2ZM5A

Crystal structure of trna modification enzyme miaa in the complex with trna(phe)
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
306
structure length
306
Chain Sequence
LPKAIFLMGPTASGKTALAIELRKILPVELISVDSALIYKGMDIGTAKPNAEELLAAPHRLLDIRDPSQAYSAADFRRDALAEMADITAAGRIPLLVGGTMLYFKALLEGLSPLPSADPEVRARIEQQAAEQGWESLHRQLQEVDPVAAARIHPNDPQRLSRALEVFFISGKTLTELTQTSGDALPYQVHQFAIAPASRELLHQRIEQRFHQMLASGFEAEVRALFARGDLHTDLPSIRCVGYRQMWSYLEGEISYDEMVYRGVCATRQLAKRQITWLRGWEGVHWLDSEKPEQARDEVLQVVGAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Snapshots of dynamics in synthesizing N(6)-isopentenyladenosine at the tRNA anticodon
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase/rna
molecule keywords tRNA delta(2)-isopentenylpyrophosphate transferase
total genus 92
structure length 306
sequence length 306
chains with identical sequence B
ec nomenclature ec 2.5.1.75: tRNA dimethylallyltransferase.
pdb deposition date 2008-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01715 IPPT IPP transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.140 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 2zm5A02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2zm5A01
3FMIA 2JLXA 2F6RA 2ANBA 2VP9A 5F3WB 1L4UA 1HTWA 1YHNA 1DAFA 5HE9A 2WKPA 5B58C 3WHLA 2HDNB 2X2EA 5JJLA 2QM7A 3KUCA 3ND8A 1XEWX 5CYOA 4MGZR 2NOAA 1FNMA 2ZRHA 1LS6A 1AZTA 3REGA 3ICEA 2P5SA 2CJWB 4JLAA 2MSDB 2RGAA 4ZV4A 1X86B 2QL6A 1WCV1 1JBKA 1AGPA 1P3JA 4DDTA 4LI0A 2XX3A 3QKSB 1LTQA 5EP2A 3G0HA 2PLRA 4AYXA 1ODFA 2AD5A 2IYLD 2BIFA 3M0EA 1ZM3A 2FSIA 4FMBB 4B71A 2GEUA 4CEJB 2KBFA 4JL8A 3E1SA 3HU2A 3CM0A 1W1WA 4AD8A 3GJ3A 1KI4A 2GVDC 1AZSC 2ZJ5A 1GDDA 2GEVA 3F0TA 2OHFA 4JJKA 4RZUA 1A7JA 1JB1A 1CJTC 3GJ4A 4B2IA 4HDQB 4NBSA 2W6ID 3I8SA 3PXGA 4BFUA 4B3CA 1FX0A 2ONKA 1Z0KA 2BM0A 2WWFA 2E1RA 4K81B 4C2TA 1XEXA 1KI2A 5JMTA 1M34E 1QG2A 3OIYA 5FUVA 3TKLA 2ZEJA 2QAJA 1FOEB 5EE9A 3RWOA 1LF5A 5KHOC 3LBIA 4MGIR 1F2TB 1OB2A 2MMGA 1NRJB 1OH8A 2RGXA 5AWFC 1E98A 4GP6A 5FOVA 4YMVA 2DPXA 4O2RA 4DIDA 2IYZA 4PSVA 4P0TA 1EESA 1E2MA 3DEFA 1T3SA 4PHHA 2IYXA 5K8TA 1KI7A 2Q21A 4CF7A 3PEWA 1RVDA 2X1VA 4WXPA 2CCKA 1D2MA 1RW4A 4HUTA 3KKQA 5JJKA 1US8A 5EP3A 2ZRPA 2NQ2C 2XXAA 4A8JB 2J59A 2LWIA 5EQTA 3UG7A 3SQWA 2PX3A 1ZNYA 2YHSA 3H86A 4M9ZA 4NH0A 1M7HA 3WYGA 4M1WA 4ESHA 1LF0A 4KODA 3MRSA 1E2FA 2GHIA 1Q44A 1XTIA 4V0OA 5CK4A 2WZQA 5EE0A 4IW3B 1R0YA 1EFUA 4IXMA 1W2HA 3BB3A 1NVVQ 2OBMA 4AK9A 2GCOA 2R8RA 1KO1A 3W9YA 1ZIOA 2VBCA 4N0DA 2QBYA 2QPAA 2XNDA 4Z51A 1RRCA 1Z28A 4TL7A 3SS8A 1KDOA 4A9AA 2YYZA 4PPGA 4XSHA 5E4FA 1GG2A 3WRYC 1NKTA 1OSNA 3RWMB 4X8MA 5FBLB 2JEOA 4B3BA 2VHQA 3BB4A 3VX4A 4GOJA 2BKUA 1TF2A 2JCSA 5F2EA 2ATXA 3A1WA 2D2EA 3A8TA 2QNRA 2PEZA 1NSFA 1R0XA 5L8VA 3QI2A 1W0JD 1EWRA 2CE2X 1EX7A 4JMPA 5FUWA 3TSWA 1Q21A 4MUBA 3AKYA 4LPSA 3UIEA 4EFMA 3AM1A 4TZ6A 1Q0UA 1Z8FA 4PC2A 4Q4HA 2IX3A 3IQXA 4ZIRA 4KI0A 5JS7A 3B6EA 1JECA 1UKZA 5AUNB 3H84A 4Q1FA 5D3QA 4LGMA 1UKVY 4PC6A 5FPHA 3RC3A 5JWRA 1V5WA 4US1R 1CF4A 4UJ5A 3WBJA 4W5WA 4TMZA 5JHGB 4LOAA 1VCMA 2RGDA 5J4YA 1DOAA 1ZNZA 3MMPA 1K8RA 1SVIA 3V4RA 4LJ8A 4TYQA 2GJSA 2PL3A 3FYHA 5KNDA 4TYPA 2JLVA 2Y8EA 2JASA 3D31A 3KFXA 2DY1A 2JLQA 2C03A 5C18A 3GLIA 3GLFA 4XVUA 1EXMA 3V00A 1YR9A 1SVWA 2R6FA 4OKSA 4QFMA 4B6EA 1GOTA 1IHUA 4QBHA 4QHTA 4F4CA 3WNDA 4KLNA 2WTUA 3Q3JB 2X8AA 2XSZD 1XCPA 1DO2A 4EPRA 2H5EA 5FR1A 4V0ME 2CL0X 2WHXA 4L16A 4EIWA 3AVVA 3BFVA 1ZM9A 1QHHB 2IHYA 1C4OA 5SZIA 2BBOA 5IRCD 1NMYA 1R4AA 1X1SA 5J4HA 1CS4C 1OH5A 4CEJA 1IXSB 2ZITA 2EYQA 5CM8B 3MWJA 3BRWD 1N5LA 4NYIR 1OE0A 1ZUHA 3O8DA 1G8PA 4NL4H 1G4AE 2LCFA 2BDTA 5TVKA 4B2PA 3O8CA 4OJKA 2OCBA 2R6GA 1NVVR 6Q21A 1S1CA 5GJWC 2QM8A 2IUUA 1CRPA 1PV4A 3QKRA 5KDDA 3TH5A 5TMPA 3UATA 4JYBA 1XEWY 4G5RA 3FKQA 4XWAA 3N70A 1DBSA 3X1WA 3B8HA 1CJVC 3KKOA 1G291 3LBNA 4FXPA 2A3RA 1JR6A 3M6AA 1R8SA 4MGYR 2TMKA 2O8DB 2V1UA 1WF3A 2A78A 2GXAA 1FTSA 5BN3A 1CR4A 1RRGA 1OYYA 4JKIA 2QG6A 1G7TA 4GDFA 4OHZA 2JDIA 1E9EA 1N5IA 2XOKA 5DYIA 2FU5C 1W47A 1JR3E 3DZ8A 4JKYA 5FOUA 3DM9B 1N6NA 1WB9A 1HT1E 3AH8A 1TEXA 2LKDA 4JLDA 2ZSEA 4WZ6A 5L3RA 5DN6D 4BWYA 3TW8B 1OV4A 2YOFA 2V6IA 2LKCA 1T4GA 3SJBA 2VO1A 1U8AA 4G0NA 4BFSA 1CEEA 2CL6X 4FI3C 2PT5A 2QMOA 4MQBA 3THXB 4C0KA 4Q5IA 1Q20A 1RRFA 3T12A 4JLPA 3EWAA 4IVQA 4OQXA 1G8FA 4LK2A 2O8BB 3AQ4A 5FPYA 4JYCA 2GILA 1AM4D 5BN5A 2GAAA 3NXSA 4Z8XA 3EX7C 2J0UA 4LJYA 2GZAA 4QJ4A 2G88A 1G5TA 3VMFA 3I8XA 1II9A 3M1IA 4P4UA 4UNQA 1HY3A 3EC2A 2GJ9A 4Q21A 4JLNA 5DLQC 2ZJAA 3H4MA 5FI1B 2ZJ8A 3AKCA 2F55A 1Z06A 1TF7A 1A82A 4M1YA 1YZNA 3ZDQA 3FHTA 2Z4SA 3B1YA 3FMFA 4PZYA 3I92A 1I2MA 5DNYB 2W2XA 1IN6A 2MSEB 4Q66C 5EUQB 2ZYUX 3SFVA 3WRXC 4XWOA 2FMXA 2WVJA 4LYFA 2JLYA 5CITA 2C78A 3QXCA 1CRQA 5D3MB 3FB4A 2RGGA 1SULA 3KQKA 4ZCLA 2BCGY 3P4YA 3B85A 1JR3A 1S3GA 2QN6A 4UXIA 4B34A 3EZ9A 3KJGA 4JL6A 2VP5A 1VYTA 2D62A 4LDJA 1Z07A 1BO6A 3B2EA 3QBVA 4QGAA 2AD1A 2G6BA 3I61A 3DMDA 3JZMA 2ERXA 2HXYA 5GADl 5JSZA 4AYWA 4EQ6B 3AVQA 3NHAA 4OYHA 3SYNA 2IXEA 4XH9B 3ZZUA 1G4UR 4POAA 5LD2C 5JJIA 1CR1A 1II8A 2ZE5A 1II8B 3EA5A 1P73A 3I5YA 4DHEA 1I4LD 1ESNA 2O8FA 4BEBA 4A2QA 1L7VC 4A0FA 2GWHA 4MDEA 1QRAA 2WKQA 