2ZM5A

Crystal structure of trna modification enzyme miaa in the complex with trna(phe)
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
306
structure length
306
Chain Sequence
LPKAIFLMGPTASGKTALAIELRKILPVELISVDSALIYKGMDIGTAKPNAEELLAAPHRLLDIRDPSQAYSAADFRRDALAEMADITAAGRIPLLVGGTMLYFKALLEGLSPLPSADPEVRARIEQQAAEQGWESLHRQLQEVDPVAAARIHPNDPQRLSRALEVFFISGKTLTELTQTSGDALPYQVHQFAIAPASRELLHQRIEQRFHQMLASGFEAEVRALFARGDLHTDLPSIRCVGYRQMWSYLEGEISYDEMVYRGVCATRQLAKRQITWLRGWEGVHWLDSEKPEQARDEVLQVVGAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Snapshots of dynamics in synthesizing N(6)-isopentenyladenosine at the tRNA anticodon
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase/rna
molecule keywords tRNA delta(2)-isopentenylpyrophosphate transferase
total genus 92
structure length 306
sequence length 306
chains with identical sequence B
ec nomenclature ec 2.5.1.75: tRNA dimethylallyltransferase.
pdb deposition date 2008-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01715 IPPT IPP transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.140 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 2zm5A02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2zm5A01
2FFQA 3AP1A 2E1RA 1E2FA 3MG9A 3CPEA 4HLQB 4JLVA 1SXJA 3UG6A 1XJ0A 4EJSB 1NP6A 2CBZA 3VKGA 1E2LA 5FBWB 1ETUA 4LYJA 4DUGD 2V54A 6Q21A 1DBSA 2JLSA 2CCJA 4BLPA 1BKDR 4JLDA 1WP9A 2YOFA 2JIZA 1W4BA 4DCUA 4HAXA 2O8DA 3CPHA 5D3QA 5L3VA 4M9ZA 4BUJA 2GZDA 1R0WA 2ZUCA 2N1BA 3OEHA 3QEOA 4NMMA 4DC9A 1HEIA 5GJBA 2NO7A 1JAHA 2QPTA 4US0R 4BPBA 1UKEA 2ZRMA 4KLZA 1HUQA 3LH5A 1W0KD 3KXLA 1CJKC 4HZUA 3K70C 4RSGA 4IVQA 1AKEA 2ZRDA 3AF0A 4RCZA 3KQNA 2NGRA 2XZLA 4RD6A 4Q5IA 1SHZA 4PC1A 3DZ8A 4DKXA 5G53C 5ANRB 5GJCA 3WYGA 1MT0A 4OQFA 3W6PA 4OHYA 2C2HA 3CWQA 4D2IA 4F4IA 1DG3A 1O3YA 1CS4C 1D2MA 5JHGB 3CR7A 5A0FA 3TSOA 3PUXA 2QY9A 3RANA 2RAPA 2WJIA 1LY1A 1OHHA 2FPMA 1IXRC 1JBKA 2QUZA 4TSFA 5J4KA 1X86B 1IN5A 4BASA 3RC8A 2X19A 3ZVRA 1GITA 4D0LB 4TL9A 4GNKA 4Q1FA 2ZSBA 4EQ6B 4R9UC 4CEJB 5AJYA 2V3CC 1HYQA 3ZDQA 3K09A 4B32A 2YC4C 1BMFD 3WP1B 4R2IA 2F3TA 4NCIA 3EC2A 2W2TA 2N42A 2ZE5A 5EXPA 1Z63A 1QHXA 1XD2B 2CK3D 5FUVA 3UG7A 1E9RA 1IN8A 1SXJC 4WXPA 2IEZA 4NDZA 4FMCF 4K81B 2RGEA 2CJWB 4URYR 4M9QA 4QL3A 5KNBA 1Z6YA 4RKFA 2F1RA 3EZ6A 1CIPA 4HAUA 5FL7A 3LV8A 1VDZA 2RGCA 3AUYA 2YWFA 3QG1A 1GRNA 4B3DA 721PA 4FWTA 1KI8A 4JBYA 4B34A 4BFUA 4N1AA 5JMTA 3QF4B 4U7DA 1AN0A 4QM6A 3MRSA 1EFRD 1G3QA 1VYUA 2LWIA 1WDTA 4TYWA 3PVSA 2QE7D 2WJGA 3CF2A 3PFIA 4ACBA 2E87A 3NDPA 3A1SA 4LK2A 1E9CA 3RC3A 2XOKA 3BH6A 4ZIRB 4A2QA 4C4PA 3O8BA 4A92A 3BERA 3T1TA 3B85A 3KX2A 5JWRA 3E1SA 4NYMQ 4B33A 3THXA 3EWSA 3R8CA 2KBEA 3QXCA 1CJUC 4XH9B 2KE5A 4NONA 3CIOA 4UNPA 2FEMA 4GMDA 3OIVA 3D6TB 4NHOA 1I2MA 3I1FA 1QF9A 4NH0A 5IHPA 1MRSA 3FWYA 4GI7A 1SXJE 4OHZA 1R10A 2HXSA 3FKSA 3FHTA 5CB6A 2YVUA 2QEQA 5J40A 2CL7X 3EAQA 4R98A 4TT3D 1ESMA 2PZFA 4RZUA 4FIDA 4H1UA 2ZYWX 3U7GA 3EPHA 2W0SA 3IEUA 4HAYA 2GHIA 3U44A 1OIVA 3DM9B 3I5XA 2ZM5A 1OXVA 3HP1A 1A5TA 4TQ9A 5L3SB 4CEIB 4F4JA 4YMVA 3HDTA 2ZSFA 1CJVC 3MJHA 1ANKA 3VAAA 1AS3A 2J7KA 2I3BA 4PHTA 3TR0A 3GJ3A 4KHZA 4FINA 1N5KA 1KDOA 2CLSA 1Z06A 1OH5A 1UBCA 3KXIA 1CTQA 1OKKA 1US8A 2C98A 1TADA 1E2GA 3ND8A 5JHHB 621PA 1JI0A 1H65A 1W2HA 1XMSA 1ZVQA 5EE9A 5EUMA 4IXNA 2HF8A 4B44A 2OO7A 1T0JB 2GAOA 1YZUA 3CLVA 4MKIA 4ZDJA 3THWB 2ZS9A 1UAAA 4PAOA 2QL6A 2IT1A 4JT2A 3HU1A 2QAGC 1G7RA 2WZQA 4AK9A 1WBBA 2IUUA 1G4UR 1ZIOA 3K70D 1G5PA 3F8TA 2PH1A 1NBMD 4JIMA 3NVAA 3BC1A 4B71A 2GKSA 4OBEA 4DHEA 2JGNA 2A30A 2JJ1A 2IL1A 3FHOA 4HLCA 1IN7A 1OIWA 4A0RA 1SKYE 5LD2C 4B3GA 4TWZA 2QNRA 5BN3A 1EFCA 1ZRHA 4OQXA 2ANCA 3GEIA 2QQ0A 2CEAA 2MMGA 1LV7A 3B78A 1ELOA 1Q12A 4Q1EA 2NZJA 2QRNA 1E1RA 1VCMA 3QKSB 5EE3A 4DSTA 3R7WA 1N2CE 1OFTA 2IWHA 2PZEA 3LO5A 1SVLA 1ZM4A 4XSHA 1KO1A 1U90A 2AD1A 1NNEA 5M04A 2B6HA 4UXHA 1EGAA 2B7BA 5CIQA 1AGRA 4Q9KA 4ASUD 1VG9B 1VIAA 2F43A 4US2R 4PX9A 3I8SA 3U3KA 2QGNA 2C8VA 3W5JA 3Q5EA 2H7VA 4A82A 1DAKA 5G40A 3IEVA 1QHGA 1Q0UA 1WA5A 2EQBA 3T5GA 2JLUA 5FBRB 1JB1A 2IYXA 5KNDA 1DAHA 1NN5A 1HT2E 2OCAA 5HKKD 4GSYA 1C9KA 2AXPA 2GTPA 3RABA 4ARZA 4DSNA 3OESA 5J4LA 4JBXA 1ZD9A 2EVWX 1OXTA 1T3LA 5FPSA 2YWEA 2FEOA 1E79D 1MO6A 2CNWD 1AA9A 1JECA 2PLFA 1F3OA 3K9NA 2NO6A 1RJ9B 2QZ4A 4OK3A 5JS7A 2WKQA 3EA5A 3QEJA 4KFUA 4BZXA 3THXB 4BGDA 3EC1A 3CR8A 2ATVA 2OBNA 4MGIR 5FI1B 5SZIA 2QAGB 4A15A 2BEJA 221PA 3D3QA 4URZR 1A1VA 2GBLA 3QVVA 4JVNA 4M0LA 3DHWC 3LBIA 4D81A 4EJSA 4WBSA 1XPRA 1Z08A 1HE1C 5GADl 4HI0E 4A0FA 4DSUA 4OK5A 5JJKA 1LVGA 4UNNA 1CBUA 5JECA 2REXB 2WWFA 2NO9A 4IVPA 4WVFA 3BFKA 4WZ6A 2ERYA 3L8YA 1VYTA 2HF9A 4M1OA 5LB2A 4RD0A 1EK0A 4JSTA 2ZJ2A 2ZUBA 1VPLA 2JLWA 3FVQA 1KDTA 3FHCB 4IEIA 4KV9A 2JEOA 1DPFA 3UWOA 4H1VA 1ZAKA 1EWRA 3PITA 2ZS7A 4Q4HB 3B2EA 1JQLB 3AGPA 1ZW6A 5FPTA 4CEJA 4LHVA 1W2GA 3C5CA 3A4NA 1Z22A 1E2IA 4D4JA 3U6BA 3N70A 2IYRA 2RGNC 3TNFA 4MH0R 4BEJA 2XOKD 1IY0A 1G3IA 2REBA 1S3GA 4LV8B 3WY9A 3JVVA 1N5IA 1Z0JA 2YWGA 4KFRA 1OXUA 1COWD 3LW7A 2P6RA 4DWJA 5E95A 2A3RA 1NLFA 5L3RA 4NPHA 3GLFE 4L9WA 3PG5A 4LX0A 1BS1A 5F98A 1U98A 4LZZA 1NJGA 2C9CA 2H57A 1IXZA 4FW9A 5DLQC 3QKTA 2GK6A 4IOKA 