3AZNB

Crystal structure of human nucleosome core particle containing h4k91q mutation
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
78
structure length
78
Chain Sequence
NIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALQRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.1
publication title Comprehensive Structural Analysis of Mutant Nucleosomes Containing Lysine to Glutamine (KQ) Substitutions in the H3 and H4 Histone-Fold Domains
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 27
structure length 78
sequence length 78
chains with identical sequence F
ec nomenclature
pdb deposition date 2011-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3aznB00
4KGCB 2NQBA 4UUZA 5AV6A 5GT0C 3AZIA 3W97B 4J8VD 3MGSA 1P3OB 5GSUB 5BNXB 5GXQD 5F99A 3AZNA 5B33B 3RELD 1TAFB 1P3PA 3AFAD 4H9SC 5B0ZA 1S32A 3X1UD 3AV1C 2L5AA 3WTPB 4Z5TB 3R45A 5AY8C 3AV1A 4WU9C 4YM6C 2CWEA 4KGCC 4XUJD 3NQJA 5B2IC 4YM6A 3W97C 3AZJD 1P3BD 3REKB 1JFIB 3AZGC 4R8PC 5GSUC 5B2IA 4KHAB 3A6NC 1P3OC 2BYKB 5B1MB 1N1JB 3MGQB 5B33C 4J8XA 2YFWA 3AZGA 3B6FB 4R8PA 5AV5A 3V9RB 3A6NA 2F8NH 3W96D 5DNMD 1P3LB 3B6GD 4ZUXD 1HQ3A 3KWQD 1ZLAB 4Z5TC 5CHLB 5KDMB 2AROB 4CAYA 1B67A 1KX3B 2HIOB 1M19D 5AVCD 1P3GA 4X23D 4J8VB 3B0CW 3MGRB 4J8UA 3REKC 5GXQB 3AYWD 5B31G 5B1MC 3MGQC 3AFAB 3AZHD 3B6FC 5DNNB 1P3LC 1ZLAC 3AN2D 5B2JA 1P34B 2AROC 5CPKD 3AZLB 1KX3C 3KXBA 2HIOC 4XUJB 3TU4D 3C1BC 5KDMA 3AZJB 4J8VC 5E5AC 3MGRC 3C1BA 5GXQC 3MNNA 3WKJD 3AZFD 3X1TD 5BO0A 5E5AA 3W96B 3MGRA 3AFAC 5DNMB 5B40D 3B6GB 5DNNC 4ZUXB 3KWQB 2JSSA 4WNNA 1P34C 2IO5B 4Z66B 2PYOA 3LZ0D 3AZLC 5GT3D 3VH6W 3X1VA 4X23B 3AZJC 1M18D 2NQBD 5CPJA 3AYWB 1BH9A 1KX5C 2RVQD 4E45A 4J8WC 1KX5A 3UTAB 5F99D 4ZUXC 4J8WA 3AZND 3KWQC 4JJNA 3WA9A 1P3PD 1AOID 1S32D 5AV9A 4WU8B 5CPKB 2IO5C 4Z66C 3WAAB 1KU5A 3TU4B 5BS7C 2F8NK 4X23C 3MVDA 5BS7A 3AYWC 2FJ7A 3AZFB 3X1TB 1F1EA 2YFVA 5B40B 1F66B 3REJA 3UTAC 4G92C 3LELD 1H3OB 2BYMA 3UTBD 5B31B 5AV5D 3UTAA 2F8NG 3WAAC 3LZ0B 1HQ3D 4WU8C 5CPKC 5GT3B 1TZYC 3REHB 3TU4C 4YS3B 1ID3A 4E44A 1M18B 1TZYA 4H9OA 3W98D 3O62A 3AZFC 3X1TC 2NZDA 5AVBD 4J8UD 2CV5B 5CP6C 1M1AB 3AV2A 1F66C 5GT0A 5B1LC 5B31C 3C1CD 1P3MB 1AOIB 5CP6A 3LZ0C 3WTPE 1H3OA 5B1LA 3REIC 5GT3C 3REHC 4YS3C 1KX4D 3REIA 4H9SA 5AV8D 3X1SD 2F8ND 3KXBD 4DRBA 1U35D 2RVQC 3VH5A 3AZED 5AY8A 4WU9A 2CV5C 1M1AC 3MNND 4KGCA 3LELB 1P3MC 3AZKB 5B32G 3W97A 4LD9B 1P3OA 5GSUA 5BNXA 4EO5B 4H9PB 5B33A 2PYOD 3WTPC 1TAFA 3W98B 1P3ID 1HTAA 3X1VD 3WTPA 4Z5TA 4CSRB 5AVBB 5G49B 3AZMD 3MGPD 4XZQD 4KUDD 4AWLB 3C1CB 1P3KD 3AZKC 3VH6A 3RELB 3REKA 1JFIA 4LD9C 4KHAA 3X1UB 2BYKA 3AZKA 1EQZD 4EO5C 5B1MA 1N1JA 3MGQA 3NQUB 4Z2MH 1KX4B 3B6FA 2HUEB 5AV8B 3V9RA 5B32D 3X1SB 2F8NB 1U35B 1P3LA 3W98C 3UT9D 5CPID 3AZEB 1ZLAA 5B24D 5AVBC 3MVDD 2AROA 2FJ7D 1P3BB 3B0BA 4H9RB 3KUYD 1KX3A 2HIOA 1R4VA 3C1CC 4WZSB 5B0YD 4J8VA 3REJD 5BT1D 3RELC 5GXQA 4QLCD 3X1UC 1P3FD 3AFAA 2HUEC 5JRGD 5DNNA 3LJAD 1P3IB 1ID3D 3AZMB 1M19B 4XUJC 5AVCB 3LZ1D 1P34A 3W99D 1P3AD 4H9NB 3MGPB 4XZQB 3AZLA 1P3BC 5AV6D 4XUJA 2NZDD 5JA4B 3AZID 1P3KB 3AZJA 1P3BA 3MGSD 3AZHB 3W96C 5GT0D 4H9QB 5DNMC 3B6GC 1EQZB 3W96A 5B32B 3AN2B 5B0ZD 5DNMA 3B6GA 1P3IC 4ZUXA 3UT9B 5CPIB 3KWQA 5B24B 3AZMC 1M19C 5AVCC 3AV1D 4Z66A 3MGPC 4XZQC 1WWSA 1M19A 4YM6D 5B0YB 4X23A 1P3KC 3WKJB 4KGCD 3AZHC 5B2ID 4QLCB 3AYWA 1EQZC 1P3FB 3W97D 4J8XD 3AZGD 4R8PD 5B32C 3A6ND 3AN2C 1P3OD 3LJAB 3B0DB 1BH8B 3UT9C 5BNVB 3LZ1B 3W99B 4WU8A 3WAAA 5CPKA 1P3AB 2NQBB 4UUZB 3TU4A 3AZIB 1P3GD 5B0YC 3WKJC 1B6WA 3MGSB 5B40C 5F99B 3AZNB 3AZFA 3X1TA 1P3PB 5B0ZB 1S32B 5B40A 1F66A 4DRAA 1BFMA 3B0DC 5B1MD 4WV4B 3MGQD 5B31A 4M6BA 4Z2MG 5B2JD 3LZ1C 1P3LD 3LZ0A 1M18C 5GT3A 2NQBC 3B0CT 3REHA 3NQJB 4YS3A 2AROD 1M18A 1KX3D 3MGSC 2HIOD 5B2IB 3C1BD 5F99C 3AZNC 3VH5T 3UTBB 4J8XB 2YFWB 5E5AD 4NE6A 4R8PB 5AV5B 3A6NB 3MGRD 3AZGB 2CV5A 5B0ZC 1S32C 1P3PC 1M1AA 1AOIC 1HQ3B 1AOIA 1P3MA 5DNND 4CAYB 1WWIA 4NFTA 1P34D 1P3GB 3AZLD 5C3IB 5CPJD 4J8UB 3LELC 3UTBC 4J8XC 5AV5C 1KX5D 4J8WD 1Q9CA 1HQ3C 3LELA 3UTBA 4JJND 3WA9D 5B2JB 3VH6T 5AV9D 4LD9A 3KXBB 4NE3A 4H9PA 4Z66D 1P3GC 1A7WA 5C3IC 3W98A 3C1BB 4J8UC 3MNNB 5BO0B 4CSRA 5AVBA 5G49A 5E5AB 4AWLC 3C1CA 4WNNB 5B2JC 3UTAD 2PYOB 3VH5W 3RELA 1KX4C 3X1SC 5AV8C 3X1UA 3KXBC 1U35C 3X1VB 4WU8D 3WAAD 3KSYA 3NQUA 1KX4A 3AZEC 3X1SA 5AV8A 2F8NA 1TZYD 5CPJB 1U35A 1BH9B 3MNNC 4KUDB 3O62D 3AZEA 1KX5B 3AV2D 4J8WB 4H9RA 4JJNB 3WA9B 5CP6D 1F66D 5AV9B 2PYOC 5B1LD 5FUGB 5B31D 3X1VC 3REID 3MVDB 1P3IA 5CPJC 3REHD 4YS3D 2FJ7B 3KUYB 4KUDC 2YFVB 3AZMA 5AY8D 5AVCA 4WU9D 2LY8A 4H9NA 3MGPA 4XZQA 3REJB 4ZBJB 4KUDA 2BYMB 5JA4A 4JJNC 3WA9C 1P3KA 2CV5D 1M1AD 5AV9C 4G92B 3AZHA 5GSUD 5JRGB 4H9QA 1P3MD 1ID3B 1EQZA 5B33D 5CPIC 5B32A 3AN2A 1ULYA 5FUGA 1TZYB 4H9OB 5B24C 3MVDC 3UT9A 5CPIA 2FJ7C 3WTPD 4G91B 4Z5TD 3O62B 5AV6B 5B24A 3KUYC 2NZDB 4HGAB 3AV2B 3REJC 3KUYA 4ZBJC 5BT1C 5GT0B 4QLCC 5CP6B 5B0YA 3WKJA 1P3FC 3REKD 5B1LB 4QLCA 5JRGC 3LJAC 3AZKD 1ID3C 1P3FA 4LD9D 3B6FD 3R45B 3REIB 5JRGA 3LJAA 3AV1B 3W99C 1BH8A 1P3AC 5BNVA 1ZLAD 4G91C 3O62C 5AV6C 2NZDC 5AY8B 3LZ1A 3AZIC 3W99A 4WU9B 4YM6B 4HGAC 4NE5A 1P3AA 3AV2C
