DOFA 3X2SA 2OE2A 2V3CC 3RABA 2D62A 1NKSA 5C2JB 5KU1A 3U4QA 1JAHA 5DNYB 4TL6A 2BMEA 3EIEA 5JMTA 3THXA 4H1VA 1NF3A 2B7BA 2BJVA 1E98A 1JPJA 1T91A 1XEWX 1TQ6A 3FFBA 5J4LA 1KMHB 1HTWA 1W2GA 2F43A 1AQYA 4LV5B 3TW8B 1P2TA 3T5DA 2JIZA 4Z54A 3U7HB 3O8BA 4RJLA 3ZQ6A 1LF0A 2ZPTX 4B33A 2AD1A 4IOLA 4LBYA 3L2OB 4BFVA 3T1VA 2GXAA 1S1MA 1PLKA 1FL9A 3AM1A 1IJEA 3FWYA 3PXGA 4NCIA 1H8HD 1E1RD 4DCVA 1NVVQ 1NBMA 4QGGA 3SQWA 1OH5A 3QKTA 5BWMA 1KKLA 2ANCA 4MQBA 5EE3A 3BD9A 3KXKA 1R0YA 1YRAA 3FKSA 1KJYA 3FFAA 1P2VA 2NOAA 1KJZA 2FE4A 2QRNA 4N3NA 1YVDA 1XCGB 3PR1A 4GMXA 1AN0A 1AZSC 1COWA 4NYJR 3CBQA 2N46A 2WOOA 2OZEA 3U3MA 2CNWA 2KBFA 4EJSC 5B57C 1KAOA 2OV2A 3EX7C 2RB4A 4P4UA 2FDCA 2MMCA 4LBZA 1WMSA 1C4OA 3FMPB 4UNNA 1L2TA 3C7KA 3NHAA 4V03A 1XTJA 3BOSA 3MWYW 1CBUA 2FSGA 1T9HA 5HPYB 2J7KA 2P6NA 1VECA 3B60A 1DEKA 2VP5A 2GCPA 2CJWB 4X8LA 2I1VB 4TQ9A 3RSLA 5FTMA 3ONWA 3F3YA 2ZYWX 4PQRA 4URZR 2ZI5A 4CVNA 3CPHA 4U02A 4W5WA 1I2MA 4JSTA 3THOA 1CF4A 3CPEA 3SYNA 2N42A 3NWJA 4LJ4A 3QSYA 1MO5A 5E7IA 1P6XA 4B48A 3GLGE 5B2ZA 4ZCIA 4C3ZA 5JI2E 1YZKA 4URYR 2D06A 2VIIA 1E9RA 1GL7A 4FCVA 1P9WA 2D74A 1XDBA 3B13B 2HLDD 3EPJA 3LXRA 1KDPA 4RD0A 1XJCA 2IYTA 2XTNA 1WB9A 2Q0HA 2OFXA 2EFHB 1JI0A 3EASA 2V55B 5CJPA 1E2JA 3WHLA 2TMKA 3RS5A 2GK7A 3QIAA 1QVAA 2QBYB 1OXUA 3GEHA 3I8SA 2ZRFA 5BN4A 1ZP6A 3NBYC 2WM9B 1E2PA 1AM4D 4RZ3A 2IYRA 3LLUA 1VG0B 2HXYA 3W8RA 4F4IA 3KQNA 1KJWA 3ZVMA 2WJGA 1RE0A 3W6PA 3KUDA 4DVGA 3SZRA 5FUXA 2NG1A 1N5IA 3GLIA 4AG5A 3I5XA 1E2HA 1NVWQ 2IXGA 2R62A 3EWAA 3AF1A 2G0TA 4ASUD 4ARZA 3UG7A 2CHVA 2WWWA 3FE2A 1W49A 1CJMA 4L16A 4EAQA 3ZIAD 3CX7A 5B64A 2XNDA 4DLZA 5AUOB 2XX3A 2WSSA 3I8XA 1CXZA 1OLOA 1ZM4A 1W4BA 2FJUA 2SHKA 4JLMA 1XNJA 4JLJA 3WY9A 1CR2A 4BFZA 3QBTA 1QHHB 3VNUA 3K0AB 2FA9A 1TUEA 2NTYC 3C15C 5DE3A 1JJ7A 4JVNA 4O2RA 1G18A 1T3HA 4RY2A 2DYKA 1CJUC 3AVXA 1KGDA 4D81A 4NYIQ 4AKHA 3S1AA 2ZRBA 4DSUA 4XWAA 3L0SA 3O8DA 3EA5A 4LJ7A 5FOSA 2ZR9A 2PZGA 3Q85A 2ZYVX 3T1QA 4DXAA 4C0JA 4QBIA 2IYQA 2JEOA 1DO2A 2C9YA 4Q47A 3H84A 3U4QB 3TK1A 2IS1A 1KO5A 1JXOA 3THXB 5GVSA 1BH2A 1DAGA 3C41J 1YQTA 2FNAA 4CW7A 4N1AA 1E2FA 1KYIA 4MKHA 4TLEA 1MABA 3CH4B 2JAQA 1ZM2A 3HR7A 4XIGS 3ZQJA 2HV8A 4I4LA 2EQBA 2F43B 2PX0A 1BMFA 4YMVA 3SYLA 5BYKA 4OQXA 3PEYA 3I1FA 5L3RA 1YU9A 1ZVQA 4PHTA 2ZU6A 1CIPA 2CBZA 3W9YA 3GFTA 1AIPA 3CRMA 3LW8A 3TKLA 3UK6A 3OIYA 5HCNA 1XXHA 2JLQA 4PZYA 4TSFA 2O8EA 3NIBA 2WV9A 1E69A 5GJVC 5HKKD 4BZQA 2FGJA 2O0KA 3QXHA 2GILA 4UNPA 3QG5A 2PMDA 4JIMA 3I61A 1SXJC 2PX3A 4LRWA 2ZRDA 5IHPA 2A78A 1BMFD 4TT3D 3MWJA 4EQ6B 1UEIA 1UBFA 4NYMQ 1ZNZA 4BEBA 3NTUA 4P4SA 4QHTA 5AUQA 2C03A 1ZIPA 2ZREA 3W5JA 4JL6A 1U9IA 2C99A 2HJGA 1F6BA 3Q7QA 4B3BA 4DJTA 1Z29A 1M6NA 1R8SA 1A82A 2D2EA 1Z47A 2ORIA 5CDFE 1Z0DA 5BYJA 2VSXA 3T15A 2W0SA 3KDSE 4GI7A 4AK9A 4C0HA 1JBKA 4PPGA 4HB4A 4XH9B 4DB2A 4LHYA 5FOTA 1FX0A 2OFOA 2IUTA 2V7QD 2PEZA 1AKYA 1VIAA 4TYQA 4ZV4A 4Q1AA 1ZUHA 2WKPA 3BE4A 4M53A 4MKFA 4TYPA 1KTVA 4G5OA 2DB3A 2FH5B 5CIQA 