2WJVA 3W9YA 4YXWD 1L8QA 3IQWA 2G6BA 3OFND 5FFMA 2PX3A 3QE0A 1OFIA 4G01B 1KHTA 3O8DA 3TH5A 3AH8A 4RFSB 1YHNA 5E7JA 1XJQA 2ZI5A 1KO4A 3U7FB 4NP6A 2CL0X 1M7BA 1VG8A 2YINC 3GFTA 4HAZA 2EWWA 2ZSEA 2YOHA 4XJXA 1DARA 1P9WA 3C41J 4JLPA 4YDHB 5AK0A 3OEHD 5IF9A 4I1SA 3MSXA 3SYLA 2GJSA 2ZRGA 3K0AA 2JJ1D 4DIDA 3C7KA 3SQXA 2FFHA 5DGXA 3BB3A 4EPVA 4UJ5A 2Q6TA 2GEVA 4CT5A 5JRZA 1Q1ZA 5GVRA 1XF9A 2WV9A 4E22A 3EX7C 4BFSA 4II7A 5DO9A 2CNWA 1AS0A 2XNDD 2PMKA 3M4YA 3SEAA 4MGKR 3TKLA 2MMCA 4FN5A 1FMJA 4PSAA 4BWYA 1E2JA 2DWOA 1NL3A 2ZI9A 1W49A 4PPQA 4I81A 1XX6A 3PIRA 1ZIPA 4Q00A 4PO8A 4BE7B 4HATA 1G8FA 2OFWA 4EJSC 2VSXA 4DZZA 3AVUA 3ASYA 2BBTA 2JLZA 3D31A 5CM9C 2G88A 1E98A 2AR7A 4LV5B 4ABYA 2FZLA 2IYWA 1DG1G 3IO5A 5HPYB 3CM0A 1XZQA 2ZREA 2A5DA 4IW3B 4JLJA 1E9DA 3IPYA 3W90A 2B7CA 2BHRA 2IF0A 1L2TA 4KYIB 2F1JA 1J7KA 5FOUA 4A0HA 3I61A 4EFMA 2MSDB 3QKRA 2GJKA 1RYHA 4G1UC 2FSHA 3EZFA 1NVUQ 2ZR0A 4A8JA 3FMOB 2ZRNA 4PSKA 4TMKA 4X8LA 3GLGA 3TQCA 2PCLA 1II0A 4MDEA 1I4LD 2V7QD 4LRWA 5IT5A 3IHWA 4LJYA 1E0SA 2G1JA 1XMVA 4HLUC 4RFSA 2TMKA 3RRYA 1IAQA 2GZAA 4BEBA 3R20A 1U0JA 4LJAA 2VRWA 4BLTA 1UDXA 3X1XA 3U61B 2EFCB 4CYMA 1QG2A 2FSGA 3NG1A 1KI1A 5FBQB 4L8GA 5CJ2A 4QG7A 2AD5A 5K8UA 2JLYA 2QE7A 1XCPA 4TLCA 3TGPA 1ZC4A 2VBCA 3VKWA 2A7QA 4A4DA 4XD7A 2QBYB 4UJ3A 5DI3A 3T1VA 3LD9A 1U0LA 3M6AA 3THOA 1U94A 2WWWA 5CK4A 4P31A 5TXGA 3W5IA 2ZI6A 3T34A 4XTRA 2Q21A 1UBEA 2VQSA 3L2OB 4PQYA 2HYIC 2QROA 4ZIRA 1M34E 1CR1A 3C4JA 1MABB 1SVMA 3NKVA 1R8SA 3MWJA 4RFVA 1S96A 2ODBA 4ERNA 5IK2D 3UANA 1OJLA 4IDQA 4JL5A 3AKYA 2UVQA 3QF4A 2VIIA 3ZLJA 4XIGS 4XD7D 4KU4A 4C0SA 3NWJA 4IEEA 1UF9A 4Z51A 3ADCA 1FTNA 3BK7A 3BFVA 2O0KA 3LQRA 2YHSA 3GJ5A 5FOTA 3FOZA 2ZRPA 3UMFA 1M1YE 1P9RA 1J90A 3I92A 4M22A 2CLCX 3BS4A 2FGKA 1ZUHA 5JBQA 4FI3C 5JCPA 4TT3A 1PJRA 1I4TD 2OBLA 3L82B 3DL0A 4P3YA 1G6OA 1N0UA 1A4RA 4Q18A 4D4KA 4V0ME 5AUPB 1RPZA 1XBTA 4DSOA 1U8ZA 4C0KA 5KU1A 3B1XA 1GRRA 5K8IA 2J59A 2YC2C 3AVXA 4DEXA 4B3XA 1XEXA 5B57C 4PO9A 4DRZA 1IBRA 1VHTA 3QXHA 3WRYC 4FXPA 3QKSA 4JYCA 1KI6A 5FI0B 5LPNA 4D0NA 4IFEA 1BMFA 2RB4A 3GFOA 1XDBA 2D74A 3H86A 4BFVA 2ZU0C 3ZQJA 4ZDIA 3P1JA 4QOSA 4C0JA 4P0TA 2CHGA 1VTKA 4TN1A 1MO5A 3T06B 3AKDA 5EE5B 2FA9A 2ZAOA 3OF5A 2XXAB 5KNCA 2R44A 1D9XA 4DB2A 4OI2A 2J45A 5E7MA 2HT1A 2IA5A 2NQ2C 1I4DD 1CR2A 1J2JA 5JI3E 1GG2A 1TQDA 5FR2A 3TRFA 2HLDD 1X1RA 2EFEB 2VHTA 3VR4A 4TYYA 4IOMA 3DOEA 4AURA 2B8WA 2ONJA 2EYUA 1XCGB 1XEFA 2OFXA 2QT0A 3NEJA 4L5BA 4BRWA 3TQFA 4LPKA 2V55B 3BFXA 3FMIA 4PPFA 3EIQA 1R8QA 1D5CA 4LJ9A 4TSFD 5JLJA 3GLIA 3U3JA 3SJZA 4F93B 3EZ2A 3U60B 3UK6A 2WPDD 3GFPA 4LHXA 3W34A 4QHSA 1GKIA 1GL9B 3VHXA 3LDAA 5JS8A 5C2JB 1JR3D 2ZR7A 4Z8YA 4LPSA 2J7PD 2W2XA 1WMSA 5P21A 1T5LA 1WQ1R 4C7OA 3QNUA 1SGWA 4URVR 3SJCA 4W5JA 1GILA 3SJBA 4TYNA 4IOJA 1M8PA 2O52A 2ZRLA 2ORWA 2W6ID 4HLDA 4ON9A 5EE1A 1K5DA 3OIYA 1E2KA 2VP2A 4P4SA 1ZNWA 3DEFA 3H84A 2W2VA 1S3SA 4KLNA 3T15A 1OH7A 2JCSA 2OG2A 5J4YA 5L3QB 1NRJB 2W0MA 4JL8A 1C1YA 2FWRA 2IS2A 5FPKA 2WICA 1G8GA 2WJYA 1P2TA 1F5NA 3RDPA 2X77A 1HQCA 1SULA 4TTPA 1HY3A 3QENA 3QKUA 1NVVR 1U8YA 2GDJA 2J3EA 3AP3A 4K46A 4EPYA 2VPPA 4XWKA 2J46A 2Z83A 4O2LA 3VHLB 2J9RA 4B47A 2BVNA 2AFIE 4JLAA 2REOA 2IS4A 3T1OA 1VIYA 1OSNA 1KO7A 1NG1A 1KJWA 1S1MA 1YKSA 1OXSC 4QBIA 3CW2A 1GUAA 4G5SA 4QNMA 3BAFA 2CJWA 1E4YA 2R9VA 1TX4B 3CX6A 4IVRA 4YONB 2EFGA 1G16A 1E0JA 5B2ZA 1XD2A 2VP6A 1UBGA 3DMNA 2J87A 2FU5C 2KBFA 2IYVA 1XTRA 5CLQA 3ZZ0A 4URUR 4IDHA 2HEIA 3ZD7A 1ZINA 1FFHA 1TQ4A 3HU3A 4TLEA 1OKKD 4KITB 4BRUA 3K0SA 2NPFA 5LB4A 4QRHA 1ZUIA 4ASUA 1U9IA 2O0HA 5CJPA 5EE0A 4DLVA 5KPJA 1Z07A 1DE0A 1Q3HA 2Z4RA 3I8XA 3K0AB 4XSGA 3I32A 2R6CA 1PVOA 2ERXA 2OCYC 3NEYA 1G7SA 3TE6A 4TMZA 4B75A 1OH8A 1N0WA 1Y3AA 3T5DA 1EX7A 4N3NA 3CWZA 2HUPA 3QXSA 4WIAA 3WMEA 1Y63A 3ZH9B 2A2ZA 3PEVA 1DVRA 4Q1DA 4LYAA 1KAGA 1JR6A 2GJ9A 3AEZA 3RRNA 2ZANA 4CT4B 4IDNA 1FW6A 2IYUA 2ZVQX 2WMNB 5A4JA 2CVFA 4A8JB 4HDOB 4YMWA 1CEEA 1UJ2A 1G9XA 4M1SA 1Q20A 3IBGA 3SDZA 4Q7LA 4JLKA 2F6RA 5HZKA 1NIJA 4JVLA 4Q1AA 1KMQA 1XU4A 4PHFA 3OHMA 2X1VA 2DCUA 4YMSA 5G3ZA 5UKDA 4GDFA 2BBSA 1OB5A 4E03A 2IF2A 2MSCB 2Q9CA 2FSIA 4D0GA 2B92A 2RCNA 1R0YA 1RRGA 3I5YA 1JPJA 4KI0A 3CZPA 3QPUA 1KKMA 2WAXA 3RS7A 3ZVMA 4G5QA 1T8TA 1XTIA 4Q7JB 1TAGA 1LTQA 3W8NA 1G5TA 3QUSA 3DM5A 4QGGA 4TQAA 4Z1MA 3GJ4A 3FE2A 2ZRFA 1ODFA 2JJ2A 2BCJQ 2P6UA 3AVOA 1DO0A 1G3MA 1S0UA 1YZLA 4KSCA 5BWMA 1YVDA 1ZM2A 5CYOA 5IDVA 3EWAA 4RZ3A 1TTTA 4BZQA 2WSSD 1U81A 4X8OA 4B3CA 3LWNA 4ITRC 3DVLA 2RGBA 1ZD8A 1S4QA 1Z6GA 3D7MA 3I3SR 1V43A 4M1TA 3UWKA 4DLYA 2O8FB 4H9GA 1QHNA 2WTUA 3E5HA 4LYFA 1Z5ZA 4GBMA 3SZRA 1JR3A 4F38A 1ZM9A 4TZ0A 1KO8A 1RC8A 1KYIA 3ND9A 3TW8B 1NBMA 3V00A 2WPDA 2FGJA 2IYLD 2ANBA 3LRPA 1Q1QA 1JAIA 4QNRA 1BIFA 4NKRA 5KSYA 5BXQC 1CRQA 4E07A 4EAQA 3UATA 2OBMA 1NKSA 1NKTA 2C78A 2ZYVX 1J8YF 4OQMA 4CZ2A 3L43A 2A78A 2PZGA 2O5VA 2MSEB 3BWDD 3PCRB 3EZ9A 3Q8XB 4AWXA 3UIEA 2GF0A 2PJRA 2QPAA 5HZHA 3R9IA 2IS6A 3S1AA 4V0MA 3BE4A 4RD3A 3T61A 4KYUA 4XWOA 4E5UA 1RRCA 3CX8A 1Z2AA 3NH9A 2KJQA 1GVNB 3K9HA 1EX6A 3N2IA 3OE7D 4ZCMA 2J0QA 3H4MA 4U02A 4OJKA 3S1AB 2GRJA 2BV3A 2ZYTX 2OXCA 4Q66C 2JLRA 3KTAA 4RKEA 2ZRKA 3A37A 5GJWC 2NTYC 4W5WA 1T91A 3LBHA 4JJKA 