chains in the Genus database with same CATH superfamily
4KGCB 2NQBA 4UUZA 5AV6A 5GT0C 3AZIA 3W97B 4J8VD 3MGSA 1P3OB 5GSUB 5BNXB 5GXQD 5F99A 3AZNA 5B33B 3RELD 3EPLA 1TAFB 1P3PA 3AFAD 4H9SC 5B0ZA 1S32A 3X1UD 3AV1C 3A1IA 2L5AA 3WTPB 2FFFB 4Z5TB 3R45A 5AY8C 3AV1A 4WU9C 4YM6C 2CWEA 4KGCC 4XUJD 3FDDA 3NQJA 5B2IC 4YM6A 3W97C 3AZJD 1P3BD 3REKB 1JFIB 3AZGC 4R8PC 5GSUC 5B2IA 4KHAB 3A6NC 1P3OC 2BYKB 5B1MB 1N1JB 3H0RC 3MGQB 5B33C 2ZM5A 2YFWA 4J8XA 3AZGA 4R8PA 5AV5A 3V9RB 3A6NA 2F8NH 3B6FB 5DNMD 1P3LB 3B6GD 4ZUXD 1HQ3A 3KWQD 1ZLAB 4Z5TC 5CHLB 3H0MC 5KDMB 2AROB 4CAYA 2UWXA 1B67A 2XD5A 1KX3B 2HIOB 1M19D 5AVCD 1P3GA 4X23D 4J8VB 2F2AC 3B0CW 3MGRB 4J8UA 3REKC 5GXQB 3AYWD 5B31G 2Y2GA 5B1MC 3MGQC 3AFAB 3AZHD 3B6FC 5DNNB 1P3LC 1ZLAC 3AN2D 2Y2KA 5B2JA 1P34B 2AROC 5CPKD 3AZLB 1KX3C 3KXBA 2G5IC 2HIOC 4XUJB 3TU4D 3C1BC 5KDMA 2Y2NA 3AZJB 4J8VC 5E5AC 3MGRC 3C1BA 5GXQC 3MNNA 3WKJD 3AZFD 3X1TD 5BO0A 5E5AA 3W96B 3MGRA 3AFAC 5DNMB 5B40D 3B6GB 5DNNC 4ZUXB 3A1KA 3KWQB 2JSSA 4WNNA 1P34C 2IO5B 4Z66B 2PYOA 3LZ0D 3AZLC 5GT3D 3VH6W 3X1VA 4X23B 2ZY3A 3AZJC 1M18D 2NQBD 5CPJA 3AYWB 1BH9A 1KX5C 2RVQD 4E45A 1W2EA 4J8WC 1KX5A 3UTAB 5F99D 4ZUXC 4J8WA 3AZND 3KWQC 4JJNA 3WA9A 1P3PD 1AOID 1S32D 1T3UA 5AV9A 4WU8B 5CPKB 2IO5C 4Z66C 3WAAB 1KU5A 3TU4B 5BS7C 2F8NK 4X23C 3MVDA 5BS7A 3AYWC 2FJ7A 3AZFB 3X1TB 3EG5B 1F1EA 2YFVA 5B40B 1F66B 3REJA 3UTAC 4G92C 2Y2OA 3LELD 1H3OB 2BYMA 3UTBD 5B31B 5AV5D 3AZGB 3UTAA 2F8NG 3WAAC 3LZ0B 1HQ3D 4WU8C 5CPKC 5GT3B 1TZYC 3REHB 3TU4C 4YS3B 1ID3A 2RIQA 1Z2CB 4E44A 1M18B 1TZYA 4H9OA 3W98D 3O62A 3AZFC 3X1TC 2NZDA 5AVBD 4J8UD 2CV5B 2JE5A 5CP6C 1M1AB 3AV2A 1F66C 5GT0A 5B1LC 5B31C 3C1CD 1P3MB 1AOIB 2JCHA 5CP6A 3LZ0C 3WTPE 1H3OA 5B1LA 3REIC 5GT3C 3REHC 4YS3C 1KX4D 3REIA 4H9SA 5AV8D 3X1SD 2F8ND 3KXBD 4DRBA 1U35D 2RVQC 3VH5A 3AZED 5AY8A 4WU9A 2CV5C 1M1AC 3MNND 4KGCA 3LELB 1P3MC 3AZKB 5B32G 3W97A 4LD9B 2BG1A 1P3OA 5GSUA 5BNXA 4EO5B 4H9PB 5B33A 2PYOD 3WTPC 1TAFA 3W98B 1P3ID 2VQRA 1HTAA 3P5JB 3X1VD 3WTPA 4Z5TA 4CSRB 5AVBB 5G49B 3AZMD 3EPKA 3MGPD 4XZQD 4KUDD 4AWLB 3C1CB 1P3KD 3AZKC 3VH6A 3RELB 3REKA 1JFIA 4LD9C 4KHAA 3X1UB 2BYKA 3AZKA 1EQZD 4EO5C 5B1MA 1N1JA 3MGQA 3NQUB 4Z2MH 1KX4B 3B6FA 2HUEB 5AV8B 3V9RA 5B32D 3X1SB 2F8NB 1U35B 1P3LA 3W98C 3UT9D 3F6TA 5CPID 3AZEB 1ZLAA 5B24D 2Y2MA 5AVBC 3MVDD 2AROA 2FJ7D 1P3BB 2Y2LA 3B0BA 4H9RB 3KUYD 1KX3A 2HIOA 1R4VA 3C1CC 4WZSB 5B0YD 4J8VA 3REJD 5BT1D 3RELC 5GXQA 4QLCD 3X1UC 1P3FD 3AFAA 2HUEC 5JRGD 5DNNA 3LJAD 1P3IB 1ID3D 3AZMB 1M19B 4XUJC 5AVCB 3LZ1D 1P34A 3W99D 1P3AD 4H9NB 3MGPB 4XZQB 3AZLA 1P3BC 5AV6D 4XUJA 2NZDD 5JA4B 3AZID 1P3KB 2DQNC 3AZJA 1P3BA 3MGSD 3AZHB 3W96C 5GT0D 4H9QB 5DNMC 3B6GC 1EQZB 3W96A 5B32B 3AN2B 5B0ZD 5DNMA 3B6GA 1P3IC 4ZUXA 3UT9B 5CPIB 3KWQA 5B24B 3AZMC 1M19C 5AVCC 3AV1D 4Z66A 3MGPC 4XZQC 1WWSA 1M19A 4YM6D 5B0YB 4X23A 1P3KC 3WKJB 4KGCD 3AZHC 5B2ID 4QLCB 3AYWA 1EQZC 1P3FB 3W97D 4J8XD 3AZGD 4R8PD 5B32C 3A6ND 3AN2C 1P3OD 3LJAB 2ZY4A 3B0DB 1BH8B 3UT9C 5BNVB 4UPKA 3LZ1B 3W99B 4WU8A 3WAAA 5CPKA 1P3AB 2NQBB 4UUZB 3TU4A 3AZIB 4WJ3C 1P3GD 5B0YC 3WKJC 1B6WA 3MGSB 5B40C 5F99B 3AZNB 3AZFA 3X1TA 2W8SA 1P3PB 5B0ZB 1S32B 5B40A 1F66A 4DRAA 1BFMA 3B0DC 5B1MD 4WV4B 3MGQD 5B31A 4M6BA 4Z2MG 5B2JD 3LZ1C 1P3LD 3LZ0A 1M18C 5GT3A 2DF4C 3B0CT 3REHA 2XD1A 3NQJB 4YS3A 2NQBC 2AROD 1M18A 1KX3D 3MGSC 2HIOD 5B2IB 3C1BD 5F99C 3AZNC 3VH5T 3UTBB 4J8XB 2YFWB 3IP4C 4NE6A 5E5AD 2Y2JA 5AV5B 4R8PB 3A6NB 3MGRD 5B0ZC 2CV5A 1S32C 1P3PC 1M1AA 1AOIC 1HQ3B 1AOIA 1P3MA 5DNND 4CAYB 1WWIA 4NFTA 1P34D 1P3GB 3AZLD 5C3IB 5CPJD 4J8UB 3LELC 3UTBC 4J8XC 5AV5C 1KX5D 3EPJA 4J8WD 1Q9CA 1HQ3C 3LELA 3UTBA 4JJND 3WA9D 2ZY5A 2ZY2A 5B2JB 3VH6T 5AV9D 4LD9A 3KXBB 3AL0C 4NE3A 4H9PA 4Z66D 1P3GC 1A7WA 5C3IC 3W98A 3C1BB 4J8UC 3MNNB 5BO0B 4CSRA 5AVBA 5G49A 5E5AB 4AWLC 3C1CA 4DQYB 4WNNB 5B2JC 3UTAD 2PYOB 