1IN4A 1G3IA 1O87A 1KO7A 3QPWA 4MDFA 1UADA 2CDNA 5EXXA 1J90A 4NE2A 3TUZC 3NBYC 1DEKA 1EK0A 3CH5A 5JCZA 3WNBA 1UDWA 4HZUA 2JLZA 2R6DA 1YZKA 2PMKA 4XVQA 1KMHA 4DSTA 3RAPR 2FSGA 3U7FB 4YC7A 1N2CE 2WIBA 3AVXA 2WPDA 2QPTA 5J4LA 4IVPA 4LBWA 2RCNA 3OE7A 4EQ6A 1MRNA 1YZLA 3N2IA 2YV5A 2H1LA 2X77A 1W46A 1JEDA 3LA6A 1GNPA 4KITB 4H1VA 1IAQA 1TUIA 4Y0VA 5CLQA 1W36C 3PV0A 4GI7A 2IS2A 3OESA 2B7BA 3VTKA 2CBZA 2G83A 4NCIA 2UZ3A 4RFSA 2P65A 4MITA 1PUJA 3ZVNA 2P6RA 1S4QA 1VG0B 3DPUA 4JLJA 2HV8A 3KX2A 4D80A 2BMDA 4M9QA 1A5TA 3FFBA 5JI3E 3SC3A 1NIPA 3ADBA 3H2YA 2QORA 1DADA 2GTPA 4CDGA 2E9SA 4GMXA 2FGKA 5B2ZA 1X8JA 4IJMA 2RHMA 3OZXA 4NHOA 3FHCB 3IQWA 5GJCA 1SXJE 2ORVA 2QA5A 1FUUA 4QBGB 5C4MA 3LNCA 4Q02A 5DIFA 2DHRA 1JAHA 5G53C 2GBLA 3BFXA 2V8OA 3EXAA 2EFDB 1FQJA 3G5UA 4AWXA 1PLJA 4DLWA 1GVNB 2F3TA 4TT3D 1P2UA 2VP4A 3L0OA 2V55B 1KO8A 4HB2A 4L8GA 4JLMA 3RS2A 4F92B 3K0EA 1P7CA 4LCBA 2YWGA 2QUZA 4U02A 4DLVA 1WBDA 4KLZA 5DO9A 2V7QA 2BBWA 2FX3A 4RFSB 1K5GA 2FE4A 1HYQA 4AG6A 4LY6A 1KY3A 2FF7A 1ZM7A 3D3QA 1P61B 4X8OA 1G64A 2QAGA 1YRBA 1TU3A 2GZDA 2IWRA 3RABA 2IYQA 3RYTC 1EFHA 4Q4AB 3RLFA 3E2IA 3R8FA 1AKEA 4YQFA 4A6PA 1IY1A 1N0WA 3IPYA 4ARZB 1SXJC 2V4ZA 3IHWA 1F3OA 5DE3A 4P4SB 5DI9A 2V7QD 3QJYA 1CJUC 1VG9B 4FWIB 4TMVA 1ZC3A 1SHZA 1R5NA 1N25A 3RS5A 3SYKA 1G16A 4Q7JB 4QG7A 1YZTA 4IOMA 1Z0AA 3GLIE 1ESMA 2DWOA 1E2PA 1W4RA 1PJRA 2B92A 4V03A 2IS1A 2O0JA 2C77A 4OI2A 4S2EA 3GLHA 3X1ZA 1E9RA 3WHKA 2VP0A 4URXR 1UBCA 5FBQB 1MO6A 2PZFA 3QPVA 4CEIB 2ZETA 3F5FA 5JWHA 4FMDB 2Z6VA 1G7SA 4JBYA 1TNDA 5EE3A 4K8OA 2H57A 4D82A 3AV0B 5AJYA 1GRNA 3CR7A 4MRVA 3TR0A 3FKSD 5FUYA 3TSOA 1QVRA 2AX4A 2O0HA 4NP6A 3CR8A 3HR8A 1IOZA 1L8QA 4JL5A 1JPJA 2F1JA 4OI4A 3EPLA 1NN1A 2I1VB 1KDPA 3SFZA 3AUXA 1VCOA 3NHBA 3BS4A 2HF9A 2D7CA 4KO8A 1NP6A 4Q1DA 1Q22A 4F7WA 1XMSA 4BLOA 3DMNA 1DAMA 2YVUA 1WMSA 4UNPA 1MRSA 2CNWD 2FSFA 3MD0A 1T6NA 5CLLA 2CLDX 1QHIA 1VMAA 4UNRA 4BLRA 5L3SB 2RGCA 2G9NA 4F38A 2A5FA 3NBZC 1D9XA 1KGDA 1TEVA 4US2R 1C9KA 1GL9B 1QZXA 1Y3AA 2QMHA 3AF3A 1VG8A 3DDCA 1CXZA 4KYUA 1NMZA 4AKEA 2ZUCA 3PR1A 1W4AA 4JVNA 3QXJA 2KWIA 3C8UA 1KAOA 4PSAA 1MABB 4B74A 2C8VA 1E0KA 1UEJA 1DO0A 4NMMA 3CPEA 5E95A 3HPQA 4MYTA 3LH5A 4IDHA 1F6BA 3SHFA 2EVWX 2ZQ5A 4PQYA 3GCGA 2J0UB 1RE0A 1V43A 2GKSA 3CZQA 4RD0A 3K70C 1HQYE 1HURA 3AGQA 3QF7A 4LX0A 1SXJA 4HAVA 1E2KA 3LX8A 4C30A 4PO8A 3I3SR 2H18A 2DCUA 4G5QA 5H70A 1HT2E 4Q4AA 1NG9A 1SXJD 1BH2A 4LHZA 3VHLB 2F9LA 1KK0A 1UKYA 3CWQA 3MWYW 2IYUA 1UFQA 3I4LA 4GOKA 5G3ZA 5HTKA 4B3XA 3DOEA 1E2JA 5KNCA 2VSFA 3EPKA 1DAIA 3T1VA 3QEJA 2A5YB 5AUPB 2JAQA 3MLEA 5CYPA 5FI0B 4JLBA 4JSTA 4KCGA 2RGNA 1Z2CA 3IEVA 2W2VA 3SE0A 4B33A 4EUNA 2IL1A 4FCVA 3EZ7A 3T61A 1SQ5A 1Z2AA 5HKKA 4NTZA 3T34A 4Z1MA 2PCJA 1ZRHA 1ZM2A 2QENA 1QHGA 3IILA 4K46A 2OCYC 2P2LA 2FJUA 4C0JA 1ZUNB 1KKMA 4UKDA 2CVHA 1F2UA 1NBMA 3B1WA 3RRMA 1W36D 1X8LA 3ZLJA 3QVUA 1E79A 4ZO4A 2ZR0A 3CRMA 2Z43A 2VIIA 2HYDA 3SQXA 1VECA 3MAAC 5FPTA 1PUIA 5H8WA 1NI3A 3EG5A 3CX8A 2BJWA 5HE8A 4NDZA 3K9GA 1KMHB 4A1FA 3T5DA 1OIXA 2VEDA 2CNWA 1Q12A 2J7KA 4R7ZA 3T1TA 1GKUB 1XB2A 4MRRA 3DM5A 3Q7PA 1UBGA 1J70A 4DCUA 3RANA 3CRRA 3B7GA 1ZJ6A 2AFIE 4D2IA 2XXAB 4AKHA 2HCBA 1NN5A 4IVRA 4MYCA 5DGXA 1R8QA 2BOVA 2PX0A 1NG1A 1LNZA 1R5OA 2F1IA 4DXAA 4A0GA 1CBUA 1FX0B 1XXHA 1ZD9A 2D74A 4RCZA 4D25A 1JEEA 2ZVQX 4Z54A 1OHHA 1R0ZA 2Q6TA 3FPAA 1SKYE 3REFA 2FFBA 1P62B 2CHGA 2GCNA 1DG3A 4OHVA 5IF9A 4F4IA 1N0UA 1XD2B 4M9SA 3OEED 1GRRA 4OHWA 3IIJA 4EJSA 1ZU5A 2ANCA 2WMNB 4YLGA 4WXRA 3NDBB 4KAXA 3U2QA 5JSZB 5EP4A 1UBEA 1R6BX 1XJQA 4J0QA 3UMRA 1TQDA 1RPZA 4BFYA 1TQ6A 3VR2A 3GLFB 4R2HA 2ECKA 3NG1A 3CRQA 5FTNA 1OJLA 2VSOA 4GFDA 4KFTA 1YR6A 1PVOA 3R20A 3EPJA 1T91A 2ZRKA 5L3QB 2O8CB 1SHKA 4CZ2A 2O8FB 3VR3A 5A0FA 2J1LA 3NH9A 1Z5ZA 2EU8A 4TLAA 2DWQA 2NIPA 4DUGA 5KO2A 3NTUA 3QF4B 4KU4A 4PZZA 2XAUA 3CB4A 2L0XA 2AHOA 4WZBE 3AVWA 4IFEA 3RC8A 1KJWA 1FNNA 1M6NA 2HUPA 3IDQA 2GF9A 1QVAA 2KI5A 3D8BA 2P6UA 2G0TA 4DCTA 4XD7D 3V9PA 5KSOA 1XTJA 2ZJYA 1NLYA 2V3CC 1XNJA 3TJZA 5SZJA 1KJYA 4CEHB 1S9HA 5CB6A 4X8LA 4AURA 1Z0DA 3SU8A 2OAQ1 3QG1A 2WM9B 4HAYA 5H1YA 1E1RA 5FTKA 2HLDD 3GFOA 1KZGB 2PLFA 1NLFA 5H68A 1EFCA 2J0SA 2EWWA 4JBWA 4XIGS 4CGZA 2C96A 2WICA 1I2DA 3U3JA 2IYTA 2XSZA 4C7OA 1WA5A 3TQCA 4UXJA 2ZRMA 2WWYA 1OH7A 2WSMA 2J87A 2V9PA 3ZVMA 4FWTA 1NNEA 5FBRB 2PZEA 4TTQA 1KKLA 1G1MA 3OEHD 3SBDA 3ZH9B 1P9RA 1XTQA 2EWVA 1ZU4A 2NTYC 3BIFA 1AS2A 4LV8B 4LV5B 2MSCB 3FMPB 2OXRA 5JBQA 3IGFA 2R65A 1MOZA 1GL7A 3K09A 4CT5A 4M1KA 4B3DA 2P3SA 4R2IA 3OEHA 2FV8A 1LV7A 2IYVA 4IOKA 3AP1A 2VF8A 2ZSAA 3QBTA 4OK5A 1OLOA 5CIQA 2NO0A 2VHCA 1US8B 1Z0IA 1Z22A 2ZS8A 4L15A 1NN3A 4L9SA 4W9MC 3UKDA 3G82C 2NZ8A 4DSNA 3THXA 5KPJA 1W44A 2J46A 2NO9A 3ASYA 3B13B 3QY0A 5CIWA 1ZM4A 2JIZD 4TL9A 5FTLA 4TLEA 4QHYA 4U00A 1XDBA 2ZE8A 1B0UA 4OK3A 1EG7A 2WSSD 1KSGA 1W7AA 1RC8A 3N5CA 2OBNA 3MJHA 1Q1ZA 3QG5A 4BQSA 4FMCF 2VP2A 3HPRA 1Z47A 4DLSA 1T3LA 1XTRA 1ZD1A 1Z3IX 221PA 4CW7A 2ZREA 2FN4A 4WA7A 4JLKA 3BORA 4EPTA 2PJZA 1Q3HA 2WKRA 3S1AA 2O8EB 1M8PA 4ZDIA 1DPFA 4PC1A 4RFVA 3WNCA 4GZLA 2RH5A 3LLMA 1T9HA 4PANA 2QROA 4CT4B 2Z5FA 2ZAMA 4JS0A 2ERYA 4HAUA 1E0SA 3Q85A 5FTJA 1E1RD 1L2TA 2VHJA 2YOGA 3K0AB 3QKSA 5GVRA 