1DVRA 3IIKA 3RS3A 3NKVA 2D2FA 1Q44A 5JEDA 4AYTA 1K6MA 2BWJA 2FWRA 2J0QA 2J7PA 3WP0A 2ERXA 4OQFA 5L3QA 1AGPA 3PV0A 1SVIA 3TLXA 5CM8B 4RVCA 2ZI9A 1LTQA 2AFIE 4PC3A 2ZR7A 1FUUA 4DCUA 4DDVA 4TMTA 2LCFA 3PCRB 3MAAC 1AGRA 1N0UA 4X8OA 3MLEA 3EC1A 2B6HA 3A4NA 1EK0A 1QG4A 1XPOA 2YOHA 3B1YA 2XJ4A 3HWSA 3F8TA 4DT1A 2D7CA 3G5UA 3EPHA 2JLYA 2CLDX 3K9HA 4A0GA 4DEYA 2Q9CA 1Q3HA 2YOFA 1QZXA 1YKSA 3V4FA 3HU1A 5FTNA 4JMPA 3U3KA 4DCNA 2UVQA 1TPZA 2B21A 3EZ6A 4PSKA 4UJ5A 2ERYA 4OHXA 3GLIB 2DFNA 2GVDC 3RRMA 3ZS9A 2O8CB 3OE7D 4MYCA 2EU8A 2PBRA 5IDVA 5B58C 2WAXA 1I4DD 1UDXA 5C4MA 4HZUB 5D3MA 3VX3A 1UKZA 1NN3A 3H86A 3GP8A 4GDFA 3UMRA 2QQ0A 2J0SA 2KB0A 3EZ2A 2X1VA 4QFMA 8OHMA 3DKPA 3KKPA 3X1XA 2VEDA 2EWWA 3BAFA 3C8UA 3RS0A 4BGDA 1U2RA 4KCGA 3IPYA 4Q00A 4I1VA 4QKQA 5GJWC 5CYOA 1OB5A 4LV8B 4Q9IA 1VHTA 3S1AB 2ZSFA 4YDHB 4TZ0A 1S9HA 4Q9JA 3SEAA 1XTRA 2YZ2A 1QRAA 1F2UB 1D9ZA 1Z08A 2ZI7A 4BFWA 2W6JD 4IOKA 3TVDA 1XPUA 3A1WA 2HUPA 2JATA 2YNMA 2GHIA 2V4ZA 3DPUA 4P0TA 3I73A 4MYTA 1P4SA 2ZYTX 1GL6A 2QMOA 4JLNA 3QF7A 1J99A 2QSYA 2OUKA 5FPTA 2FZLA 1XWIA 1UKYA 1FMLA 2XSZA 4JVMA 4JKYA 1HA3A 4RD4A 4XWOA 5L3VA 5FR2A 4FN5A 3KJHA 1S8FA 1E9AA 1W4AA 2GCOA 3QF4B 3Q72A 4HUQB 1XD2B 4LK2A 4LYJA 4UQOA 2NPFA 3RRYA 4BRWA 4TYNA 1PUJA 1NLYA 1S96A 2E1RA 1OF1A 4N0EA 3OIUA 2MSCB 4E03A 2QUZA 2UZ3A 3CLVA 1XXHB 4Q21A 4V0MA 4C0BA 1UJ2A 2J3EA 2NO9A 2ZSDA 4A6XA 2O8EB 1NJGA 1GVNB 4PZLA 2REBA 5JSZB 3PUVA 1KY2A 3AP2A 3T35A 2IS4A 4HEJA 2FGKA 2Z0MA 5JBQA 5HR5A 2AKAB 1T4GA 4JLVA 4GZLA 3LAWA 4P4SB 4Z1MA 5JRJA 5BN3A 5AUPB 3QXSA 1TTTA 3CW2A 1KKMA 1EESA 1OIWA 1QG2A 1NVVR 3SN6A 3RLFA 4A2PA 3KQKA 4S2EA 1KY3A 2BCGY 2BCJQ 2IK8A 1T6NA 3HU3A 5JLJA 1ETUA 1WQ1R 4TYWA 2J87A 2IW3A 3VKGA 2IEYA 2H17A 4ZI2A 2V1UA 1OSNA 2R2AA 3MWLA 4QGHA 4IXNA 2WZQA 4PHGA 3IEVA 3TBKA 1Q22A 3ZD7A 1C9KA 1NIJA 1LV7A 5J4HA 3GJXC 1I4TD 2K5UA 3N70A 2VSOA 2VA8A 4LPSA 2ZVPX 1S2MA 1GUAA 3QVUA 2W6ID 3WMFA 4PAOA 1W36D 4KVGA 2ONJA 2C98A 2J0VA 1KNXA 1N6KA 1WA5A 1ZU5A 5TARA 5P21A 2C9OA 3IO5A 4W5HA 1E0JA 1E96A 2ECKA 3VAAA 3SYKA 3SJAA 2QL6A 1GRRA 2CE7A 5AUNB 3ETLA 1E2EA 1ZD8A 3KFVA 3U3JA 3LX5A 3IGFA 3THWA 1X1RA 1S4QA 4A2QA 2ZRIA 1TU4A 1NMYA 4CZ2A 3QEJA 1U98A 3B8HA 3TH5A 1JR3E 3SU8A 2KBEA 2XZPA 1R7RA 4B2PA 1OXVA 1N6LA 1KZGB 1MO6A 3B1XA 4HYYA 5LDDC 4OL0A 4HAZA 1T3SA 4KAXA 1DG3A 2O0JA 4DT1B 3GLFE 4N0DA 4YLGA 1Q1BA 1OT3A 4YC7A 4DDTA 1D2EA 1S9DA 2Q3HA 4Q7MB 1SVOA 4D0GA 4ZPXA 1GIAA 1RRGA 4FWTA 3EIQA 4A8JA 2IBMA 4YMUA 2I1QA 1BS1A 2A5DA 1OJLA 3CZPA 1HUQA 4CEIA 4HDOB 1D6JA 1G6OA 4I1UA 4ZCMA 3KTAA 4RFVA 2IT1A 1NVUQ 4TQAA 3QVVA 2CK3D 4W7SA 4HI0E 2GF0A 2X77A 2YJTD 3PUXA 3OAAD 4L9SA 4LYAA 2G9NA 4HAXA 4GSYA 5CJ2A 3A4MA 5GVRA 3REFA 4BFSA 3EZ7A 1DPFA 2OXCA 5FL7A 3IBYA 4AC9A 3VKWA 1WE2A 4RD3A 3EZFA 2RGXA 1GOTA 2HEIA 1ZU4A 4O25A 5DHFA 1JALA 4K46A 4MRPA 4R2IA 2C9CA 1NY5A 4US1R 4ZKDA 3LLMA 4LOAA 5DIFA 2ZROA 1II8B 5TMPA 3H4MA 3RVBA 3GCGA 2QT1A 4QHSA 4DDWA 4QJ3A 3BJIC 1OYYA 2C5LA 5FOXA 2IWRA 3K53A 1RW4A 1WDTA 3R8CA
