3AZNB

Crystal structure of human nucleosome core particle containing h4k91q mutation
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
78
structure length
78
Chain Sequence
b'NIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALQRQGRTLYGFGG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.1
publication title Comprehensive Structural Analysis of Mutant Nucleosomes Containing Lysine to Glutamine (KQ) Substitutions in the H3 and H4 Histone-Fold Domains
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 27
structure length 78
sequence length 78
chains with identical sequence F
ec nomenclature
pdb deposition date 2011-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3aznB00
4H9QB 5CPKC 4J8VD 2FJ7B 3W97D 5GT3D 3X1UA 1HTAA 4G91C 5JRGD 3AN2C 3UTAC 3AYWD 4WU9C 1BFMA 2F8ND 5AVCB 3LELA 3AFAC 4J8UC 3WAAA 5G49A 5B31G 1EQZC 5B0YD 5B32G 1M18B 1Q9CA 3B6FD 5AV9A 2L5AA 2AROD 3LJAD 1KX5B 5B40C 5B24B 3REKC 1TZYA 3AV1A 3AV1B 2HIOA 1KU5A 3LELD 3WAAD 5CPID 5F99A 3X1VC 4WU8A 3LZ1C 3UT9B 3VH5W 3W99B 3AV2C 1P34B 4LD9C 1R4VA 1TZYD 3AZIB 3KUYD 1P3PA 3AZKA 5B1MD 3TU4D 5AV5C 4ZUXA 3AZNC 5B33C 2YFWA 2NZDC 4AWLC 3O62B 4R8PB 3C1CC 4ZBJC 5KDMB 5GT0C 3MGQC 1H3OB 2HUEB 4H9PB 3AZMC 2PYOA 3MGPC 3AZKD 4H9OA 1KX3A 4H9OB 4ZUXD 1F1EA 3MGRB 1AOIA 3RELA 4J8WA 4J8WB 1P3KB 2F8NK 5GXQB 4Z66D 4YM6A 1TAFB 3B0DC 3X1SB 3KXBC 5CPKA 3REHC 4HGAB 5AV8B 5AVBC 5B1LB 3AN2A 3MNNB 3AZGB 3AZJB 4WU9A 4CAYB 4YM6D 5C3IB 3AFAA 4J8UA 1S32C 1EQZA 1P3BC 1P3FC 3A6NC 3X1TC 4NE5A 3WA9B 5DNNC 3REKA 5GT3C 5BNXA 3MGSA 2CV5D 3AN2D 3MGSB 5BNXB 3C1BB 3REIB 3UTAD 1M19C 4J8UD 1EQZD 5B0ZC 3X1VA 3LZ1A 4KHAA 2AROC 1P3GB 3AV2A 1ZLAB 5CPJB 5B40D 3LZ0B 4Z2MH 4XZQB 4KGCC 5AV5A 5CPIC 4XUJA 3AZNA 5B33A 4XUJB 3X1VD 2NQBC 2NZDA 1P3IA 4DRAA 2NZDB 3REJC 5JA4A 1P3IB 1ID3B 3AV2D 4UUZA 3C1CA 4LD9D 2IO5B 5GT0A 3MGQA 4Z2MG 3KUYC 5BO0A 3AZMA 3MGPA 2RVQC 3TU4C 5AV5D 3VH5T 3W98B 4H9RB 4EO5B 3AZND 1JFIA 3UTBB 1M1AD 1JFIB 3B0CW 4H9NB 3WKJC 5GT0D 3AZMD 3MGPD 3AZEC 3KXBA 3REHA 4J8XB 3W96B 4Z5TB 5AVBA 4WZSB 4KUDC 3AZFB 4Z66C 1P3OC 3B6GB 5CP6B 1S32A 1P3BA 1P3FA 1ULYA 3A6NA 3X1TA 3REHD 4J8VA 4J8VB 5AVBD 5DNNA 3W97B 5GT3A 3WTPC 5JRGA 3AYWA 5JRGB 3AYWB 2F8NA 1M19A 5E5AB 1S32D 5B0YA 2JSSA 1P3BD 1P3FD 5B0YB 5B0ZA 3B6FA 3X1TD 3A6ND 1U35C 3B6FB 2AROA 3LJAA 3AZHD 3LJAB 5DNND 2CV5C 3X1UB 4KGCA 1M19D 5CPIA 3LELB 1P3MC 3WAAB 5G49B 5B0ZD 2NQBA 5B2JC 5GSUD 5AV9B 3MVDC 5AY8D 3KWQD 3KUYA 1TZYB 1BH8A 5B1MA 4H9SC 3TU4A 4X23D 2HIOB 5B1MB 4KGCD 1HQ3D 3AZLC 3R45A 5F99B 5B32D 2NQBD 4WU8B 3REJD 3VH6A 4YS3C 3NQUA 3NQUB 2RVQD 1P3PB 3AZKB 5BT1D 4JJNC 4ZUXB 2CWEA 1M1AC 2YFWB 3WKJD 4WV4B 4Z66A 1P3OA 2PYOB 3AZED 1KX3B 1KX5D 1AOIB 3RELB 5B24D 3WTPA 4KUDD 1P3OD 4YM6B 1F66C 4WNNA 5CPKB 4M6BA 1P34D 5B2IC 5DNMC 3AZID 2CV5A 3WTPD 3UTAA 3AN2B 4G91B 3UTAB 5FUGA 4WU9B 1P3AC 1P3LC 1KX4C 3AFAB 4J8UB 1P3MA 1EQZB 5B2JA 1U35D 3AZHC 5B40A 4R8PD 5B40B 3REKB 1P3MD 4NE3A 4G92C 3AZLA 4CSRA 4QLCC 3MGRD 4CSRB 3X1VB 5GSUC 5B2JD 1B67A 3LZ1B 4KHAB 3MVDD 5AY8C 3AV2B 4LD9A 3KWQC 4LD9B 4YS3A 4X23C 5AV5B 1HQ3C 4JJNA 5B31C 3AZLD 2YFVA 3AZNB 5B33B 1M1AA 5B32C 2YFVB 1M1AB 4AWLB 5JA4B 4UUZB 3AZGD 3C1CB 4YS3D 4ZBJB 5GT0B 3MGQB 3AZJD 3AZMB 5BO0B 3MGPB 5BT1C 5AV6C 4JJND 3V9RA 2FJ7C 3WA9D 4NFTA 5AVCC 3WTPE 1F66A 3B0DB 1M18C 3KXBB 3REHB 1KX5C 5CPJD 5B2IA 5B24C 5AVBB 3AV1C 1F66D 1S32B 1P3BB 1P3FB 3UT9C 4E44A 3W99C 3A6NB 3AZHA 3X1TB 3AZHB 1P34C 5B2ID 5DNNB 5DNMD 3AZIC 5GT3B 1WWIA 3NQJA 1P3AD 1P3LD 1KX4D 2F8NB 1M19B 3W98D 4QLCA 5B0ZB 5GSUA 3O62C 2AROB 4R8PC 5AY8A 3KWQA 2HUEC 3KWQB 2F8NH 4X23A 4KGCB 1HQ3A 5CPIB 5B31A 5BS7C 3VH6W 4QLCD 5BNVA 5B32A 3MGRC 2NQBB 3REJA 4J8WC 1P3KC 3REJB 5GXQC 2F8NG 3KUYB 1N1JA 3X1SC 5CP6D 1N1JB 4E45A 1BH8B 3TU4B 5B31D 4HGAC 3R45B 2FJ7A 