3CLVA 3J81k 3BE4A 3GLFE 1N6RA 1Z0FA 2CXXA 4LYHA 5B30A 4PSKA 4GZMA 2HYIC 1IN8A 3BAFA 2ZRDA 1E9SA 1S9DA 1WP9A 2J7PA 2ZJBA 1GKIA 1N6LA 4LZZA 1M74A 3SJCA 4GSYA 5B64A 2UZIR 4GBMA 4GP7A 3AVUA 4X8HA 1XTSA 5L3VA 3W3AA 4QGHA 1HEIA 4DLTA 4CEIA 5LB4A 4M4SA 4DUGD 3KTAB 4XOIA 3QPUA 3DZDA 4RKEA 1ANKA 3EZ6A 3T06B 3THOA 1N6OA 2PMDA 3EAQA 3RDPA 5DHAA 5FTMA 2FA9A 2ZRFA 2HEIA 4HUQB 3AB3A 3U3OA 1UPTA 1D9ZA 4B75A 4MRSA 2FEOA 3GJ0A 2XZOA 2G0NA 2YC2C 4QL3A 2WWWA 1KY2A 3SZRA 1E1QA 1VCIA 4RD3A 2R44A 2WJYA 5JRZA 3C16C 2X19A 4QRHA 5TB5A 2ZUBA 4P3YA 1T0JB 4RSGA 4QM7A 4BPBA 1ZVQA 2ZI6A 5EXSA 3A4MA 3TRFA 2FFAA 2QSYA 2HT1A 2BHRA 1KZ7B 3ECCA 4A2WA 2JDID 1KDTA 1ONBA 2OZEA 4IHQA 3PUWA 2BBSA 3KKPA 4HDCA 1Q1EA 2QAGB 3ZZTA 5M04A 4ZDWA 4A0HA 3A6PC 4M1MA 1OKKD 4B47A 2Z0MA 4URUR 2FSHA 3QQ5A 1P6XA 1KNQA 2BV3A 3LBHA 4TQUS 3VR1A 1S0UA 3I1FA 2UKDA 2OUKA 4QKQA 2RMKA 4E5UA 1F2UB 1QHYA 2QRZA 1E2QA 3W8RA 4TYYA 2EQBA 3U3KA 4ZKDA 2ZYWX 3TBKA 4WAUA 2Q9AA 1ZBDA 3X2SA 3LX5A 3PUYA 2Q9CA 1G21E 4YMSA 5GJBA 2J7PD 1CTQA 5J40A 8OHMA 1HE1C 4C7OB 4PO1A 1SVSA 3U7GA 3CNNA 2AXNA 1KI3A 4AY2A 3GPLA 1YQTA 1FP7A 1XP8A 4NYMR 3UXMA 3LW8A 5CJ2A 4BFZA 1NBMD 4M21A 4YXWD 1J99A 5F9HA 4A8JA 2O0KA 3GLGE 1RYHA 1XF9A 4DCSA 3LD9A 4LHXA 2XTNA 2VHUA 1P5ZB 4MUAA 3VHXA 4PHFA 2QTHA 3P1JA 3CKLA 3VX3A 3K70B 1Z29A 3EIEA 2H7VA 4IRUB 2H16A 2DWPA 1GKYA 3FOZA 1GWNA 1KI6A 2BBTA 3OIUA 2V6JA 4BE7B 3L0SA 2D7DA 2H17A 1U98A 2NO6A 3K0AA 1YR7A 4NYJR 2ZXUA 1NIJA 3U4QA 5G40A 1FQKA 3I73A 3KXIA 1TPZA 4WVFA 3FVQA 3KL4A 1MABA 4HEJA 4TL6A 4DIEA 1JJ7A 3FFAA 2RAPA 3LFUA 1OH6A 4BFXA 2J5XA 2AFHE 3SBEA 1JQJC 5TXGA 3ONWA 4L5BA 2FFQA 4V0NA 2I4IA 3PENA 4PXAA 2O52A 4ESVA 1JXMA 2P5TB 4DRZA 2YWEA 1VHTA 4DWJA 2ZRCA 4JVSB 4A4DA 1MH1A 3IUYA 2GETA 3TVDA 3BH7A 1H8EA 2B7CA 3SJAA 4BASA 4OJQA 1HUQA 5DHFA 1W4CA 4HAZA 4H9GA 1T8TA 4LHVA 1WDTA 4DLXA 4DEXA 1N6PA 3DVLA 2ZRJA 3RS7A 2AN9A 2CVFA 1IM2A 3D7MA 3H0KA 2FFHA 4Z8YA 5LDDC 2VL7A 1N6KA 3PUVA 2IA5A 2VH5R 4XWKA 3JVVA 4PTLA 1NY6A 1Z08A 2W6JA 1DELA 3Q8XB 2ZSBA 5EUMA 2GXUA 1COWA 1TF5A 3K0CA 4I99A 4N0EA 2WV9A 3C5CA 4PX9A 2CJWA 3P20A 1PLLA 3T35A 1ZAKA 4GPTA 4RD4A 3FWYA 3GEIA 5KDOA 4B44A 3QSYA 4KYIB 3C7KA 1KDRA 2MMCA 3HDTA 2RB4A 2ZU6A 1NMXA 2GK6A 5LB2A 3U3RA 1IN5A 1D8TA 1ELOA 4DT1B 4I1UA 3W3ZB 2B8WA 2QGNA 2YWFA 1NL3A 4HAXA 1EX6A 4DLZA 5B57C 2FZ4A 2ZR7A 5C1BA 3FMOB 4UJ3A 2AR7A 2PCLA 4ITRC 5DISB 1BS1A 3VQTA 1EFRA 4IDQA 3WYFA 1P4SA 4Q1EA 3GLGA 1XFAA 2Q9BA 3GJ5A 5F9FA 3Q7QA 4JIMA 3W34A 5FOTA 4NONA 2H92A 2FWRA 5C4GB 5K8UA 1U90A 3OF5A 3K0SA 1X8KA 1P72A 1U0HC 2AKAB 1TL7C 2ZYVX 2JA1A 3BB1A 4F4JA 1YZQA 1QG4A 4QJ3A 2WJGA 3VR4A 1PZNA 2OLJA 1GNQA 1KYIA 421PA 3ZQJA 4TT3A 3EC1A 5AJWA 3AKEA 5CDFA 5HZHA 1UJ2A 5CK5A 3VKGA 2J41A 2G3YA 3TUIC 2NPIA 4Q19A 3MSXA 5AUOB 2CL7X 2NGRA 3ZS9A 4EFLA 4C3ZA 1QHNA 2OESA 3UANA 1DG1G 4G1UC 3DKVA 3IPXA 3WP0A 1KSFX 2CCGA 4OQNA 5SZKB 4HB0A 3VR5A 1IONA 1E9BA 1NBME 1RZ3A 3FGNA 2EYUA 3C5HA 2IF0A 2NPFA 1RFLA 2QSZA 3R9IA 2C9OA 4B73A 3GLHE 3PQCA 3Q9LA 1XPRA 3KQUA 4HATA 4IDOA 1E9AA 1FZQA 3X1XA 1ZIPA 2F7SA 4OQMA 1VYVA 1DARA 2BWJA 2Q3HA 3ADKA 3HP1A 3QKRB 2GBLC 4IEIA 1KAGA 3LY5A 3GJ7A 2YNMA 2FDCA 2W6IA 1DVRA 1E2HA 1IY2A 4D0NA 3FHOA 3KJHA 1XD9A 2WPDD 4EPYA 5L3SA 1FW6A 3SOPA 5IK2A 5FL3A 1W0KD 4A15A 1E0AA 1E79D 1T0HB 3R9WA 3QXSA 3KUDA 1KK1A 4Q48A 1OFTA 1ZD8A 2F1HA 2YZ2A 5BN4A 2EFHB 2CHQA 2JGNA 1NJGA 4U5XA 2IUTA 1NVUQ 1H8ED 2ODNA 4NCNA 4P4TA 3U6KA 1ZNWA 1YU9A 4HSEA 2GXQA 4TSFD 1E32A 5L3QA 1SVKA 1SVOA 2EFGA 1X3SA 2QP9X 2O8CA 1CLUA 2ZAOA 3PUZA 3T5GA 2OAP1 2YOHA 3CZPA 2OE2A 1D2EA 3QVVA 2NO1A 1E2NA 3CW2A 1Z6XA 2IXGA 4LHYA 2VQSA 4ZPXA 1P2SA 3TLXA 3PVSA 4AYTA 3K9HA 4GMDA 2HT6A 4M9XA 4OQLA 4URZR 2QRNA 5EE5B 2P0EA 3L8YA 5FR2A 4EJSC 4W5JA 3Q5DA 3IIMA 1NY5A 5EJEA 1E6CA 1TQ4A 3GJXC 1U94A 2BMFA 2SHKA 3QENA 2OXCA 4Q9KA 3B82A 4Q9LA 2HJGA 2IEZA 4N3NA 3EW9A 4OK6A 1GITA 1DS6A 2FH5B 1A2KC 2QTFA 5TY0A 3THWB 5E3HA 1E9CA 2WWIA 4HAWA 3A4LA 4P4SA 3U4QB 2QPOA 3BGWA 1OFHA 2OSBA 1P9NA 3GQBA 1U99A 4UQOA 5CJPA 1MO5A 1XJ0A 4QOSA 1W49A 3QKUA 4ACBA 3TQFA 4DEYA 2IBMA 2ZI3A 5IHPA 3BOSA 4LYAA 3UMFA 2XZPA 4D6PA 1U8YA 5A5GA 2VSXA 1OFIA 3U61B 3EZ2A 2OILA 4QXAA 4TMKA 1E2GA 3RNLA 2RHDA 2VA8A 4HYYA 4ASUD 2XGJA 4B3FX 3RHFA 3LXRA 1H8HA 1BMFA 3DKPA 4FN5A 1Z6YA 4KSBA 1AQUA 2WOJA 1N6HA 5J4VA 2GDJA 3RS3A 3K0FA 5IT5A 1RIFA 4DKXA 5CDFE 4NU0A 5LD2B 4HLDA 1UKEA 5E7JA 3PEYA 3WY9A 1RYFA 2GJ8A 1WBBA 5KYKA 3EA0A 4I1OA 5DI3B 1P2TA 2ONJA 2DB3A 3AVTA 4EPVA 4KFRA 4I1SA 4D4KA 2ZE7A 1DAKA 2ZRGA 4DLUA 2RGBA 4BLQA 1W36B 2AXPA 3A1UA 1KK2A 4Q18A 4QJ5A 1U0LA 2E87A 4QBFA 3RRNA 2FPMA 5EXPA 2FGJA 2XB4A 4O2LA 3T15A 1GM5A 3C41J 3KKNA 3K09C 3NC1C 3ZD6A 2KE5A 3X1DA 1XTKA 2GCPA 4PHTA 4YONB 2F43A 4GOXA 5G3YA 2JJ1A 1W48A 3EWSA 4HI0E 4O3MA 5FL7A 2ZYTX 3PG5A 2C98A 1YR8A 1N5JA 2ORIA 3LW7A 1U2RA 2PZGA 4UNSA 3IHLA 2HXSA 4UXHA 4XVRA 1VDZA 4BFWA 2WMOB 3F3YA 4DB4A 1NKSA 2QP3A 3RSOA 2REBA 1UBFA 4KV9A 1G20E 1XD2A 4LJ7A 3BJIC 3MFYA 3UWOA 5C2JB 2ORWA 3N2EA 3KTAA 5A4JA 3CBQA 4KSCA 4M22A 4DCNA 3PCRB 4E07A 2O8DA 4CYMA 4MYUA 1OPXA 3L0IB 4CRWB 4LJ5A 1LY1A 4LPKA 1HQCA 2NMVA 2YWHA 2WIAA 1R7RA 2XB2A 4IFBA 4Q9JA 4A2PA 1IXZA 4US0R 2GXSA 1DAGA 2C5LA 3BERA 1E69A 5KDLA 3K1JA 1SKYB 