chains in the Genus database with same CATH superfamily
3HB1A 1B73A 1EFHA 1I2DA 4ABTA 3CCFA 3P8ZA 3WK6A 2FFHA 1X1TA 3QEBZ 1Z17A 1OROA 1AK9A 4Q01A 2ZTLA 3VNVA 4MWTA 2ATEA 1U3DA 2AXPA 1A8HA 1XN1A 1NX9A 3EXG2 1TVMA 4I4CA 4ZAYA 1YULA 2H2IA 3CCBA 3VU1A 5ESWA 4Q05A 3SHVA 5HQTA 1UBGA 3REJD 1FNNA 1OHHD 4MRMA 4RZXA 3Q0IA 1C4KA 2IJGX 4JASB 1E3JA 4BS9A 5BPFA 5JNLA 4Y2VA 4CG2A 7REQB 1IY0A 4WVFA 2LCIA 4C0LA 3WRYA 1U7PA 1RLIA 5HK9A 1E9BA 3FFXA 2CC2A 3AFOA 1NX6A 3A36A 2V98A 3EMVA 2BFPA 1FPMA 2VYNA 1KX4D 3OZ7A 4C0AC 3FROA 3GRVA 1Y4UA 3GVIA 1DV1A 3HA5A 2PH1A 1E1RA 1V4BA 4I1PA 2BBWA 3KYDB 5GZ1A 3FDDA 3AXSA 1QP7A 3AKEA 2VHVA 2FHSA 3MRXA 1YONA 4O0MA 2PRYA 4MCHA 3FVTA 3KUYA 1PJ3A 2O7SA 1V8PA 3UPUA 3AZGB 1KVQA 3K2IA 3SJZA 1PT7A 3NATA 2RGWA 3ED1A 4DLVA 3M4JA 1KH2A 5AV6D 4HYTA 3BRSA 1FS4A 1THTA 2YINC 5CT4A 1QFJA 1VP3A 2NP6A 1MHPA 1LF5A 3KYIB 5H4GA 3M6IA 1GTZA 4N7BA 4PAQA 3EVTA 4QUHA 3FMFA 1Y7IA 3VH2A 2OMEA 1RPZA 3GLHB 3DWFA 5KVSA 1IDOA 4YN3A 3A9CA 2QP4A 3D6VA 4M6BA 1ATIA 3PEFA 1J90A 3O8OA 1P4GA 4EG5A 3UT9C 2R6CA 1LPNA 4Z51A 1LPOA 3QE0A 4WXMA 4ZANA 2AKEA 2PPVA 1X80A 3RBAA 4FPXA 4LZOA 1K88A 2O8FA 2J4FA 1BA3A 2AROB 1W4CA 3TU4C 1INLA 3QVXA 2AWOA 3BXHA 1RFGE 4Q19A 2PQ2A 4YRTA 2R00A 5JROA 4S3MA 3QSGA 3ZJUA 1CDDA 4DTCA 1CLUA 3P2MA 2H5EA 2V7EA 4QASA 4TT3A 1LRJA 1JT2A 5FPHA 1E7YA 3GEEA 1I7PA 5JVDA 1ENZA 4IRUB 4PG6A 2M1XA 1Y5LA 2WYVA 4YCCA 2WEKA 2GA8A 4IVQA 4RSGA 4M2LA 1M6HA 4OKIA 1GCIA 3NAGA 1RCTE 2JBAB 4FLMA 4R1SA 4PGFA 1IBCA 3I62A 3NTVA 1XZBA 3WS7A 4LZLA 2HQSA 4C7OA 2IEDA 3F5SA 1AHIA 1WSWA 1Z8DA 3OTQA 2R87A 2HDOA 3VTZA 3QUAA 2WTUA 3I01A 1VPEA 3Q7PA 4MYRA 2XTAA 4GP6A 2C96A 4G9EA 1IY2A 5CHYA 1P3GB 1IHXA 3GJTA 3ZWOA 3PJEA 4HLCA 3S28A 4J9VA 4D25A 2GEDA 2YXEA 3PWSA 4YYZA 1LJUA 3VNSA 5BVGB 3BREA 1FUKA 2HWWA 1I36A 2W00A 3DD1A 1Z5NA 3INRA 2HFKA 1XDUA 1YI1A 3HDVA 3Q7EA 1MEOA 4KQ9A 2CVHA 4WAUA 4PPNA 4J8VA 2A92A 2P2SA 1OVMA 4PTZA 1Y5IA 2V9CA 3AEXA 4XWYA 2JIQA 3OKCA 4XSGA 1GUBA 1IN6A 1Z8FA 1OPRA 4RA9A 4EJFA 1MT0A 4BO7A 3DXZA 1BE1A 2F8MA 4M6WA 2B4YA 5IVIA 3WLMA 1M2JA 2HA4A 3OEED 5IABA 1C29B 4ZUXB 1X15A 3IJRA 1W0JD 2P8SA 4L08A 2RKWA 1BGWA 1V7ZA 1KMQA 1R0BA 3PNMA 1FNCA 4DHEA 4LXHA 3O2QB 2WZBA 2AEFA 1ZUNA 2R7AA 2WQ6A 2JD0A 3QENA 1JXMA 4Q48A 3H05A 4ZU1X 1OOEA 4K9KA 4GZ5A 1ZJYA 1SXJD 1PR9A 2V97A 1JFLA 4MWEA 3E0XA 2QR2A 2C20A 4FINA 1F48A 1PW7A 4JNCA 3I64A 3PSAA 3CT4A 1S7GA 1A9YA 3PDCA 3B5JA 3TMYA 2DWUA 1U2QA 4LJRA 4G8DA 1WHSB 4UEKA 1R3UA 1E1KA 3NQJA 4JUBA 3VHQA 3AP3A 3SJCA 3GEIA 2J3JA 3L0OA 2QD5A 4L27A 2CFIA 3BG5A 1ENYA 1GN9A 4DNPA 1DXYA 2ZUSA 1AKVA 1MQSA 2IIVA 1E79A 1G5TA 2H7YA 4MVJI 3FCSB 3MIIA 4ABYA 3PDWA 3SFVA 3EB9A 1PFGA 4YAIA 1PGNA 4IIHA 5H81A 1SHZA 3CSUA 3PDUA 4C9BA 5MN4A 3GX1A 4UAGA 4FOLA 2LBPA 3MWFA 2QVYX 1BRTA 4X7RA 4PYQA 3PKZA 1RXSA 1QWOA 4D6PA 1SVNA 1A4RA 5BYAA 2ZBPA 2BUCA 3HFRA 1I0IA 2WA2A 4RTQA 2H6EA 5JS1A 3CZ5A 3HZZA 2WZDA 5JNTA 3OWHA 4R31A 4WA7A 4F4JA 1XRNA 1XTQA 2GWHA 2A1UB 4GHWA 