3VH5W 3RELA 3W96D 1KX4C 3X1SC 5AV8C 3X1UA 3KXBC 1U35C 3X1VB 4WU8D 3WAAD 3KSYA 3NQUA 1KX4A 3AZEC 3X1SA 5AV8A 2F8NA 1TZYD 5CPJB 1U35A 1BH9B 3MNNC 4KUDB 3O62D 3AZEA 1KX5B 2Y2PA 4J8WB 3AV2D 4H9RA 4JJNB 2Y2QA 3WA9B 5CP6D 1F66D 5AV9B 2PYOC 5B1LD 5FUGB 5B31D 2Y2IA 3X1VC 3REID 3MVDB 2J8PA 1P3IA 5CPJC 3REHD 4YS3D 2FJ7B 3KUYB 4KUDC 2YFVB 3AZMA 5AY8D 5AVCA 4WU9D 2LY8A 3EPHA 4H9NA 3MGPA 4XZQA 3REJB 4ZBJB 4KUDA 2BYMB 5JA4A 4JJNC 3WA9C 1P3KA 2CV5D 1M1AD 5AV9C 4G92B 3AZHA 5GSUD 5JRGB 4H9QA 1P3MD 1ID3B 1EQZA 3H0LC 5B33D 5CPIC 5B32A 3AN2A 1ULYA 5FUGA 1TZYB 4H9OB 5B24C 3MVDC 3UT9A 5CPIA 2FJ7C 3WTPD 4G91B 4Z5TD 3O62B 5AV6B 5B24A 3KUYC 2NZDB 4HGAB 3AV2B 3KFUG 3REJC 3KUYA 4ZBJC 5BT1C 5GT0B 4QLCC 5CP6B 5B0YA 3WKJA 1P3FC 3REKD 5B1LB 4QLCA 5JRGC 3LJAC 3AZKD 1ID3C 1P3FA 2Y2HA 4LD9D 3B6FD 3R45B 3REIB 5JRGA 3LJAA 3AV1B 3W99C 1BH8A 1P3AC 5BNVA 1ZLAD 4G91C 3O62C 5AV6C 2NZDC 2G5HC 5AY8B 3LZ1A 3AZIC 4WU9B 4YM6B 3W99A 4HGAC 4NE5A 1P3AA 1PZRA 3AV2C
chains in the Genus database with same CATH topology
4KGCB 2NQBA 4UUZA 5AV6A 5GT0C 3AZIA 3W97B 4J8VD 3MGSA 1P3OB 5GSUB 5BNXB 5GXQD 5F99A 3AZNA 5B33B 3RELD 3EPLA 1TAFB 1P3PA 3AFAD 4H9SC 5B0ZA 1S32A 3X1UD 3AV1C 3A1IA 2L5AA 3WTPB 2FFFB 4Z5TB 3R45A 5AY8C 3AV1A 4WU9C 4YM6C 2CWEA 4KGCC 4XUJD 3FDDA 3NQJA 5B2IC 4YM6A 3W97C 3AZJD 1P3BD 3REKB 1JFIB 3AZGC 4R8PC 5GSUC 5B2IA 4KHAB 3A6NC 1P3OC 2BYKB 5B1MB 1N1JB 3H0RC 3MGQB 5B33C 2ZM5A 2YFWA 4J8XA 3AZGA 4R8PA 5AV5A 3V9RB 3A6NA 2F8NH 3B6FB 5DNMD 1P3LB 3B6GD 4ZUXD 1HQ3A 3KWQD 1ZLAB 4Z5TC 5CHLB 3H0MC 5KDMB 2AROB 4CAYA 2UWXA 1B67A 2XD5A 1KX3B 2HIOB 1M19D 5AVCD 1P3GA 4X23D 4J8VB 2F2AC 3B0CW 3MGRB 4J8UA 3REKC 5GXQB 3AYWD 5B31G 2Y2GA 5B1MC 3MGQC 3AFAB 3AZHD 3B6FC 5DNNB 1P3LC 1ZLAC 3AN2D 2Y2KA 5B2JA 1P34B 2AROC 5CPKD 3AZLB 1KX3C 3KXBA 2G5IC 2HIOC 4XUJB 3TU4D 3C1BC 5KDMA 2Y2NA 3AZJB 4J8VC 5E5AC 3MGRC 3C1BA 5GXQC 3MNNA 3WKJD 3AZFD 3X1TD 5BO0A 5E5AA 3W96B 3MGRA 3AFAC 5DNMB 5B40D 3B6GB 5DNNC 4ZUXB 3A1KA 3KWQB 2JSSA 4WNNA 1P34C 2IO5B 4Z66B 2PYOA 3LZ0D 3AZLC 5GT3D 3VH6W 3X1VA 4X23B 2ZY3A 3AZJC 1M18D 2NQBD 5CPJA 3AYWB 1BH9A 1KX5C 2RVQD 4E45A 1W2EA 4J8WC 1KX5A 3UTAB 5F99D 4ZUXC 4J8WA 3AZND 3KWQC 4JJNA 3WA9A 1P3PD 1AOID 1S32D 1T3UA 5AV9A 4WU8B 5CPKB 2IO5C 4Z66C 3WAAB 1KU5A 3TU4B 5BS7C 2F8NK 4X23C 3MVDA 5BS7A 3AYWC 2FJ7A 3AZFB 3X1TB 3EG5B 1F1EA 2YFVA 5B40B 1F66B 3REJA 3UTAC 4G92C 2Y2OA 3LELD 1H3OB 2BYMA 3UTBD 5B31B 5AV5D 3AZGB 3UTAA 2F8NG 3WAAC 3LZ0B 1HQ3D 4WU8C 5CPKC 5GT3B 1TZYC 3REHB 3TU4C 4YS3B 1ID3A 2RIQA 1Z2CB 4E44A 1M18B 1TZYA 4H9OA 3W98D 3O62A 3AZFC 3X1TC 2NZDA 5AVBD 4J8UD 2CV5B 2JE5A 5CP6C 1M1AB 3AV2A 1F66C 5GT0A 5B1LC 5B31C 3C1CD 1P3MB 1AOIB 2JCHA 5CP6A 3LZ0C 3WTPE 1H3OA 5B1LA 3REIC 5GT3C 3REHC 4YS3C 1KX4D 3REIA 4H9SA 5AV8D 3X1SD 2F8ND 3KXBD 4DRBA 1U35D 2RVQC 3VH5A 3AZED 5AY8A 4WU9A 2CV5C 1M1AC 3MNND 4KGCA 3LELB 1P3MC 3AZKB 5B32G 3W97A 4LD9B 2BG1A 1P3OA 5GSUA 5BNXA 4EO5B 4H9PB 5B33A 2PYOD 3WTPC 1TAFA 3W98B 1P3ID 2VQRA 1HTAA 3P5JB 3X1VD 3WTPA 4Z5TA 4CSRB 5AVBB 5G49B 3AZMD 3EPKA 3MGPD 4XZQD 4KUDD 4AWLB 3C1CB 1P3KD 3AZKC 3VH6A 3RELB 3REKA 1JFIA 4LD9C 4KHAA 3X1UB 2BYKA 3AZKA 1EQZD 4EO5C 5B1MA 1N1JA 3MGQA 3NQUB 4Z2MH 1KX4B 3B6FA 2HUEB 5AV8B 3V9RA 5B32D 3X1SB 2F8NB 1U35B 1P3LA 3W98C 3UT9D 3F6TA 5CPID 3AZEB 1ZLAA 5B24D 2Y2MA 5AVBC 3MVDD 2AROA 2FJ7D 1P3BB 2Y2LA 3B0BA 4H9RB 3KUYD 1KX3A 2HIOA 1R4VA 3C1CC 4WZSB 5B0YD 4J8VA 3REJD 5BT1D 3RELC 5GXQA 4QLCD 3X1UC 1P3FD 3AFAA 2HUEC 5JRGD 5DNNA 3LJAD 1P3IB 1ID3D 3AZMB 1M19B 4XUJC 5AVCB 3LZ1D 1P34A 3W99D 1P3AD 4H9NB 3MGPB 4XZQB 3AZLA 1P3BC 5AV6D 4XUJA 2NZDD 5JA4B 3AZID 1P3KB 2DQNC 3AZJA 1P3BA 3MGSD 3AZHB 3W96C 5GT0D 4H9QB 5DNMC 3B6GC 1EQZB 3W96A 5B32B 3AN2B 5B0ZD 5DNMA 3B6GA 1P3IC 4ZUXA 3UT9B 5CPIB 3KWQA 5B24B 3AZMC 1M19C 5AVCC 3AV1D 4Z66A 3MGPC 4XZQC 1WWSA 1M19A 4YM6D 5B0YB 4X23A 1P3KC 3WKJB 4KGCD 3AZHC 5B2ID 4QLCB 3AYWA 1EQZC 1P3FB 3W97D 4J8XD 3AZGD 4R8PD 5B32C 3A6ND 3AN2C 1P3OD 3LJAB 2ZY4A 3B0DB 1BH8B 3UT9C 5BNVB 4UPKA 3LZ1B 3W99B 4WU8A 3WAAA 5CPKA 1P3AB 2NQBB 4UUZB 3TU4A 3AZIB 4WJ3C 1P3GD 5B0YC 3WKJC 1B6WA 3MGSB 5B40C 5F99B 3AZNB 3AZFA 3X1TA 2W8SA 1P3PB 5B0ZB 1S32B 5B40A 1F66A 4DRAA 1BFMA 3B0DC 5B1MD 4WV4B 3MGQD 5B31A 4M6BA 4Z2MG 5B2JD 3LZ1C 1P3LD 3LZ0A 1M18C 5GT3A 2DF4C 3B0CT 3REHA 2XD1A 3NQJB 4YS3A 2NQBC 2AROD 1M18A 1KX3D 3MGSC 2HIOD 5B2IB 3C1BD 5F99C 3AZNC 3VH5T 3UTBB 4J8XB 2YFWB 3IP4C 4NE6A 5E5AD 2Y2JA 5AV5B 4R8PB 3A6NB 3MGRD 5B0ZC 2CV5A 1S32C 1P3PC 1M1AA 1AOIC 1HQ3B 1AOIA 1P3MA 5DNND 