3CPJB 2J1LA 2J0UA 3QBTA 1W5TA 4U00A 4PQRA 1MV5A 2LKDA 5HCIA 2GETA 4MRPA 1VECA 3PJRA 1P2SA 4DT1B 2IYTA 2ONKA 3B6EA 4PC6A 2CE7A 3NDBB 1VCNA 1Z6AA 1IM2A 2WKRA 1A2BA 4LHZA 1FUUA 3FTQA 4JVSB 3O8CA 3HU2A 2R6FA 2HV8A 5K8TA 5B64A 3BD9A 3LW8A 4B2LA 3AVTA 3WNCA 2CCKA 3PEWA 2ZI7A 4KVGA 3A36A 2ZRIA 4BFWA 1JNYA 1E2PA 3MUFA 2QP4A 4OI4A 1WXQA 2QA5A 1QHHA 4FWIB 3LLUA 3C8UA 4B48A 4EPRA 1TQ6A 3QQ5A 3RS3A 3AB3A 2R65A 2W00A 2Q9AA 2CCGA 1DAFA 3OIWA 2IHBA 1G19A 3EIEA 4BQSA 4YMTA 1X8KA 3KUDA 1FX0A 2W6JD 1LFDB 3JZMA 3P27A 3T1QA 1VYVA 2I1QA 4MGZR 1XFAA 4KXFB 1H8ED 4A6XA 4D80A 1KDRA 2QMUA 4K8OA 3T12A 4NCKA 1XTKA 3BGWA 3KJEA 3AUXA 2LKCA 2HJVA 2BJWA 3LNCA 1KMHB 1HE8B 1D2EA 2Y8EA 3ZVLA 3GQBA 5JJLA 1JPNA 3IILA 2Z43A 3CKLA 5TB5A 3VR6A 1CR4A 2BMDA 3JVUA 2FDCA 5DN6D 3IIMA 1AJEA 1TQ2A 2AWNA 5AUOB 2VTKA 5EXSA 1AM4D 5AUNB 3U7HB 3TAHA 2QU8A 1ZUNB 2BCGY 2EFDB 3TMKA 5JEDA 3U44B 1Z0KA 4L15A 2H18A 4XTCS 1XD9A 3LVQE 5FUXA 2C5LA 3O8RA 2J5XA 3N5CA 1E6CA 1RRFA 2WWXA 3Q5DA 1LW7A 1Z28A 1CU1A 821PA 1II8B 1ZD1A 4RJLA 4DLRA 2GZHA 3GD7A 3KKOA 1RE0A 2RH5A 5HE8A 2EYQA 1E2MA 2OT3B 1GP2A 1XXHE 2OCPA 1SKYB 4LYHA 3EZ7A 1F60A 3EPKA 1MH1A 1O87A 1IXSB 5DHFA 3ASZA 4Q4AA 1WBDA 4NBSA 1U8AA 3AGQA 3KKNA 4RCYA 2V1XA 1UFQA 2DY1A 1NLYA 2C9YA 2BM0A 2GNOA 4M1KA 5E4FA 4AD8A 4D4LA 2QMHA 3B13B 3V4FA 2IYQA 1E9SA 1B0UA 3AVYA 2J41A 4MUBA 1NN1A 1KJYA 3LXXA 4Z1MD 2LCFA 5EJEA 1DAIA 2KB0A 5AWFC 2HCJB 4OHWA 4QXAA 2QM7A 3A1TA 2NO1A 2R62A 1KSHA 3H0KA 2O8EB 5LDDC 4PC7A 1UKYA 2C99A 1A2KC 2WHXA 4F92B 1TF2A 2QMEA 3LX8A 1N0VC 2IXEA 4JL6A 2V6IA 1Z6TA 4JT4A 3X1ZA 2BM1A 3IUYA 1E0AA 3H1TA 1VG1A 3WBJA 4C3ZA 4LBWA 4EQ6A 2R8RA 5E3HA 4Y0VA 1MABA 2PT5A 1NSTA 4DCNA 4QGHA 2BWJA 1FQJA 4WOPA 5HE9A 3GLIB 3ECCA 2IC5A 1IJEA 4AYTA 1E9BA 3REFA 1TU3A 3OZXA 3GPLA 2XGJA 1KO5A 3RS0A 5JRJA 1Q1BA 3P20A 3PR1A 4HDQB 4URWR 5H68A 4KFSA 1QZXA 2VLIA 4JJZA 1N6PA 1SKQA 4I1VA 4DLXA 2W83A 3OFNA 2C77A 3IHLA 2XZOA 2D62A 1D9ZA 1NMZA 3RAPR 4DIEA 1ZCAA 5DNYB 3NBFA 2GXUA 1DAMA 2OZEA 1FQKA 1KNXA 4MGYR 4OL0A 4B6EA 1NY5A 4BFTA 3THYA 1XNJA 4JLNA 1E4VA 1M74A 3PQCA 4RZXA 4AKHA 2A5YB 4DCSA 4Q19A 4Q9JA 5KTYA 2XXAA 5FBVB 3ETLA 2QAJA 4AIIA 5KSPA 1G291 1WCV1 3QXJA 3SNHA 1KMHA 2QM8A 1P3JA 3QKRB 2WWYA 1U0HC 5FTJA 4LJ7A 1JEEA 3MMPA 4MRRA 1RKBA 2CDNA 3FKSD 3RLFA 2BBWA 2ZXUA 4EDHA 1OXXK 2QTFA 2GXAA 4RD2A 2QENA 3G5UA 1IHUA 2JJ8A 2X2EA 1II8A 1JXOA 4DLWA 3AVQA 3VU9A 4JKIA 4B74A 4D26A 1SXJB 5A5GA 2V8OA 4GZLA 1EFTA 5TV2A 2ZS8A 4V0NA 5FOXA 5CIWA 1KI9A 5BN5A 2AKYA 1H8HA 1MRNA 4MRVA 5CLLA 3M0EA 4N0EA 4BLQA 4F4CA 1KKLA 1ZM3A 3VR2A 5L8VA 2O8BA 2F9LA 1G8YA 1II9A 3IO3A 4KSBA 3VU9B 2WAYA 4C0AC 1KY3A 4AKEA 8OHMA 5B58C 1CP2A 3EXAA 3IIJA 2D7DA 1U9IC 1Z0IA 4CIDA 4JZKA 4NCHA 4ZPXA 2P5SA 4PZZA 2G1KA 3AV0B 1KK3A 4ESVA 1QVAA 1XEXB 1QVRA 2BJVA 3LX5A 4YC7A 1LB1B 3SFVA 3VQTA 4LBVA 4PZLA 2OFOA 1SVOA 1W4AA 4AG6A 3MWYW 1FX0B 5FPHA 1N5LA 4MYHA 1QDEA 3IIKA 1X8JA 3CF0A 5DHAA 4HB2A 4TL7A 2IWRA 3DOFA 2IYZA 3BJIC 1DOAA 2A5JA 4X8HA 2ZJBA 5L3SA 4P33A 2P65A 1N6NA 2ZTSA 1ZBDA 4TMTA 3RNLA 3GCGA 1T6NA 2XSZD 3A1WA 3K0FA 4HYYA 2Z4SA 4F7WA 4AKGA 5ELXA 1VCIA 3K0CA 1QHHB 2XTZA 3LVRE 3ZZUA 1E1QD 3D8BA 3B5JA 3A4LA 1TF7A 5CK5A 2GBLC 1XEWY 4D6PA 2G77B 2ZSAA 2WVJA 2XITA 2W6IA 1ESNA 4MITA 2WWIA 5DE3A 1ZJ6A 3CRRA 2ODWA 4URXR 4CEHB 1P6XA 2CL6X 4MRNA 3K1JA 1VCOA 4JSYA 2DYKA 2H17A 2OAQ1 2UKDA 4WAUA 5F3WB 2WM9B 3MAAC 4NYJR 4EUNA 1FMLA 4J0QA 2IHYA 4RD4A 2ZE6A 1IJFA 1TU4A 2CMKA 2GEDA 1VKJA 4DT1A 2P67A 2ZI3A 2EFHB 3KKPA 4LC1A 5FTNA 1W7AA 3NH6A 4ZKDA 1OH6A 2D3WA 2FH5B 2ECKA 2R2AA 1KJZA 4QFMA 4ZCLA 3LLMA 1T3SA 1OYWA 4PAQA 1P7CA 2QORA 3WHLA 2JDIA 2KSQA 2JIZD 1KSJA 4B6FA 3R9WA 2ZRAA 3QI2A 4I1UA 3AF3A 3MLEA 1Q3TA 5DYGA 3TSZA 1G17A 2WIBA 5BYKA 2X2FA 4FMBB 1FNMA 3L0SA 5AJWA 5KSOA 3IGFA 1OLOA 4X8MA 1GTVA 4I1OA 2ZE8A 1KTVA 4MUAA 2C9OA 3KDSE 3WNDA 1FNNA 4TLBA 3MWLA 4WZAE 4NE2A 1Q1EA 4P32A 4MDFA 2C04A 4ZO4A 3B1VA 4ZKEA 4IJMA 5EP1A 4GFDA 4EKDA 2JAQA 1ZNYA 4R7ZA 2ZJ8A 2V4ZA 1XB2A 1J8MF 4TLAA 1KGDA 4O0MA 3TUIC 4YMUA 5FTLA 2QGZA 1CR0A 1E94E 1W0KA 3PENA 3ZYCA 2IXFA 2BDTA 3LBNA 2DFLA 3ZJYA 5KDLA 1T0HB 2JJ2D 4HB0A 3W8RA 5BYJA 4MKHA 3RRZA 4NYIQ 1EXMA 1JJ7A 3QF7A 4E09A 5KYKA 1M2OB 3WYFA 3Q3JB 1W4RA 1UDWA 5KPDA 1KK1A 5AJVB 2WWGA 1FL9A 1FZQA 1SXJD 1N6OA 3BH7A 4AYXA 3MCAA 2I1VB 2RHMA 3H2YA 3CBQA 1E79A 4HEJA 4O2RA 5FL3A 2A5FA 2GCOA 2YV5A 1PUIA 3KKQA 2IUSA 4MA4A 3RRMA 3ICQB 1G5RA 5FOWA 1W48A 2AK2A 2JLXA 2RGGA 2XNSA 3B60A 2ZJOA 2HCBA 3WMGA 2GAAA 3VR1A 5HKKA 2YYZA 4MKFA 4TYQA 3KJIA 3W3AA 2QTVB 3QXXA 2IUTA 3SBEA 1Q21A 3SYKA 4PHHA 3K8YA 1G7CA 4KFTA 4ILEA 1RZ3A 4MYCA 2QTHA 1P60A 5TMPA 1H8EA 3A1VA 2VHJA 3IKJA 2PMDA 5SZKB 1XEWX 1JJVA 3W3ZB 3B8HA 1GM5A 3BH0A 2ZUDA 4L16A 4W9MC 2OCBA 1G8HA 4IHQA 5FOSA 3QIAA 4B2PA 4A2WA 4TTQA 5JEEA 1RFLA 1OW3B 3LFUA 1F2UB 2V7QA 4BLOA 1Z0AA 3CRVA 3ZQ6A 3G0HA 3SU8A 3TJZA 121PA 2VA8A 3VR3A 3AM1A 2RGDA 3NC0C 2BKEA 2RGAA 3UXMA 1TEXA 2G3YA 5DISB 3SHFA 4ZDWA 2BMFA 1GKYA 3THWA 3SOPA 2AN9A 4GL2A 4OHVA 4RZ2A 1IY2A 4US1R 2C96A 4KBGA 2JATA 4LGMA 2F9MA 2VF7A 5TVKA 1IQPA 2IBMA 4TMVA 2F7SA 3PUZA 3FPAA 4V0OA 1Q44A 1S9HA 5JSZB 3SE0A 3RS4A 1X6VA 1E9EA 5AJXA 2VHQA 4Q47A 1ZU4A 4GT1A 1DTSA 2G83A 3G82C 3EG5A 4DXAA 5H8WA 