3AF2A 2XZLA 3RRYA 2CE7A 4HLQB 3ZIAD 4NCHA 1RJ9A 2ZJ2A 4TLCA 3L82B 1VYUA 2VYFA 3EIHA 5KU1A 1F60A 621PA 1IQPA 1ZINA 3TMKA 1JQLB 2Q3MA 5IDVA 3WP1B 1AKYA 1QF9A 5FOXA 4RD1A 4ZIRB 1TQ2A 5KUTA 3WXMA 4RCYA 3A4NA 3QEOA 3THYA 1OW3B 3AEZA 4AI6A 1Z6TA 5AR1A 5JEDA 2IWHA 3GD7A 4KHZA 3UWKA 4UNNA 4PQRA 5C46F 4TYWA 5DI3A 1GP2A 4C9BA 4URYR 4ZKEA 3O8BA 2CLCX 2FNAA 2W2TA 3T1QA 4DSOA 2HJVA 4WBSA 4KFUA 4A36A 3HR7A 3FDIA 4PZLA 4Q9HA 5FBVB 1BYUA 2CK3A 4GNKA 3MUFA 3U44A 1PLKA 2IS6A 2ZJZA 4KFSA 5JCPA 3PJRA 2BJVA 4NYMQ 2C9CA 2F1RA 3VU9B 3W6NA 4LJ4A 2WSSA 4DLYA 2H8KA 4BFTA 1VHLA 4Q01A 1G8GA 1A4RA 2JIZA 4Q7KA 3GP8A 3TSZA 2R6AA 1G18A 1YE8A 2QEQA 3CPJB 3NWJA 4HLUC 2ZU0C 2GJKA 1H8HD 2VLIA 1YJ5A 2QMUA 2G1KA 3PIRA 4P31A 4JSYA 1G7CA 3KFVA 5DH9A 2VRWA 2CMKA 1P60A 3RRZA 1GAJA 1GIAA 3IO5A 2PT7A 4GRAA 3R7WA 3CIOA 1T3HA 3VNUA 1AA9A 3WBKA 2D3WA 2R9VA 2FZLA 4S35A 3W5IA 3AVYA 4B35A 5DSZA 2OO7A 4IDNA 2BMEA 1F48A 2IC5A 1FPMA 3TAUA 1XBTA 2ZANA 2YKGA 2WBLC 1FMJA 4G5SA 1E3MA 3P4XA 2GF0A 1I4DD 4PAQA 1SXJB 1NF3A 4R98A 3B60A 5EZ6B 1G7RA 2ODEA 2XNDD 2CCJA 2AKYA 2A5JA 4JT4A 3VU9A 4Q1AA 1MT0A 1VG1A 2WWXA 4HZUB 2DYKA 4ACAA 3AF0A 3LVRE 4D4LA 2IHBA 2DFKB 4MKIA 3GLGB 4A6XA 4C0BA 2O5VA 1E2EA 2IW3A 3CWZA 5UKDA 4ZDKA 4M2LA 2GAOA 1D2NA 1YZGA 3ZVRA 1G3MA 4M1OA 4WW0A 3P27A 2B8TA 1NVXQ 3NVAA 1OXTA 2C99A 4TZ0A 1HA3A 1SVLA 3WMGA 5HR5A 3NDPA 1IBRA 4ZCMA 2AK3A 1MO4A 2ZS7A 1ZCAA 3W6OA 2ZM5A 1JI0A 1AGRA 3RS4A 3I5XA 2WJVA 4LBVA 1RKBA 2Z83A 1CP2A 4QNRA 1E2IA 1RJ9B 5E7MA 1D6JA 4IOJA 4B2LA 1QHHA 4I1VA 3O47A 3L8ZA 3TE6A 4RVCA 4HLUA 3AP2A 2QT1A 4AKIA 2DR3A 2XEXA 4YMWA 4TQ9A 4C0AC 1N3BA 4B48A 4NYIQ 1GSIA 3ETLA 1C1YA 4DLRA 2Q0HA 4IKEA 4Q47A 1U8ZA 3NEYA 1W5TA 1AS3A 4AIIA 4ERNA 3GEEA 2WJIA 3KQLA 3A37A 3KZ1E 1E2LA 4Q4JB 1Q1QA 2P67A 1GZSA 4NZYA 2OCPA 2F3RA 3B1ZA 4LV6A 4QHSA 3ZYCA 3ADCA 1KJZA 3JVUA 4JLOA 4C0HA 4KBGA 3OAAA 1TADA 1EWQA 4KXFB 3GLHB 1ZCBA 3LO5A 4BEJA 4D0GA 3ADDA 4B43A 2BEJA 4PAMA 4OBEA 1TX4B 1JNYA 3EIQA 1E2DA 1J8YF 4BFVA 2AWNA 3C15C 3SR0A 1R2QA 4ARZA 2XTMA 2ZRBA 1JJVA 1U81A 5HPYB 1G6HA 4FCTA 4A82A 1L4YA 2GNOA 1O3YA 1E96A 4ON9A 4PO9A 1IJEA 3PITA 1VTKA 4TWZA 1BIFA 1E94E 1TAGA 1ZW6A 4E09A 3OIVA 2KSQA 2REXB 5KNBA 2JJ2D 2ZROA 1OT3A 4TMTA 2VPPA 1J2JA 1FFHA 2AWOA 2OLKA 4PHGA 4QC2A 3EZFA 1FL9A 3OFND 1VIYA 5D3MA 4B32A 3HU3A 5JECA 1NSTA 2BVNA 4A92A 4TTRA 4E03A 4DDWA 5KOYA 5ELXA 1M7BA 2ZVPX 1MR3F 1Y63A 4O25A 4LSGA 3LQQA 3PUXA 3CONA 3NH6A 4N1AA 3IBGA 4Z1MD 5FOWA 4W5HA 5GJVC 1GRQA 2C2HA 2ZSFA 4L9WA 5BQ5A 1KK3A 4CEHA 1VCNA 2EW1A 1TTTA 3B78A 2ZE6A 1DAEA 4FMDF 4M8NE 2Q3FA 2QTVB 4NCJA 4RY2A 1YKSA 2DFLA 2OBLA 2PEYA 3GFTA 5EZ5A 4EDHA 2XNSA 4D4MA 4II7A 2JLSA 1ETUA 3U44B 3HU1A 3R9XA 1HH4A 4HB4A 4IOLA 1KI8A 2VHTA 4MRNA 4C0SA 1KO4A 121PA 1XZQA 2J0VA 4G01B 3GJ8A 2A5GA 1Q57A 3TUJC 3NBXX 3BBPA 2OFOA 2W6JD 3CNLA 5CM9C 1IJFA 3THWA 3UK6A 3PEUA 3Q5EA 3D6TB 4BRUA 2C95A 2R6CA 3GJ6A 2W00A 3TR5A 4AC9A 1X6VA 3SN6A 1W4BA 1Z83A 2J45A 2OCAA 4BGDA 1SGWA 5K8LA 4DCVA 1OFUX 1A1VA 5JHHB 2WJJA 2ZR9A 3ZGXA 3AVOA 3IBYA 4EPWA 3CF6R 3CPHA 4DB2A 2GRJA 3B9PA 3WMFA 1OXSC 1R10A 1XCGB 3QXHA 5KSZA 5EP1A 1JALA 4B3GA 3MG9A 1OIWA 1R5BA 4GL2A 3PFIA 3FE2A 4DC9A 1XEFA 2HF8A 3I32A 1GTVA 2C9YA 2EFEB 4Q4JA 1F2TA 3E70C 4FD2A 4JT2A 1ZP6A 4LHWA 1TUEA 2QU8A 4YDHB 5BWMA 2J0QA 2CEAA 4LC1A 4LJAA 1ZUIA 2QT0A 1XXHB 2AL7A 2YJTD 3GFPA 3QE0A 3SYLA 2GEDA 2ODWA 4AKGA 4MKHA 2ZPTX 5GVSA 2JLUA 4G3XA 5DYGA 4A0RA 4V0LA 2WWGA 2ZRIA 4OL0A 4M0LA 3W6PA 2NO7A 5JZVA 3THYB 1SVMA 1M1YE 2YC4C 3QOFA 4RD2A 5FOSA 1W0JA 1U0JA 3AF4A 1K5DA 2QE7A 4XJXA 5LPNA 4IEEA 1I4TD 2KB0A 1YVDA 2IYYA 2WOOA 1ZMXA 2IT1A 4I81A 4LWZA 1CJKC 1MV5A 3FKSA 1S2MA 4KBFA 3U7EB 3QKTA 5LBIA 2OEPA 5BYJA 3U60B 1WRBA 1F5NA 1KI6B 3U5ZB 5FBWB 1JPNA 2K5UA 4DSUA 3LWNA 1AS0A 2F43B 3AGPA 3V4FA 4O0MA 1D5CA 3UMSA 4HB3A 1XXHE 5JLJA 1GL6A 2ZRNA 3MWLA 4BZXA 1A2BA 2F9MA 3R8CA 4YXWA 1AK2A 4JJZA 1FMLA 3GLIB 5FPKA 2ASEA 4LBYA 1EFTA 1SKQA 4G5GA 1XZPA 3CUEF 2PH1A 2Z4RA 3VNVA 4DDUA 2N42A 2JJ2A 2ZI9A 3GEHA 4URVR 4H1UA 2QGZA 4ZCIA 4FCWA 1QDEA 2XTZA 4MGKR 2FPLA 1X1RA 3VKHA 5AJVB 1MO3A 2JLWA 1E4VA 2J3EA 2QQEA 2GCOB 2RGNC 2D06A 5JS8A 3QNUA 5KSYA 1GILA 1QHSA 1NJFA 1G5PA 4PC3A 3UPUA 2O8BA 2QZ4A 5KPDA 2AK2A 3R7WB 2IUSA 1E4YA 3TAHA 4QM6A 1OKKA 3X1YA 3L0PA 1G8HA 2OT3B 1N6IA 4MRPA 2B21A 3Q72A 5HZKA 4BECA 3OFNA 3OAAD 4MKGA 2I1QA 3VKWA 4I4LA 1XRJA 4Q7MB 2A5DA 5ANRB 4EAQA 3SJZA 1NVWQ 4U7DA 5AUQA 2DFTA 2VP6A 4FW9A 2ODBA 2IYRA 4DBLC 1G17A 3CRW1 3MGCA 1G3QA 3SHWA 4YDSA 4BLSA 1P9WA 1E1QD 821PA 3A36A 1AN0A 4LC0A 3EPHA 4LJ9A 3ZVLA 3ICQB 3B5JA 3BXZA 2CHVA 2YINC 1BOFA 4C4PA 3AVPA 4YMUA 1Z63A 3F8TA 4NPHA 4HDOB 3ZQ6A 2W0SA 3DO6A 2QBYB 2ATVA 4Q00A 3WYAA 2IXFA 4TL8A 4OI0A 1HE8B 2R2AA 5HCNA 1XMVA 4TLDA 2PJRA 3QUSA 5AJXA 5G41A 1BKDR 1CU1A 1S1MA 1NN0A 3KJIA 4TMXA 1KHTA 1M7GA 4JBXA 4LYJA 4OHYA 3IIKA 1WQ1R 1IXRC 1VPLA 2X2FA 1G8YA 3BH0A 2A2ZA 2A7QA 2IS4A 1BMFD 3BFKA 3U3MA 3LDAA 1KTVA 1W2GA 3OE7D 3OHMA 5J5CA 4RD6A 1W5SA 3IKJA 3NIBA 2G77B 3QF4A 4W7SA 5BW8A 1QHXA 3SDZA 2XJ4A 2WAYA 2FG5A 4Q03A 4NKRA 1JXOA 1T5IA 2W58A 3O8RA 3HYRA 4RKFA 1VKJA 3K70D 2ZTSA 3TVTA 4ZI3A 4KJZA 4TQAA 4JVLA 4Q4LA 2GESA 1E99A 3W8NA 1XCMA 1UEIA 1U9IC 5P21A 3KKMA 1RRPA 1Z6AA 3AF1A 