3PNQA 3QITA 1TKRA 5TQ2A 2QMHA 2C8VA 3QVMA 3DBOB 1UXGA 4EVIA 3QWAA 4CM1A 4ESHA 1U8CB 1FDVA 1BGXT 5F99B 3V8MA 1I51A 1XKQA 5DBOA 1QLJA 1J8YF 4WLFA 1HQ3B 4L4XA 3FPKA 2NZ8A 2ID9A 3R3YA 2F3TA 3JALA 4DADA 1U0SY 3H5OA 1WP9A 3ZHVA 3RHTA 5I5GA 1VRVA 2YV5A 3GHHA 4J16A 3KD2A 4IUDS 4IG9A 1DC6A 1LK7A 5ALTA 1IJBA 1Z16A 3GPCA 4AB1A 1L7OA 4AU1A 3GUYA 2UYHA 1MN6A 3VC3A 4QJIA 2H08A 4QIHA 2ARKA 2AS0A 4EHLA 5H80A 2O3SA 4QBHA 2CF6A 4L28A 1U65A 1M1UA 2PRJA 1VJRA 4U7WA 2XZTA 2YWFA 3OZGA 3W06A 4UE3S 4L4SA 1DEXA 2OSVA 9ATCA 3SY8A 4EJ2A 3RJ5A 2Q6KA 4PN7A 3LOQA 2ERCA 1R66A 1RHQA 2X5OA 3NONA 2FN8A 5JRGC 2PUJA 2BKUA 4F9EA 5FI0B 4W5OA 4R9NA 3HDTA 3ZE0B 4EG8A 1RACA 3IALA 2Y8EA 5KNBA 2H7VA 1KAQA 1SUDA 2Q1WA 2G83A 4LJAA 2GA9A 3IAS1 1C8BA 4DDHA 2RHTA 4DMLA 2D0IA 4PU0A 5FWNA 3N2LA 1EE1A 2FTKE 3OQ1A 2WYIA 3JSXA 4EKEA 4QUGA 1G59A 1PLLA 1XRPA 2KX7A 3T9FA 2PEYA 4Q3DA 4CQLA 4AJNA 1T9DA 3N7UA 1J6UA 2QAJA 3AZFD 2ZAIA 5IF9A 4TPKA 2AN3A 4G8BA 2C0QA 2XNJA 2CHEA 2ZDGA 3V8QA 4FGWA 4O4IA 5JWRA 1UKVY 1YR9A 3ANLA 4R84A 4BLSA 3TMAA 4CMBA 1YH3A 3A1NA 4JC4A 4YAUA 3ZHQA 3OPMA 1W6RA 2OM2A 5FRDA 1YZLA 4QJ5A 3ZVLA 3DXXA 2J8ZA 3QUSA 4RENA 3N5KA 5KX5A 2HSGA 4I1SA 4S05A 4ARUA 4Q66C 3C1BD 1GCGA 1U8FO 4E5DA 4R9UC 1NYQA 4CM8B 5DM1A 2K87A 2HLHA 3PSHA 3QLVC 4R0NA 3LCMA 4EH1A 2ZSHA 1NPTO 2C58A 5B2IA 3HKEA 1R4NB 1GRNA 2Z5LA 1SC4A 3AKDA 1KSGA 2ZIXA 4BLTA 2ZUEA 2P35A 4W4TA 1GGFA 3SF8B 2R84A 2P77A 5JOQA 3C3PA 4ARSA 1J0EA 1E2IA 1NU6A 3PVCA 3IA2A 3KKMA 2A5LA 3T99A 1ZIOA 1Z2NX 4WERA 1GUDA 3V2GA 1FSGA 4ZYUA 1WCWA 1RQNA 2LPMA 2JASA 3A2NA 3MT7A 4GUDA 4CF4A 3IX7A 4U7GA 3GEGA 2BR4A 2B5WA 4RYDA 2QMUA 3AFNA 4RYLA 1II8A 3JAKB 3AV0B 3TLGB 5GV8A 3WL7A 2F17A 4IIUA 4KFUA 1J97A 3DBRA 3NC4A 3VZPA 3PKJA 1W19A 5ECDA 3WNVA 3NU1A 4UUPA 5IYZB 1SIBE 3C1UA 4W8GA 1HR0B 1K0FA 4J8PA 4OI0A 4M88A 1LH0A 2C4VA 1M6EX 2XD5A 3G2KA 2ZP1A 3W8NA 3QWHA 3QVKA 4F72A 2RGEA 3CSSA 4Q4AB 4E5SA 1K8XB 3UKJA 5J59A 2UV8A 4M1ZA 2FSSA 3N7TA 2VPZA 2FLKA 5AW4A 1CP2A 1LQTA 2C7RA 1H2HA 1SK8A 4GP7A 5G02A 1UT8A 2WJZB 1EFUA 3OCXA 3CWCA 4AZ3B 2YFKA 5JV5A 4AS3A 3M5WA 2OP1A 2P2YA 3FR7A 4C22A 4RY0A 3I52A 5EG5A 3AR5A 4NZYA 3O3NB 4UM8B 1JQ3A 3TCXB 2Q9AA 2IBTA 4IJVA 3BS4A 1ETHA 4R6WA 5JARA 2H2HA 3MGRC 4MQFA 4RWZA 1X86B 2ZYIA 3ITNA 4DLSA 2JFNA 2FN9A 1U8XX 1SOVA 2J5QA 2FP3A 3HE3A 3I0ZA 3W6NA 1PWXA 4L0CA 2YWEA 5ITWA 4EVQA 2F6RA 4GOJA 4AXXA 2C2GA 3V48A 5DI3B 3WLFA 3TIFA 4K88A 5BSFA 1K9SA 2NXWA 5C8ZA 1YHYA 3GUUA 1W9MA 4GS5A 4AYXA 2A8YA 1T0PA 1CZOA 3A1FA 3BMOA 2Q8PA 5ER6A 2AW5A 3REGA 3AR8A 4BZZA 3T7EA 1LCIA 4CYMA 1EFKA 5JWOA 4M9UA 3Q2OA 2R5FA 3AUYA 1T2CA 3OWXA 5TMEA 2FN3A 5JSFA 1GZ4A 1ID1A 4RACA 4EB6A 4LHSA 4YQYA 4B31A 3U17A 4H1HA 3GMDA 4IX9A 3RUEA 4MI9A 4ERNA 1EQUA 1EUDA 4BUZA 3V5NA 4NMHA 2BHNA 3ZY4A 4W9MC 5ALFA 5GOTA 4YROA 1KI3A 1NV8A 2D62A 2I4TA 5KU1A 1P3IC 4DV6B 1QTQA 1EFAA 2Q1XA 1HSZA 4I55F 3U7HB 2XUIA 4ROSA 1LF0A 4IOLA 4TV8A 5CX1A 3PXGA 1GPJA 1QIFA 4DIMA 5ETJA 1L8XA 1ZONA 1POWA 3FFAA 4ITVA 3NQUB 