5AV8C 5B1LC 3WKJA 3WKJB 3MNNC 3AZGC 3AZJC 5AVCA 5C3IC 5E5AD 3AZEA 5AV6D 3B0BA 1M18A 3AZEB 1B6WA 3WA9C 1KX5A 2FJ7D 5B24A 4KUDA 3MGSC 3C1BC 3REIC 4DRBA 3X1UD 4KUDB 4Z66B 5AVCD 1P3OB 3B0CT 1M18D 3UT9A 1P3GC 3W99A 5AV9D 1ZLAC 5CPJC 1P34A 3LZ0C 3AZIA 4XZQC 3AV1D 3WTPB 5CHLB 2HIOD 4XUJC 5F99D 4WNNB 3UT9D 1U35A 3W99D 3O62A 4WU8D 1U35B 1P3IC 1ID3C 4R8PA 2IO5C 5KDMA 1H3OA 4H9PA 2CV5B 3VH5A 1P3PD 5FUGB 3W98C 4EO5C 1P3MB 3KSYA 5BS7A 3UTBC 3MGRA 2BYKA 2BYKB 5B2JB 3O62D 1P3KA 3MVDA 5GXQA 3MVDB 1TAFA 2PYOD 3X1SA 4H9SA 1KX3D 4J8XC 3AZLB 3W96C 4Z5TC 5AV8A 1AOID 5B1LA 4J8WD 3RELD 1P3KD 5GXQD 3AZFC 3MNNA 3AZGA 3AZJA 2LY8A 4CAYA 4YS3B 3B6GC 3VH6T 5CP6C 3X1SD 4JJNB 5CPKD 4J8VC 3WA9A 5AV8D 5B1LD 3W97C 3C1BA 3REIA 3MNND 5JRGC 3AYWC 4WU9D 3AFAD 4NE6A 5E5AC 5B0YC 3B6FC 1P3GA 3V9RB 1ZLAA 3LJAC 5CPJA 3LZ0A 3REKD 4XZQA 2BYMA 3MGSD 3X1UC 3C1BD 3REID 2BYMB 3WAAC 3LELC 1F66B 1A7WA 1P3GD 5AV9C 3LZ1D 1ID3A 1ZLAD 1BH9A 3LZ0D 5DNMA 5B2IB 1BH9B 1TZYC 5DNMB 4XZQD 1P3AA 2HIOC 5B1MC 1P3AB 1P3LA 1KX4A 1P3LB 1KX4B 3W98A 4H9RA 4XUJD 5F99C 5B33D 3UTBA 4WU8C 2NZDD 4H9NA 1P3ID 1ID3D 3C1CD 3MGQD 1WWSA 3NQJB 1P3PC 3AZKC 4ZUXC 4J8XA 3UTBD 4G92B 3W96A 4Z5TA 4QLCB 5GSUB 3AZFA 5AY8B 3B6GA 2PYOC 5CP6A 4X23B 1KX3C 1HQ3B 5B31B 3KXBD 4J8XD 3W96D 4Z5TD 5B32B 1AOIC 5BNVB 3RELC 3W97A 3AZFD 3B6GD 4YM6C 5E5AA 5AV6A 5AV6B 4H9QA
chains in the Genus database with same CATH superfamily
4H9QB 5CPKC 4J8VD 2FJ7B 3W97D 5GT3D 3X1UA 1HTAA 4G91C 5JRGD 3AN2C 3UTAC 3AYWD 4WU9C 2Y2MA 1BFMA 2F8ND 5AVCB 3LELA 3AFAC 4J8UC 3WAAA 5G49A 5B31G 2XD1A 1EQZC 5B0YD 5B32G 1M18B 1Q9CA 3B6FD 5AV9A 2L5AA 2AROD 3LJAD 1KX5B 5B40C 5B24B 3REKC 1TZYA 3AV1A 3AV1B 2DF4C 2UWXA 2HIOA 1KU5A 3LELD 3WAAD 5CPID 5F99A 3X1VC 4WU8A 3LZ1C 3UT9B 3VH5W 3W99B 2Y2OA 3AV2C 1P34B 4LD9C 1R4VA 1TZYD 3AZIB 3KUYD 1P3PA 3AZKA 5B1MD 3TU4D 5AV5C 3IP4C 4ZUXA 3AZNC 5B33C 2YFWA 2NZDC 4AWLC 3O62B 4R8PB 3C1CC 4ZBJC 5KDMB 5GT0C 3MGQC 1H3OB 2HUEB 4H9PB 3AZMC 2PYOA 3EG5B 3MGPC 3AZKD 4H9OA 2Y2PA 1KX3A 4H9OB 3P5JB 4ZUXD 1F1EA 3MGRB 1AOIA 3RELA 4J8WA 4J8WB 1P3KB 2F8NK 5GXQB 4Z66D 4YM6A 1TAFB 3B0DC 3X1SB 3KXBC 5CPKA 3REHC 4HGAB 5AV8B 5AVBC 5B1LB 3AN2A 3MNNB 3AZGB 3AZJB 4WU9A 4CAYB 4YM6D 5C3IB 3AFAA 4J8UA 1S32C 1EQZA 1P3BC 1P3FC 3A6NC 3X1TC 4NE5A 3WA9B 5DNNC 3REKA 5GT3C 5BNXA 3MGSA 2CV5D 3AN2D 3MGSB 5BNXB 3C1BB 3REIB 3UTAD 1M19C 4J8UD 2Y2GA 1EQZD 5B0ZC 3X1VA 3LZ1A 4KHAA 2AROC 1P3GB 3AV2A 1ZLAB 5CPJB 5B40D 3LZ0B 4Z2MH 4XZQB 4KGCC 5AV5A 5CPIC 4XUJA 3AZNA 5B33A 4XUJB 3A1KA 3X1VD 2NQBC 2NZDA 1P3IA 4DRAA 2NZDB 3REJC 5JA4A 1P3IB 1ID3B 3AV2D 4UUZA 3C1CA 4LD9D 2IO5B 5GT0A 3MGQA 4Z2MG 3KUYC 5BO0A 3AZMA 3MGPA 2RVQC 3TU4C 5AV5D 3VH5T 3W98B 4H9RB 4EO5B 3AZND 1JFIA 3UTBB 1M1AD 1JFIB 3B0CW 4H9NB 3WKJC 5GT0D 3AZMD 3MGPD 3AZEC 3KXBA 3REHA 4J8XB 3W96B 4Z5TB 5AVBA 4WZSB 4KUDC 3AZFB 4Z66C 1P3OC 3B6GB 2F2AC 5CP6B 1S32A 1P3BA 1P3FA 1ULYA 3A6NA 3X1TA 3REHD 4J8VA 4J8VB 5AVBD 5DNNA 3W97B 5GT3A 3WTPC 5JRGA 3AYWA 5JRGB 3AYWB 2F8NA 1M19A 5E5AB 1S32D 5B0YA 2JSSA 2Y2NA 1P3BD 1P3FD 5B0YB 5B0ZA 3B6FA 3X1TD 2ZY2A 3A6ND 1U35C 2AROA 3B6FB 3LJAA 3AZHD 3LJAB 5DNND 2CV5C 3X1UB 4KGCA 1M19D 5CPIA 3LELB 1P3MC 3WAAB 5G49B 5B0ZD 2NQBA 5B2JC 5GSUD 5AV9B 3MVDC 5AY8D 3AL0C 3KWQD 3KUYA 1TZYB 1BH8A 5B1MA 4H9SC 3TU4A 4X23D 2HIOB 2ZY4A 5B1MB 4KGCD 1HQ3D 3AZLC 3R45A 5F99B 5B32D 2NQBD 4WU8B 3REJD 2Y2QA 3VH6A 4YS3C 3NQUA 3NQUB 2RVQD 1P3PB 3AZKB 5BT1D 4JJNC 4ZUXB 2CWEA 1M1AC 2YFWB 3WKJD 4WV4B 4Z66A 1P3OA 2PYOB 3AZED 1PZRA 1KX3B 4WJ3C 1KX5D 1AOIB 3RELB 5B24D 3WTPA 4KUDD 2Y2IA 1P3OD 2Y2HA 4YM6B 1F66C 4WNNA 5CPKB 4M6BA 1P34D 5B2IC 5DNMC 3AZID 2CV5A 3WTPD 3UTAA 3AN2B 3H0LC 4G91B 3UTAB 5FUGA 1Z2CB 4WU9B 1P3AC 1P3LC 1KX4C 3AFAB 4J8UB 1P3MA 3FDDA 1EQZB 5B2JA 1U35D 3AZHC 5B40A 4R8PD 1W2EA 2ZM5A 