4CAYB 1WWIA 4NFTA 1P34D 1P3GB 3AZLD 5C3IB 5CPJD 4J8UB 3LELC 3UTBC 4J8XC 5AV5C 1KX5D 3EPJA 4J8WD 1Q9CA 1HQ3C 3LELA 3UTBA 4JJND 3WA9D 2ZY5A 2ZY2A 5B2JB 3VH6T 5AV9D 4LD9A 3KXBB 3AL0C 4NE3A 4H9PA 4Z66D 1P3GC 1A7WA 5C3IC 3W98A 3C1BB 4J8UC 3MNNB 5BO0B 4CSRA 5AVBA 5G49A 5E5AB 4AWLC 3C1CA 4DQYB 4WNNB 5B2JC 3UTAD 2PYOB 3VH5W 3RELA 3W96D 1KX4C 3X1SC 5AV8C 3X1UA 3KXBC 1U35C 3X1VB 4WU8D 3WAAD 3KSYA 3NQUA 1KX4A 3AZEC 3X1SA 5AV8A 2F8NA 1TZYD 5CPJB 1U35A 1BH9B 3MNNC 4KUDB 3O62D 3AZEA 1KX5B 2Y2PA 4J8WB 3AV2D 4H9RA 4JJNB 2Y2QA 3WA9B 5CP6D 1F66D 5AV9B 2PYOC 5B1LD 5FUGB 5B31D 2Y2IA 3X1VC 3REID 3MVDB 2J8PA 1P3IA 5CPJC 3REHD 4YS3D 2FJ7B 3KUYB 4KUDC 2YFVB 3AZMA 5AY8D 5AVCA 4WU9D 2LY8A 3EPHA 4H9NA 3MGPA 4XZQA 3REJB 4ZBJB 4KUDA 2BYMB 5JA4A 4JJNC 3WA9C 1P3KA 2CV5D 1M1AD 5AV9C 4G92B 3AZHA 5GSUD 5JRGB 4H9QA 1P3MD 1ID3B 1EQZA 3H0LC 5B33D 5CPIC 5B32A 3AN2A 1ULYA 5FUGA 1TZYB 4H9OB 5B24C 3MVDC 3UT9A 5CPIA 2FJ7C 3WTPD 4G91B 4Z5TD 3O62B 5AV6B 5B24A 3KUYC 2NZDB 4HGAB 3AV2B 3KFUG 3REJC 3KUYA 4ZBJC 5BT1C 5GT0B 4QLCC 5CP6B 5B0YA 3WKJA 1P3FC 3REKD 5B1LB 4QLCA 5JRGC 3LJAC 3AZKD 1ID3C 1P3FA 2Y2HA 4LD9D 3B6FD 3R45B 3REIB 5JRGA 3LJAA 3AV1B 3W99C 1BH8A 1P3AC 5BNVA 1ZLAD 4G91C 3O62C 5AV6C 2NZDC 2G5HC 5AY8B 3LZ1A 3AZIC 4WU9B 4YM6B 3W99A 4HGAC 4NE5A 1P3AA 1PZRA 3AV2C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KGC B;  2NQB A;  4UUZ A;  5AV6 A;  5GT0 C;  3AZI A;  3W97 B;  4J8V D;  3MGS A;  1P3O B;  5GSU B;  5BNX B;  5GXQ D;  5F99 A;  3AZN A;  5B33 B;  3REL D;  1TAF B;  1P3P A;  3AFA D;  4H9S C;  5B0Z A;  1S32 A;  3X1U D;  3AV1 C;  2L5A A;  3WTP B;  4Z5T B;  3R45 A;  5AY8 C;  3AV1 A;  4WU9 C;  4YM6 C;  2CWE A;  4KGC C;  4XUJ D;  3NQJ A;  5B2I C;  4YM6 A;  3W97 C;  3AZJ D;  1P3B D;  3REK B;  1JFI B;  3AZG C;  4R8P C;  5GSU C;  5B2I A;  4KHA B;  3A6N C;  1P3O C;  2BYK B;  5B1M B;  1N1J B;  3MGQ B;  5B33 C;  4J8X A;  2YFW A;  3AZG A;  3B6F B;  4R8P A;  5AV5 A;  3V9R B;  3A6N A;  2F8N H;  3W96 D;  5DNM D;  1P3L B;  3B6G D;  4ZUX D;  1HQ3 A;  3KWQ D;  1ZLA B;  4Z5T C;  5CHL B;  5KDM B;  2ARO B;  4CAY A;  1B67 A;  1KX3 B;  2HIO B;  1M19 D;  5AVC D;  1P3G A;  4X23 D;  4J8V B;  3B0C W;  3MGR B;  4J8U A;  3REK C;  5GXQ B;  3AYW D;  5B31 G;  5B1M C;  3MGQ C;  3AFA B;  3AZH D;  3B6F C;  5DNN B;  1P3L C;  1ZLA C;  3AN2 D;  5B2J A;  1P34 B;  2ARO C;  5CPK D;  3AZL B;  1KX3 C;  3KXB A;  2HIO C;  4XUJ B;  3TU4 D;  3C1B C;  5KDM A;  3AZJ B;  4J8V C;  5E5A C;  3MGR C;  3C1B A;  5GXQ C;  3MNN A;  3WKJ D;  3AZF D;  3X1T D;  5BO0 A;  5E5A A;  3W96 B;  3MGR A;  3AFA C;  5DNM B;  5B40 D;  3B6G B;  5DNN C;  4ZUX B;  3KWQ B;  2JSS A;  4WNN A;  1P34 C;  2IO5 B;  4Z66 B;  2PYO A;  3LZ0 D;  3AZL C;  5GT3 D;  3VH6 W;  3X1V A;  4X23 B;  3AZJ C;  1M18 D;  2NQB D;  5CPJ A;  3AYW B;  1BH9 A;  1KX5 C;  2RVQ D;  4E45 A;  4J8W C;  1KX5 A;  3UTA B;  5F99 D;  4ZUX C;  4J8W A;  3AZN D;  3KWQ C;  4JJN A;  3WA9 A;  1P3P D;  1AOI D;  1S32 D;  5AV9 A;  4WU8 B;  5CPK B;  2IO5 C;  4Z66 C;  3WAA B;  1KU5 A;  3TU4 B;  5BS7 C;  2F8N K;  4X23 C;  3MVD A;  5BS7 A;  3AYW C;  2FJ7 A;  3AZF B;  3X1T B;  1F1E A;  2YFV A;  5B40 B;  1F66 B;  3REJ A;  3UTA C;  4G92 C;  3LEL D;  1H3O B;  2BYM A;  3UTB D;  5B31 B;  5AV5 D;  3UTA A;  2F8N G;  3WAA C;  3LZ0 B;  1HQ3 D;  4WU8 C;  5CPK C;  5GT3 B;  1TZY C;  3REH B;  3TU4 C;  4YS3 B;  1ID3 A;  4E44 A;  1M18 B;  1TZY A;  4H9O A;  3W98 D;  3O62 A;  3AZF C;  3X1T C;  2NZD A;  5AVB D;  4J8U D;  2CV5 B;  5CP6 C;  1M1A B;  3AV2 A;  1F66 C;  5GT0 A;  5B1L C;  5B31 C;  3C1C D;  1P3M B;  1AOI B;  5CP6 A;  3LZ0 C;  3WTP E;  1H3O A;  5B1L A;  3REI C;  5GT3 C;  3REH C;  4YS3 C;  1KX4 D;  3REI A;  4H9S A;  5AV8 D;  3X1S D;  2F8N D;  3KXB D;  4DRB A;  1U35 D;  2RVQ C;  3VH5 A;  3AZE D;  5AY8 A;  4WU9 A;  2CV5 C;  1M1A C;  3MNN D;  4KGC A;  3LEL B;  1P3M C;  3AZK B;  5B32 G;  3W97 A;  4LD9 B;  1P3O A;  5GSU A;  5BNX A;  4EO5 B;  4H9P B;  5B33 A;  2PYO D;  3WTP C;  1TAF A;  3W98 B;  1P3I D;  1HTA A;  3X1V D;  3WTP A;  4Z5T A;  4CSR B;  5AVB B;  5G49 B;  3AZM D;  3MGP D;  4XZQ D;  4KUD D;  4AWL B;  3C1C B;  1P3K D;  3AZK C;  3VH6 A;  3REL B;  3REK A;  1JFI A;  4LD9 C;  4KHA A;  3X1U B;  2BYK A;  3AZK A;  1EQZ D;  4EO5 C;  5B1M A;  1N1J A;  3MGQ A;  3NQU B;  4Z2M H;  1KX4 B;  3B6F A;  2HUE B;  5AV8 B;  3V9R A;  5B32 D;  3X1S B;  2F8N B;  1U35 B;  1P3L A;  3W98 C;  3UT9 D;  5CPI D;  3AZE B;  1ZLA A;  5B24 D;  5AVB C;  3MVD D;  2ARO A;  