2EOAA 2QRNA 1YVDA 2VTBA 1RYEA 4UAUA 1RJEA 3CBQA 1H2RS 2UVPB 4DRBA 4P4UA 4W6ZA 3HUUA 3H2GA 1A5ZA 1N2OA 3VR5D 4QREA 2CJWB 4UHBA 4WJZA 4XIJA 4EI8A 3H9JA 1NA5A 5F2OA 5TEVA 3MGRD 4CGYA 2VCHA 5DYYA 3SJ7A 3AIKA 3HFGA 4IIBA 1GL7A 4ZOBA 3D0QA 4ZEWA 3VV2A 4DIBA 3G0OA 4P2GA 5JCOA 2OFXA 4ZZIA 2R48A 1OXUA 3DTYA 1U28A 3RYHB 4QAJA 4CHGA 4DREA 2R62A 2Y1FA 1W49A 2XX3A 5KNCD 3LCUA 1CR2A 2IIBA 1G18A 5EVJA 1T3HA 2GPSA 4JUIA 4NE5A 2IV7A 1Q14A 2N1MA 1Q0TA 4INZA 3UQYS 1JXOA 1QZZA 3R7DA 3E58A 4XIGS 1PS9A 2VDUE 2FWMX 1QF7A 5E2BA 1VB5A 1UBMS 3K4HA 2QN7A 3W9YA 5B40B 1VI6A 4CXMA 2WAAA 3K5IA 2E4XA 5L4NA 1YE5A 4WCFA 4TWAA 4C4RA 4GQBA 3DWIA 4EQ6B 1F51E 1H2AS 4P4SA 3FB1A 1IXYA 2JLCA 4Z7QB 2C99A 1OA0A 1F6BA 4B3BA 4D9GA 1WIWA 4PPGA 3ROZA 4LTDA 3FF4A 1P3ID 1D1PA 4UTRA 1CQIA 1U8UA 4XGKA 3ZK9A 5LKRA 5DN9A 2PMEA 2XDQA 2O2GA 1GAEO 1A72A 3UJ9A 4GWGA 1SVIA 1LQ2A 3JQFC 4WK4B 2JRLA 1HDCA 2CMFA 5E1DA 4MO9A 1N0UA 4IQFA 3KQSA 1T9KA 2VHWA 3OKAA 4H3HB 1JHUA 1DT3A 2ZT6A 1J5EB 5AV9A 2H5JA 1N9ZA 1V39A 2HRDA 4MYCA 4C89A 4R1TA 4WBNF 4QGBA 2KB0A 3EQ2A 2QU7A 2JI4A 4TZ0A 5ALEA 3NM4A 1JQKA 3N8IA 2V4ZA 3KPYA 4P0TA 1JHAA 1I2ZA 2OUKA 2WAMA 2NPFA 1OF1A 5EA2A 3OIUA 4BDSA 4CF3A 1XXHB 2IYEA 2O8EB 4YP1A 4G07A 5B2JB 5JO9A 2VDVE 4QYTA 5JR3A 3LAWA 1CEXA 1RWPA 2OENG 5HFNA 3RLFA 4DA7A 3RYCB 4L0DA 2H9IA 4PIMA 4JI2B 4A3SA 5FV7A 4IXNA 1U1IA 2AOTA 1F0YA 2COEA 1DCMA 1I4TD 2VA8A 3TLYA 3WMFA 2J0VA 3CB2A 1DNPA 1RU3A 4W5HA 3SDSA 5AUNB 3ETLA 1ICIA 3NI2A 5ADHA 4BVLA 2W6QA 3C8DA 4XYGA 5CP6C 2YFWA 6ADHA 4JI0B 5M34A 1KZGB 3ZD8A 2VSNA 4ZPJA 5B1IA 4BP8A 3WB0A 3EIQA 2JCVA 1PJTA 1RC1A 4CEIA 5DXFA 5I7WA 1D6JA 1I80A 2WFLA 4GX5A 1Q1GA 2E3JA 2V5UA 3G1UA 4MW0A 3LK6A 3I39X 4JBIA 4GXNA 1ZU4A 5B0YD 5LYYA 2ZXEA 2OO5A 2BP7A 2QL7A 3RVBA 3R6DA 3RSSA 1H2ZA 2GSDA 5KDLA 1PCXA 3DCJA 4H1TA 1VIDA 4I4TB 1ZPDA 2I2WA 2H85A 3OD1A 1JDUA 3L0IB 4KGCB 4EFMA 3ZU6A 4INPA 3AU8A 3HR8A 3CEMA 4X95A 2VSQA 4JI7B 2ETXA 5B0ZB 1F4PA 3U2QA 3PPVA 4OK5A 4PR3A 2YFVA 1B14A 1OXMA 3ZE9A 1IHOA 2LGJA 3ROXA 5IANA 2FX2A 5CPIC 2NQTA 4XE5A 3MOSA 4U4AA 2JDIA 4LRUA 4XPZA 4AO7A 3KU4A 4MZDA 5KTYA 3X1TB 2F8NB 2OBLA 4JJ4A 2WD7A 2RHHA 1JNYA 1A2KC 1Z83A 5EZYF 1MAAA 3RRNA 2IH2A 5U1PA 3RE1A 3D7MA 2QW8A 3H8JA 2QXYA 1QV9A 4LYEA 1MRNA 4EHDA 4CL8A 1TRHA 3C8ZA 1N5DA 3EXEB 2GERA 4AQYB 1XRLA 2Q07A 5C80A 2IHUA 3GJQA 4DDUA 5F9FA 5FFNA 5FF9A 1FVFA 1BVYF 1NMZA 4AZTA 1JNXX 3F6CA 5CP6D 3TJMA 4EENA 5I8WA 2MSKA 4TRRA 1NTRA 1GAJA 2PANA 1YU6A 1N5KA 3R4VA 4Q9LA 1WZNA 4W8HA 1YS6A 1MJGA 1L5VA 2Q6VA 3LKBA 2Q99A 6LDHA 5CDSA 3EXHB 4FKZA 1RQ7A 2C84A 3DOEA 5LNK6 4CLOA 5KNDD 4BKMA 3VDQA 1U2DA 3LU1A 4WJKB 4EPXA 5E6SA 2CDNA 4YMIA 2PX6A 3VR2A 1UFVA 2DBRA 2W9XA 3DCYA 1M1NA 2C07A 4M1EA 3C74A 4C21A 4Y0VA 4EVRA 3Q15C 2HNBA 3GHYA 3T3IA 1Z0KA 4RESA 2FDXA 1NBAA 1WP4A 4CEJA 5KZMB 621PA 4UPKA 3W5DA 1BE0A 1D1TA 4UAJA 1CW2B 4KDEA 2PBZA 4OQMA 2P9JA 1ZJ5A 5AVBC 3BDAA 4B9AA 5CM2Z 2UUPA 4AD8A 4RDHA 3HYSA 3G0IA 4REMA 4HO1X 2YJ4A 1G7RA 3W99C 1LLFA 2PGIA 