5B40B 3REKB 1P3MD 4NE3A 4G92C 3AZLA 4CSRA 4QLCC 3MGRD 4CSRB 3X1VB 5GSUC 5B2JD 1B67A 3LZ1B 4KHAB 3MVDD 5AY8C 3AV2B 4LD9A 3KWQC 4LD9B 4YS3A 4X23C 5AV5B 1HQ3C 2G5HC 4JJNA 5B31C 3AZLD 2YFVA 3AZNB 2J8PA 5B33B 5B32C 2YFVB 1M1AA 1M1AB 4AWLB 5JA4B 4UUZB 3AZGD 3C1CB 4YS3D 4ZBJB 5GT0B 3MGQB 3AZJD 3AZMB 5BO0B 3MGPB 5BT1C 5AV6C 4JJND 2DQNC 3V9RA 2JCHA 2FJ7C 3WA9D 4NFTA 2Y2KA 5AVCC 3WTPE 1F66A 3B0DB 3H0RC 1M18C 3KXBB 3REHB 2VQRA 1KX5C 5CPJD 5B2IA 5B24C 5AVBB 3AV1C 2Y2LA 2JE5A 2W8SA 1F66D 1S32B 1P3BB 1P3FB 3UT9C 4E44A 3W99C 3A6NB 3AZHA 3X1TB 3AZHB 1P34C 5B2ID 5DNNB 5DNMD 3AZIC 5GT3B 1WWIA 3NQJA 1P3AD 1P3LD 1KX4D 2F8NB 1M19B 3W98D 2G5IC 4QLCA 5B0ZB 5GSUA 3O62C 2AROB 4R8PC 5AY8A 3KWQA 2HUEC 3KWQB 2F8NH 4X23A 4KGCB 1HQ3A 5CPIB 5B31A 5BS7C 3EPHA 3VH6W 4QLCD 5BNVA 5B32A 3MGRC 2NQBB 3REJA 4J8WC 1P3KC 3REJB 5GXQC 2Y2JA 2F8NG 3KUYB 1N1JA 3X1SC 5CP6D 1N1JB 4E45A 1BH8B 3TU4B 5B31D 4HGAC 3R45B 2FJ7A 3A1IA 5AV8C 5B1LC 3WKJA 3WKJB 3MNNC 3AZGC 3AZJC 5AVCA 5C3IC 5E5AD 3AZEA 5AV6D 3B0BA 1M18A 3AZEB 3F6TA 1B6WA 3WA9C 1KX5A 2FJ7D 5B24A 4KUDA 3MGSC 3C1BC 3REIC 4DRBA 3X1UD 4KUDB 4Z66B 5AVCD 1P3OB 3B0CT 1M18D 3UT9A 1P3GC 3W99A 5AV9D 1ZLAC 5CPJC 1P34A 3LZ0C 3AZIA 4XZQC 3AV1D 3WTPB 5CHLB 2HIOD 4XUJC 5F99D 4WNNB 3UT9D 1U35A 3W99D 3O62A 4WU8D 1U35B 1P3IC 1ID3C 4R8PA 2IO5C 2BG1A 5KDMA 1H3OA 4H9PA 2CV5B 4DQYB 3VH5A 1P3PD 5FUGB 3W98C 4EO5C 1P3MB 3KSYA 5BS7A 3UTBC 3MGRA 2BYKA 2BYKB 5B2JB 3O62D 1P3KA 3MVDA 5GXQA 3MVDB 3KFUG 1TAFA 2PYOD 3X1SA 4H9SA 1KX3D 4J8XC 3AZLB 3W96C 4Z5TC 3EPKA 5AV8A 1AOID 5B1LA 4J8WD 3RELD 1P3KD 5GXQD 3AZFC 3MNNA 3AZGA 3AZJA 2LY8A 4CAYA 4YS3B 3B6GC 3VH6T 1T3UA 5CP6C 3X1SD 4JJNB 5CPKD 2XD5A 4J8VC 3WA9A 5AV8D 5B1LD 3W97C 4UPKA 3C1BA 3REIA 3MNND 5JRGC 3AYWC 4WU9D 3AFAD 4NE6A 5E5AC 5B0YC 3B6FC 1P3GA 3V9RB 1ZLAA 3LJAC 5CPJA 3LZ0A 3REKD 4XZQA 2BYMA 3MGSD 3X1UC 3C1BD 3REID 2BYMB 3WAAC 3LELC 1F66B 3H0MC 1A7WA 1P3GD 5AV9C 3LZ1D 1ID3A 1ZLAD 1BH9A 3LZ0D 5DNMA 5B2IB 1BH9B 1TZYC 5DNMB 4XZQD 1P3AA 2ZY3A 2HIOC 5B1MC 1P3AB 1P3LA 1KX4A 1P3LB 1KX4B 3W98A 4H9RA 4XUJD 5F99C 5B33D 3UTBA 2ZY5A 4WU8C 2NZDD 4H9NA 1P3ID 1ID3D 3C1CD 3MGQD 1WWSA 3NQJB 1P3PC 2FFFB 3AZKC 4ZUXC 4J8XA 3UTBD 4G92B 3W96A 4Z5TA 4QLCB 5GSUB 3AZFA 5AY8B 3B6GA 2PYOC 5CP6A 3EPLA 4X23B 1KX3C 1HQ3B 2RIQA 5B31B 3KXBD 4J8XD 3W96D 4Z5TD 5B32B 1AOIC 5BNVB 3RELC 3W97A 3EPJA 3AZFD 3B6GD 4YM6C 5E5AA 5AV6A 5AV6B 4H9QA
chains in the Genus database with same CATH topology
4H9QB 5CPKC 4J8VD 2FJ7B 3W97D 5GT3D 3X1UA 1HTAA 4G91C 5JRGD 3AN2C 3UTAC 3AYWD 4WU9C 2Y2MA 1BFMA 2F8ND 5AVCB 3LELA 3AFAC 4J8UC 3WAAA 5G49A 5B31G 2XD1A 1EQZC 5B0YD 5B32G 1M18B 1Q9CA 3B6FD 5AV9A 2L5AA 2AROD 3LJAD 1KX5B 5B40C 5B24B 3REKC 1TZYA 3AV1A 3AV1B 2DF4C 2UWXA 2HIOA 1KU5A 3LELD 3WAAD 5CPID 5F99A 3X1VC 4WU8A 3LZ1C 3UT9B 3VH5W 3W99B 2Y2OA 3AV2C 1P34B 4LD9C 1R4VA 1TZYD 3AZIB 3KUYD 1P3PA 3AZKA 5B1MD 3TU4D 5AV5C 3IP4C 4ZUXA 3AZNC 5B33C 2YFWA 2NZDC 4AWLC 3O62B 4R8PB 3C1CC 4ZBJC 5KDMB 5GT0C 3MGQC 1H3OB 2HUEB 4H9PB 3AZMC 2PYOA 3EG5B 3MGPC 3AZKD 4H9OA 2Y2PA 1KX3A 4H9OB 3P5JB 4ZUXD 1F1EA 3MGRB 1AOIA 3RELA 4J8WA 4J8WB 1P3KB 2F8NK 5GXQB 4Z66D 4YM6A 1TAFB 3B0DC 3X1SB 3KXBC 5CPKA 3REHC 4HGAB 5AV8B 5AVBC 5B1LB 3AN2A 3MNNB 3AZGB 3AZJB 4WU9A 4CAYB 4YM6D 5C3IB 3AFAA 4J8UA 1S32C 1EQZA 1P3BC 1P3FC 3A6NC 3X1TC 4NE5A 3WA9B 5DNNC 3REKA 5GT3C 5BNXA 3MGSA 2CV5D 3AN2D 3MGSB 5BNXB 3C1BB 3REIB 3UTAD 1M19C 4J8UD 2Y2GA 1EQZD 5B0ZC 3X1VA 3LZ1A 4KHAA 2AROC 1P3GB 3AV2A 1ZLAB 5CPJB 5B40D 3LZ0B 4Z2MH 4XZQB 4KGCC 5AV5A 5CPIC 4XUJA 3AZNA 5B33A 4XUJB 3A1KA 3X1VD 2NQBC 2NZDA 1P3IA 4DRAA 2NZDB 3REJC 5JA4A 1P3IB 1ID3B 3AV2D 4UUZA 3C1CA 4LD9D 2IO5B 5GT0A 3MGQA 4Z2MG 3KUYC 5BO0A 3AZMA 3MGPA 2RVQC 3TU4C 5AV5D 3VH5T 3W98B 4H9RB 4EO5B 3AZND 1JFIA 3UTBB 1M1AD 1JFIB 3B0CW 