3KJEA 2C04A 5AK0A 2GVZC 4MH0R 5JRJA 5FFMA 1T8UA 4HLCA 3WMEA 4LBZA 3NBFA 4M1SA 1CJMA 3DHWC 3LAWA 2IEYA 4WIAA 3UG6A 3I62A 1R0WA 4QBIA 3ZS8A 3ZZ0A 2ZSDA 3DOFA 2IK8A 4B6FA 3S1AB 1UDXA 3MWKA 4C0QC 2N1BA 1LFDB 4B76A 4ZI2A 3BK7A 1VIAA 3CX6A 3B1XA 3C4JA 3QXXA 2ZS9A 3RVBA 1OF1A 1KI1A 1NLZA 4TYNA 3A1VA 2BKEA 4KVAA 5TDHA 3KB2A 1GNRA 3CRVA 4Q7LA 1H65A 3JZAA 2G1JA 4PAOA 4L4UA 4PPFA 3U7HB 4Q4HB 2ZRAA 1KMQA 1OXVA 5EXTA 5K8IA 3B1VA 2VTKA 1WXQA 2D4HA 4KVGA 1CR2A 2IYWA 3H1TA 4F91B 4Y0AA 2BM1A 2V1XA 2PBRA 1AJEA 1ZNXA 1JR3D 4Q9IA 4TSFA 3VFDA 3C14C 1KIMA 1OXXK 3TGPA 1KOFA 1KSHA 1WE2A 3M4YA 1YZUA 3TW4A 1YRAA 1SZPA 3PEVA 4BZQA 2OM2A 5KTYA 3U6BA 4OI1A 5FPSA 2XITA 4XTRA 3K0FB 1OB5A 3SNHA 1UAAA 4V0MA 1AIPA 1W0KA 3CH4B 5IK2D 5E7IA 4CVNA 2V54A 1KI9A 2ZRLA 3LXXA 3W5JA 3BH6A 1U9IA 4ABYA 3CF0A 3RS0A 4LJ6A 4DDVA 4V0KA 2ZIAA 3TK1A 3E5HA 721PA 2HLDA 1GUAA 2IF2A 3QIAA 4EFNA 5SZHB 1IN7A 3K9LA 1CKEA 1N0VC 4PR0A 4D0LB 4QNMA 3CO5A 4F93B 3LV8A 2QI9C 3NC0C 2BEKA 4TTPA 3ZIAA 4CIDA 2CK3D 2DFNA 2FOLA 3K53A 1G3RA 4XD7A 4D81A 4ZDJA 1CULC 3KXLA 4FIDA 4LRWA 2RGEA 4BLTA 1S3SA 4C0LA 3CF2A 5JFGA 2OFXA 4PC7A 4EKDA 3K9NA 4PFSA 1KNXA 2REOA 3HJNA 1LVGA 2P6NA 1II0A 1OXUA 4RJLA 1XPOA 1FUKA 4PPQA 3KQHA 3P32A 5DN6A 3K8YA 2VF7A 4Q1CA 4HUQA 3TNFA 5J47A 3FTQA 4FMCB 4EPXA 4URWR 4R9UC 3ASZA 1HV8A 2XOKD 1XD8A 3AP3A 4G5OA 4PPNA 4QGGA 2RKOA 4Q1BA 2R62A 2A9KA 3RSLA 2I3BA 1OIVA 4TLBA 2ZI5A 2DBYA 4IDPA 2JLRA 5J4KA 2OG2A 4EJSB 1CR0A 5EE1A 4DT1A 5AJZA 3CNOA 2UVQA 5TV2A 2B6HA 3DL0A 5JWOA 4FINA 4GT1A 4A8JC 3BWDD 2ZUDA 1Z0JA 5FL7D 2WAXA 2GK7A 3LLUA 1IY0A 2JJ1D 2N46A 3ZJYA 3L43A 3OEEA 4D26A 1EFRD 4P33A 3T1OA 5CB8A 1J7KA 3VR6A 4DJTA 1XPUA 2KBEA 4BUJA 1XEXB 2ZJOA 1OYWA 1XX6A 2BMJA 1E9FA 3LRPA 1OHHD 1S8FA 3KDSE 1P2VA 4V02A 2GA8A 4TMWA 4BLPA 1BYIA 5F98A 4C2UA 3AUYA 3NEJA 4XTCS 3MJRA 1T5LA 1TU4A 1KSJA 3KB1A 521PA 4TN1A 4RZ3A 2ZI4A 4NYJQ 3A1SA 1QBKC 3EASA 2QMEA 1MKYA 1XMIA 5TARA 1GFIA 1S96A 2OV2A 2QE7D 2QP4A 2A30A 4JZKA 1ZC4A 1XJCA 3GMTA 1COWD 2NZJA 2BC9A 1DAHA 3A1TA 3CX7A 2W83A 3HYTA 2QY9A 3MCAA 1UF9A 4RZ2A 5FUXA 4WZAE 4PQFA 5BXQC 1LS1A 4IXNA 3W90A 4JLVA 3TIFA 1DTSA 2FPKA 2WWHA 4MYHA 1UM8A 3A58B 4XSGA 4DZZA 4AG5A 1FP6A 1LB1B 1M2OB 2J9RA 1G19A 3LVQE 4DVGA 2O8EA 2QQ0A 1G5RA 1XMJA 3NKVA 4ASUA 1B23P 1Z6GA 1E9DA 3IO3A 2HCJB 4MKFA 1XWIA 1G3UA 4R71A 1Q3TA 2GJAA 2GZHA 5FH9A 5HCIA 3AKDA 5HKKD 4QGFA 1G6OA 1K6MA 4NCKA 4BRWA 2NG1A 4ILEA 2W0MA 4M53A 1CIPA 3KXKA 4HZIA 2D2FA 1ZYUA 2CLSA 1Q1BA 5JI2E 1EGAA 1LW7A 1XU4A 3ND9A 1G41A 2WJHA 3BD9A 1DE0A 1J8MF 3IEUA 2IYSA 1N5KA 3K0CC 1G9XA 5JEEA 3L2OB 1TMKA 3EARA 4P32A 4E22A 4JVMA 3OIWA 5KSPA 2BCJQ 1AQYA 2FEMA 1JAIA 2QAGC 4OQFA 3BC1A 4RZXA 1KO5A 3ZD7A 3VAAA 3KQNA 4MA4A 2JJ8A 3P26A 4YMTA 3HWSA 4LUCA 1E0JA 1P75A 4M1TA 3LQRA 4BZPA 2ZI7A 3SEAA 2JATA 3SI7A 2KJQA 3I72A 4WOPA 4OHXA 4D4JA 2EFCB 2OFWA 1FTNA 2XJ9A 5BYKA 3B9QA
chains in the Genus database with same CATH superfamily
4AWLC 5KDMA 1RJGA 2ANBA 2F6RA 3FDZA 3M5WA 1L8LA 1YHNA 2ZB3A 3L02A 3N28A 4P08A 5CVCA 1K4MA 2NM0A 3WHLA 5ALIA 4EF5A 3VU3A 3CLTC 2QM7A 3KV3O 4ND8B 3KV1A 5JJLA 3ND8A 1XEWX 5A3VA 2Q27A 3LF2A 4ZVMA 1LS6A 1LLQA 1YH3A 4YT2A 2CJWB 3E9RA 4RVOA 1P3IA 1YRLA 3GRYA 3QVJA 3LT0A 5B12A 1WCV1 2IZ0A 5JLAA 1E2BA 3RSSA 1JBKA 1IEWA 1AGPA 1P3JA 2G09A 2XX3A 3QKSB 4RX1A 2AC4A 5EP2A 3WK9A 1GGJA 3WK5A 3X1UB 3LHKA 5BN4B 3T3GA 2JI4A 2IYLD 2BIFA 4IIJF 3M0EA 3ZJTA 4YAKA 4MS3A 1QQ6A 2BYMA 5AVBB 1ND6A 4AXXA 4O2BF 4OJNA 4Y8VA 3ZV3A 3WKJC 1LRLA 2VUHB 5DJ5A 4KQXA 4PM4A 2J67A 1SXGA 2ZT7A 1ZH0A 1SPXA 3E1SA 3G2QA 1TIKA 5CAEA 3KKLA 1AKUA 3B6FD 1KI4A 2I99A 2VJYA 4WOCA 1SA0B 2WP8J 1RBZA 3FUCA 2GEVA 2IHVA 5KTRA 1PV1A 2EKPA 3O75A 5ITZA 1A7JA 4ZVUA 4YP7A 2PQ0A 3CEHA 4RGQA 5EWJB 4EUHA 4HDQB 2B99A 4NBSA 4C14A 5JNTA 1QYCA 1V8PA 1T4DA 2XYGA 2O5RA 3HU5A 3I8SA 2WVHA 1WQ3A 2PGOA 2B98A 2WWFA 1Z0KA 2HHAA 2P78A 1HQ3C 4EHAA 4C2TA 1XEXA 1KI2A 2QIPA 4G2NA 3GAMA 5EA2A 2W8SA 1M34E 1QG2A 2BGGA 5FUVA 5AVZA 2A9QA 3RELA 4U7GA 2WIGA 2QOEA 3I76A 3QEBZ 4FHCA 2V4MA 3P9NA 1LF5A 5EE9A 3S2GA 3ZTWA 4A26A 1F2TB 1TGVA 2PH5A 3MGSB 3C1BA 1OH8A 5C35A 2YZMA 4KXUA 5FP0A 2O07A 4EGQA 4CI9A 2YJ6A 4MS3B 1PW7A 2ERCA 2YS6A 2R4TA 1FRNA 3O1IC 1JU4A 4KPFC 5B5SA 3NDRA 3WWCA 2OB2A 3RYCB 3U56A 3FCUB 2II6A 2PGDA 1E2MA 3DEFA 5BWOA 1P7VA 4G0UA 2JA2A 1GZ3A 2Q21A 1QQTA 1I7LA 3OA2A 3O4GA 2MDTA 5ICSA 4WXPA 4H59A 2HWUA 4XW2A 5KTSA 3OSZA 2JKYA 1US8A 2V9ZA 4H60A 4M98A 4C5BA 1BFDA 2Q5FA 2RDMA 3BQNB 3HO8A 2OV8A 4RL4A 4XGQA 4XE5A 3NJRA 3T3HA 3HXQA 1XC7A 3W2FA 1ZNYA 5GZ1A 3H86A 4DR4B 1RYDA 3E5NA 4YCDA 1V6SA 2GI4A 3MRSA 2GHIA 1XTIA 2XXJA 3HM9A 5CK4A 4NJEA 3AL3A 3L04A 3TU4B 1BQ3A 4QLAA 1C1XB 2Q07A 1R0YA 4AY6A 3I53A 1NPYA 1QYIA 2O54A 1Y3FE 2R0QC 1G66A 3LXUX 2C7PA 5K3CA 3LPNA 3IODA 4YQEA 3WO1A 2GCOA 5FWYA 1KO1A 1Q5PA 3NRBA 4RVDA 3W9YA 2PSDA 1KH1A 1ZIOA 3L7OA 4KIFA 5A7HA 3ZHZA 4Q37A 1DJNA 1TJ3A 2QPAA 2X1HA 1ID3D 1T9CA 4Z51A 3SS8A 5GT3B 2V7VA 4A9AA 5LNK6 2Y2MA 5E4FA 3IRUA 1GG2A 4G24A 1EK2A 5COQA 2XZDA 4GI1A 2ZT5A 1CVLA 2QY6A 1JQ3A 5TRTA 5I7RA 3EGCA 2VHQA 4B3BA 3OM8A 2BKUA 1TF2A 2VYND 5F2EA 1X1BA 1E5XA 1O9GA 1VKHA 2ATXA 2E4VA 3MIIA 1RP1A 3F2VA 2I2DA 1OLSB 2Q6KA 3A1WA 3I1IA 4JQZA 3PQ4A 3GLQA 1K4YA 