3HR8A 5EUQB 2XJ9A 3ZIAD 5EZ5A 1D6JA 3THYB 3MWKA 3RVBA 3A4MA 2ZITA 3ADDA 5BQ5A 1LF0A 2HLDA 5F2EA 1P2UA 2VL7A 2CE2X 5HTKA 3GLIE 3SBDA 1AZTA 1NSFA 1P4SA 1QRAA 1NJFA 2GCPA 1M7GA 1R0ZA 3B82A 1CF4A 1P9NA 5C46F 1NMXA 4P4TA 4JLOA 1E32A 1G18A 1SVWA 1B23P 3EASA 4CRWB 2IW3A 4DDWA 1OB2A 2WOJA 1YQTA 3AVWA 2ODNA 5FOVA 3QSYA 1YZTA 3BB1A 3FKQA 1GFIA 5JCZA 1QBKC 1P2VA 4FMDF 2NO0A 3PV0A 4D25A 1GIAA 3DO6A 4TQUS 2G9NA 4JVMA 4Q4HA 4GZMA 1N6IA 5GJVC 2EWVA 4MYTA 1OIXA 2IYYA 3R7WB 4PC3A 4FCTA 2XTNA 5L3QA 2ZR9A 1BYIA 4MRSA 4O25A 4AY2A 4OQLA 2GF9A 1X8LA 1VG0B 2WJJA 2OHFA 2OILA 1Z83A 1SVSA 2CHQA 4M1YA 2JA1A 4LJ6A 3ZIAA 4PANA 5CM8B 4GP6A 4NYJQ 2O8CB 5H1YA 1GL7A 3VNUA 2BC9A 4U5XA 3WRXC 1YZNA 2WSMA 4C0HA 2HXYA 1A82A 4FCVA 3GJXC 4TZ6A 1SVKA 3CF6R 2Q3HA 3REGA 3ICEA 5J4VA 4ZDKA 1P72A 2BMJA 1X1SA 4MYUA 4PFSA 1E2HA 4Y0AA 1T5IA 4BFZA 2PBRA 1Z3IX 2R6AA 2SHKA 1JR3E 3FB4A 3CX7A 1XPUA 4LBZA 1RJ9A 4DLTA 4Q01A 1XMJA 1WE2A 3HYRA 3WP0A 2VP5A 1OYYA 4TL6A 1K5GA 1XTJA 3CRQA 5FPYA 2DFKB 2WOOA 3TR5A 1FPMA 1E2NA 2WMOB 4EPTA 2NIPA 1N6KA 1DELA 3UKDA 2IS1A 2GCOB 1KI3A 3KQUA 4M1MA 2F1HA 1NN0A 1SZPA 3QPVA 5DIFA 4Z8XA 1UBFA 2D2EA 1R7RA 4CEIA 2DBYA 1QHSA 4PC2A 2DFNA 5BN4A 4D82A 1K8RA 4NCNA 2ZRBA 3HPQA 1U99A 2PJZA 4Q1CA 3KFVA 5DI9A 2FE4A 1XJCA 2F43B 2YOGA 1OHHD 4B3BA 1G6HA 1E3MA 2AXNA 4LC0A 4V0LA 4M21A 4S35A 3DPUA 2VP9A 3HR7A 1A7JA 5KDDA 2J0SA 4NYIR 1N25A 3B1YA 2OESA 3GLHA 4M9XA 1KI6B 3TSWA 1R0XA 4LI0A 1YRBA 1GNPA 5J5CA 1W1WA 1X3SA 1NG9A 3OAAD 3PXGA 4D4MA 2P5TB 3IQXA 4LOAA 1E9FA 2Q0HA 3R9XA 1L4YA 2RMKA 1P75A 3WBKA 1N6RA 1TPZA 3KXKA 1RVDA 2GJAA 3A58B 1P61B 4LY6A 4NTZA 1C4OA 4ZI2A 4PTLA 5JFGA 1TF5A 5F9HA 3FYHA 2ZPTX 1HV8A 4Q9LA 1MR3F 2Q9BA 1W36B 4DUGA 5CDFA 1JALA 2NOAA 4PSVA 1PLLA 2OUKA 4OQNA 5EQTA 4I99A 4QBFA 5KDOA 4PZYA 3KB1A 1TEVA 3KQHA 3CRMA 4ACAA 4DLSA 1E1QA 4OHXA 4UNRA 4NU0A 2CXXA 2ZYUX 4AG5A 2ASEA 4OI1A 2CLDX 2EU8A 2FZ4A 2XZPA 1HURA 2G0NA 5JI2E 3ZD6A 4UQOA 4FCWA 1QHIA 2ZE7A 4V03A 3W6NA 2R6DA 3ONWA 4FMCB 2XEXA 4LSGA 1XWIA 2FV8A 4Q02A 3A8TA 2JDID 2WIAA 3EW9A 1HT1E 3TLXA 3AKEA 1NN3A 1AQYA 3CZQA 2OEPA 1KK0A 5G41A 3SJAA 3UMRA 1S2MA 4P4SB 2OV2A 3TUJC 2ZI4A 4QBGB 3TK1A 3NIBA 1RW4A 2IYSA 2XTMA 4LUCA 4OKSA 5FTKA 5J4HA 3B1ZA 4ESHA 3J81k 2ZJ5A 2ZU6A 2QSZA 4B35A 2JLVA 3AF2A 3K53A 1DS6A 2NPIA 4OI0A 2IK8A 4Q7KA 3P4XA 2P0EA 4HZIA 1MO4A 4W7SA 1FUKA 3K0FB 1N5JA 1R2QA 1AQUA 3ADKA 4TLDA 2P6NA 5FH9A 5CITA 2FFAA 4QHTA 1UADA 3C14C 4LJ5A 1Q57A 5SZJA 3DKVA 1XZPA 2OE2A 3VNVA 4HLUA 2PT7A 3AQ4A 4Q7MB 3L0OA 4B76A 1AZSC 1NVVQ 1T8UA 2VP0A 5H70A 5TARA 2XNDA 3Q7PA 3KUCA 1HA3A 4WW0A 1N6LA 1COWA 5K8LA 4OYHA 3CUEF 4KVAA 4R2HA 1UKVY 1N6HA 3CNNA 4NYMR 4R71A 1FTSA 1M7HA 2Z0MA 4Q03A 2OSBA 1XD8A 4G5OA 3B7GA 4KBFA 1L4UA 2WWHA 2PL3A 3WXMA 4LCBA 2J7PA 4ZCIA 4BFYA 2ZEJA 2Z5FA 4A1FA 2GVDC 4HZUB 1QHYA 4BLSA 3GLGE 3NTUA 1TMKA 2R6GA 3RWMB 4AKIA 4LJ8A 2IX3A 1YR7A 1AGPA 1LS1A 3QPWA 1G4AE 3QVUA 3MFYA 4DCTA 4AYWA 4L9SA 421PA 1W46A 4Q4JA 3OIUA 2AFHE 5IRCD 2XJ4A 1L7VC 2XAUA 4HUTA 4JLMA 1G21E 1ZNZA 2FPKA 2RGNA 5J47A 2D7CA 2P3SA 4JKYA 4DVGA 2FMXA 3LY5A 1FOEB 2OM2A 2WSSA 3GJ8A 1E69A 2FOLA 2BKUA 4RY2A 1IY1A 3BB4A 4PPNA 1KSFX 5FBLB 1SVIA 3AF1A 3I73A 1SHKA 1ZM7A 2ZIAA 2QPOA 3Q9LA 4NCJA 5B30A 1W0JD 2KI5A 4I4LA 3SR0A 4LHWA 4WXRA 1ZCBA 2GESA 1LF5A 2ZVPX 4QHYA 3WHKA 2OLKA 4PXAA 3PUWA 3SYNA 1EG7A 4KO8A 4C0BA 2OXRA 2NG1A 3GEEA 1PUJA 2DWQA 2BOVA 4BFXA 1E99A 3GP8A 3IPXA 1UPTA 4LV6A 2V9PA 4A0GA 4HDCA 1S8FA 3W6OA 2ZJZA 2I4IA 1R5NA 2ORIA 4DEYA 3L8ZA 3I4LA 1RRPA 2XSZA 2ZQ5A 3OAAA 5KO2A 1KI2A 3FFBA 1OV4A 5CB8A 5AUQA 2F3RA 1YR6A 3WMFA 4DLZA 5LD2B 2ZJAA 1KI7A 3ZVNA 5DSZA 1W36C 4M9SA 1EFRA 2HDNB 1R4AA 2H5EA 3P26A 2O8DB 4XVQA 4XVUA 1G3UA 1KZ7B 3M1IA 1GWNA 1FP6A 3HPRA 1NY6A 4MQBA 1VMAA 1GZSA 4IDPA 1AKYA 4IKEA 1GKUB 4UXJA 4Q21A 5CYPA 1MKYA 4DBLC 4B3FX 1JEDA 4KCGA 4MKGA 1EESA 1F48A 2BBOA 2WKPA 3LA6A 3KKMA 3AP2A 2ZJYA 3P32A 4IFBA 5DI3B 1XMIA 3VMFA 2ORVA 4OK6A 4BLRA 5KHOC 2A5GA 1FP7A 1PLKA 3CH5A 4LDJA 2ZROA 4DDTA 3GJ7A 4XOIA 2GA8A 1XPOA 4QGAA 2ODEA 2NMVA 3EPLA 1BH2A 2QSYA 2WJHA 1S1CA 3MJRA 3Q85A 2QP3A 2O8EA 3C15C 4BZPA 1BO6A 4QGFA 4Q4LA 5FTMA 2CVHA 2VEDA 3BXZA 1P62B 4W5HA 2B21A 3DZDA 1ZNXA 1WRBA 1ONBA 3TUZC 2DHRA 1W36D 1NMYA 1G64A 4O3MA 3TBKA 1YR8A 3VR5A 3SI7A 3X1DA 5G3YA 2BIFA 2H1LA 3BIFA 4GOKA 3FMFA 4UKDA 4C30A 5CDFE 4G3XA 2YWHA 1J70A 1NVXQ 4Q4AB 1HQYE 3JZAA 3PEYA 3KJGA 4A8JC 2ZRCA 2XB2A 2FF7A 1I2DA 1BYUA 3QY0A 3C16C 2YJTD 1GL6A 1UKZA 1AS2A 4TMWA 5AR1A 4QJ3A 4YLGA 1F2TA 4GP7A 1PLJA 4TMXA 1T3HA 2K5UA 1G8PA 2V6JA 4HAWA 4IRUB 3A1UA 4GOJA 4A2PA 4V0KA 3C5HA 1NLZA 3ZS9A 1KOFA 1M6NA 1W5SA 3TIFA 4A6PA 4B43A 1ZYUA 4PAMA 1AK2A 5DN6A 3KJHA 2C95A 2HT6A 1K6MA 1V5WA 4JS0A 5AJZA 5BW8A 2ZAMA 4DCVA 3K9GA 1LNZA 5HR5A 3U3OA 2PLRA 3KQLA 3BOSA 1H8HD 2DPXA 5EZ6B 1GNQA 3FFAA 4HUQB 3Q7QA 4C0QC 4M8NE 5FUYA 3CNOA 2GJ8A 1CXZA 1RIFA 4PHGA 4IXMA 5EP3A 3GLHB 4B73A 1Q22A 3PUYA 3L0PA 4CW7A 1Z8FA 1RYFA 3CH4B 5C4MA 4C2UA 3VX3A 4EFNA 4HUQA 4Q9HA 3SFZA 3NHAA 3L0IB 2GILA 1EFUA 4YQFA 1YU9A 4WA7A 4POAA 4EPWA 2AKAB 3RS5A 1MOZA 5F9FA 2Q3MA 4EIWA 3KQKA 1XXHB 2OAP1 5D3MB 1G20E 2AL7A 1GSIA 3OEED 1YZKA 1GAJA 3U2QA 5FL7D 1KSGA 2WBLC 3BORA 4M1WA 4GPTA 3BBPA 3RYTC 2O8CA 1OFUX 3TVDA 