2FJ7 D;  1P3B B;  3B0B A;  4H9R B;  3KUY D;  1KX3 A;  2HIO A;  1R4V A;  3C1C C;  4WZS B;  5B0Y D;  4J8V A;  3REJ D;  5BT1 D;  3REL C;  5GXQ A;  4QLC D;  3X1U C;  1P3F D;  3AFA A;  2HUE C;  5JRG D;  5DNN A;  3LJA D;  1P3I B;  1ID3 D;  3AZM B;  1M19 B;  4XUJ C;  5AVC B;  3LZ1 D;  1P34 A;  3W99 D;  1P3A D;  4H9N B;  3MGP B;  4XZQ B;  3AZL A;  1P3B C;  5AV6 D;  4XUJ A;  2NZD D;  5JA4 B;  3AZI D;  1P3K B;  3AZJ A;  1P3B A;  3MGS D;  3AZH B;  3W96 C;  5GT0 D;  4H9Q B;  5DNM C;  3B6G C;  1EQZ B;  3W96 A;  5B32 B;  3AN2 B;  5B0Z D;  5DNM A;  3B6G A;  1P3I C;  4ZUX A;  3UT9 B;  5CPI B;  3KWQ A;  5B24 B;  3AZM C;  1M19 C;  5AVC C;  3AV1 D;  4Z66 A;  3MGP C;  4XZQ C;  1WWS A;  1M19 A;  4YM6 D;  5B0Y B;  4X23 A;  1P3K C;  3WKJ B;  4KGC D;  3AZH C;  5B2I D;  4QLC B;  3AYW A;  1EQZ C;  1P3F B;  3W97 D;  4J8X D;  3AZG D;  4R8P D;  5B32 C;  3A6N D;  3AN2 C;  1P3O D;  3LJA B;  3B0D B;  1BH8 B;  3UT9 C;  5BNV B;  3LZ1 B;  3W99 B;  4WU8 A;  3WAA A;  5CPK A;  1P3A B;  2NQB B;  4UUZ B;  3TU4 A;  3AZI B;  1P3G D;  5B0Y C;  3WKJ C;  1B6W A;  3MGS B;  5B40 C;  5F99 B;  3AZN B;  3AZF A;  3X1T A;  1P3P B;  5B0Z B;  1S32 B;  5B40 A;  1F66 A;  4DRA A;  1BFM A;  3B0D C;  5B1M D;  4WV4 B;  3MGQ D;  5B31 A;  4M6B A;  4Z2M G;  5B2J D;  3LZ1 C;  1P3L D;  3LZ0 A;  1M18 C;  5GT3 A;  2NQB C;  3B0C T;  3REH A;  3NQJ B;  4YS3 A;  2ARO D;  1M18 A;  1KX3 D;  3MGS C;  2HIO D;  5B2I B;  3C1B D;  5F99 C;  3AZN C;  3VH5 T;  3UTB B;  4J8X B;  2YFW B;  5E5A D;  4NE6 A;  4R8P B;  5AV5 B;  3A6N B;  3MGR D;  3AZG B;  2CV5 A;  5B0Z C;  1S32 C;  1P3P C;  1M1A A;  1AOI C;  1HQ3 B;  1AOI A;  1P3M A;  5DNN D;  4CAY B;  1WWI A;  4NFT A;  1P34 D;  1P3G B;  3AZL D;  5C3I B;  5CPJ D;  4J8U B;  3LEL C;  3UTB C;  4J8X C;  5AV5 C;  1KX5 D;  4J8W D;  1Q9C A;  1HQ3 C;  3LEL A;  3UTB A;  4JJN D;  3WA9 D;  5B2J B;  3VH6 T;  5AV9 D;  4LD9 A;  3KXB B;  4NE3 A;  4H9P A;  4Z66 D;  1P3G C;  1A7W A;  5C3I C;  3W98 A;  3C1B B;  4J8U C;  3MNN B;  5BO0 B;  4CSR A;  5AVB A;  5G49 A;  5E5A B;  4AWL C;  3C1C A;  4WNN B;  5B2J C;  3UTA D;  2PYO B;  3VH5 W;  3REL A;  1KX4 C;  3X1S C;  5AV8 C;  3X1U A;  3KXB C;  1U35 C;  3X1V B;  4WU8 D;  3WAA D;  3KSY A;  3NQU A;  1KX4 A;  3AZE C;  3X1S A;  5AV8 A;  2F8N A;  1TZY D;  5CPJ B;  1U35 A;  1BH9 B;  3MNN C;  4KUD B;  3O62 D;  3AZE A;  1KX5 B;  3AV2 D;  4J8W B;  4H9R A;  4JJN B;  3WA9 B;  5CP6 D;  1F66 D;  5AV9 B;  2PYO C;  5B1L D;  5FUG B;  5B31 D;  3X1V C;  3REI D;  3MVD B;  1P3I A;  5CPJ C;  3REH D;  4YS3 D;  2FJ7 B;  3KUY B;  4KUD C;  2YFV B;  3AZM A;  5AY8 D;  5AVC A;  4WU9 D;  2LY8 A;  4H9N A;  3MGP A;  4XZQ A;  3REJ B;  4ZBJ B;  4KUD A;  2BYM B;  5JA4 A;  4JJN C;  3WA9 C;  1P3K A;  2CV5 D;  1M1A D;  5AV9 C;  4G92 B;  3AZH A;  5GSU D;  5JRG B;  4H9Q A;  1P3M D;  1ID3 B;  1EQZ A;  5B33 D;  5CPI C;  5B32 A;  3AN2 A;  1ULY A;  5FUG A;  1TZY B;  4H9O B;  5B24 C;  3MVD C;  3UT9 A;  5CPI A;  2FJ7 C;  3WTP D;  4G91 B;  4Z5T D;  3O62 B;  5AV6 B;  5B24 A;  3KUY C;  2NZD B;  4HGA B;  3AV2 B;  3REJ C;  3KUY A;  4ZBJ C;  5BT1 C;  5GT0 B;  4QLC C;  5CP6 B;  5B0Y A;  3WKJ A;  1P3F C;  3REK D;  5B1L B;  4QLC A;  5JRG C;  3LJA C;  3AZK D;  1ID3 C;  1P3F A;  4LD9 D;  3B6F D;  3R45 B;  3REI B;  5JRG A;  3LJA A;  3AV1 B;  3W99 C;  1BH8 A;  1P3A C;  5BNV A;  1ZLA D;  4G91 C;  3O62 C;  5AV6 C;  2NZD C;  5AY8 B;  3LZ1 A;  3AZI C;  3W99 A;  4WU9 B;  4YM6 B;  4HGA C;  4NE5 A;  1P3A A;  3AV2 C; 
#chains in the Genus database with same CATH topology
 4KGC B;  2NQB A;  4UUZ A;  5AV6 A;  5GT0 C;  3AZI A;  3W97 B;  4J8V D;  3MGS A;  1P3O B;  5GSU B;  5BNX B;  5GXQ D;  5F99 A;  3AZN A;  5B33 B;  3REL D;  3EPL A;  1TAF B;  1P3P A;  3AFA D;  4H9S C;  5B0Z A;  1S32 A;  3X1U D;  3AV1 C;  3A1I A;  2L5A A;  3WTP B;  2FFF B;  4Z5T B;  3R45 A;  5AY8 C;  3AV1 A;  4WU9 C;  4YM6 C;  2CWE A;  4KGC C;  4XUJ D;  3FDD A;  3NQJ A;  5B2I C;  4YM6 A;  3W97 C;  3AZJ D;  1P3B D;  3REK B;  1JFI B;  3AZG C;  4R8P C;  5GSU C;  5B2I A;  4KHA B;  3A6N C;  1P3O C;  2BYK B;  5B1M B;  1N1J B;  3H0R C;  3MGQ B;  5B33 C;  2ZM5 A;  2YFW A;  4J8X A;  3AZG A;  4R8P A;  5AV5 A;  3V9R B;  3A6N A;  2F8N H;  3B6F B;  5DNM D;  1P3L B;  3B6G D;  4ZUX D;  1HQ3 A;  3KWQ D;  1ZLA B;  4Z5T C;  5CHL B;  3H0M C;  5KDM B;  2ARO B;  4CAY A;  2UWX A;  1B67 A;  2XD5 A;  1KX3 B;  2HIO B;  1M19 D;  5AVC D;  1P3G A;  4X23 D;  4J8V B;  2F2A C;  3B0C W;  3MGR B;  4J8U A;  