2PEZA 1UC8A 1ISRA 4CZ2A 1TB4A 3QI2A 1H1LB 4EY6A 2D2IA 1L7AA 5CURA 3TSWA 4QEZA 2IU3A 1N77A 4HH4A 3DMYA 3VR0A 3OQMA 1ISGA 4FHZA 1RLMA 1Z16A 4I19A 1H05A 1JLLB 3KXPA 3O38A 1EFPA 1CWUA 1FEZA 5JS7A 1ZH8A 4ZQHA 4KGCC 2BHNA 5ED4A 5D3QA 3OY7A 4LGMA 1UKVY 4UZEA 2AC7A 5CG2A 3BTOA 1V5WA 5M34A 1YQDA 4UJ5A 1CF4A 3BREA 4W5WA 5JHGB 5LR6A 3DBRA 1VM6A 3I45A 3QH4A 1ZNZA 5DXAA 5B7NA 3A6ZA 3V4RA 4L9AA 2GJSA 1H6DA 2G72A 3HN7A 4H77A 2XF2A 3IP7A 1P45A 2JLQA 2C03A 3GIDA 4XVUA 5FNVA 3BHNA 3OOJA 5JXHA 4F4CA 4MI6A 5HA5A 1SZCA 3S8YA 2HJ9A 1FDOA 3BWBA 3WLEA 4CR8A 3OM0A 1XCPA 1G6Q1 3CLRD 1DO2A 1VHWA 1BDMA 1RPAA 2H5EA 5K2OA 2XODA 1QVVA 4LDRA 3C8MA 4EIWA 3AZFD 3GZ4A 3K9BA 4N82A 1ZM9A 1K1EA 3E8MA 4GXNA 2IHYA 5K6AA 2BH9A 5F2KA 2J6HA 5SZIA 3IAS1 2DPGA 4N7MA 3DAYA 4KQCA 3UJAA 1R50A 1CERA 1X1SA 1ZWKA 4HMOA 1VBKA 1L1QA 1PIWA 3TD6A 2ZITA 3T1YB 2XUIA 4NS4A 5C5DA 3BRWD 3W2TA 4DGSA 1N5LA 5KMGB 4JXKA 5DYYA 1JHUA 2BDTA 4LOLA 5HK8A 4ZZ3A 3O8CA 4OJKA 5LA6B 2HA4A 4RJTA 4WK2B 2GR9A 5GJWC 1PJZA 4D9FA 3A9SA 1LRJA 1NJSA 3MNNC 1Q0ZA 2O2HA 2ZSUA 3DB2A 3QKRA 1QTNA 5EKSA 4FBGA 4AF8A 4DBLE 4P53A 5K5EA 3JARB 1JEQA 3SY8A 4XJSA 1DQRA 1XEWY 4B31A 2PAFA 3HKCA 1IUOA 2NT3A 4L2IB 4X1YB 3VXKA 2X0EA 2I66A 3U4CA 4GRDA 3B8HA 1S7CA 3X1WA 4D9GA 1CDDA 3LBNA 1RYNA 4RIFA 1RR6A 2O8DB 3KVYA 1NJ8A 1KEPA 4G1BA 3T0FA 3KLPX 5AY8C 1XZFA 1QXSA 3SIRA 2PT9A 3VH5T 2WAAA 2VR1A 1FQWA 4YFVA 3SEQA 2CNLA 5LQDA 3F3KA 2XOKA 4BB0A 4PVCA 3WWYA 1EE2A 2FU5C 4CLHA 3T41A 5EI5A 5FAXA 4G0MA 1N6NA 5GWXA 3HJTA 1BDIA 1TEXA 2LKDA 2ZSEA 4LECA 3ZGVA 1YQ9A 1QSGA 2BY4A 3KP1A 2FMUA 1TYDE 4KTVE 4KXVA 1ZJ4A 5KTMA 2R8OA 1MENA 2Y2UA 3HY6A 3M33A 3GYGA 1KQ3A 1GLNA 2K2WA 4XX0B 5K0NA 4N03A 1L9XA 2Z2IA 3AV1C 3TKAA 2ZUTA 3THXB 3VOSA 1JDVA 2WJZB 3O4FA 1JJBA 3E9NA 4W9RA 3T12A 4S1VA 2DTXA 5K8VA 4Q3AA 1EFPB 1M5TA 3IQIX 2P4QA 3PHBE 1XDWA 4OQXA 4J1SA 1DV1A 3FOWA 1RWPA 2W4MA 3NOXA 4HYQA 4J76A 3ROEA 3V8BA 4B7XA 4IZHA 5BN5A 4OJYA 4EB8A 1M8GA 3KZMA 2GAAA 1IZ7A 3NXSA 1I3NA 3MTJA 4Z8XA 4LJYA 4BKMA 4CQMB 3AZEC 2FPUA 2G88A 2H2IA 2YMLA 3I8XA 1EINA 2XI4A 2BCEA 2V0CA 4JLNA 2CXNA 3CA8A 5DLQC 1E18A 4BU0A 4F7DA 3BWVA 3AKCA 4HX5A 3ZWVA 4CCYA 1BGVA 2X1MA 4M1YA 3DT6A 4R8MA 4DV4B 3FHTA 3O2QB 1IWBB 1KORA 4MWCA 1V7QA 1EVIA 3EHEA 3HKDB 3I92A 4ZP1A 3SC6A 2C3UA 1IN6A 4PWZA 4PRYA 5EUQB 3SMQA 2WM3A 3U1VA 4IF4A 4XWOA 2X8WA 4D4GA 1I7DA 1OZ0A 2PUDA 2JIRA 5B3JA 4LFBB 2OCLA 4J8WB 3WKJB 1D2CA 4HV4A 5CDYA 3P0FA 3DDHA 3E1GA 1Z2PX 1Y9AA 2H4ZA 4Y2RA 3TFWA 5ALUA 2RGGA 1SULA 4G0QA 3FZGA 4GLJA 3TINA 1A5AB 2POQX 1V96A 4J8XA 3WTPA 1L3CA 1XIVA 2YW9A 3P4YA 4ZCLA 2GJ4A 3NLLA 3T54A 3HSSA 4B34A 5ARBA 3CF4G 4FYHA 3LGSA 4GE0A 3OQ1A 4JL6A 1TAFB 3FNGA 4K86A 2C2ZA 4RKQA 1HYBA 4LDJA 4PIPA 5EN4A 5K8JB 3MWEB 1U0OC 4ZJUA 2Q7OE 1BN7A 1OI7A 1Z4IA 2RIRA 2Z9CA 3B2EA 3V80A 3LSYA 2VDOB 1SN7A 2WHQA 1OTHA 2FW6A 3DMDA 5KX5B 1HO3A 3GFSA 3ML1A 1ZGGA 4UTRA 1CZLA 4X71A 4DV1B 5LLTA 1WSAA 1QQAA 4ZQBA 2O50A 3SYNA 2ZR8A 4U8GA 1E6LA 4DCGA 2C4NA 2IXEA 4OMUA 3TFOA 3TZQA 4HWRA 3RUEA 2FPXA 2ARKA 1K3TA 2QXYA 1B67A 3L1IA 4POAA 2CUZA 4WNAB 4BKPA 5LD2C 2C7QA 4YS3C 2VOEA 3EA5A 3EGVA 1IJBA 1KX5D 2H1RA 1SUAA 3KELA 3ZXIA 2C83A 4D99A 1YI0A 2B1IA 1U35A 2OO3A 2VUUA 3RELB 4A0FA 3LP5A 2LR0A 4MDEA 1XZGA 4DF3A 3KT6A 1O87A 1G3IA 2VJLA 3QPWA 4M88A 3T7SA 7YASA 3SXPA 1ZLAD 2IDMA 8ATCA 2CDNA 3L7YA 3STWA 1WUJS 4NE2A 3TUZC 3NBYC 5AQ1A 1IPEA 4KQHA 1A4IA 2WUFA 2AROD 3UNXA 4CMIB 3HXPA 1P4GA 2GO7A 2X4LA 2EP8A 4IO0A 1UDWA 3COWA 4HZUA 5JZ9A 1NVGA 1QFJA 3P5BA 2ZP1A 4IIGA 1O08A 3PPWA 3EIXA 3FTPA 3UJNA 3SJ7A 4PONA 3QEAZ 3GN2A 5H02A 1N2CE 4QDTA 3AVXA 1W87A 5J4LA 4IVPA 5I7HA 3VR5H 1XVIA 3ND5A 3OE7A 5IVIA 4EQ6A 4QOIA 1GA4A 2YNMD 2W9XA 4MQ5A 1JEDA 3QMVA 2YWCA 4E3ZA 1GNPA 4Y0VA 1JG7A 5HG0A 1SMKA 1MNAA 1BW9A 3UT9B 4Y6LA 2YRWA 3REHD 1MB2A 4OHRA 3VTKA 4J8XC 1PVVA 4L74A 2D00A 3RYIB 1S4QA 4AJIA 4DNQA 1CUBA 3KX2A 5ELMA 1AKTA 5TLSA 4J8WC 2Y93A 4MMXB 2RGRA 3FFBA 4QATA 3SC3A 1NIPA 2ECPA 1DX9A 4Z3OA 1GAXA 1ODLA 2AXQA 3R7BA 3K31A 1Q2XA 1ZI6A 1Y1QA 2HWWA 3TQIA 2IFTA 4B4VA 1HQ3B 2W90A 4CDGA 1JYEA 3CTMA 1N5OX 1X8JA 1REQA 4IQ4A 3OZXA 4JP1A 4AO6A 1Y6QA 1CD5A 5NLLA 4MUNA 5THKA 3HC7A 2QA5A 3DBIA 4WV4B 2CZQA 3DBLB 1G8AA 2G4CA 5DLPA 1VI2A 2WLSA 3NKLA 1FJGB 4Q02A 3LDUA 4C0WA 3M3PA 4K87A 5FWXA 4J8WD 1G2OA 1LJ8A 3PF9A 4JQOA 1HM5A 3TD2A 3I5YA 3UTAD 3CUTA 2OOKA 4I6JA 2YFVA 1P7PA 3UYKA 5ADWA 2F3TA 2GEFA 4BNVA 3OQNA 1WETA 4F8JA 5K0BA 2BFBA 2V55B 4PU0A 4JLMA 4TV8B 3AJAA 3GYBA 2QLMA 1J33A 1XGKA 4I66A 4LCBA 4U02A 2Y6VA 4AICA 1TI7A 2RG1A 4CG1A 2WZBA 1KYTA 5JNVA 1IJKA 3LUHA 4F84A 3LQFA 2FX3A 2BKAA 1Z5PA 2XMBA 4RFSB 4EEXA 3ZS9A 4OH7A 2FP3A 2FE4A 3OKAA 4GKAA 3OJOA 4IYRA 3ZHCA 3D3QA 3WMRA 1X77A 1P61B 2Y2QA 1G64A 2C59A 2IWRA 1K7XB 4QLCB 2B1GA 2GZDA 3FOCA 4LRYA 3RABA 3STUA 2BFNA 1DSSG 5JA4A 4KN9S 4KQEA 3TZLA 3R8FA 3CURA 3W7VA 4FEYA 4YQFA 3P0RA 3AR4A 1GQSA 2GN4A 3UJ7A 3ZHVA 3RSGA 2NUAA 4JXXA 1S02A 2AUTA 1M6VB 1OFVA 1SXJC 1PBNA 4HDSA 1PSZA 2V4ZA 4HMQA 3OCJA 1F3OA 3AYXB 4OHCA 4EM6A 4UE6A 3QJYA 4KAFA 1R6DA 2FJ7B 3OPXA 4TMVA 3MRXA 4FT4A 1SHZA 3CSSA 4JJNB 4UM9B 4OAQA 3U4IA 5JJBA 1I1OA 1EM6A 3PGLA 4TXLA 1QIFA 1QP7A 3G9TA 4LF8B 1B8UA 2W8BB 1RM5A 4IOMA 3SHOA 3WA9C 1E2PA 1TO6A 3NWOA 