1Z2CA 1NBME 3GEHA 2RKOA 1G7TA 3LXRA 3ADBA 5JZVA 3SN6A 3AKCA 1D8TA 1Z47A 4M53A 4LJ4A 3HYTA 2P2LA 1G1MA 2PCJA 1Z0DA 2VHUA 2FN4A 3WYAA 3NC1C 2O0JA 4Q48A 1E96A 2GWHA 4YXWA 2YKGA 3OE7A 3TW4A 1EWQA 4S2EA 1US8B 1W0JA 3TVTA 1HH4A 1SQ5A 1ZP6A 2IXGA 4WZBE 2GK7A 4XVRA 4AI6A 2J0VA 1OE0A 5TDHA 1OFHA 3U4QA 3U7EB 4DJTA 3GLHE 2J0UB 3QOFA 3GLFB 1IN4A 2DR3A 4ZI3A 4JMPA 5TY0A 5DYIA 4GRAA 2VYFA 3RSLA 2Q3FA 4TTRA 3BRWD 2QRZA 4CGZA 1R5BA 1YJ5A 2AWOA 3A6PC 1DO2A 3U3RA 4C7OB 3GLFA 1F2UA 2JASA 3GJ6A 2ZETA 3U4QB 4Q1BA 1Z29A 1JXMA 3F5FA 1IONA 4HAVA 5D3MA 5KSZA 1XXHA 4DDVA 3VX4A 2GXSA 3NBXX 1JQJC 3AVPA 3CO5A 3EIHA 4UXIA 3CB4A 1U2RA 1D2NA 1TNDA 1W47A 1ZC3A 3NBYC 3NBZC 4IDOA 1YR9A 2H92A 4EFLA 2QAGA 3VTKA 1YRAA 4TL8A 1R5OA 3KB2A 5JSZA 4LWZA 1G41A 3O47A 5HCNA 4Q9IA 2DB3A 4QJ5A 3SS8A 3T35A 4A36A 1E0KA 3FDIA 3KL4A 1CKEA 1NF3A 3RWOA 4DB4A 2QBYA 3VKHA 3N2EA 5C18A 1HTWA 3ZS8A 5C1BA 3WNBA 1YE8A 1IN6A 1WF3A 2EW1A 4PPGA 2H8KA 2JLQA 1T4GA 3EPJA 3MD0A 1KIMA 2DWPA 4OJQA 2GEUA 2PEYA 3E2IA 1DAGA 3PEUA 3DKPA 4JLBA 4ARZB 2HYDA 3IBYA 2W58A 2H16A 1LS6A 3SQWA 2E9SA 1F6BA 5GVSA 1XRJA 2FSFA 4UNQA 3RSOA 3CRW1 2PEZA 4G5GA 4DLUA 1Z6XA 2AK3A 2L0XA 1OPXA 2FFBA 3OEEA 1MO3A 3K0EA 1KDPA 2G0TA 3FMPB 4JYBA 4LHYA 3K0CC 1KAOA 4QBHA 3MGCA 4TYPA 1OT3A 2FX3A 1NVWQ 3CNLA 4C0LA 2QN6A 1Z0FA 521PA 1KK2A 3AF4A 3U6KA 4C2TA 3GMTA 4C9BA 3B9QA 1CRPA 4V02A 1NI3A 2VO1A 3LAWA 2BMEA 3HJNA 3NXSA 2XX3A 2YNMA 3X2SA 1W4CA 4PQFA 2UZIR 1E1RD 4PR0A 4QC2A 1UM8A 3KFXA 2VF8A 3P4YA 1YZGA 2VHCA 3B9PA 2VSFA 1DADA 1NIPA 4Q4JB 3ZGXA 1J99A 5EP4A 2DFTA 2VH5R 1S9DA 4B2IA 5LBIA 2QI9C 5JWOA 2W6JA 3Q72A 3I62A 1KY2A 1UEJA 3QBVA 1QG4A 5JWHA 1UEIA 5SZHB 5EP2A 1CULC 1F2TB 2ZSDA 1E2DA 1TL7C 1W44A 4N0DA 3HWSA 2CHVA 4XWAA 3RHFA 3CONA 3AVVA 2VSOA 3F0TA 4CDGA 1P5ZB 1VHLA 1DAEA 4QKQA 2F1IA 2N46A 5FUWA 1KZGB 2AX4A 3VFDA 1G3RA 3K70B 1GNRA 2FG5A 3K9LA 2IEYA 4EPXA 4F91B 4Z54A 5IK2A 4AC9A 4P4UA 2RGXA 3IDQA 1XP8A 4BECA 1XTQA 2FNAA 1XTSA 2GVZC 2NZ8A 4M2LA 2QP9X 2UZ3A 1E2QA 3DMDA 3TAUA 3I72A 2FPLA 3EA0A 4HB3A 4UNSA 1AIPA 1DEKA 2RHDA 2VP4A 4RVCA 4IOLA 3SC3A 1BOFA 1CLUA 3B1WA 4HB4A 2XB4A 1KI4A 4KJZA 2ZRHA 1GRQA 4G0NA 5E7IA 1PZNA 1ZU5A 4CEHA 3KTAB 4QM7A 3UPUA 1E9AA 1R6BX 4ZV4A 1TUIA 2V1UA 5FR1A 3F3YA 3PUVA 2QT1A 4A9AA 4FMDB 5KOYA 4DDUA 2F55A 3U5ZB 1CJMA 3QG5A 3SHWA 3DDCA 5C4GB 3V9PA 2B8TA 3KZ1E 2QG6A 3LQQA 4GMXA 2GXQA 1KNQA 5EXTA 5KUTA 2D4HA 4NZYA 4QJ4A 1CJTC 2CK3A 3FGNA 1E2EA 3ZZTA 4RD1A 2QMOA 3GJ0A 3U3MA 4CVNA 1TUEA 1XCMA 3GLGB 1GDDA 4M4SA 4GOXA 3E70C 3V4RA 1EFHA 3NHBA 4FD2A 4JBWA 5EXXA 4G5RA 4L4UA 1ZMXA 4PO1A 4KODA 2D2FA 4HSEA 2ZRJA 4YDSA 3X1WA 2FJUA 2QQEA 1IOZA 4KAXA 2OLJA 1GOTA 3RS2A 2AHOA 1YZQA 2X8AA 2C03A 2GCNA 2O8FA 2YZ2A 3UMSA 4NL4H 3QJYA 3EARA 3X1YA 1N3BA 4LBYA 3K09C 3R8FA 2A9KA 2ATXA 1WB9A 1PV4A 1P73A 2BEKA 4CF7A 2KWIA 5DH9A 5JJIA 1OF1A 1T9HA 2O8BB 2D06A 2HJGA 2Z6VA 2PX0A
chains in the Genus database with same CATH superfamily
4AMBA 3WGYA 2E1RA 1P31A 3D3KA 1E2FA 3EDMA 3HO1A 1XKLA 3DE3X 3QGMA 1HPLA 3CPEA 3H2KA 3UV7A 1DKQA 4N3CA 5GXQD 1UP7A 4EGFA 1QVWA 4C4XA 3UG6A 4GE0A 4W6QA 4EJSB 2HWWA 4QLAA 4ZVPA 1WHSB 1OWLA 1NP6A 4P34A 3FXAA 2JBHA 1QUFA 2J3QA 2JCHA 2C2BA 4IS2A 1GGVA 2QPLA 2NU9A 1BKSB 2X3UA 3IP3A 2XA1A 1WW3A 4LYJA 1JFSA 1I30A 1WSDA 4YT8A 1DBSA 1I2ZA 4GPD1 1SVNA 3M7IA 2PZMA 4MDYA 1BKDR 2JIZA 2EKPA 4H9OA 1C80A 2QTZA 3JVDA 2QTRA 3U81A 4B79A 3WZ2A 4K8RB 5D3QA 5L3VA 4RW0A 2NM0A 1P3OB 4GECA 5E4JA 1OTXA 1R0WA 2GZDA 2NUTB 3OEHA 1H2XA 2KW5A 2YY6A 3DOUA 4UUMA 5A6VA 3L0CA 3SM3A 4TKVB 1M2EA 1SA0A 2NO7A 3QU7A 1DLIA 2CV5D 1LTKA 1XAJA 3P9IA 1IY9A 4KOEC 4RJ2A 1B42A 3HDYA 4BPBA 5LBUA 4ZUXD 3WFZA 1DOHA 5HHTA 1X0VA 5JPDA 2CLEB 3Q10A 4LYEA 2ZB2A 1XDWA 1K92A 1YI1A 4HZUA 3UTBD 3DGFC 3QE3A 4MW2A 1KARA 3OIGA 3CURA 3KQNA 1SPBS 2NGRA 2CNOA 2F8NH 3DZ8A 2P77A 5G53C 3M83A 3O8OB 5GJCA 3D3WB 1XAIA 4OHYA 1ZGZA 4MW1A 4D2IA 2A7XA 1UMCB 4UVGA 3BWXA 1TM1E 1KX3C 2BKLA 1D2MA 2O1XA 4QDJA 1E3WB 2XMZA 3Q3VA 2BDUA 5A0FA 3I9FA 2H4ZA 2QJWA 1L1FA 5HRUA 1JZSA 1J2TA 4ZHSA 5IYZA 1LY1A 1OHHA 2FPMA 4YUXA 4E46A 2PGDA 4DY4A 4M6BA 5JJBA 1KRWA 3UNXA 2PWZA 3KXBD 1OZFA 5AKLA 2ALJA 3RC8A 3IL2A 2WB2A 2C82A 4GNKA 3GRRA 1VI6A 3RTDA 2Y1LA 3Q11A 1WIWA 4BWFB 2XD9A 4ZICA 3HFGA 4DR4B 3MGQA 3H9BA 5AJYA 1IBSA 2RFLA 3K09A 3IPAA 1P1JA 3REHA 1FU4A 2N42A 1L5HB 1WOMA 3OQPA 1HYGA 2IEZA 3LC7O 2MOKA 5DWVA 4YAGA 2F3UA 4K81B 4HGZA 3TMAA 3V9RA 3DZFA 2VJOA 5DXAA 4WBNA 4CM1A 1JLMA 3T7TA 4RKFA 5CU7A 1EM8A 5JO9A 1CDDA 5BNTA 4AF6A 3G0OA 1VDZA 1FXUA 2YWFA 4RWEA 3DAYA 5INTA 2XD5A 2PGJA 4B3DA 4DREA 3K9FC 1DC5A 4HXFB 2Q4BA 2Q9UA 3FYCA 4AKTA 4BFUA 1BS2A 3WAAD 4QUAA 3RRFA 2JFUA 3IURA 1EFRD 4QM6A 4EY5A 1XZKA 2Q50A 4GX5A 1X39A 2WJGA 5EGSA 1AOID 4ACBA 3R5XA 4HDSA 4LK2A 3RBXA 1Y7IA 1PT7A 3RFTA 3BH6A 3G2QA 5H0IA 4A2QA 1M1YA 2FW1A 3LQKA 1T35A 3HKBB 1XU7A 1Z12A 3L7IA 3RT9A 3E1SA 5CA0F 1D2AA 1EDEA 1MW9X 1RM5A 2VWGA 4XH9B 4DPLA 3ET4A 3CIOA 4P5PA 1TO1E 4LY0A 1I1HA 4KR9A 3OC6A 3SC2A 4A5OA 3D6TB 4FFPA 3MTBA 4NH0A 3I04A 2JSSA 3DHVA 3TQTA 3AZIA 3I42A 4OHZA 2JIOA 2IE8A 1OI3A 2PGXA 1RD4A 1GZ7A 1LBEA 5J40A 5C0OE 3LCUA 4AN4A 2B25A 4RZUA 2W71A 4FIDA 3W96C 3I2JA 4H35A 2Y3IA 4MUMA 4RIGA 1B2LA 3RUHA 1U2TA 3U7GA 3F6CA 