2FFAA 3M6VA 1JA1A 5CPID 4W5NA 1P3MA 4F6LA 3D4LA 4TTAA 5J58A 1KX5B 4HF7A 1JE1A 2IYNA 3G2OA 1GRVA 1Y1QA 2NVUA 1DKNA 1T9GS 2AH5A 2DECA 2CXRA 2CFTA 2FW8A 3CVOA 2MOKA 4E11A 4CR8A 3I8OA 1F1BA 4IOMA 1QCYA 1TEVA 4EB3A 4C7MA 1C5KA 1E2KA 2AK2A 3ELBA 3I2KA 3ZKWA 2EZUA 4E13A 3VMFA 4M0UA 1ZGHA 2Z4RA 1YQGA 1LW6E 1VZ3A 4MUBA 2O2CA 2GWRA 4QDUA 2QE7D 4AL4A 1TF5A 4PNZA 3H5RA 5IKEA 3NALA 3I0NA 3TVTA 2AIRA 1JYSA 4FFRA 3FWPA 1PL8A 4XTCS 1NG1A 4RH1A 3U4MA 1SEVA 2PUDA 3OOJA 2ZTHA 4MULA 1NF8A 5TQVA 1GPDG 4E5UA 4JELA 1VLJA 1BOOA 3CUWA 1N5JA 3NXKA 2ODTX 3GLKA 2O23A 1PQPA 3MWDA 3CKKA 3GLGA 1QRTA 2QRGA 1TM7E 4XGNA 4YO8A 4QZVA 1QIJA 3GBVA 4ZI7B 4HDMA 3WQHA 4KZPA 3G2IA 3H1BA 5EMMA 4MTCA 5AVBD 4TMKA 2GJKA 2IW1A 5JZBA 4GZ3A 1CP3A 4WV4B 1KGSA 2BAGA 2QT0A 1CIJA 5I7RA 4HWGA 4NZNA 1P80A 5KVVA 2Q4TA 1EQZD 3RUHA 4I50F 1GPYA 1G21B 4XCXA 2BRUA 2LKDA 3B53X 3RUIA 5ALXA 5JY1A 2NTJA 3G85A 1SVMA 1L7VC 3P9CA 2B4RO 4XD7D 2ZS8A 3S8YA 4QATA 3Q2IA 1Z5PA 4D4GA 4DYVA 3M4NA 1PD1A 4NE7A 4B6JA 1SU6A 4D0SA 5DSXA 1KO8A 3B3JA 4OREX 1V3QE 2MU1A 4QUAA 3WGZA 1VDZA 1Z0JA 3UB4A 2O5RA 2XYQA 2HNKA 4EYSA 1IZYA 2JGLA 3CC8A 1EXWA 4FIDA 5KI6A 2UWXA 5LB4A 4GW3A 4LMAA 5CDFA 1UWVA 1JA9A 1CKEA 3LO5A 4J2TA 3R45B 3E2IA 3W7AA 3Q5GA 1BXGA 1EH5A 4J90A 4B83A 3ZEAA 1BH9B 3HBJA 3I2FA 3H8VA 2EHDA 4J0DA 2IDZA 4IW3B 1E1QA 1ECPA 1SOUA 3QMWA 4M37A 1G5IA 3QU9A 4U7PB 1R5NA 3A1VA 2ZK7A 5F35A 2RFLA 1I32A 4U6SA 3C6KA 4H4EA 2GF2A 5BN5B 2XITA 2DWQA 4B40A 4XLZA 3TTYA 1WBBA 3RAEC 2PJRA 1M1AB 4F97A 3UYLA 3HLKA 2O8NA 4D3DA 1H9BA 3OICA 3HI4A 3RU3A 3IXLA 1X7HA 3LUBA 3OMWA 4YM6A 1PZMA 4C08A 2JJ2D 3TYXA 2PNFA 2C1EA 4LSZA 2NUAA 2RGNC 3ESQA 4J07A 1IHPA 3CG0A 4MV9A 3MWGA 4ARAA 2G72A 2EF0A 3FG9A 1F0PA 3A58B 5L4LA 2PSEA 2ZUTA 1OA1A 5DIZA 1A9QA 1KOGA 4CM7A 3AZKA 1NR1A 2WU3A 3V1TC 4V0OA 3DE2X 1WABA 3VDXA 3HJBA 4G0WA 1RPJA 1BN7A 4JYAB 1M6VB 3ZV6A 1SQFA 2R85A 2VXCA 3AR6A 1YZVA 1XVAA 3O92A 1REQA 4M9ZA 3BB3A 4Y2SA 5CLGA 3GJ5A 4DZTA 3DV2A 4AMUA 2PMFA 1WWIA 1GZDA 3VVBA 3IPRA 4MV5A 1UWKA 3A04A 1JPUA 3M49A 1F2DA 2P4EA 2H31A 1EP1B 3RHFA 4PFQA 3TNFA 3KCQA 5CVTA 4OHCA 3EGEA 5CB6A 1O6ZA 4I8IA 1L5QA 3T1YB 2P2DA 1TTHA 3M4XA 4RPCA 1HT0A 1D2RA 4G0VA 4KDFA 5A9SA 4BFYA 4ZIRB 2GAAA 1C0LA 5ABPA 4X66B 1LSJA 2CNWD 2ZBEA 4WXYB 3UZUA 2A7QA 4B6PA 2YN0A 1DOAA 4DQLA 2RI6A 4KLZA 1U2GC 3PGLA 2O20A 4JY7A 3D2BA 3C5WP 3OFNA 4G8CA 2B4QA 4D9NA 4H7EA 1PR5A 2BDUA 4ZGGA 5AM0A 1FQJA 2IBSA 2D0PB 2FFRA 1BEZA 1FXSA 2IH5A 1T9BA 1ZI9A 2BVNA 2J3KA 1OJ7A 2B1IA 2MSWA 4O3FA 2WHRA 4WU8B 4FMCB 2V45A 1NM5A 4ZGWA 1QG0A 5HQ3A 2VZ0A 2JGJA 3TI7A 4AUMA 3AR4A 1TVCA 4QXMA 2Z5FA 3JQ9C 5BUCA 3U7EB 1E2GA 1NPDA 4JEMA 4EW3A 3QWFA 3K5PA 1YI0A 5DBEX 4IRMA 1IMJA 4Y2RA 4F38A 4RTLA 1W36C 3QFHA 3WIEA 4RULA 5B6JA 4JD5A 2BUBA 1Y8RB 1V3UA 4O2BF 2DFLA 3WB9A 4N6NA 1RYNA 2IU3A 1A9TA 2CHUA 1MNAA 2X2EA 4LKOA 3GXBA 3UUEA 3FIUA 4EHKA 1QP8A 1T1JA 4H6XA 4PRKA 4ZQFA 5IH7A 4C78A 1NP7A 4V2IA 3OFKA 4XVQA 5CAEA 3VU9B 4I3GA 3KOXA 2QQEA 3HC7A 4A8JC 