1PJRA 2B92A 5CX1B 1P3FD 3M83A 1DXQA 1XK7A 2VP0A 4WKNA 1UBCA 4EG6A 3AZED 3AB8A 1PCXA 3DMTC 3FR7A 2GUWA 3JWPA 4RK7A 3EULA 3SDBA 4BKUA 5K2MA 1X1QA 3C3EA 1EGHA 5EE3A 3LZ1D 4INOA 2H57A 3U7QB 1BE1A 2P9BA 4JJFA 1WZIA 3I52A 1R6AA 3O91A 1QGDA 2ZIWB 3CR7A 4UOQA 4ENPA 3CNBA 3CX3A 1H0HA 3DMRA 3AZND 4M0EA 4MRVA 3N2NA 5IKOA 3VO2A 1BMTA 1KKUA 1IFXA 1SBZA 4Z66B 1PR0A 4MX8A 1M2JA 3HR8A 4BOYA 1BMDA 1J0BA 4Q3BA 4JL5A 2G71A 3PYMA 4BNKA 4C4RA 4F1KA 1QK4A 3UHPA 1PNRA 4M37A 5AK4A 3M4NA 4GZ6A 4P84A 3H75A 4DWOA 5BUSA 1MX9A 2HF9A 2VF4X 5B40A 4Q1DA 5LUBA 1YT5A 5FHQA 3FMGA 2EZUA 1WAMA 3Q4GA 1ZDMA 3DMNA 2YVUA 1PZEA 3FZYA 2PX2A 4L0MA 1T6NA 2Q46A 5AHXA 4D3YA 3WAJA 4HVTA 1A04A 2H51A 1VMAA 1NJ6A 3V42A 5CFMA 1KAEA 2H1OA 2A5FA 1JXAA 1W4ZA 4PCLA 5GSUA 1TEVA 3IQDB 1F8YA 3NVDA 3GFGA 1HMPA 1Y48E 1HMYA 3WAAD 3L8EA 3PXUA 1CXZA 2I76A 2PYOA 2J5KA 4OQZA 1NMZA 3HB9A 1BDBA 3WFZA 3CQ9A 2N3ZA 3PR1A 4HNAB 1AGYA 2QX8A 4Y9TA 3EE6A 1JUDA 1L4NA 4K40A 2XUKA 4PSAA 1MABB 3BZWA 3D3EA 2FWNA 1KX3B 4MCJA 4KQ2A 4KPUA 4G92B 5JDIC 1BJKA 1DO0A 5TX7A 3BKXA 4D98A 5CLHA 1GG8A 3CPEA 1UMCA 2F59A 3CE6A 3AI1A 3PGMA 1KZ6A 3K1AB 4IDHA 4DRBA 3RTEA 2IBSA 4R1PA 3LJAB 1V4VA 5AQEA 3NUGA 4GXQA 4YX9A 3AZOA 1K68A 4H2DA 2VXYA 3F3SA 2OYRA 3NGMA 2HR1A 4R84A 2J33A 3LX8A 4RPIA 3VI4B 4QELA 4WCFB 3I3SR 4PX5A 4U2BA 2XQJA 3CVUA 1Z35A 4RVGA 2DCUA 4G5QA 1FSSA 1HT2E 4DR2B 1BH6A 5AKKA 1M1AB 4LHZA 4X7PA 2F9LA 2HA3A 3GJQA 4AS1A 1SBCA 1F66C 3DC2A 3ANXA 3IAHA 5EYPB 4AJLA 2XB8A 3SF8A 4XKJA 4Q39A 3M5PA 4CLRB 2J32A 4JBIA 4KLCA 5JADA 5FT9A 3EPKA 3NEAA 1YJXA 2GASA 2A5YB 4UNIA 2H54A 2JAQA 2H00A 3DZCA 5D5HA 5CDGA 4JSTA 1O57A 4X93A 3IEVA 1Q7GA 1P4JA 4LQDA 4EUNA 2ACWA 1NBOA 3NMUF 1SQ5A 1C7EA 4Z1MA 3HSYA 4BGVA 1ZRHA 2JBAA 3MS2A 1AZLA 1NC3A 1ZLYA 2NVUB 2OCYC 4IUDS 4F5EA 1IAVA 4RNDB 2OPHA 4IIJB 3B1WA 3P9SA 4QU9A 1LCIA 2JFVA 2CWWA 4EENA 3ZLJA 3QVUA 3ORFA 4NICA 1VPTA 3TMAA 2WQ7A 3DVAB 3DWGA 4IG9A 3PL1A 5DX1A 3FTCA 3SQXA 1M2OA 3SE7A 4DQYB 2VUIB 1BE8A 1PUIA 5H8WA 3REIA 3DV9A 1B2LA 2BJWA 1QS0B 4JD5A 1DMRA 1LBIA 1WMAA 5HE8A 1KMHB 1KFJB 3H9CA 4A1FA 2VEDA 4X3CA 3N1UA 1Q12A 3OZIA 5EJIA 1ILWA 4OP1A 3T1TA 1DEHA 4WESA 1J20A 2X86A 3DL2A 4H0FA 4UCFA 2YUTA 1UBGA 4W99A 4IJKA 3B7GA 2XXAB 4RKYA 3KXBA 1FYEA 2ZUUA 3AY6A 4R2WA 4CG2A 4IVRA 5DGXA 4W5RA 2PX0A 1KBQA 2BOVA 1P6QA 1VSUA 3LVFO 3PJDA 1NG1A 1EGQA 4RCZA 1FX0B 2D74A 4F45A 1JEEA 4Z54A 2C20A 3W77A 4C06A 3TEFA 3W5VA 2FFBA 2CHGA 3WHPA 5FUGB 4DA8A 8LDHA 1NUTA 2DGDA 3UOWA 5IF9A 4NMXB 1XD2B 1Q83A 1CYDA 2WWTA 5CXXA 2WAMA 4CXMA 2FYTA 2G7MC 2G25A 3SBOA 1MXFA 4TVOA 4YLGA 1I2AA 4LN1A 3NDBB 4DJJA 3LDHA 2WIDA 5JSZB 5GIOE 2H06A 3MGSD 4MWGA 1KEEB 4J0QA 4R81A 1E3SA 2JVIA 2ECKA 4WLNA 5COBA 5F1OA 3ESZA 1M1AC 4MUJA 3PNPA 1APBA 1OJLA 2VSOA 1LQ2A 4BTEA 5L3QB 3OTGA 4BO0A 3NH9A 4EHKA 4JB3A 4LTMA 4KQKA 1GPWB 2QJRA 4TLAA 5JV5A 1DTEA 1LZKA 3KXBB 2NIPA 4DUGA 4E4TA 5KO2A 3DTVB 2UUAB 4ML3A 3NPAA 1V1RA 1YDWA 1F0NA 4WZBE 1PQWA 4FEAA 4I3GA 2JGJA 1KJWA 4H1HA 3LZ1C 1M6NA 1CZOA 1F5SA 3D2BA 5AVBA 2GF9A 3IDQA 2F1OA 1ZITA 5BVGA 3WAGA 4PYIA 3V9PA 1TKRA 5AV5D 4ZODA 4CMBA 5HF8A 2Z2ZA 4D82A 1RABA 1ESZA 2HSJA 3TZCA 1NI4A 4CEHB 1S9HA 4WK6A 4WNCA 1SUIA 5CB6A 5CXUA 1NPTO 3SU8A 3ASUA 2OAQ1 3QG1A 5H1YA 1YS7A 3OOSA 1E1RA 2QTVA 2YFKA 4OQEA 4UPEA 2XA9A 2HLDD 4ZHQF 2HDWA 5DCLA 2XCLA 2BGNA 3P52A 4ZI5A 5DGTA 1EM8B 3VAYA 4JQCA 4UVHA 2JVKA 2EWWA 1WW8A 4ITUA 1SC6A 4XIGS 3OZFA 4RIIA 2OECA 1UJ6A 2C96A 2HIAA 4WZAB 1HQDA 3IDFA 5A6VA 4YWJA 2OBYA 1WA5A 4XB2A 2MWMA 4UXJA 3TQCA 1SG9A 4CTJA 3B6GD 3EGWA 4EI9A 3AZPA 3DNMA 3B3GA 3U19A 4FWTA 2RJNA 5FXMA 1NNEA 1J5EB 4TTQA 1KKLA 2ZW9A 3NOOA 1GTZA 4L7QA 3NVMB 4Z4GA 3MGSC 1TTHA 4P54A 2RB5A 1ADCA 4HNSA 3IEKA 1L6IA 1W6UA 2XECA 1CQIA 3Q3EA 4UFPA 3FMPB 3M70A 3IGFA 2FLKA 3MHPA 3FUUA 4HFMA 2X8LA 4M1KA 2F4VB 1DC4A 4QU0A 5DRTA 2AIRA 3K5HA 1IEXA 2BEVA 2HDOA 3BD7A 3OEHA 4OFZA 4R2IA 3VC2A 4CLEA 4IOKA 2ZSAA 3QBTA 4OK5A 4WEQA 4BS9A 5BNWA 4MR7B 2NO0A 1GYRA 1US8B 1Z0IA 2I4LA 2JBWA 5COAA 3KQLA 4I14A 3W2HA 2XQFA 4TMYA 4QRDA 5GGYA 1FSGA 3CH7A 3L8MA 4R9NA 1H4TA 4GQIA 4QUBA 1W44A 2NO9A 2VRNA 3QY0A 3BGOS 5CVDA 2AE2A 4JA2A 4NOMA 3KZKA 3RVOA 4U00A 5JRGD 1B0UA 1KIFA 3O62B 4WZAA 1A9XB 3QQPA 3HFRA 3N5CA 2OBNA 3QG5A 3QLEA 4N7JA 3WBFA 2VJOA 3CCFA 4GI2A 2RKBA 4O2BB 1G8SA 1U3DA 5LQMA 4O4HA 3VNAA 221PA 3TLEA 1RZRD 3OU6A 3I0NA 4N8SA 2W8ZA 2IEIA 4MCHA 1CZRA 4NK4A 5IJ9B 1V71A 2FN4A 4MW9A 1XRLA 4G0ZA 1M0WA 4CE6A 1TZYA 3A6NB 2BEWA 2PJZA 3KSZO 4MV5A 3BE6A 4ZDIA 3REHC 4JUBA 5TMDA 2XA2A 2GPJA 1L7NA 3R3XA 4A91A 1T9HA 3DULA 3HJAA 1PGNA 4FU0A 2QROA 5JJ5A 5M5BA 4CT4B 1ZR4A 4EUSA 4M36A 5IM4A 2LCIA 4JS0A 1IXYA 3MZ0A 5LC1A 4EW6A 3QELA 5KJFA 1GAQA 4EEZA 2PU7A 4QUDA 1AURA 3K0AB 5GVRA 1PFWA 4RSHA 3CLVA 4WKCA 5AM5A 3IRVA 3EF1A 2UVDA 1N6RA 5BNTA 5B30A 3QYPA 1AQ6A 5JDCA 1IN8A 2AR9A 2CC2A 2V5UA 1WP9A 3F78A 2CMGA 1GKIA 5JXWA 2XE7A 3LTEA 5E8JA 2HSEA 1BCRA 3SJCA 1XCLA 1FUYB 2FB9A 2CDAA 5ALGA 5KTOA 4QTZA 1PJCA 2UZIR 4GBMA 5KCZA 3N3AC 2G07A 1XTSA 1U9CA 2C7RA 4YM6A 1R5JA 2PWBA 4MTCA 2JARA 3J7AC 4DA6A 3FJYA 3ZE1B 3WGJA 3L8GA 3G88A 3BZBA 4DLTA 4E6PA 4CEIA 3KTAB 5CA0F 4DBZA 3UHAA 3JQ7B 4QFBA 1TZYB 3QPUA 3MGGA 2C5EA 2OHOA 4IHJA 4TS3A 3LP8A 2GNAA 5DHAA 5CW1A 