2CMHA 5K0EA 2Z2ZA 1CUGA 4HDMA 3DVAB 4HWKA 4L6CA 4OXXA 3DM9B 2ZM5A 1RWMA 4TQ9A 3DYIA 4WBNF 5L3SB 2C2XA 3FTDA 1MPXA 1ILWA 4GPZA 4TUYA 3DP9A 3KTOA 2ZSFA 3UC9A 1TE2A 1S3FA 5CVTA 3FOFC 1W1IA 2FG7C 2NXNA 4CKWA 1U3UA 2J7KA 4MQ4A 4W1QA 1SUSA 4F06A 2R3SA 1MEOA 1YQWA 3N59A 4M87A 1N5KA 2ECOA 4TS1A 2RGYA 1UIRA 4G0XA 5TE9A 1NJ8A 3V3KA 1UBCA 3EG9A 4FE3A 1CTQA 4HBGA 4C0XA 1MB3A 3HBNA 3MTAA 1P3LD 3ZD6A 2AG1A 3AHHA 2VCEA 3TZQA 1C81A 3U9TA 1R88A 621PA 5EUMA 1BS9A 4IXNA 2W70A 3RK1A 1T0JB 5DN9A 2GAOA 5LNK6 3BMQA 2AEFA 4OJYA 2OXEA 5K09A 4J9UE 2MTBA 2QL6A 2RJ3A 4PAOA 4QVKA 2J33A 4B2YA 5J43A 3F47A 4B5LA 3C5VA 1B3BA 3B2QA 5LWQA 1D6SA 1WBBA 2IUUA 3PRHA 4G1MB 3NVDA 2PH1A 2BE7A 3N6VA 4JIMA 4OU5A 3NVAA 4WZBA 1P0PA 3UBTA 4DHEA 1RYNA 1DKOA 2A30A 2WU0A 4A0RA 1OIWA 4DC0A 4W7IA 3RYHA 1V11A 4GSLA 1TI7A 2P0AA 1ZRHA 2XNKA 2E89A 2AN3A 1JPVA 1LV7A 1VHQA 5JQWA 1W5EA 4DMGA 4UDOA 1Z5WA 5ESRA 3IP6A 5A3VA 1A4UA 3IIIA 4Q1EA 3VDRA 2NZJA 5DU2A 5CAEA 1QRTA 1YIOA 5AI4A 3NIWA 3QKSB 3ELDA 4NFHA 3R7WA 4IDGA 2DHDA 3CSDA 1SVLA 3TTVA 3V46A 1KO1A 1JAYA 2C9DA 4B87A 4F2PA 4ID9A 2AD1A 4ZOQI 4ZO9A 5HM6A 1EGAA 2NXEA 2B7BA 2JGKA 2Q5QA 1AGRA 4FT2A 3RELD 1VG9B 3L0ZA 5CIQA 4US2R 3M5CA 3KSZO 5GPBA 3U3KA 1DWPA 2O59A 4A82A 1WPRA 4X60A 3GA0A 4DILA 1Q0UA 3HCOA 4X6XA 3T5GA 3TNYA 1TB4A 3JR7A 4UCQA 5FBRB 3W04A 4EJFA 2IYXA 3L7KA 3QVJA 1HTTA 1YB2A 5F99B 1HT2E 5IAJA 1ADJA 2VTDA 3ZJVA 2D1QA 4ARZA 3SS7X 3BK1A 3OESA 4RY0A 5C34B 1ENPA 3IVGA 2YXNA 3H6GA 5EHZA 1W59A 4GVPA 1GPDG 3R45B 3X1UB 1A9PA 1MO6A 1J5XA 2CNWD 1AA9A 2PLFA 3QYJA 4N39A 2GUWA 3K9NA 5AHWA 3MERA 1TJ4A 3MILA 4I5IA 4EL0A 1N36B 2OL4A 4ZMSA 5CCXA 5JSFA 2WNHA 4AS1A 3UV6A 4R0MA 5MDHA 4BBJA 1ZIXA 5LMNB 2E6KA 4N8DA 3KUUA 5TSDA 4P5EA 4MGIR 5FI1B 4B7XA 1J0XO 2J08A 3U4DA 4EJ2A 2YVKA 4Z3KA 221PA 4URZR 3LSTA 3SEZA 2CWEA 1SC4A 2IP1A 3QVVA 4LE2A 1Q0ZA 1QOZA 1X8XA 2PO5A 3EMDA 3KQQA 5JAIA 1XPRA 1QP0A 2IBTA 4FZ5A 2XT0A 1L3BA 4RV4A 3O4RA 4O59O 2LUOA 1XDDA 3CF4A 3GYGA 1YF3A 4DSUA 4IGFA 4U7TB 4UNNA 1LLFA 3STUA 4IJ6A 5G49B 5K20A 2REXB 1Y4UA 2WWFA 3KVNA 2NO9A 4WVFA 3U0BA 1TZCA 4MW7A 1W6RA 5IAAA 1ONPA 2AQHA 3DFKA 5LB2A 2ADOA 2HBYA 4RTQA 3JQGA 4IXTA 2WHQA 3BFJA 4BRSA 5A7GA 1FK8A 3O0DA 3MTJA 1VPLA 3S55A 4Z2MG 5CNMA 1G6KA 1TT7A 4JD5A 2NVWA 1HR0B 1U5BA 2BFMA 4KV9A 3CZRA 3VR3D 1HNZB 2FQWA 1H9AA 1Y6JA 3NT2A 3IDZA 4HGOA 1LQ2A 1ORIA 2BEWB 1SQ6A 2ETVA 2QYOA 3O4FA 2XB8A 1JQLB 1I36A 3AGPA 3GXOA 3IQZA 1ZW6A 4E5KA 3FOCA 3KLPX 3C5CA 3A4NA 2Y6VA 4ZEMA 1NFFA 2Z3WA 3HS3A 4TUYF 4LMAA 4HQ0A 2ZIXB 1E0DA 2F8NK 4HWSA 1HQ3D 3NM6B 4ZANA 2XOKD 2IOHA 1G3IA 2HSDA 2NU6B 4QJBA 3P2EA 4XA8A 4BO4A 2AF3C 4HLNA 5IT9A 3JVVA 1N5IA 5KNBD 2YWGA 4KFRA 1COWD 4G0OA 2VTVA 3KFUG 1RDFA 3JQFC 1RPAA 2G5IC 3TZLA 5GM2A 2GPTA 3GLFE 3OA0A 5F98A 4DWOA 4LZZA 1NJGA 4YRBA 4N7RA 5IWCA 1Z2NX 3UEOA 1TW3A 3GLRA 3I9LA 3NAGA 2BR4A 2H57A 3QIVA 2DULA 1YOBA 5G0VA 4LXUA 5A4AA 1A7UA 4FW9A 1SNYA 4ENQA 2HA6A 3OOJA 4MVWA 1L8QA 3OFND 4H2DA 4OBWA 4H9QA 2DE0X 1KHTA 3OCVA 3PHIA 4CM6A 4RFSB 1JHZA 1X19A 2J67A 1RLOA 4PLZA 4BMZA 3KXBA 1BVHA 1MP0A 2Q5HA 1M7BA 1EQ2A 4GOOD 5B33B 1AG9A 3GUUA 1KETA 3KT3A 4DXDA 2EWWA 2PKWA 2YYYA 4K6GA 1L7NA 5KVSA 3H05A 1QOQB 5SV2A 5EFOA 3S8EA 3T7JA 1P9WA 1SMKA 3GP5A 4MKXA 1V6SA 3BFPA 3C43A 3OP4A 2DPHA 5CB4B 2BR5A 5IU6A 2NTVA 3SYLA 1TZBA 3HK2A 4LRTB 1AB5A 2P40A 4NXMB 2WMYA 1NQWA 4L1KA 5DULA 4IG4A 2VXBA 4QULA 5JSHA 3VTFA 2Y92A 4E15A 1NZDA 1MB4A 1V0JA 3MT9A 2C1ZA 4FNGA 4F6LA 2HIMA 4AFNA 3P94A 5IUJC 2GDZA 3U5TA 3RB8A 3C1BB 2LVBA 2Q6TA 3ITDA 3W5VA 5JRZA 2IGBA 1QVVA 3AOEC 1K6EA 4Z4IA 4E22A 2PDAA 5K2MA 1IYZA 4A0SA 1Q50A 2CNWA 2PKRA 4ITUA 4EDFA 2PMKA 3SEAA 3LKBA 4L0DA 3GH1A 1UXIA 5H02A 4BP8A 1IHXA 1N9ZA 1K9VF 3BSYA 2VXOA 3OE5A 1X1DA 4FN5A 4H3KB 4NU6A 2ZI9A 4PSAA 4WKNA 3EDQA 2E1PA 1XT6A 2FI1A 3AYXB 1ZIPA 3DD1A 2VHYA 3I9JA 4ZOBA 5FNVA 4BE7B 1F14A 5I9LA 1EPUA 3T1HB 1RR6A 2OOSA 3X1VD 1E3DA 2PH7A 2PV0A 4R5HA 4MUXA 4UVEA 1NXPA 1H2ZA 2AR7A 1KYVA 2G88A 4RACA 1ZESA 2C8JA 3C6QA 3LQ4A 5FFNA 1W73A 2PJDA 3VTZA 1JJBA 1RYZA 3SXUA 2IRWA 1I8TA 2C5BA 3VPBA 4E3ZA 5HPYB 3KSAC 4DV5B 1WW8A 5CGQB 3S81A 4JLJA 4RHEA 1HQ3B 3AZID 5CX4A 2RKBA 3ESAA 2L82A 3FYUA 1NVBA 5THQA 4FOSA 3PC8C 1FRQA 1U3DA 2F1JA 2INGX 2XDYA 4K6HA 3VNBA 3GNSA 1OX5A 1S2OA 3FPLA 4REOA 1B41A 1NUHA 4ROTA 4EO5B 1XCJA 5LYJA 2GPJA 1NVUQ 5GSUA 2ZR0A 3EZFA 3FMOB 2ZRNA 4NFTA 2PIAA 4TMKA 4DMFA 3GLGA 5DNND 3GH3A 1ADGA 2PCLA 3BXEA 1PS0A 1I4LD 2V7QD 4LRWA 5A6SB 3IQGX 4D9BA 4DV6B 1G20B 2G1JA 4NENA 4G9EA 2BFOA 2Z2IA 3BMCB 3MEQA 2PE5A 4TLLB 1CUBA 5EJIA 4REMA 2PS9A 4AJHA 4BLTA 3A3OA 1UDXA 1M0SA 1EINA 2ES4A 3E05A 3V1MA 1QG2A 3BXXA 3RVPA 3U61B 1ZO8A 3EMKA 4NOKA 1SOVA 1ZSVA 1Q6ZA 1IPFA 1VPVA 4WY8A 2FVXA 1EHCA 3UMYA 4G92C 5K8UA 4PRZA 3O84A 2BMWA 3OT1A 4RK6A 1UK9A 2WWRA 3TGPA 2X0IA 3UYKA 3I0MA 2V6BA 1E61A 3CNEA 4ECEA 1GZHB 3VKWA 1R6DA 1S2IA 3EJ6A 4CL8A 5COAA 5KTPA 1DUVG 3T1VA 2ZTHA 3LD9A 4MPRA 5AW6A 3GRYA 3THOA 1U94A 2XE4A 3I9OA 1YMQA 4PSUA 4R8PA 2HMWA 3TKYA 5IFLA 3T34A 4XTRA 2VQSA 2BUBA 4MB2A 2O0MA 1P77A 1XF1A 2HYIC 1W85A 4FSDA 1MABB 3TI9A 3NKVA 2PAFA 2YQ4A 8GPBA 3BAZA 4PRLA 5CLGA 2ODBA 1ARZA 3FH0A 3I9NA 3OCWA 1F6DA 4Z5TB 4IDQA 4LDZA 1KYTA 3AONB 3DZCA 2UVQA 3M6MD 1BE8A 3ONEA 