3REK C;  5GXQ B;  3AYW D;  5B31 G;  2Y2G A;  5B1M C;  3MGQ C;  3AFA B;  3AZH D;  3B6F C;  5DNN B;  1P3L C;  1ZLA C;  3AN2 D;  2Y2K A;  5B2J A;  1P34 B;  2ARO C;  5CPK D;  3AZL B;  1KX3 C;  3KXB A;  2G5I C;  2HIO C;  4XUJ B;  3TU4 D;  3C1B C;  5KDM A;  2Y2N A;  3AZJ B;  4J8V C;  5E5A C;  3MGR C;  3C1B A;  5GXQ C;  3MNN A;  3WKJ D;  3AZF D;  3X1T D;  5BO0 A;  5E5A A;  3W96 B;  3MGR A;  3AFA C;  5DNM B;  5B40 D;  3B6G B;  5DNN C;  4ZUX B;  3A1K A;  3KWQ B;  2JSS A;  4WNN A;  1P34 C;  2IO5 B;  4Z66 B;  2PYO A;  3LZ0 D;  3AZL C;  5GT3 D;  3VH6 W;  3X1V A;  4X23 B;  2ZY3 A;  3AZJ C;  1M18 D;  2NQB D;  5CPJ A;  3AYW B;  1BH9 A;  1KX5 C;  2RVQ D;  4E45 A;  1W2E A;  4J8W C;  1KX5 A;  3UTA B;  5F99 D;  4ZUX C;  4J8W A;  3AZN D;  3KWQ C;  4JJN A;  3WA9 A;  1P3P D;  1AOI D;  1S32 D;  1T3U A;  5AV9 A;  4WU8 B;  5CPK B;  2IO5 C;  4Z66 C;  3WAA B;  1KU5 A;  3TU4 B;  5BS7 C;  2F8N K;  4X23 C;  3MVD A;  5BS7 A;  3AYW C;  2FJ7 A;  3AZF B;  3X1T B;  3EG5 B;  1F1E A;  2YFV A;  5B40 B;  1F66 B;  3REJ A;  3UTA C;  4G92 C;  2Y2O A;  3LEL D;  1H3O B;  2BYM A;  3UTB D;  5B31 B;  5AV5 D;  3AZG B;  3UTA A;  2F8N G;  3WAA C;  3LZ0 B;  1HQ3 D;  4WU8 C;  5CPK C;  5GT3 B;  1TZY C;  3REH B;  3TU4 C;  4YS3 B;  1ID3 A;  2RIQ A;  1Z2C B;  4E44 A;  1M18 B;  1TZY A;  4H9O A;  3W98 D;  3O62 A;  3AZF C;  3X1T C;  2NZD A;  5AVB D;  4J8U D;  2CV5 B;  2JE5 A;  5CP6 C;  1M1A B;  3AV2 A;  1F66 C;  5GT0 A;  5B1L C;  5B31 C;  3C1C D;  1P3M B;  1AOI B;  2JCH A;  5CP6 A;  3LZ0 C;  3WTP E;  1H3O A;  5B1L A;  3REI C;  5GT3 C;  3REH C;  4YS3 C;  1KX4 D;  3REI A;  4H9S A;  5AV8 D;  3X1S D;  2F8N D;  3KXB D;  4DRB A;  1U35 D;  2RVQ C;  3VH5 A;  3AZE D;  5AY8 A;  4WU9 A;  2CV5 C;  1M1A C;  3MNN D;  4KGC A;  3LEL B;  1P3M C;  3AZK B;  5B32 G;  3W97 A;  4LD9 B;  2BG1 A;  1P3O A;  5GSU A;  5BNX A;  4EO5 B;  4H9P B;  5B33 A;  2PYO D;  3WTP C;  1TAF A;  3W98 B;  1P3I D;  2VQR A;  1HTA A;  3P5J B;  3X1V D;  3WTP A;  4Z5T A;  4CSR B;  5AVB B;  5G49 B;  3AZM D;  3EPK A;  3MGP D;  4XZQ D;  4KUD D;  4AWL B;  3C1C B;  1P3K D;  3AZK C;  3VH6 A;  3REL B;  3REK A;  1JFI A;  4LD9 C;  4KHA A;  3X1U B;  2BYK A;  3AZK A;  1EQZ D;  4EO5 C;  5B1M A;  1N1J A;  3MGQ A;  3NQU B;  4Z2M H;  1KX4 B;  3B6F A;  2HUE B;  5AV8 B;  3V9R A;  5B32 D;  3X1S B;  2F8N B;  1U35 B;  1P3L A;  3W98 C;  3UT9 D;  3F6T A;  5CPI D;  3AZE B;  1ZLA A;  5B24 D;  2Y2M A;  5AVB C;  3MVD D;  2ARO A;  2FJ7 D;  1P3B B;  2Y2L A;  3B0B A;  4H9R B;  3KUY D;  1KX3 A;  2HIO A;  1R4V A;  3C1C C;  4WZS B;  5B0Y D;  4J8V A;  3REJ D;  5BT1 D;  3REL C;  5GXQ A;  4QLC D;  3X1U C;  1P3F D;  3AFA A;  2HUE C;  5JRG D;  5DNN A;  3LJA D;  1P3I B;  1ID3 D;  3AZM B;  1M19 B;  4XUJ C;  5AVC B;  3LZ1 D;  1P34 A;  3W99 D;  1P3A D;  4H9N B;  3MGP B;  4XZQ B;  3AZL A;  1P3B C;  5AV6 D;  4XUJ A;  2NZD D;  5JA4 B;  3AZI D;  1P3K B;  2DQN C;  3AZJ A;  1P3B A;  3MGS D;  3AZH B;  3W96 C;  5GT0 D;  4H9Q B;  5DNM C;  3B6G C;  1EQZ B;  3W96 A;  5B32 B;  3AN2 B;  5B0Z D;  5DNM A;  3B6G A;  1P3I C;  4ZUX A;  3UT9 B;  5CPI B;  3KWQ A;  5B24 B;  3AZM C;  1M19 C;  5AVC C;  3AV1 D;  4Z66 A;  3MGP C;  4XZQ C;  1WWS A;  1M19 A;  4YM6 D;  5B0Y B;  4X23 A;  1P3K C;  3WKJ B;  4KGC D;  3AZH C;  5B2I D;  4QLC B;  3AYW A;  1EQZ C;  1P3F B;  3W97 D;  4J8X D;  3AZG D;  4R8P D;  5B32 C;  3A6N D;  3AN2 C;  1P3O D;  3LJA B;  2ZY4 A;  3B0D B;  1BH8 B;  3UT9 C;  5BNV B;  4UPK A;  3LZ1 B;  3W99 B;  4WU8 A;  3WAA A;  5CPK A;  1P3A B;  2NQB B;  4UUZ B;  3TU4 A;  3AZI B;  4WJ3 C;  1P3G D;  5B0Y C;  3WKJ C;  1B6W A;  3MGS B;  5B40 C;  5F99 B;  3AZN B;  3AZF A;  3X1T A;  2W8S A;  1P3P B;  5B0Z B;  1S32 B;  5B40 A;  1F66 A;  4DRA A;  1BFM A;  3B0D C;  5B1M D;  4WV4 B;  3MGQ D;  5B31 A;  4M6B A;  4Z2M G;  5B2J D;  3LZ1 C;  1P3L D;  3LZ0 A;  1M18 C;  5GT3 A;  2DF4 C;  3B0C T;  3REH A;  2XD1 A;  3NQJ B;  4YS3 A;  2NQB C;  2ARO D;  1M18 A;  1KX3 D;  3MGS C;  2HIO D;  5B2I B;  3C1B D;  5F99 C;  3AZN C;  3VH5 T;  3UTB B;  4J8X B;  2YFW B;  3IP4 C;  4NE6 A;  5E5A D;  2Y2J A;  5AV5 B;  4R8P B;  3A6N B;  3MGR D;  5B0Z C;  2CV5 A;  1S32 C;  1P3P C;  1M1A A;  1AOI C;  1HQ3 B;  1AOI A;  1P3M A;  5DNN D;  4CAY B;  1WWI A;  4NFT A;  1P34 D;  1P3G B;  3AZL D;  5C3I B;  5CPJ D;  4J8U B;  3LEL C;  3UTB C;  4J8X C;  5AV5 C;  1KX5 D;  3EPJ A;  4J8W D;  1Q9C A;  1HQ3 C;  3LEL A;  3UTB A;  4JJN D;  3WA9 D;  2ZY5 A;  2ZY2 A;  5B2J B;  3VH6 T;  5AV9 