2FEMA 3QVTA 3O0TA 3H2YA 4B3CA 3NX4A 3GZNB 2O9JA 1XEXB 3ZYCA 3AUSA 2MINA 2XD4A 2Q6LA 2IP1A 4NBWA 3NS7A 2E21A 4ID3A 3IEMA 1WU7A 3E3NA 2WIFA 1VLHA 4Q9AA 4ZVLA 1NQUA 4MA0A 1ORTA 2CFOA 3NT4A 4KVFA 1IZ0A 3A26A 3Q7RA 4V0SA 5WRFA 1VYVA 1EVEA 4NE6A 5E4FA 4BKOA 2VAPA 2REXB 2R68A 5KOYA 1FTNA 4EBFA 1VMEA 1KDYA 3KR9A 1Z39A 1K5GA 1JXQA 1FSSA 3I04M 2PS3A 2OWDA 3CX8A 3MMPA 4UEQA 4P80A 4F8YA 5LJLA 3SC2B 1X9HA 3FPBA 1L4MA 2X0DA 1V1JA 5LZ4A 5A04A 1Y9AA 5F77A 4MP3A 1UBTS 3U4GA 3ONNA 3KZOA 2X0EA 1Z28A 1NNI1 3OPYA 4AYWA 2NV2B 1B8VA 3OOSA 3F8WA 3D7SA 3A6HA 1D8AA 5JZOA 4NE3A 4DUPA 2NWQA 4CIYA 3O62B 5B24A 3LZ1B 5KU7A 2GD1O 1E3WA 3R23A 1VSTA 4HEHA 3FKQA 3X1UB 3W96B 4PPYA 4RFLA 3GMSA 4WN9B 4A6EA 2WUWE 4TMZA 5HHTA 1H1DA 4I8DA 3UAYA 3H2SA 3FRJA 3BK7A 3WQRA 3UF0A 1JQ5A 1V5WA 3GELA 2I0FA 2H4HA 3UMYA 1FDRA 4RVOA 3E1GA 1YVRA 4BLQA 1N2GA 2UKDA 2I34A 1N7HA 1ID3A 1XALA 2WSIA 1P9LA 4WLEA 1DC5A 4IJ6A 5BNVB 1ZH0A 5LB2A 3KZCA 3BERA 5AV6C 2QTZA 1IQ0A 3PLAE 2XMZA 5TJ9A 4D8YA 3U3OA 4ZO6A 4FYYA 2FSFA 4HLQB 5EE9A 5H1YA 1N2JA 5L4SA 4JLPA 1H6AA 1ACLA 5I9TA 1L1FA 4RKYA 3IAAA 5HEKA 4C0SA 2E49A 4PO1A 4H9QA 5KYXA 4RTPA 2V0CA 2NX2A 4E94A 4IGAA 3AZMA 1NXWA 2ECFA 2PGOA 3RC7A 3E15A 4NYMR 1WXIA 2WKWA 4DQKA 4CL2A 3TOVA 3AI3A 4XZQD 2AZ4A 3KJQA 5G1PA 2QAGA 2YXBA 4I1RA 1TGYA 3BL5A 3VKHA 2NU6A 3FVVA 5CVCA 4HB3A 3LBYA 1VLQA 2VQFB 4BV8A 4KFTA 2GR9A 2ZRGA 2W2TA 3B0DB 3M9XA 5AJUA 4AAYA 5L51A 2FPPA 4KFRA 2H9AA 2NZDB 5FHRA 3L46A 4NAVA 2RH8A 3PCTA 1EXMA 4S2UA 2XTMA 3RU9A 1G17A 2CXQA 1E4YA 2KE5A 2VWQA 1XCLA 4GWKA 3REIC 5K3OA 1VBMA 3U81A 3RFFA 2JD2A 1JG2A 3WLIA 3VSEA 3L2OB 1P1CA 3MUOA 4OHUA 1F6DA 4QGGA 1OH5A 4X93A 4WOJA 4MB6A 4YJGB 1Y6RA 1KJYA 3L6UA 3SHQA 4UM9D 3QH4A 1SU8A 2VDWB 5AVJA 1COWA 4NYJR 4J4BA 1KAOA 3EX7C 4UNNA 1I8TA 2AVNA 3BOSA 3GVPA 2XKJE 1DEKA 1P0PA 2ACEA 1XQ1A 1ZESA 2R6JA 5JU6A 3VYTB 4X8LA 1Y9JA 2XMDA 3LSYA 3GT0A 4UHCA 1V8OA 2JAPA 4KQWA 5I01A 2Y71A 3REHA 4RSRA 5I4IA 4RJJA 2PQ6A 3K9FC 4XUJB 5I9NA 2CUTA 3C6YA 1U0FA 3Q6IA 4QQFA 2IYTA 3T4XA 3PP8A 4E12A 2I55A 1ZP6A 3NBYC 1AM4D 2AQIA 2Y76A 4WESA 3ZVMA 4F06A 2EEZA 4PN3A 5JSHA 2FLVA 3R5JA 4IHJA 1FW8A 4ARZA 3G2HA 4Z0NA 1H2FA 5BSKA 5HJ2A 4MR9A 1VLZA 4Z66B 4BCDA 3GNQA 5AVSA 2HJWA 1N1DA 2DKFA 2HRQA 5MF6A 2BMVA 4LXXA 4ZZ2A 1T36B 1MJGM 4Q47A 3AN2B 5F7ZA 1DJLA 1KYIA 3PC8A 3SMQA 3GG9A 4O63O 2PTGA 2XRMA 3UMVA 1Q17A 4OTZA 4PHTA 2JVKA 3GRUA 2QN9A 3EZLA 4EGSA 5DNWA 1E69A 3IT1A 4YVFA 2PMDA 2X3FA 1SXJC 5IHPA 2H2DA 2NXEA 4EYGA 1BMFD 2DE0X 2WNHA 1JEQB 1AB6A 3TBHA 2GSWA 1R18A 1Z29A 1M6NA 2NV0A 2I8CA 2D2EA 1BVUA 4Q7QA 3REID 1PJ4A 3CW8X 4C7JA 1RKXA 1T1SA 2HWXA 3AHEA 3RFTA 2HNAA 4RK5A 3K2QA 1E0DA 5AHRA 3IIKA 4OYLA 1K6JA 2F8NH 1OWOA 1XDWA 2ERXA 1F3LA 3DLTA 2QLLA 4PC3A 1B6TA 2LCFA 5CT5A 3QVLA 1Y80A 3A4NA 2YOHA 3D54D 3F8TA 1RXIA 4DEYA 1FYFA 1MIHA 4FHFA 3HU1A 1ULHA 4MQ4A 4DYHA 3B6FB 5BOSA 5DDIP 4OHXA 1BWSA 4ZALA 1TZYB 3GP8A 3D64A 2ZB7A 2Y27A 3DZBA 4TT8A 2VSYA 3IPYA 2HI0A 5CYOA 5LQNA 1PWZA 1G60A 1ML4A 