4H9NB 3WKJC 5GT0D 3AZMD 3MGPD 3AZEC 3KXBA 3REHA 4J8XB 3W96B 4Z5TB 5AVBA 4WZSB 4KUDC 3AZFB 4Z66C 1P3OC 3B6GB 2F2AC 5CP6B 1S32A 1P3BA 1P3FA 1ULYA 3A6NA 3X1TA 3REHD 4J8VA 4J8VB 5AVBD 5DNNA 3W97B 5GT3A 3WTPC 5JRGA 3AYWA 5JRGB 3AYWB 2F8NA 1M19A 5E5AB 1S32D 5B0YA 2JSSA 2Y2NA 1P3BD 1P3FD 5B0YB 5B0ZA 3B6FA 3X1TD 2ZY2A 3A6ND 1U35C 2AROA 3B6FB 3LJAA 3AZHD 3LJAB 5DNND 2CV5C 3X1UB 4KGCA 1M19D 5CPIA 3LELB 1P3MC 3WAAB 5G49B 5B0ZD 2NQBA 5B2JC 5GSUD 5AV9B 3MVDC 5AY8D 3AL0C 3KWQD 3KUYA 1TZYB 1BH8A 5B1MA 4H9SC 3TU4A 4X23D 2HIOB 2ZY4A 5B1MB 4KGCD 1HQ3D 3AZLC 3R45A 5F99B 5B32D 2NQBD 4WU8B 3REJD 2Y2QA 3VH6A 4YS3C 3NQUA 3NQUB 2RVQD 1P3PB 3AZKB 5BT1D 4JJNC 4ZUXB 2CWEA 1M1AC 2YFWB 3WKJD 4WV4B 4Z66A 1P3OA 2PYOB 3AZED 1PZRA 1KX3B 4WJ3C 1KX5D 1AOIB 3RELB 5B24D 3WTPA 4KUDD 2Y2IA 1P3OD 2Y2HA 4YM6B 1F66C 4WNNA 5CPKB 4M6BA 1P34D 5B2IC 5DNMC 3AZID 2CV5A 3WTPD 3UTAA 3AN2B 3H0LC 4G91B 3UTAB 5FUGA 1Z2CB 4WU9B 1P3AC 1P3LC 1KX4C 3AFAB 4J8UB 1P3MA 3FDDA 1EQZB 5B2JA 1U35D 3AZHC 5B40A 4R8PD 1W2EA 2ZM5A 5B40B 3REKB 1P3MD 4NE3A 4G92C 3AZLA 4CSRA 4QLCC 3MGRD 4CSRB 3X1VB 5GSUC 5B2JD 1B67A 3LZ1B 4KHAB 3MVDD 5AY8C 3AV2B 4LD9A 3KWQC 4LD9B 4YS3A 4X23C 5AV5B 1HQ3C 2G5HC 4JJNA 5B31C 3AZLD 2YFVA 3AZNB 2J8PA 5B33B 5B32C 2YFVB 1M1AA 1M1AB 4AWLB 5JA4B 4UUZB 3AZGD 3C1CB 4YS3D 4ZBJB 5GT0B 3MGQB 3AZJD 3AZMB 5BO0B 3MGPB 5BT1C 5AV6C 4JJND 2DQNC 3V9RA 2JCHA 2FJ7C 3WA9D 4NFTA 2Y2KA 5AVCC 3WTPE 1F66A 3B0DB 3H0RC 1M18C 3KXBB 3REHB 2VQRA 1KX5C 5CPJD 5B2IA 5B24C 5AVBB 3AV1C 2Y2LA 2JE5A 2W8SA 1F66D 1S32B 1P3BB 1P3FB 3UT9C 4E44A 3W99C 3A6NB 3AZHA 3X1TB 3AZHB 1P34C 5B2ID 5DNNB 5DNMD 3AZIC 5GT3B 1WWIA 3NQJA 1P3AD 1P3LD 1KX4D 2F8NB 1M19B 3W98D 2G5IC 4QLCA 5B0ZB 5GSUA 3O62C 2AROB 4R8PC 5AY8A 3KWQA 2HUEC 3KWQB 2F8NH 4X23A 4KGCB 1HQ3A 5CPIB 5B31A 5BS7C 3EPHA 3VH6W 4QLCD 5BNVA 5B32A 3MGRC 2NQBB 3REJA 4J8WC 1P3KC 3REJB 5GXQC 2Y2JA 2F8NG 3KUYB 1N1JA 3X1SC 5CP6D 1N1JB 4E45A 1BH8B 3TU4B 5B31D 4HGAC 3R45B 2FJ7A 3A1IA 5AV8C 5B1LC 3WKJA 3WKJB 3MNNC 3AZGC 3AZJC 5AVCA 5C3IC 5E5AD 3AZEA 5AV6D 3B0BA 1M18A 3AZEB 3F6TA 1B6WA 3WA9C 1KX5A 2FJ7D 5B24A 4KUDA 3MGSC 3C1BC 3REIC 4DRBA 3X1UD 4KUDB 4Z66B 5AVCD 1P3OB 3B0CT 1M18D 3UT9A 1P3GC 3W99A 5AV9D 1ZLAC 5CPJC 1P34A 3LZ0C 3AZIA 4XZQC 3AV1D 3WTPB 5CHLB 2HIOD 4XUJC 5F99D 4WNNB 3UT9D 1U35A 3W99D 3O62A 4WU8D 1U35B 1P3IC 1ID3C 4R8PA 2IO5C 2BG1A 5KDMA 1H3OA 4H9PA 2CV5B 4DQYB 3VH5A 1P3PD 5FUGB 3W98C 4EO5C 1P3MB 3KSYA 5BS7A 3UTBC 3MGRA 2BYKA 2BYKB 5B2JB 3O62D 1P3KA 3MVDA 5GXQA 3MVDB 3KFUG 1TAFA 2PYOD 3X1SA 4H9SA 1KX3D 4J8XC 3AZLB 3W96C 4Z5TC 3EPKA 5AV8A 1AOID 5B1LA 4J8WD 3RELD 1P3KD 5GXQD 3AZFC 3MNNA 3AZGA 3AZJA 2LY8A 4CAYA 4YS3B 3B6GC 3VH6T 1T3UA 5CP6C 3X1SD 4JJNB 5CPKD 2XD5A 4J8VC 3WA9A 5AV8D 5B1LD 3W97C 4UPKA 3C1BA 3REIA 3MNND 5JRGC 3AYWC 4WU9D 3AFAD 4NE6A 5E5AC 5B0YC 3B6FC 1P3GA 3V9RB 1ZLAA 3LJAC 5CPJA 3LZ0A 3REKD 4XZQA 2BYMA 3MGSD 3X1UC 3C1BD 3REID 2BYMB 3WAAC 3LELC 1F66B 3H0MC 1A7WA 1P3GD 5AV9C 3LZ1D 1ID3A 1ZLAD 1BH9A 3LZ0D 5DNMA 5B2IB 1BH9B 1TZYC 5DNMB 4XZQD 1P3AA 2ZY3A 2HIOC 5B1MC 1P3AB 1P3LA 1KX4A 1P3LB 1KX4B 3W98A 4H9RA 4XUJD 5F99C 5B33D 3UTBA 2ZY5A 4WU8C 2NZDD 4H9NA 1P3ID 1ID3D 3C1CD 3MGQD 1WWSA 3NQJB 1P3PC 2FFFB 3AZKC 4ZUXC 4J8XA 3UTBD 4G92B 3W96A 4Z5TA 4QLCB 5GSUB 3AZFA 5AY8B 3B6GA 2PYOC 5CP6A 3EPLA 4X23B 1KX3C 1HQ3B 2RIQA 5B31B 3KXBD 4J8XD 3W96D 4Z5TD 5B32B 1AOIC 5BNVB 3RELC 3W97A 3EPJA 3AZFD 3B6GD 4YM6C 5E5AA 5AV6A 5AV6B 4H9QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4H9Q B;  5CPK C;  4J8V D;  2FJ7 B;  3W97 D;  5GT3 D;  3X1U A;  1HTA A;  4G91 C;  5JRG D;  3AN2 C;  3UTA C;  3AYW D;  4WU9 C;  1BFM A;  2F8N D;  5AVC B;  3LEL A;  3AFA C;  4J8U C;  3WAA A;  5G49 A;  5B31 G;  1EQZ C;  5B0Y D;  5B32 G;  1M18 B;  1Q9C A;  3B6F D;  5AV9 A;  2L5A