2SKEA 3QUQA 5ULLA 2VIIA 2DT5A 3TW6A 4XD7D 1X15A 4C0SA 1UM9B 1UF9A 4WTOA 4J16A 2W2PA 4LOHA 1FNBA 5ARDA 5GZ1A 4KEAA 3REIA 3R7FA 2YHSA 3GJ5A 2C42A 4E70A 4EHAA 2II6A 4JA2A 4M22A 5I9SA 1R4MA 5FBHA 4MS4A 5THXA 4WV3A 5BWOA 1YJ8A 4HFNA 4OGLA 1PJRA 1I4TD 1X1TA 4FPXA 4W1RA 2OBLA 3L82B 5I48A 3UK1A 2OG1A 4YRNA 2BGIA 4M99A 3LG2A 1A4RA 4BX0A 4D4KA 4V0ME 5LJIA 3LQ2A 3DMYA 3N05A 1G4HA 1UIMA 1OLSB 3JZFA 3SJ7A 2GPBA 1YZVA 3B20A 4HRYA 3W1WA 8ATCA 1J07A 1LPBB 1KH1A 1PI3A 3B1XA 5K4GA 2AZMA 3LGSA 3GRFA 4OM8A 3RVRA 1FXWA 2J59A 2YC2C 4YT2A 3H6HA 2XT6A 4CMAA 5B57C 2ON6A 3QXHA 3WRYC 1FYEA 4FXPA 4JI7B 3QKSA 4JYCA 5CYFA 2JIPA 5LPNA 5B33C 2RB4A 2D74A 3H86A 4LTMA 5IJAA 3W06A 2QRVB 1J25A 1WVMA 2ZU0C 4CQMA 3ZQJA 3G7UA 5BVGA 4ZDIA 4O02B 3P1JA 4QOSA 3ZTTA 3AZNB 3DMTA 2CHGA 2A33A 3AKDA 2FA9A 3ILVA 3JAWB 1JFFB 3OF5A 5ES3A 4B3IA 3K05A 2WHRA 5KNCA 3COYA 2CSUA 2XXAB 5B3KA 2PA3A 5HRAA 4DB2A 2HT1A 1AE1A 2HWYA 4KR0A 4Z2AA 1CR2A 2WVHA 1UKAA 1GG2A 4B4UA 3AYZB 1EUDA 3ZE2B 1XZDA 2XKAA 1BHJA 1ZRNA 3OPQA 3SJUA 3O75A 5EAIA 4EO9A 2W7TA 4FDAA 2EFEB 1GPJA 2OCLA 2QTBA 3D4BA 3Q7TA 3L7BA 3WB0A 4AX8A 5E1DA 4E7OA 4F4HA 5LP6F 2XWJI 2JEYA 4Z9XA 4O8CA 4AURA 2O20A 3JCZA 2EYUA 2PK3A 1XCGB 3FWZA 2OFXA 3ZDRA 4LXGA 4W8OA 5FT9A 2BFBB 3EY4A 3IEKA 4DLKA 5L95A 1TTPB 3HFRA 1KOLA 4NG5A 1INLA 2G9VA 1BGXT 2F00A 1DIRA 1GCOA 4U2FA 3FMIA 2GK4A 5DSTA 3VU1A 1JBEA 3O9VA 1D5CA 1JFVA 2FOXA 3GLIA 3KSYA 1FYDA 3FVRA 2O3UA 2P69A 3OF3A 4Z5TD 1DC4A 1UANA 1U3FA 3O9MA 1ENOA 3QELA 2JZCA 3EXHB 3UK6A 4IHJA 4LHXA 4FGUA 1O4VA 1CB7A 4RAOA 4J0CA 3IKMB 3P0RA 4OEHA 5JS8A 2FWJA 1P0IA 5C2JB 3VYSB 1JR3D 4EMTA 4Z8YA 4K6OA 4UEQA 3DVAA 1YKFA 4ZEOA 1AQNA 2V6GA 4BQIA 4EECA 2BFPA 3U16A 1SGWA 2MWMA 4WE3A 1Q15A 2HIOC 2JFGA 1GCAA 4JYMA 4L51A 1GQYA 3OQ1A 4NMHA 2QSJA 5FLEX 3SJBA 3WSTA 1IDN1 3RG2A 4C43A 1KFKB 1N1GA 2ORWA 2W6ID 3REQB 1SBYA 3IBTA 3OIYA 5A06A 2CNLA 5TLSA 1PJLA 3B53X 4P4SA 2VI5A 1JZQA 4OSPA 1OH7A 4C6TB 1S3SA 4LK3A 2JCSA 2OG2A 1E7WA 1G8MA 3EGIA 4KXLA 2AA3A 2VJQA 1NRJB 2W0MA 4GWLA 1MOQA 2FWRA 2ONYA 4OH7A 5FPKA 2WICA 2WJYA 1CEXA 3IULA 1UH5A 3N58A 1KEPA 1U9JA 1F5NA 1KAEA 4BNKA 1HQCA 1WSAA 1IC6A 4WLNA 5DM0A 3QENA 4XW2A 1NVVR 1YL7A 2PGOA 2VUHB 4NEQA 2JCYA 4KQCA 1XMPA 3BL6A 4K46A 5B1MC 1Q0HA 2EKBA 3D3JA 4COOA 4LDAA 1FTWA 2IHZA 2I29A 3KZMA 3ZU3A 3TZBA 2BVNA 3EEOA 2AFIE 3WV4A 3ZEIA 3HDQA 1VIYA 3O83A 4N7JA 5K99A 1FVOA 3WDSA 4BNJA 2XBMA 2HX1A 3URKA 3UK0A 1IWBB 1U35A 1OYOA 5B1LC 2FWBA 3X1KA 2PKEA 1BXZA 1ES9A 1L4NA 3EF0A 5A9TA 1EA5A 3BAFA 3HUTA 1S2LA 2UYGA 4ITVA 2H1RA 5E2AA 1X7YB 1JRLA 1QB7A 1XAHA 3JQAA 3UAYA 4LTDA 3ZDAA 2HREA 1L5HA 3IIEA 1H9CA 2VP6A 4BZWA 2NYRA 3ETNA 3R4CA 3RIMA 1ND6A 3L6RA 5C5EA 4FHZA 1MBZA 2YWRA 9ATCA 2K87A 3WMXA 4ZZ1A 2IYVA 3LDFA 3ZD7A 3OEWA 5IYZF 3L77A 1ZINA 2EHDA 3PFFA 4TV8B 2HQSA 3BRQA 1P2GA 4XGKA 3UPTA 4ZO8A 4E1AA 4FYVA 3MCWA 4KITB 4MVJG 4BRUA 4FHGA 2PZLA 4H18A 4UC0A 2RIPA 1JMVA 1YS6A 3PC6A 3PL1A 4M9CA 3D9QX 3S8YA 3F98A 2CLHB 5CJPA 3L93A 4EZEA 3MNNA 2YV4A 4DLVA 5IYZB 5H7XA 2Z4RA 3K9WA 3VSBA 5J63A 2VQ6A 4UPKA 5FPPA 4FYMA 3K0AB 4XSGA 3H2HA 4H1HA 2OBYA 3I32A 2R6CA 2XBUA 3E22A 2BGLA 2CMGA 5GWXA 5H9WA 3NEYA 5AOVA 2HW8A 4P22A 1OH8A 5ADVA 1G98A 4N3NA 5JRGC 2WILA 3LC2O 2J3JA 1N2CA 3QXSA 1X7WA 4EOGA 1JLRA 2EV9A 1U7PA 3B3FA 1DVRA 3ESBA 3G49A 3VDNB 4G1FA 4Q1DA 4RJJA 4LJRA 2GJ9A 4CT4B 4MVJI 3CZCA 2BGTA 5L6LB 4LGCA 3TXYA 2QL5A 3AUSA 3EIFA 1JWBB 3CN7A 3TS1A 3QEAZ 2AS0A 2WMNB 5EJ7A 5HNKA 3OQVA 1L6RA 2EC5A 5JYCA 2CVFA 5IM4F 4OAPA 4A8JB 3LWDA 1Y34E 1CEEA 4KMOA 1L9KA 5I7RA 1LD3A 4M1SA 1G0NA 2Z2JA 3IBGA 3O4JA 3AN2C 3WA9D 1Z17A 4XVHA 4YQYA 4YWHA 1L5GB 4F9EA 3MWFA 4Q1AA 1H2RS 1K63A 4I4TA 1NQAO 3AOEA 5K8VA 4H7HA 2FWNA 3ASVA 2X1VA 2DCUA 2YFKA 4PHFA 5UKDA 3WIEA 3K9BA 4C7KA 1Y4DE 1A4XA 1EUCA 1JVNA 2QU7A 3MQ4A 3PPVA 4UMVA 2VLBA 1OB5A 5E1BA 3N2GA 3WKJA 3ABZA 3AWDA 4RJIA 1YJCA 1PZRA 3UY4A 1VJTA 3I5YA 2WWVD 2PQ0A 3OIDA 3RS7A 1NXQA 1D2RA 5C80A 5A4MS 3IUNA 4RV9A 5AV5C 4Y6SA 1JEOA 1TAGA 3F3SA 4Q7JB 3QUCA 2DG2A 2HJ9A 1DBWA 1PRYA 3WAAB 4DJFC 3DM5A 1H94A 3CSUA 3FUWA 1EU1A 2C58A 3JZDA 4ER5A 3FE2A 4D6XA 1ABEA 4ZYXA 1RBZA 2K7ZA 1ODFA 2Q8NA 1S0UA 3MGPB 3REKC 1KVQA 5BWMA 3K30A 1ZM2A 2IHVA 4NOMA 3QW2A 5JY6A 3EWAA 4RZ3A 4ZO6A 4S1WA 5DW3A 3IAM1 2WSSD 4BZQA 5HX7A 1TKRA 3G79A 3HGTA 3SLKA 3V2HA 1JH8A 2C0PA 3D7MA 2O8FB 4MTCA 1XWFA 1QHNA 4XUGB 2PUFA 1XHLA 5DZSA 1QLHA 3B3JA 2WTUA 2BFAA 3ED5A 2DQYA 1K2WA 4GBMA 1JR3A 2RHHA 1BGVA 1ZM9A 2Q6VA 4TZ0A 4MAMA 3TSCA 1KL7A 1SOMA 5KDMA 2HB6A 3TW8B 2LTAA 3HGQA 3NKFA 4ZI7B 1XKTA 4I6EA 3FWHA 4JUAA 1Q1QA 1JAIA 1XA0A 3EULA 4OUDB 4QNRA 1BIFA 1E1CA 4ND4A 1I9CA 3QMWA 3C3PA 3IAS1 4P4LA 2CF6A 5CP6C 1T6BY 3CLSD 2P9FA 2NQBB 3L43A 5EZQA 5BVHB 5KVVA 1IEQA 2PZGA 2FCAA 5KDMB 1WL8A 3Q8XB 1TLTA 4D8VA 1QYXA 2YUIA 4YJGB 3HADA 3UTBB 1YNSA 3ZX4A 3VZCA 3MYRA 1B43A 4LRXA 4V0MA 3S1AA 4DXHA 5IF3A 2IS6A 1O58A 3I6YA 3HCEA 4MLPA 4CMIA 1Z0SA 4UTVA 4XWOA 3TPFA 2C2YA 3VA7A 4KGXA 4KN6A 1NNUA 1MVLA 3M6UA 2FZVA 5KYUB 3VO8A 3KZOA 4N9WA 3C98A 5HJ7A 1XVAA 1P3LB 1GN8A 4E51A 3M1LA 2V7BA 1IQRA 3ITNA 4GLFA 1AUOA 4UD6A 5D7BA 1ZR2A 4ALKA 2OXCA 3R1IA 3T95A 4EYSA 2CMDA 1GGKA 3AFAC 2OHHA 4RKEA 3LBAA 3P0EA 3U4CA 4X1IB 2YV2A 4FHDA 1QTIA 2JW5A 