2ZRFA 4JJ7A 1A95A 1V3TA 3AB3A 2VSYA 3N87A 4WDQA 2Z6UA 3N2KB 4YRPA 1A8PA 1C3LA 2FEOA 3GJ0A 2YC2C 1KY2A 3SZRA 1E1QA 4UC0A 3WLHA 3T3OA 3UJHA 2DAPA 2I62A 4EVIA 8MHTA 4U63A 3EF3A 4YUXA 5B0YC 4D9BA 1XHEA 3C16C 5JRZA 4Z53A 2ZUBA 3EAGA 3W9SA 4QA9A 5EXSA 2ZBQA 1OX4A 2I0FA 4EABA 1K89A 2TECE 4GQBA 4Y2SA 2HRQA 5ALQA 1DKUA 4H15A 1KDTA 3QU2A 1T9ZA 4FFLA 4MW6A 1Q1NA 3DT8A 4F2DA 5AESA 1VPDA 1VMIA 2IELA 3HV0A 4EKYA 4NV1A 4OGFA 2QDKA 4RDCA 4BVLA 1YS4A 4LE0A 3TDKA 2ATEA 5LBUA 2XV1A 5BQ3A 3L4KA 2VDPB 4II3A 1OKKD 3PVCA 4M1MA 4B47A 2WKWA 2Z0MA 3DJFA 4DWWA 1VIVA 1N2JA 3FNHA 3VR1A 4ARVA 4CTMA 3PD1A 3REHB 2DHQA 2QRZA 1BG6A 4HQLA 2Z09A 3SVZA 3VI3B 3W8RA 4DANA 4ZOAA 4FFDA 1POWA 2CLKB 4OAPA 4WAUA 1CNMA 1ZBDA 4HG2A 4HWOA 3A6EA 3PUYA 4JCOA 2Q9CA 4MB0A 2DQ4A 5IDWA 3SQMA 4QGSA 2IH2A 2PH3A 3AHCA 3TYXA 5M7EA 4KMSA 3D3JA 1P8AA 2CD7A 3A27A 2ABWA 3LC7O 3CVXA 4P0PB 4BNTA 3FOAA 2GZMA 3D7RA 1SVSA 3K8ZA 5TVGA 3CNNA 2AXNA 3O31A 2WJAA 3FOFC 3UW1A 4P82A 4AY2A 1EDBA 1YQTA 5KVAA 4G5FA 4OL9A 1KR2A 1N4DA 2HFJA 5AI0A 2Q1XA 2P9JA 3DP7A 4GOND 3KYDB 4R0NA 1J99A 2XE4A 2A9OA 4CR7A 2H1VA 5JH7B 3REOA 2ID8A 5K3OA 1C30B 3Q0IA 3OTHA 3ZE8A 5JFOA 3VBEA 3TSCA 4NEHB 5JPDA 2XTNA 2R87A 1P5ZB 4NDAA 3VHXA 4X60A 1JWLA 3CKLA 3GCDA 3TLYA 2VQDA 3PPYA 2Z5GA 3CLSC 1W34A 2PLNA 3GEPA 2H16A 1O58A 3LY7A 4NU5A 2EGHA 3AWDA 2DWPA 5B37A 1ECBA 2QZPA 3KAKA 2J3MA 2NU6A 4NU6A 5EMNA 3LWDA 4QASA 4WFKA 1UFVA 2NO6A 1DIOB 4HAOA 2FPWA 3K0AA 3KQOA 4D96A 4PSUA 1YR7A 1DAOA 4RTRA 4XDGA 2YJNA 4BU1A 1LLDA 2ZXUA 2HNKA 5I8WA 3D8UA 3ECAA 1WIWA 3G79A 3VH6W 2ZJ0A 2AJDA 1K08A 1XJWA 4KPGA 3SIWA 3C3AA 5EHGA 4PN3A 2HA0A 4NAVA 1M0TA 2VHEA 1FLDA 1JJ7A 5HMLA 4DQKA 2HHHB 1OH6A 3LFUA 3SLKA 3LOPA 1N0HA 3LZCA 4GVPA 3FWPA 3DE4X 4Y1RB 3SBEA 1JQJC 5TXGA 2UUBB 4FPXA 4FS8A 1M6YA 2FFQA 3P19A 4HGYA 1BQEA 5E8RA 3PENA 3UOGA 3VTAA 4JOQA 1I6LA 4I55F 4W9NC 3NI2A 4HDNB 3L6CA 4LDPA 3WQSB 2P5TB 1LX7A 3FJOA 4LDAA 4DRZA 3ZX5A 2WSIA 2L82A 2DH5A 5EIOA 1PR9A 1O96A 4A4DA 1XU7A 4YRGA 4CM5A 3X1SD 3B8EA 4OJQA 4NC9A 5MN6A 2BMVA 1TM1E 1L7OA 1IUPA 4P7JA 1L7QA 1QB8A 3NIWA 3OWOA 3UMMA 4L5AA 5T6BA 1M66A 2REQA 4DEXA 3MGRB 2OGSA 2WMDA 1O95A 2WHPA 2O05A 2ZPUA 3F9CA 2O7SA 2AN9A 5C8YF 1C5KA 3AUKA 2ZIUB 3E6AA 3HRKA 1OC2A 3MT0A 4ID3A 4J8XB 2VL7A 5JH7A 1DX6A 1N6KA 2C8LA 2AFHA 3QPDA 1Z2EA 1IVSA 4UDXX 1Z4NA 2CNNA 3ELBA 4YJFA 4UDOA 1W8DA 3LQKA 4FUTA 4PTLA 1A9PA 1GPDG 1Z08A 2PNFA 2CXPA 1DRKA 2GBCA 3IBCA 3PC8C 5I8ZA 4H4CA 3MCZA 5EUMA 1QAOA 2IPLA 2AQIA 3AEQB 5CFPA 1MW9X 3H5WA 7MHTA 5DGDA 4N0EA 1VBNA 2FJPA 1HE4A 1P91A 1UC9A 3LZ0B 5LYJF 3P20A 4LKRA 1PLLA 3UCFA 1G98A 3E7PA 3H5AA 3FWYA 1LU9A 4RD4A 2EJTA 2HPAA 2IYPA 4K9LA 4MUGA 5EJAA 4OJTA 3RRFA 1BJTA 3AFAA 5KJ6A 3QSYA 4I36A 2DTDA 4J8UA 3SSAA 2J09A 2Q2QA 1IMJA 4Z4CA 4O59O 4MR8B 4UASA 3JAKA 4XYBA 3KEOA 1YR3A 3I58A 4BZWA 3PDCA 4C6TA 4B4DA 5CPIA 1YR2A 1ORWA 4DJDC 5DISB 2GZ1A 3VJRA 2JZCA 3RFVA 1EFRA 4JFRA 4IDQA 3Q9UA 4L3OA 4YCJA 4J8VC 3WYFA 3GJZA 4KUDC 1XFAA 3R8XA 3GJ5A 5F9FA 1GN9A 4J0DA 5FLXA 4LYGA 2H92A 1RWMA 1U90A 1FRZA 1Z4PX 1X8KA 2HUNA 5THXA 1THZA 1P72A 2W2LD 1WM1A 5EHIA 4IZIA 1KY5A 2G7ZA 4F4JA 4QJ3A 2CLEB 3VR4A 4LDZA 2DH6A 5HOQA 2OLJA 1M1YB 1GNQA 5HX7A 5JAHA 1UKCA 2NN3C 3EC1A 1M10A 3AKEA 2RHTA 5CDFA 3SC4A 4F3CA 4I9GA 5HZHA 1UJ2A 3O62C 3DZJA 5CK5A 3WWEA 3MUOA 2XD1A 1ESEA 4YRNA 1MAHA 1YUBA 1I3OA 4BFCA 1QH8B 3QYAA 5AUOB 2W2QA 2NGRA 3LQ2A 3ZLUA 4B4UA 3HJFA 1MJHA 1XSEA 2Y1CA 2ZLBA 4R0VA 3IEXA 3UT9C 2FWJA 1DG1G 4DIUA 1DRVA 4OP2A 1MP0A 4M9UA 4W63A 2WUWE 2ZSHA 3T5TA 4E0BA 5BUCA 4CL8A 5CFRA 3FGNA 2QRMA 2WSBA 2H7XA 4NE9A 1HQKA 3G23A 2QNBA 2C9OA 3I1JA 2CSUA 1EXNA 4CMEA 5GONA 3PQCA 2FMKA 4TWJA 4H3VA 4JBHA 2DUJA 4EZBA 3KQUA 3QP9A 1PTJC 1AN9A 3UT9D 2F7SA 2NQ8A 3LPAA 2A94A 1Q9CA 2BWJA 1EFVB 1F66D 2X8JB 3GW8A 3MTEA 3W7AA 3A6DA 2XVXA 1WMEA 3LY5A 4FYKA 2CNDA 3JYNA 3BIOA 1DKLA 2VJDA 4KZKA 4HNRA 3STYA 1E2HA 1GRCA 2AFIB 3BWCA 1Z8DA 3FHOA 5BO5A 2WPDD 1Q7TA 1D09A 5JD3A 3SOPA 4EL5A 1BU8A 1YCHA 2BFEA 2R7KA 1MZVA 1PSDA 4LXUA 3MBKA 1VMDA 2JK1A 3FCOA 3K6RA 3QXSA 1ICEA 3LUAA 4E5NA 1U4NA 4Q48A 1Q0HA 4RJKA 3UEOA 2JFHA 1XA4A 1FJHA 4CKCB 1OFTA 2GOYA 5DNCA 1Y1RA 2F1HA 1N7GA 1Z13A 3G8CA 3C8DA 4XIIA 5BN4A 1U7ZA 3CGWA 1QRSA 2DSTA 2R6ZA 4U5XA 1Y6JA 3HYSA 4Y6GB 2AF3C 1UBOS 1BD4A 1BWQA 4DVJA 4NCNA 5C3UA 1N7JA 1R4NB 2W2MA 3OURA 2GXQA 3V2UA 1K63A 2B69A 2RG7A 2EFGA 4JKOA 2ZAOA 1ONOA 1WULS 3T5GA 2AN5A 2YOHA 4KH1A 5FFFA 4EO7A 5BWCA 4IX9A 1D2EA 3W5AA 4WA8A 1E2NA 1BNCA 1NF9A 1O94A 1Z6XA 4F9FA 1GYPA 3N6XA 2JI8A 3PVSA 2XKJE 3EHDA 3K9HA 4M9XA 3TIXB 1UMDB 3RIXA 5K7SA 1FSZA 4Y2UA 1D2AA 1LNQA 1PRYA 2EERA 2I33A 4LTDA 4U2CA 4W5JA 5EJEA 1YOVA 2Q41A 3DV0A 3WA9A 1TQ4A 2AI3A 4HH1A 3SYTA 4BNUA 2PDAA 1V6CA 1TD9A 2BMFA 2R00C 3IHTA 3NAMA 4UAVA 5CX1A 2OXCA 4JJ8A 3IC5A 3HA3A 2ZKIA 3EW9A 2R48A 3ONNA 2IODA 2EGUA 2Z95A 4ZCQA 1DO8A 5IKXA 3K9CA 1RLJA 1C7RA 4RZSA 3THWB 4CF3A 5DNMB 5TY0A 4Z5TB 2YDXA 5E3HA 4FR5A 1PJLA 2GA9A 5F99B 4Z99A 4KHAB 3I9NA 2NAFA 3DFFA 4WWHA 4G0YA 5AY8D 3MMSA 2COEA 4UQOA 1VPEA 1MO5A 4QOSA 1OPRA 5CJPA 5T4EA 1XQXA 3NT2A 2WJ3A 3LELA 3LE8A 2XADA 2GAIA 4CUJA 4EGSA 4NXNB 3KKZA 2FPPB 1BXGA 3UMFA 2XZPA 1TYBE 1XRMA 3PE3A 4AMYA 3PYLA 4ZGGA 2BR3A 5B2JC 1CZKA 2XVAA 2ZSJA