A;  2ARO D;  3LJA D;  1KX5 B;  5B40 C;  5B24 B;  3REK C;  1TZY A;  3AV1 A;  3AV1 B;  2HIO A;  1KU5 A;  3LEL D;  3WAA D;  5CPI D;  5F99 A;  3X1V C;  4WU8 A;  3LZ1 C;  3UT9 B;  3VH5 W;  3W99 B;  3AV2 C;  1P34 B;  4LD9 C;  1R4V A;  1TZY D;  3AZI B;  3KUY D;  1P3P A;  3AZK A;  5B1M D;  3TU4 D;  5AV5 C;  4ZUX A;  3AZN C;  5B33 C;  2YFW A;  2NZD C;  4AWL C;  3O62 B;  4R8P B;  3C1C C;  4ZBJ C;  5KDM B;  5GT0 C;  3MGQ C;  1H3O B;  2HUE B;  4H9P B;  3AZM C;  2PYO A;  3MGP C;  3AZK D;  4H9O A;  1KX3 A;  4H9O B;  4ZUX D;  1F1E A;  3MGR B;  1AOI A;  3REL A;  4J8W A;  4J8W B;  1P3K B;  2F8N K;  5GXQ B;  4Z66 D;  4YM6 A;  1TAF B;  3B0D C;  3X1S B;  3KXB C;  5CPK A;  3REH C;  4HGA B;  5AV8 B;  5AVB C;  5B1L B;  3AN2 A;  3MNN B;  3AZG B;  3AZJ B;  4WU9 A;  4CAY B;  4YM6 D;  5C3I B;  3AFA A;  4J8U A;  1S32 C;  1EQZ A;  1P3B C;  1P3F C;  3A6N C;  3X1T C;  4NE5 A;  3WA9 B;  5DNN C;  3REK A;  5GT3 C;  5BNX A;  3MGS A;  2CV5 D;  3AN2 D;  3MGS B;  5BNX B;  3C1B B;  3REI B;  3UTA D;  1M19 C;  4J8U D;  1EQZ D;  5B0Z C;  3X1V A;  3LZ1 A;  4KHA A;  2ARO C;  1P3G B;  3AV2 A;  1ZLA B;  5CPJ B;  5B40 D;  3LZ0 B;  4Z2M H;  4XZQ B;  4KGC C;  5AV5 A;  5CPI C;  4XUJ A;  3AZN A;  5B33 A;  4XUJ B;  3X1V D;  2NQB C;  2NZD A;  1P3I A;  4DRA A;  2NZD B;  3REJ C;  5JA4 A;  1P3I B;  1ID3 B;  3AV2 D;  4UUZ A;  3C1C A;  4LD9 D;  2IO5 B;  5GT0 A;  3MGQ A;  4Z2M G;  3KUY C;  5BO0 A;  3AZM A;  3MGP A;  2RVQ C;  3TU4 C;  5AV5 D;  3VH5 T;  3W98 B;  4H9R B;  4EO5 B;  3AZN D;  1JFI A;  3UTB B;  1M1A D;  1JFI B;  3B0C W;  4H9N B;  3WKJ C;  5GT0 D;  3AZM D;  3MGP D;  3AZE C;  3KXB A;  3REH A;  4J8X B;  3W96 B;  4Z5T B;  5AVB A;  4WZS B;  4KUD C;  3AZF B;  4Z66 C;  1P3O C;  3B6G B;  5CP6 B;  1S32 A;  1P3B A;  1P3F A;  1ULY A;  3A6N A;  3X1T A;  3REH D;  4J8V A;  4J8V B;  5AVB D;  5DNN A;  3W97 B;  5GT3 A;  3WTP C;  5JRG A;  3AYW A;  5JRG B;  3AYW B;  2F8N A;  1M19 A;  5E5A B;  1S32 D;  5B0Y A;  2JSS A;  1P3B D;  1P3F D;  5B0Y B;  5B0Z A;  3B6F A;  3X1T D;  3A6N D;  1U35 C;  3B6F B;  2ARO A;  3LJA A;  3AZH D;  3LJA B;  5DNN D;  2CV5 C;  3X1U B;  4KGC A;  1M19 D;  5CPI A;  3LEL B;  1P3M C;  3WAA B;  5G49 B;  5B0Z D;  2NQB A;  5B2J C;  5GSU D;  5AV9 B;  3MVD C;  5AY8 D;  3KWQ D;  3KUY A;  1TZY B;  1BH8 A;  5B1M A;  4H9S C;  3TU4 A;  4X23 D;  2HIO B;  5B1M B;  4KGC D;  1HQ3 D;  3AZL C;  3R45 A;  5F99 B;  5B32 D;  2NQB D;  4WU8 B;  3REJ D;  3VH6 A;  4YS3 C;  3NQU A;  3NQU B;  2RVQ D;  1P3P B;  3AZK B;  5BT1 D;  4JJN C;  4ZUX B;  2CWE A;  1M1A C;  2YFW B;  3WKJ D;  4WV4 B;  4Z66 A;  1P3O A;  2PYO B;  3AZE D;  1KX3 B;  1KX5 D;  1AOI B;  3REL B;  5B24 D;  3WTP A;  4KUD D;  1P3O D;  4YM6 B;  1F66 C;  4WNN A;  5CPK B;  4M6B A;  1P34 D;  5B2I C;  5DNM C;  3AZI D;  2CV5 A;  3WTP D;  3UTA A;  3AN2 B;  4G91 B;  3UTA B;  5FUG A;  4WU9 B;  1P3A C;  1P3L C;  1KX4 C;  3AFA B;  4J8U B;  1P3M A;  1EQZ B;  5B2J A;  1U35 D;  3AZH C;  5B40 A;  4R8P D;  5B40 B;  3REK B;  1P3M D;  4NE3 A;  4G92 C;  3AZL A;  4CSR A;  4QLC C;  3MGR D;  4CSR B;  3X1V B;  5GSU C;  5B2J D;  1B67 A;  3LZ1 B;  4KHA B;  3MVD D;  5AY8 C;  3AV2 B;  4LD9 A;  3KWQ C;  4LD9 B;  4YS3 A;  4X23 C;  5AV5 B;  1HQ3 C;  4JJN A;  5B31 C;  3AZL D;  2YFV A;  3AZN B;  5B33 B;  1M1A A;  5B32 C;  2YFV B;  1M1A B;  4AWL B;  5JA4 B;  4UUZ B;  3AZG D;  3C1C B;  4YS3 D;  4ZBJ B;  5GT0 B;  3MGQ B;  3AZJ D;  3AZM B;  5BO0 B;  3MGP B;  5BT1 C;  5AV6 C;  4JJN D;  3V9R A;  2FJ7 C;  3WA9 D;  4NFT A;  5AVC C;  3WTP E;  1F66 A;  3B0D B;  1M18 C;  3KXB B;  3REH B;  1KX5 C;  5CPJ D;  5B2I A;  5B24 C;  5AVB B;  3AV1 C;  1F66 D;  1S32 B;  1P3B B;  1P3F B;  3UT9 C;  4E44 A;  3W99 C;  3A6N B;  3AZH A;  3X1T B;  3AZH B;  1P34 C;  5B2I D;  5DNN