4LDZA 4IOKA 4R4JA 1AVTA 1YUNA 4WUTA 5EUCA 1EM8B 2DUMA 5T57A 1A8SA 3QF7A 3VYSB 2P2ZA 1HA3A 2JJYA 5AW0A 3OZUA 3I42A 2PAFA 3UV7A 3EFEA 4PLWA 1RWMA 2XWPA 2QTNA 2GD0A 3HP7A 3CW2A 1JSXA 1C81A 4LXIA 1Z5WA 3KQKA 2NVOA 3F6EX 5JAPA 4TYWA 1NDUA 3WADA 1E4EB 3QE2A 2QRMA 3OCJA 3AFMA 2VFAA 5DULA 3PJFA 2ZRQA 4JWKA 1SCKA 3GVXA 4YT8A 3UO8B 4H7KA 2R6R1 3A3KA 1GLNA 1DQPA 3M5CA 4Q34A 3IO5A 3VAAA 2ZCUA 4BX9A 1IUOA 5EMHA 1H5UA 1NVDA 3NHUA 4DLKA 4ZOCA 1DG3A 4V1CB 2ZIGA 1L5MA 2EP8A 2VDLB 2CN1A 2WFMA 3UBMA 2IBMA 3OCCA 1NYTA 1H4SA 3T7IA 1SOMA 1IRIA 2IT1A 4TQAA 3PUXA 2EKQA 1WHTB 5CJ2A 4X23B 4UZSA 3REFA 1M18B 5EJ7A 5FL7A 3HCNA 4JV5B 3G9UA 3O1LA 1ESCA 1LRLA 4RD3A 5GSUA 2RGXA 3GBPA 1U2PA 4US1R 4G5HA 3LLMA 2PFSA 4G0PA 4UZFA 1T4DA 4QHSA 3RBZA 2SCUB 1T5IA 3HJHA 4PLCA 3TGLA 3REQA 2FFBA 3LQKA 3AZNA 4WTOA 4ZZ1A 3PXAA 1WDWB 1AGXA 4CKCB 1E9CA 1JFIA 4EY7A 3JYNA 4I5EA 5KQRA 3KELA 1DJQA 5IJ9B 2KLBA 2Y1WA 4IDPA 1I4OA 2PH3A 1B0ZA 1WRBA 3ABRB 5K1ZA 3AZEB 2I7DA 3IRVA 3ITKA 4LY3A 1AH2A 1MJ5A 3HCDA 3ZJ5A 4RJTA 5GJBA 4I1OA 3KWQA 4E31A 1X0VA 3R5SA 2ENWA 3UAWA 2OB2A 1GNVA 4BVJA 4CUZA 3AV2A 2V0NA 2AC4A 1WD7A 4OLFA 4FTWA 2OYCA 3VNRA 1QHFA 4PZDA 2C9MA 3AQ4A 1O9HA 3AZFC 1LK0A 4GYYA 2G4CA 2AI2A 4DDKA 5K8CA 5DLQC 5AY8B 2FK7A 5CMLA 2HMTA 2P2CA 4O1IA 2VHCA 4E22A 1TK2A 2FUCA 4JLSA 5FUYA 2Q1UA 2PKYX 3HK2A 4KRXA 2BIFA 3AF2A 1WEKA 1NE2A 1T4BA 1J8DA 4PLVA 3DGFC 4M0PA 1F4LA 3S2UA 3DV0B 4QOFA 1N2ZA 2BLLA 4MS3A 3C1BC 1ZOPA 3O1JC 1KZHA 3HP1A 5EEGA 4NE2A 5IT0A 2QAIA 4OQNA 5AMXA 4UCQA 1KYQA 1XU9A 2C1ZA 1YZUA 1N3BA 2FMIA 2X8JA 3O4HA 3B9PA 1OWMA 2PXXA 2IA5A 1B41A 4JWTA 4GPAA 4AMGA 1J20A 3WQBA 4O33A 4KMRA 7AT1A 2GPJA 3ZHUA 3X1VC 3HL0A 3IIJA 5CLQA 1P73A 2RC5A 3A9UA 5B31C 4WCVA 4YMTA 5CH3A 4MQMA 1I6MA 2P3SA 4F1JA 3T61A 2PGNA 5ALQA 4QDJA 4PY2A 3VPGA 4LRSB 4N65A 5HIAA 2QZ4A 2K7FA 1Z07A 2W43A 2R8OA 2FCAA 3ONEA 1BS9A 4DUYB 4GPZA 5M04A 4GU5A 2B83A 1H6BA 2RKOA 2GHTA 1C7IA 1UEJA 4HATA 4PV7A 3LECA 3LA8A 2Z6AA 1AE1A 1KI6A 1OD6A 5DW3A 3LKZA 2D5IA 2H4YA 1RQGA 3UTBA 1EFVA 1T13A 5JCZA 2JAWA 4PYJA 2J9FB 4Q9HA 4ZGBA 3RELA 5C8XA 4DRXB 5KJ1A 2Z2IA 3KL4A 2XUPA 4DILA 3RC8A 1CYEA 4NEGA 4LV6A 1LJLA 2GYUA 1K7XB 1M2OA 2BFNA 2ZUUA 1D09A 2ZSEA 1IBSA 4CT5A 4FGLA 3TZHA 5A3RA 1IPHA 2PFGA 2FKAA 3E22B 3JVDA 4X5OA 1N2CB 4WZBE 4QDTA 1XLTC 1UT5A 4TYMA 1MAWA 2LDXA 2BTQA 5F33A 4R9RA 5LQAA 3ECAA 3ISTA 1NY6A 2RK4A 1BDBA 1UBNA 4RSMA 4AY6A 4B44A 2EF1A 1V9CA 4EPWA 4QBGB 1JRLA 3EDRA 1N1MA 1QF6A 1NVXQ 4PSCA 2PZLA 1ZJWA 2XHZA 4TMWA 3GN1A 1YS4A 1U2EA 1ELOA 3X1DA 4D92A 4BB0A 3NHWA 4NBSA 3SSOA 1RKUA 3C4JA 3UWKA 2HF7A 3IAEA 4KL8S 3T7SA 3X1VD 5EN4A 2JF0A 2CV1A 1YBHA 3U44B 3P9YA 5B31D 1L7QA 4ZMBA 4HDKB 3TWOA 1GPH1 3I2GA 3R5KA 5FA5A 3K5WA 2JFQA 1BKDR 1UOEA 2CUKA 2OQIA 4HVAA 1GZ7A 2WF9A 5B12A 4EBBA 2HF8A 5FOVA 3VHLB 3GP3A 4P0QB 3PNOA 2P2LA 2IHKA 2XB4A 4BQSA 1KI4A 1LS1A 2Z2JA 3HZHA 5JASA 1KMMA 3R3JA 5ARBA 4RK0A 4AX8A 1LC0A 2FU5C 2IS2A 3BD7A 4YJ3F 1FP2A 1NQXA 1RRMA 1EK1A 4RKQA 3P9PA 3ICWA