4JJKA 1O9HA 2HV9A 1PHPA 2P2ZA 2J1LA 3UFBA 5LXTB 1JFTA 2RIQA 2YFYA 4U00A 2OB1A 3QPCA 4M0FA 3WGHA 1YA6A 1H6DA 2GETA 4HQNA 4JR0A 1USGA 4KTTE 3WWEA 4DT1B 1CE8B 2IYTA 2ONKA 2ZFUA 3G2HA 3T3DA 4WU8D 3EXG1 4RADA 1IM2A 2O0LA 2QG9A 2WKRA 3AILA 3G1WA 2ATIA 1FUUA 3NRBA 4J1TC 4BNIA 1QU3A 2QYHA 4BVKA 4RXMA 5EJ4A 5K8TA 1IXKA 3WISA 3QTBA 3DTVB 4IJKA 5F5NA 3ZOZA 1U6JA 4RDCA 3VAYA 2JCBA 3LW8A 4FJ2A 4RS4A 3WQBA 2HIOD 1JJFA 4I4TB 1VJ5A 3KUYC 2BGRA 4MCJA 4D5GA 4AY6A 4Z53A 1W4LA 1DMSA 3KWMA 1L4KA 1PYDA 2ZI7A 2XUQA 4KVGA 3U80A 3PQ6A 1PQPA 4LECA 1PSZA 3A28A 4LKOA 1E2PA 1VBFA 5T67A 4RTNA 3DNMA 3DMTC 2CFIA 3PJFA 3G9ZA 4I9GA 4MQEA 1FLVA 3BWBA 1MD9A 3SX0A 4B48A 4HRXA 4P35A 1TQ6A 2ZJ0A 3DCYA 3ZXXA 4F12A 3AB3A 5IULC 1WO8A 2AGVA 2FLWA 2R65A 2QDXA 3CLTC 5TT1A 1ZMTA 1KX3B 1DAFA 2JD2A 1P3AB 2JARA 4G1BA 3WRYA 1XU9A 1KXZA 1JYEA 2B6NA 4AICA 5DKFA 3E7XA 3VH2A 4N7BA 1MJHA 1U0TA 3GO4A 3JR3A 2Z1MA 5HM8A 3HSYA 3L04A 5AFSA 1MIHA 2PSJA 1KP9A 3BSSA 1Q3KA 4AJJA 1N7IA 2BT4A 2AG0A 4KIUA 2G8LA 1Z8HA 1U2GA 1A7AA 1VYVA 1GTG1 3GOQA 8ADHA 3PDWA 4A6XA 3RU9A 4CM7A 2W2QA 2Q1SA 3P4UA 4PWZA 4WXYB 5KYXB 3MGSD 1WUKS 1QFJA 2AN4A 4XEHA 3T12A 4ER6A 3BGWA 1A8QA 3KYCA 3TZ6A 2IU6A 3GN1A 3ZCPA 2AFHA 2LKCA 5ALTA 4QXPA 5AV8D 2H1SA 1D2EA 5AH0A 1OLXB 2R8XA 1JPNA 1ESEA 2QOEA 4I50A 1YB7A 1M2NA 1Z26A 2Q29A 4DA7A 3MGPC 3H2SA 4B6QA 1AJEA 4ARIA 1DKRA 3WFJA 1HL3A 2VTKA 3JD0A 3VO1A 3LOPA 3QEMB 5AUNB 4BQQA 2HRDA 3U62A 3QV1A 1VSUA 2BCGY 2EFDB 1RJDA 3TMKA 3M4JA 4YO7A 2IJGX 5C7LO 5FWNA 2R6R1 3U44B 2H18A 4XTCS 3JQAB 1W5FA 5AW5A 2D1FA 2AF4C 4BVLA 5CP6A 2FJ7C 2A9PA 1HFWA 2J3IA 4NAUA 4I7EA 3A6NB 1B73A 2YH2A 4YIKA 3Q5DA 4CQLB 1QVZA 1PKXA 3LUHA 5TQVA 3VPHA 1II8B 5B0ZA 1T6ZA 5JDIC 4DLRA 3GD7A 2FTKE 3QLTA 4V2IA 3AZEA 3PGVA 4KUDA 1HKUA 1B6SA 4B7AA 1CERA 4EY7A 5B1SA 3JWJA 5L51A 4CLOA 4QOFA 3F5QA 5AXBA 3RAEC 4FNOA 2OCPA 5IZ4A 1SKYB 4LYHA 3EZ7A 1GARA 2EDAA 1O87A 1PF7E 2O4UX 2NLOA 2R1UA 4RYDA 1RADA 3RFFA 2WT9A 1WBDA 2HSWA 4NBSA 4OJNA 3RGGA 2C9MA 5HILA 4G9GA 4JBNA 2V1XA 4QYSA 4MEBA 3I23A 1UFQA 2DY1A 1NLYA 2ODAA 1S32B 2BM0A 3KYJB 4XKJA 1OBCA 2IQ5A 4IIXA 1WY7A 2IIPA 1RRVA 1WUJS 5E4FA 1EXDA 2M32A 4KB5A 3FRIA 4UHJA 2IYQA 4KDRA 3V4FA 3WK8A 4WKGA 1B0UA 1WWSA 3C7AA 1NN1A 3BGDA 4TTVA 1J06A 4IWXA 3WWCA 2NSHA 1DAIA 1SCJA 1YMVA 4J8VD 5BP7A 1KJ8A 3L8DA 1MNQA 2NO1A 1KSHA 2R8BA 1LZLA 3VSCA 2Q49A 4EAAA 3M82A 3WA6A 3GEBA 4DY6A 3V32A 3K6KA 3LNTA 1AQ6A 4MX8A 2WHXA 4MIOA 3W9BA 3GP3A 1Z6PA 4ZBJC 1LK7A 3TI7A 1KZHA 4YR7A 5BOSA 3SM9A 3B52X 3WDMA 5AVQA 2QTNA 4BZZA 3H1TA 1E2BA 1U8CB 1Q1GA 1QANA 2L18A 5GV7A 3R3SA 5CBKA 1R6XA 1Y6QA 3PQ5A 4OHCA 4LDQA 3RELB 1OQAA 2IEGA 2GZRA 4H4EA 4MUHA 1PL8A 2HM7A 2BH9A 1NSTA 2AROB 1U2ZA 3CEJA 2H5IA 1FQJA 1JFIA 1H2WA 5JJ5A 3FVVA 4EB6A 3GLIB 1BDIA 1U5AA 1ECGA 5JRGB 1LDYA 4O2AA 5CPIB 1PG2A 1XPJA 3IXMA 1DDIA 4PXSA 1J0DA 1YR2A 4HN4B 4Y2VA 5FYDA 3TTWA 4DDKA 1Z5GA 3PEFA 3S3TA 2JF0A 3C3EA 3R5KA 2RJNA 1CY1A 3EIXA 3PNBA 4M3NA 4IBOA 4JQOA 3ZDYB 2WUDA 4OHOA 2X9VA 5ALXA 2VDNB 3ROFA 3UM9A 4DQUA 4WLUA 4EM6A 4HHEA 1CUHA 5CP6B 5B0YD 4CWAA 3AZJB 4DIEA 4ZRMA 3DE5X 4O2BF 1C4WA 2GXUA 5IZCA 1TUGA 1S89A 2O05A 3L7NA 1UL1X 1HT3A 3P9ZA 4M1EA 1XNJA 3A7EA 3LE8A 2FJ0A 4TVKA 1N2ZA 3G5MA 1GSAA 2QNIA 1G5QA 3PQCA 2B3DA 4RZXA 3G6WA 4DCSA 3KAKA 5KTSA 1NM5A 4E2WA 2DHEA 4O2BB 3V6MA 4JYPA 2XXAA 3QJGA 5JDCA 3PHJA 3B1JA 3EQ6A 3R7NA 5GT3D 4J1QA 8ABPA 5KSPA 1I7SB 3H0RC 3RUPA 2COKA 2Q1TA 3SNHA 3PLRA 2D8MA 2DKOA 1RT9A 3DL7A 4L4XA 5FNZA 4ZJUA 4ND8B 5DPMA 5FTJA 2CDCA 3EQ7A 4ZT2A 4DA0A 2QZ9A 4LJ7A 3FFWA 4GUAA 1ZSNA 4HXGA 1EI9A 3AUKA 1RKBA 2BBWA 1I4EB 4JENA 2BMVA 2VSYA 3C1CA 3BIWA 5LP6C 2R97A 1BFUA 2ZXUA 2OZLA 4EDHA 2QTFA 5K8JB 3AEQA 1CEQA 3G5UA 2QMQA 4F5WA 2X2EA 4DLWA 3AVQA 3VU9A 2KHZA 2NAFA 3IP5A 4UHBA 1TK2A 4YV1A 3ZW7A 2V3WA 1FC0A 3DH0A 3PGJA 4O1MA 4LWPA 3HVJA 3GT0A 3O38A 4QXQA 2QB5A 3CE6A 3W96D 1PJZA 1RQ7A 4E31A 4I1PA 4V0NA 5B2ID 2QRQA 2AKYA 5CLLA 1FFWA 4MRVA 4RIHA 4PGHA 3EGXA 3I6MA 1TM7E 4BNTA 4F84A 4YRMA 3VR2A 1Z4LA 3NBMA 3CH7A 1E4OA 2NXCA 2F9LA 2WU8A 5HQ3B 5I7FA 4NEGA 5CJJA 1D1SA 4NX2A 5JCOA 5IJXA 1FA9A 4HV4A 1FFAA 4H6VA 3OPYB 3V1LA 3AYWB 4JZKA 4NCHA 5I45A 2HKIA 2E3JA 4PIVA 4ZPXA 4J49A 2QJRA 2P5SA 2AN5A 2OECA 3AV0B 5A4FS 4E14A 4IIBA 4DCJA 1QVRA 1AOIC 5DNVA 2J8PA 2Y2OA 1NMEA 1JAZA 3LZCA 2FRDA 4WHMA 1YK0A 3IE2A 3SD7A 3VISA 5JZOA 4TT8A 4WGGA 3F3MA 2VK4A 3KJXA 4CQLA 1E6WA 1L4LA 1QPBA 5HMLA 4A1OA 3AEXA 4MYHA 3ANMA 1J8FA 1PL7A 1QDEA 3CF0A 5DHAA 4ZVVA 4TL7A 1TLFA 5M2QA 4RLFA 4OLBA 4ENWA 1GCIA 2VRCA 3JQ6A 2O7QA 2ZJBA 5I5EA 4YRJA 5JZMA 2PVPA 3CLTD 2PS0A 4Q3CA 1ZBDA 2Y4NA 2UYOA 2DTDA 4TMTA 5E2BA 3ZWYA 4BIIA 2FDRA 4AKGA 1T6NA 3F6BX 2NTJA 3F46A 4HYYA 4B81A 1M0WA 1Y9AA 3K0CA 1P3MA 1QHHB 4JOQA 1OVMA 1V1MA 3KSMA 1R8XA 5CK5A 3ZYZA 3NT4A 1XEWY 3ZKWB 2YJZA 7REQB 3Q9SA 3WGNA 1ICIA 2CL5A 3GL9A 3PDIB 2W6IA 4YRGA 2A59A 1ESNA 1OCEA 3FNFA 4HWRA 3PA6A 3Q8LA 2AN1A 2FSVA 3EG5B 1REQB 2TMDA 2QD1A 3D6AA 5ARBA 3GZTB 1SZCA 1V9CA 3LZ6A 4WAUA 4R41A 3D6VA 4QSHA 5B40A 1FMLA 2D3TA 1EQZA 2WJ6A 3QPBA 4Y6OA 1E1CB 2FQYA 3LHIA 3O2NA 3HJGA 4RD4A 2FP4A 3B9RA 3TL6A 5A2QA 5U9CA 2HBZA 1LWNA 4HNTA 4KQKA 3V33A 1P4GA 3NH6A 1P3KC 4O4HF 1RRKA 3LF2A 1J2RA 1RQPA 4ZCLA 3F4LA 4R16A 1ADYA