D;  4LD9 A;  3KXB B;  3AL0 C;  4NE3 A;  4H9P A;  4Z66 D;  1P3G C;  1A7W A;  5C3I C;  3W98 A;  3C1B B;  4J8U C;  3MNN B;  5BO0 B;  4CSR A;  5AVB A;  5G49 A;  5E5A B;  4AWL C;  3C1C A;  4DQY B;  4WNN B;  5B2J C;  3UTA D;  2PYO B;  3VH5 W;  3REL A;  3W96 D;  1KX4 C;  3X1S C;  5AV8 C;  3X1U A;  3KXB C;  1U35 C;  3X1V B;  4WU8 D;  3WAA D;  3KSY A;  3NQU A;  1KX4 A;  3AZE C;  3X1S A;  5AV8 A;  2F8N A;  1TZY D;  5CPJ B;  1U35 A;  1BH9 B;  3MNN C;  4KUD B;  3O62 D;  3AZE A;  1KX5 B;  2Y2P A;  4J8W B;  3AV2 D;  4H9R A;  4JJN B;  2Y2Q A;  3WA9 B;  5CP6 D;  1F66 D;  5AV9 B;  2PYO C;  5B1L D;  5FUG B;  5B31 D;  2Y2I A;  3X1V C;  3REI D;  3MVD B;  2J8P A;  1P3I A;  5CPJ C;  3REH D;  4YS3 D;  2FJ7 B;  3KUY B;  4KUD C;  2YFV B;  3AZM A;  5AY8 D;  5AVC A;  4WU9 D;  2LY8 A;  3EPH A;  4H9N A;  3MGP A;  4XZQ A;  3REJ B;  4ZBJ B;  4KUD A;  2BYM B;  5JA4 A;  4JJN C;  3WA9 C;  1P3K A;  2CV5 D;  1M1A D;  5AV9 C;  4G92 B;  3AZH A;  5GSU D;  5JRG B;  4H9Q A;  1P3M D;  1ID3 B;  1EQZ A;  3H0L C;  5B33 D;  5CPI C;  5B32 A;  3AN2 A;  1ULY A;  5FUG A;  1TZY B;  4H9O B;  5B24 C;  3MVD C;  3UT9 A;  5CPI A;  2FJ7 C;  3WTP D;  4G91 B;  4Z5T D;  3O62 B;  5AV6 B;  5B24 A;  3KUY C;  2NZD B;  4HGA B;  3AV2 B;  3KFU G;  3REJ C;  3KUY A;  4ZBJ C;  5BT1 C;  5GT0 B;  4QLC C;  5CP6 B;  5B0Y A;  3WKJ A;  1P3F C;  3REK D;  5B1L B;  4QLC A;  5JRG C;  3LJA C;  3AZK D;  1ID3 C;  1P3F A;  2Y2H A;  4LD9 D;  3B6F D;  3R45 B;  3REI B;  5JRG A;  3LJA A;  3AV1 B;  3W99 C;  1BH8 A;  1P3A C;  5BNV A;  1ZLA D;  4G91 C;  3O62 C;  5AV6 C;  2NZD C;  2G5H C;  5AY8 B;  3LZ1 A;  3AZI C;  4WU9 B;  4YM6 B;  3W99 A;  4HGA C;  4NE5 A;  1P3A A;  1PZR A;  3AV2 C; 
#chains in the Genus database with same CATH homology
 4KGC B;  2NQB A;  4UUZ A;  5AV6 A;  5GT0 C;  3AZI A;  3W97 B;  4J8V D;  3MGS A;  1P3O B;  5GSU B;  5BNX B;  5GXQ D;  5F99 A;  3AZN A;  5B33 B;  3REL D;  3EPL A;  1TAF B;  1P3P A;  3AFA D;  4H9S C;  5B0Z A;  1S32 A;  3X1U D;  3AV1 C;  3A1I A;  2L5A A;  3WTP B;  2FFF B;  4Z5T B;  3R45 A;  5AY8 C;  3AV1 A;  4WU9 C;  4YM6 C;  2CWE A;  4KGC C;  4XUJ D;  3FDD A;  3NQJ A;  5B2I C;  4YM6 A;  3W97 C;  3AZJ D;  1P3B D;  3REK B;  1JFI B;  3AZG C;  4R8P C;  5GSU C;  5B2I A;  4KHA B;  3A6N C;  1P3O C;  2BYK B;  5B1M B;  1N1J B;  3H0R C;  3MGQ B;  5B33 C;  2ZM5 A;  2YFW A;  4J8X A;  3AZG A;  4R8P A;  5AV5 A;  3V9R B;  3A6N A;  2F8N H;  3B6F B;  5DNM D;  1P3L B;  3B6G D;  4ZUX D;  1HQ3 A;  3KWQ D;  1ZLA B;  4Z5T C;  5CHL B;  3H0M C;  5KDM B;  2ARO B;  4CAY A;  2UWX A;  1B67 A;  2XD5 A;  1KX3 B;  2HIO B;  1M19 D;  5AVC D;  1P3G A;  4X23 D;  4J8V B;  2F2A C;  3B0C W;  3MGR B;  4J8U A;  3REK C;  5GXQ B;  3AYW D;  5B31 G;  2Y2G A;  5B1M C;  3MGQ C;  3AFA B;  3AZH D;  3B6F C;  5DNN B;  1P3L C;  1ZLA C;  3AN2 D;  2Y2K A;  5B2J A;  1P34 B;  2ARO C;  5CPK D;  3AZL B;  1KX3 C;  3KXB A;  2G5I C;  2HIO C;  4XUJ B;  3TU4 D;  3C1B C;  5KDM A;  2Y2N A;  3AZJ B;  4J8V C;  5E5A C;  3MGR C;  3C1B A;  5GXQ C;  3MNN A;  3WKJ D;  3AZF D;  3X1T D;  5BO0 A;  5E5A A;  3W96 B;  3MGR A;  3AFA C;  5DNM B;  5B40 D;  3B6G B;  5DNN C;  4ZUX B;  3A1K A;  3KWQ B;  2JSS A;  4WNN A;  1P34 C;  2IO5 B;  4Z66 B;  2PYO A;  3LZ0 D;  3AZL C;  5GT3 D;  3VH6 W;  3X1V A;  4X23 B;  2ZY3 A;  3AZJ C;  1M18 D;  2NQB D;  5CPJ A;  3AYW B;  1BH9 A;  1KX5 C;  2RVQ D;  4E45 A;  1W2E A;  4J8W C;  1KX5 A;  3UTA B;  5F99 D;  4ZUX C;  4J8W A;  3AZN D;  3KWQ C;  4JJN A;  3WA9 A;  1P3P D;  1AOI D;  1S32 D;  1T3U A;  5AV9 A;  4WU8 B;  5CPK B;  2IO5 C;  4Z66 C;  3WAA B;  1KU5 A;  3TU4 B;  5BS7 C;  2F8N K;  4X23 C;  3MVD A;  5BS7 A;  3AYW C;  2FJ7 A;  3AZF B;  3X1T B;  3EG5 B;  1F1E A;  2YFV A;  5B40 B;  1F66 B;  3REJ A;  3UTA C;  4G92 C;  2Y2O A;  3LEL D;  1H3O B;  2BYM A;  3UTB D;  5B31 B;  5AV5 D;  3AZG B;  3UTA A;  2F8N G;  3WAA C;  3LZ0 B;  1HQ3 D;  4WU8 C;  5CPK C;  5GT3 B;  1TZY C;  3REH B;  3TU4 C;  4YS3 B;  1ID3 A;  2RIQ A;  1Z2C B;  4E44 A;  1M18 B;  1TZY A;  4H9O A;  3W98 D;  3O62 A;  3AZF C;  3X1T C;  2NZD A;  5AVB D;  4J8U D;  2CV5 B;  2JE5 A;  5CP6 C;  1M1A B;  3AV2 A;  1F66 C;  5GT0 A;  5B1L C;  5B31 C;  3C1C D;  1P3M B;  1AOI B;  2JCH A;  5CP6 A;  3LZ0 C;  3WTP E;  1H3O A;  5B1L A;  3REI C;  5GT3 C;  3REH C;  4YS3 C;  1KX4 D;  3REI A;  4H9S A;  5AV8 D;  3X1S D;  2F8N D;  3KXB D;  4DRB A;  1U35 D;  2RVQ C;  3VH5 A;  3AZE D;  5AY8 A;  4WU9 A;  2CV5 C;  1M1A C;  3MNN D;  4KGC