B;  5DNM D;  3AZI C;  5GT3 B;  1WWI A;  3NQJ A;  1P3A D;  1P3L D;  1KX4 D;  2F8N B;  1M19 B;  3W98 D;  4QLC A;  5B0Z B;  5GSU A;  3O62 C;  2ARO B;  4R8P C;  5AY8 A;  3KWQ A;  2HUE C;  3KWQ B;  2F8N H;  4X23 A;  4KGC B;  1HQ3 A;  5CPI B;  5B31 A;  5BS7 C;  3VH6 W;  4QLC D;  5BNV A;  5B32 A;  3MGR C;  2NQB B;  3REJ A;  4J8W C;  1P3K C;  3REJ B;  5GXQ C;  2F8N G;  3KUY B;  1N1J A;  3X1S C;  5CP6 D;  1N1J B;  4E45 A;  1BH8 B;  3TU4 B;  5B31 D;  4HGA C;  3R45 B;  2FJ7 A;  5AV8 C;  5B1L C;  3WKJ A;  3WKJ B;  3MNN C;  3AZG C;  3AZJ C;  5AVC A;  5C3I C;  5E5A D;  3AZE A;  5AV6 D;  3B0B A;  1M18 A;  3AZE B;  1B6W A;  3WA9 C;  1KX5 A;  2FJ7 D;  5B24 A;  4KUD A;  3MGS C;  3C1B C;  3REI C;  4DRB A;  3X1U D;  4KUD B;  4Z66 B;  5AVC D;  1P3O B;  3B0C T;  1M18 D;  3UT9 A;  1P3G C;  3W99 A;  5AV9 D;  1ZLA C;  5CPJ C;  1P34 A;  3LZ0 C;  3AZI A;  4XZQ C;  3AV1 D;  3WTP B;  5CHL B;  2HIO D;  4XUJ C;  5F99 D;  4WNN B;  3UT9 D;  1U35 A;  3W99 D;  3O62 A;  4WU8 D;  1U35 B;  1P3I C;  1ID3 C;  4R8P A;  2IO5 C;  5KDM A;  1H3O A;  4H9P A;  2CV5 B;  3VH5 A;  1P3P D;  5FUG B;  3W98 C;  4EO5 C;  1P3M B;  3KSY A;  5BS7 A;  3UTB C;  3MGR A;  2BYK A;  2BYK B;  5B2J B;  3O62 D;  1P3K A;  3MVD A;  5GXQ A;  3MVD B;  1TAF A;  2PYO D;  3X1S A;  4H9S A;  1KX3 D;  4J8X C;  3AZL B;  3W96 C;  4Z5T C;  5AV8 A;  1AOI D;  5B1L A;  4J8W D;  3REL D;  1P3K D;  5GXQ D;  3AZF C;  3MNN A;  3AZG A;  3AZJ A;  2LY8 A;  4CAY A;  4YS3 B;  3B6G C;  3VH6 T;  5CP6 C;  3X1S D;  4JJN B;  5CPK D;  4J8V C;  3WA9 A;  5AV8 D;  5B1L D;  3W97 C;  3C1B A;  3REI A;  3MNN D;  5JRG C;  3AYW C;  4WU9 D;  3AFA D;  4NE6 A;  5E5A C;  5B0Y C;  3B6F C;  1P3G A;  3V9R B;  1ZLA A;  3LJA C;  5CPJ A;  3LZ0 A;  3REK D;  4XZQ A;  2BYM A;  3MGS D;  3X1U C;  3C1B D;  3REI D;  2BYM B;  3WAA C;  3LEL C;  1F66 B;  1A7W A;  1P3G D;  5AV9 C;  3LZ1 D;  1ID3 A;  1ZLA D;  1BH9 A;  3LZ0 D;  5DNM A;  5B2I B;  1BH9 B;  1TZY C;  5DNM B;  4XZQ D;  1P3A A;  2HIO C;  5B1M C;  1P3A B;  1P3L A;  1KX4 A;  1P3L B;  1KX4 B;  3W98 A;  4H9R A;  4XUJ D;  5F99 C;  5B33 D;  3UTB A;  4WU8 C;  2NZD D;  4H9N A;  1P3I D;  1ID3 D;  3C1C D;  3MGQ D;  1WWS A;  3NQJ B;  1P3P C;  3AZK C;  4ZUX C;  4J8X A;  3UTB D;  4G92 B;  3W96 A;  4Z5T A;  4QLC B;  5GSU B;  3AZF A;  5AY8 B;  3B6G A;  2PYO C;  5CP6 A;  4X23 B;  1KX3 C;  1HQ3 B;  5B31 B;  3KXB D;  4J8X D;  3W96 D;  4Z5T D;  5B32 B;  1AOI C;  5BNV B;  3REL C;  3W97 A;  3AZF D;  3B6G D;  4YM6 C;  5E5A A;  5AV6 A;  5AV6 B;  4H9Q A; 
#chains in the Genus database with same CATH topology
 4H9Q B;  5CPK C;  4J8V D;  2FJ7 B;  3W97 D;  5GT3 D;  3X1U A;  1HTA A;  4G91 C;  5JRG D;  3AN2 C;  3UTA C;  3AYW D;  4WU9 C;  2Y2M A;  1BFM A;  2F8N D;  5AVC B;  3LEL A;  3AFA C;  4J8U C;  3WAA A;  5G49 A;  5B31 G;  2XD1 A;  1EQZ C;  5B0Y D;  5B32 G;  1M18 B;  1Q9C A;  3B6F D;  5AV9 A;  2L5A A;  2ARO D;  3LJA D;  1KX5 B;  5B40 C;  5B24 B;  3REK C;  1TZY A;  3AV1 A;  3AV1 B;  2DF4 C;  2UWX A;  2HIO A;  1KU5 A;  3LEL D;  3WAA D;  5CPI D;  5F99 A;  3X1V C;  4WU8 A;  3LZ1 C;  3UT9 B;  3VH5 W;  3W99 B;  2Y2O A;  3AV2 C;  1P34 B;  4LD9 C;  1R4V A;  1TZY D;  3AZI B;  3KUY D;  1P3P A;  3AZK A;  5B1M D;  3TU4 D;  5AV5 C;  3IP4 C;  4ZUX A;  3AZN C;  5B33 C;  2YFW A;  2NZD C;  4AWL C;  3O62 B;  4R8P B;  3C1C C;  4ZBJ C;  5KDM B;  5GT0 C;  3MGQ C;  1H3O B;  2HUE B;  4H9P B;  3AZM C;  2PYO A;  3EG5 B;  3MGP C;  3AZK D;  4H9O A;  2Y2P A;  1KX3 A;  4H9O B;  3P5J B;  4ZUX D;  1F1E A;  3MGR B;  1AOI A;  3REL A;  4J8W A;  4J8W B;  1P3K B;  2F8N K;  5GXQ B;  4Z66 D;  4YM6 A;  1TAF B;  3B0D C;  3X1S B;  3KXB C;  5CPK A;  3REH C;  4HGA B;  5AV8 B;  5AVB C;  5B1L B;  3AN2 A;  3MNN B;  3AZG B;  3AZJ B;  4WU9 A;  4CAY B;  4YM6 D;  5C3I B;  3AFA A;  4J8U A;  1S32 C;  1EQZ A;  1P3B C;  1P3F C;  3A6N C;  3X1T C;  4NE5 A;  3WA9 B;  5DNN C;  3REK A;  5GT3 C;  5BNX A;  3MGS A;  2CV5 D;  3AN2 D;  3MGS B;  5BNX B;  3C1B B;  3REI B;  3UTA D;  1M19 C;  4J8U D;  2Y2G A;  1EQZ D;  5B0Z C;  3X1V A;  3LZ1 A;  4KHA A;  2ARO C;  1P3G B;  3AV2 A;  1ZLA B;  5CPJ B;  5B40 D;  3LZ0 B;  4Z2M H;  4XZQ B;  4KGC C;  5AV5 A;  5CPI C;  4XUJ A;  3AZN A;  5B33 A;  4XUJ B;  3A1K A;  3X1V D;  2NQB C;  2NZD A;  1P3I A;  4DRA A;  2NZD B;  3REJ C;  5JA4 A;  1P3I B;  1ID3 B;  3AV2 D;  4UUZ A;  3C1C A;  4LD9 D;  2IO5 B;  5GT0 A;  3MGQ A;  4Z2M G;  3KUY C;  5BO0 A;  3AZM A;  3MGP A;  2RVQ C;  3TU4 C;  5AV5 D;  3VH5 T;  3W98 B;  4H9R B;  4EO5 B;  3AZN D;  1JFI A;  3UTB B;  1M1A D;  1JFI B;  3B0C W;  4H9N B;  3WKJ C;  5GT0 D;  3AZM D;  3MGP D;  3AZE C;  3KXB A;  3REH A;  4J8X B;  3W96 B;  4Z5T B;  5AVB A;  4WZS B;  4KUD C;  3AZF B;  4Z66 C;  1P3O C;  3B6G B;  2F2A C;  5CP6 B;  1S32 A;  1P3B A;  1P3F A;  1ULY A;  3A6N A;  3X1T A;  3REH D;  4J8V A;  4J8V B;  5AVB D;  5DNN A;  3W97 B;  5GT3 A;  3WTP C;  5JRG A;  3AYW A;  5JRG B;  3AYW B;  2F8N A;  1M19 A;  5E5A B;  1S32 D;  5B0Y A;  2JSS A;  2Y2N A;  1P3B D;  1P3F D;  5B0Y B;  5B0Z A;  3B6F A;  3X1T D;  2ZY2 A;  3A6N D;  1U35 C;  2ARO A;  3B6F B;  3LJA A;  3AZH D;  3LJA B;  5DNN D;  2CV5 C;  3X1U B;  4KGC A;  1M19 D;  5CPI A;  3LEL B;  1P3M C;  3WAA B;  5G49 B;  5B0Z D;  2NQB A;  5B2J C;  5GSU D;  5AV9 B;  3MVD C;  5AY8 D;  3AL0 C;  3KWQ D;  3KUY A;  1TZY B;  1BH8 A;  5B1M A;  4H9S C;  3TU4 A;  4X23 D;  2HIO B;  2ZY4 A;  5B1M B;  4KGC D;  1HQ3 D;  3AZL C;  3R45 A;  5F99 B;  5B32 D;  2NQB D;  4WU8 B;  3REJ D;  2Y2Q A;  3VH6 A;  4YS3 C;  3NQU A;  3NQU B;  2RVQ D;  1P3P B;  3AZK B;  5BT1 D;  4JJN C;  4ZUX B;  2CWE A;  1M1A C;  2YFW B;  3WKJ D;  4WV4 B;  4Z66 A;  1P3O A;  2PYO B;  3AZE D;  1PZR A;  1KX3 B;  4WJ3 C;  1KX5 D;  1AOI B;  3REL B;  5B24 D;  3WTP A;  4KUD D;  2Y2I A;  1P3O D;  2Y2H A;  4YM6 B;  1F66 C;  4WNN A;  5CPK B;  4M6B A;  1P34 D;  5B2I C;  5DNM C;  3AZI D;  2CV5 A;  3WTP D;  3UTA A;  3AN2 B;  3H0L C;  4G91 B;  3UTA B;  5FUG A;  1Z2C B;  4WU9 B;  1P3A C;  1P3L C;  1KX4 C;  3AFA B;  4J8U B;  1P3M A;  3FDD A;  1EQZ B;  5B2J A;  1U35 D;  3AZH C;  5B40 A;  4R8P D;  1W2E A;  2ZM5 A;  5B40 B;  3REK B;  1P3M D;  4NE3 A;  4G92 C;  3AZL A;  4CSR A;  4QLC C;  3MGR D;  4CSR B;  3X1V B;  5GSU C;  5B2J D;  1B67 A;  3LZ1 B;  4KHA B;  3MVD D;  5AY8 C;  3AV2 B;  4LD9 A;  3KWQ C;  4LD9 B;  4YS3 A;  4X23 C;  5AV5 B;  1HQ3 C;  2G5H C;  4JJN A;  5B31 C;  3AZL D;  2YFV A;  3AZN B;  2J8P A;  5B33 B;  5B32 C;  2YFV B;  1M1A A;  1M1A B;  4AWL B;  5JA4 B;  4UUZ B;  3AZG D;  3C1C B;  4YS3 D;  4ZBJ B;  5GT0 B;  3MGQ B;  3AZJ D;  3AZM B;  5BO0 B;  3MGP B;  5BT1 C;  5AV6 C;  4JJN D;  2DQN C;  3V9R A;  2JCH A;  2FJ7 C;  3WA9 D;  4NFT A;  2Y2K A;  5AVC C;  3WTP E;  1F66 A;  3B0D B;  3H0R C;  1M18 C;  3KXB B;  3REH B;  2VQR A;  1KX5 C;  5CPJ D;  5B2I A;  5B24 C;  5AVB B;  3AV1 C;  2Y2L A;  2JE5 A;  2W8S A;  1F66 D;  1S32 B;  1P3B B;  1P3F B;  3UT9 C;  4E44 A;  3W99 C;  3A6N B;  3AZH A;  3X1T B;  3AZH B;  1P34 C;  5B2I D;  5DNN B;  5DNM D;  3AZI C;  5GT3 B;  1WWI A;  3NQJ A;  1P3A D;  1P3L D;  1KX4 D;  2F8N B;  1M19 B;  3W98 D;  2G5I C;  4QLC A;  5B0Z B;  5GSU A;  3O62 C;  2ARO B;  4R8P C;  5AY8 A;  3KWQ A;  2HUE C;  3KWQ B;  2F8N H;  4X23 A;  4KGC B;  1HQ3 A;  5CPI B;  5B31 A;  5BS7 C;  3EPH A;  3VH6 W;  4QLC D;  5BNV A;  5B32 A;  3MGR C;  2NQB B;  3REJ A;  4J8W C;  1P3K C;  3REJ B;  5GXQ C;  2Y2J A;  2F8N G;  3KUY B;  1N1J A;  3X1S C;  5CP6 D;  1N1J B;  4E45 A;  1BH8 B;  3TU4 B;  5B31 D;  4HGA C;  3R45 B;  2FJ7 A;  3A1I A;  5AV8 C;  