A;  3LEL B;  1P3M C;  3AZK B;  5B32 G;  3W97 A;  4LD9 B;  2BG1 A;  1P3O A;  5GSU A;  5BNX A;  4EO5 B;  4H9P B;  5B33 A;  2PYO D;  3WTP C;  1TAF A;  3W98 B;  1P3I D;  2VQR A;  1HTA A;  3P5J B;  3X1V D;  3WTP A;  4Z5T A;  4CSR B;  5AVB B;  5G49 B;  3AZM D;  3EPK A;  3MGP D;  4XZQ D;  4KUD D;  4AWL B;  3C1C B;  1P3K D;  3AZK C;  3VH6 A;  3REL B;  3REK A;  1JFI A;  4LD9 C;  4KHA A;  3X1U B;  2BYK A;  3AZK A;  1EQZ D;  4EO5 C;  5B1M A;  1N1J A;  3MGQ A;  3NQU B;  4Z2M H;  1KX4 B;  3B6F A;  2HUE B;  5AV8 B;  3V9R A;  5B32 D;  3X1S B;  2F8N B;  1U35 B;  1P3L A;  3W98 C;  3UT9 D;  3F6T A;  5CPI D;  3AZE B;  1ZLA A;  5B24 D;  2Y2M A;  5AVB C;  3MVD D;  2ARO A;  2FJ7 D;  1P3B B;  2Y2L A;  3B0B A;  4H9R B;  3KUY D;  1KX3 A;  2HIO A;  1R4V A;  3C1C C;  4WZS B;  5B0Y D;  4J8V A;  3REJ D;  5BT1 D;  3REL C;  5GXQ A;  4QLC D;  3X1U C;  1P3F D;  3AFA A;  2HUE C;  5JRG D;  5DNN A;  3LJA D;  1P3I B;  1ID3 D;  3AZM B;  1M19 B;  4XUJ C;  5AVC B;  3LZ1 D;  1P34 A;  3W99 D;  1P3A D;  4H9N B;  3MGP B;  4XZQ B;  3AZL A;  1P3B C;  5AV6 D;  4XUJ A;  2NZD D;  5JA4 B;  3AZI D;  1P3K B;  2DQN C;  3AZJ A;  1P3B A;  3MGS D;  3AZH B;  3W96 C;  5GT0 D;  4H9Q B;  5DNM C;  3B6G C;  1EQZ B;  3W96 A;  5B32 B;  3AN2 B;  5B0Z D;  5DNM A;  3B6G A;  1P3I C;  4ZUX A;  3UT9 B;  5CPI B;  3KWQ A;  5B24 B;  3AZM C;  1M19 C;  5AVC C;  3AV1 D;  4Z66 A;  3MGP C;  4XZQ C;  1WWS A;  1M19 A;  4YM6 D;  5B0Y B;  4X23 A;  1P3K C;  3WKJ B;  4KGC D;  3AZH C;  5B2I D;  4QLC B;  3AYW A;  1EQZ C;  1P3F B;  3W97 D;  4J8X D;  3AZG D;  4R8P D;  5B32 C;  3A6N D;  3AN2 C;  1P3O D;  3LJA B;  2ZY4 A;  3B0D B;  1BH8 B;  3UT9 C;  5BNV B;  4UPK A;  3LZ1 B;  3W99 B;  4WU8 A;  3WAA A;  5CPK A;  1P3A B;  2NQB B;  4UUZ B;  3TU4 A;  3AZI B;  4WJ3 C;  1P3G D;  5B0Y C;  3WKJ C;  1B6W A;  3MGS B;  5B40 C;  5F99 B;  3AZN B;  3AZF A;  3X1T A;  2W8S A;  1P3P B;  5B0Z B;  1S32 B;  5B40 A;  1F66 A;  4DRA A;  1BFM A;  3B0D C;  5B1M D;  4WV4 B;  3MGQ D;  5B31 A;  4M6B A;  4Z2M G;  5B2J D;  3LZ1 C;  1P3L D;  3LZ0 A;  1M18 C;  5GT3 A;  2DF4 C;  3B0C T;  3REH A;  2XD1 A;  3NQJ B;  4YS3 A;  2NQB C;  2ARO D;  1M18 A;  1KX3 D;  3MGS C;  2HIO D;  5B2I B;  3C1B D;  5F99 C;  3AZN C;  3VH5 T;  3UTB B;  4J8X B;  2YFW B;  3IP4 C;  4NE6 A;  5E5A D;  2Y2J A;  5AV5 B;  4R8P B;  3A6N B;  3MGR D;  5B0Z C;  2CV5 A;  1S32 C;  1P3P C;  1M1A A;  1AOI C;  1HQ3 B;  1AOI A;  1P3M A;  5DNN D;  4CAY B;  1WWI A;  4NFT A;  1P34 D;  1P3G B;  3AZL D;  5C3I B;  5CPJ D;  4J8U B;  3LEL C;  3UTB C;  4J8X C;  5AV5 C;  1KX5 D;  3EPJ A;  4J8W D;  1Q9C A;  1HQ3 C;  3LEL A;  3UTB A;  4JJN D;  3WA9 D;  2ZY5 A;  2ZY2 A;  5B2J B;  3VH6 T;  5AV9 D;  4LD9 A;  3KXB B;  3AL0 C;  4NE3 A;  4H9P A;  4Z66 D;  1P3G C;  1A7W A;  5C3I C;  3W98 A;  3C1B B;  4J8U C;  3MNN B;  5BO0 B;  4CSR A;  5AVB A;  5G49 A;  5E5A B;  4AWL C;  3C1C A;  4DQY B;  4WNN B;  5B2J C;  3UTA D;  2PYO B;  3VH5 W;  3REL A;  3W96 D;  1KX4 C;  3X1S C;  5AV8 C;  3X1U A;  3KXB C;  1U35 C;  3X1V B;  4WU8 D;  3WAA D;  3KSY A;  3NQU A;  1KX4 A;  3AZE C;  3X1S A;  5AV8 A;  2F8N A;  1TZY D;  5CPJ B;  1U35 A;  1BH9 B;  3MNN C;  4KUD B;  3O62 D;  3AZE A;  1KX5 B;  2Y2P A;  4J8W B;  3AV2 D;  4H9R A;  4JJN B;  2Y2Q A;  3WA9 B;  5CP6 D;  1F66 D;  5AV9 B;  2PYO C;  5B1L D;  5FUG B;  5B31 D;  2Y2I A;  3X1V C;  3REI D;  3MVD B;  2J8P A;  1P3I A;  5CPJ C;  3REH D;  4YS3 D;  2FJ7 B;  3KUY B;  4KUD C;  2YFV B;  3AZM A;  5AY8 D;  5AVC A;  4WU9 D;  2LY8 A;  3EPH A;  4H9N A;  3MGP A;  4XZQ A;  3REJ B;  4ZBJ B;  4KUD A;  2BYM B;  5JA4 A;  4JJN C;  3WA9 C;  1P3K A;  2CV5 D;  1M1A D;  5AV9 C;  4G92 B;  3AZH A;  5GSU D;  5JRG B;  4H9Q A;  1P3M D;  1ID3 B;  1EQZ A;  3H0L C;  5B33 D;  5CPI C;  5B32 A;  3AN2 A;  1ULY A;  5FUG A;  1TZY B;  4H9O B;  5B24 C;  3MVD C;  3UT9 A;  5CPI A;  2FJ7 C;  3WTP D;  4G91 B;  4Z5T D;  3O62 B;  5AV6 B;  5B24 A;  3KUY C;  2NZD B;  4HGA B;  3AV2 B;  3KFU G;  3REJ C;  3KUY A;  4ZBJ C;  5BT1 C;  5GT0 B;  4QLC C;  5CP6 B;  5B0Y A;  3WKJ A;  1P3F C;  3REK D;  5B1L B;  4QLC A;  5JRG C;  3LJA C;  3AZK D;  1ID3 C;  1P3F A;  2Y2H A;  4LD9 D;  3B6F D;  3R45 B;  3REI B;  5JRG A;  3LJA A;  3AV1 B;  3W99 C;  1BH8 A;  1P3A C;  5BNV A;  1ZLA D;  4G91 C;  3O62 C;  5AV6 C;  2NZD C;  2G5H C;  5AY8 B;  3LZ1 A;  3AZI C;  4WU9 B;  4YM6 B;  3W99 A;  4HGA C;  4NE5 A;  1P3A A;  1PZR A;  3AV2 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...