5B1L C;  3WKJ A;  3WKJ B;  3MNN C;  3AZG C;  3AZJ C;  5AVC A;  5C3I C;  5E5A D;  3AZE A;  5AV6 D;  3B0B A;  1M18 A;  3AZE B;  3F6T A;  1B6W A;  3WA9 C;  1KX5 A;  2FJ7 D;  5B24 A;  4KUD A;  3MGS C;  3C1B C;  3REI C;  4DRB A;  3X1U D;  4KUD B;  4Z66 B;  5AVC D;  1P3O B;  3B0C T;  1M18 D;  3UT9 A;  1P3G C;  3W99 A;  5AV9 D;  1ZLA C;  5CPJ C;  1P34 A;  3LZ0 C;  3AZI A;  4XZQ C;  3AV1 D;  3WTP B;  5CHL B;  2HIO D;  4XUJ C;  5F99 D;  4WNN B;  3UT9 D;  1U35 A;  3W99 D;  3O62 A;  4WU8 D;  1U35 B;  1P3I C;  1ID3 C;  4R8P A;  2IO5 C;  2BG1 A;  5KDM A;  1H3O A;  4H9P A;  2CV5 B;  4DQY B;  3VH5 A;  1P3P D;  5FUG B;  3W98 C;  4EO5 C;  1P3M B;  3KSY A;  5BS7 A;  3UTB C;  3MGR A;  2BYK A;  2BYK B;  5B2J B;  3O62 D;  1P3K A;  3MVD A;  5GXQ A;  3MVD B;  3KFU G;  1TAF A;  2PYO D;  3X1S A;  4H9S A;  1KX3 D;  4J8X C;  3AZL B;  3W96 C;  4Z5T C;  3EPK A;  5AV8 A;  1AOI D;  5B1L A;  4J8W D;  3REL D;  1P3K D;  5GXQ D;  3AZF C;  3MNN A;  3AZG A;  3AZJ A;  2LY8 A;  4CAY A;  4YS3 B;  3B6G C;  3VH6 T;  1T3U A;  5CP6 C;  3X1S D;  4JJN B;  5CPK D;  2XD5 A;  4J8V C;  3WA9 A;  5AV8 D;  5B1L D;  3W97 C;  4UPK A;  3C1B A;  3REI A;  3MNN D;  5JRG C;  3AYW C;  4WU9 D;  3AFA D;  4NE6 A;  5E5A C;  5B0Y C;  3B6F C;  1P3G A;  3V9R B;  1ZLA A;  3LJA C;  5CPJ A;  3LZ0 A;  3REK D;  4XZQ A;  2BYM A;  3MGS D;  3X1U C;  3C1B D;  3REI D;  2BYM B;  3WAA C;  3LEL C;  1F66 B;  3H0M C;  1A7W A;  1P3G D;  5AV9 C;  3LZ1 D;  1ID3 A;  1ZLA D;  1BH9 A;  3LZ0 D;  5DNM A;  5B2I B;  1BH9 B;  1TZY C;  5DNM B;  4XZQ D;  1P3A A;  2ZY3 A;  2HIO C;  5B1M C;  1P3A B;  1P3L A;  1KX4 A;  1P3L B;  1KX4 B;  3W98 A;  4H9R A;  4XUJ D;  5F99 C;  5B33 D;  3UTB A;  2ZY5 A;  4WU8 C;  2NZD D;  4H9N A;  1P3I D;  1ID3 D;  3C1C D;  3MGQ D;  1WWS A;  3NQJ B;  1P3P C;  2FFF B;  3AZK C;  4ZUX C;  4J8X A;  3UTB D;  4G92 B;  3W96 A;  4Z5T A;  4QLC B;  5GSU B;  3AZF A;  5AY8 B;  3B6G A;  2PYO C;  5CP6 A;  3EPL A;  4X23 B;  1KX3 C;  1HQ3 B;  2RIQ A;  5B31 B;  3KXB D;  4J8X D;  3W96 D;  4Z5T D;  5B32 B;  1AOI C;  5BNV B;  3REL C;  3W97 A;  3EPJ A;  3AZF D;  3B6G D;  4YM6 C;  5E5A A;  5AV6 A;  5AV6 B;  4H9Q A; 
#chains in the Genus database with same CATH homology
 4H9Q B;  5CPK C;  4J8V D;  2FJ7 B;  3W97 D;  5GT3 D;  3X1U A;  1HTA A;  4G91 C;  5JRG D;  3AN2 C;  3UTA C;  3AYW D;  4WU9 C;  2Y2M A;  1BFM A;  2F8N D;  5AVC B;  3LEL A;  3AFA C;  4J8U C;  3WAA A;  5G49 A;  5B31 G;  2XD1 A;  1EQZ C;  5B0Y D;  5B32 G;  1M18 B;  1Q9C A;  3B6F D;  5AV9 A;  2L5A A;  2ARO D;  3LJA D;  1KX5 B;  5B40 C;  5B24 B;  3REK C;  1TZY A;  3AV1 A;  3AV1 B;  2DF4 C;  2UWX A;  2HIO A;  1KU5 A;  3LEL D;  3WAA D;  5CPI D;  5F99 A;  3X1V C;  4WU8 A;  3LZ1 C;  3UT9 B;  3VH5 W;  3W99 B;  2Y2O A;  3AV2 C;  1P34 B;  4LD9 C;  1R4V A;  1TZY D;  3AZI B;  3KUY D;  1P3P A;  3AZK A;  5B1M D;  3TU4 D;  5AV5 C;  3IP4 C;  4ZUX A;  3AZN C;  5B33 C;  2YFW A;  2NZD C;  4AWL C;  3O62 B;  4R8P B;  3C1C C;  4ZBJ C;  5KDM B;  5GT0 C;  3MGQ C;  1H3O B;  2HUE B;  4H9P B;  3AZM C;  2PYO A;  3EG5 B;  3MGP C;  3AZK D;  4H9O A;  2Y2P A;  1KX3 A;  4H9O B;  3P5J B;  4ZUX D;  1F1E A;  3MGR B;  1AOI A;  3REL A;  4J8W A;  4J8W B;  1P3K B;  2F8N K;  5GXQ B;  4Z66 D;  4YM6 A;  1TAF B;  3B0D C;  3X1S B;  3KXB C;  5CPK A;  3REH C;  4HGA B;  5AV8 B;  5AVB C;  5B1L B;  3AN2 A;  3MNN B;  3AZG B;  3AZJ B;  4WU9 A;  4CAY B;  4YM6 D;  5C3I B;  3AFA A;  4J8U A;  1S32 C;  1EQZ A;  1P3B C;  1P3F C;  3A6N C;  3X1T C;  4NE5 A;  3WA9 B;  5DNN C;  3REK A;  5GT3 C;  5BNX A;  3MGS A;  2CV5 D;  3AN2 D;  3MGS B;  5BNX B;  3C1B B;  3REI B;  3UTA D;  1M19 C;  4J8U D;  2Y2G A;  1EQZ D;  5B0Z C;  3X1V A;  3LZ1 A;  4KHA A;  2ARO C;  1P3G B;  3AV2 A;  1ZLA B;  5CPJ B;  5B40 D;  3LZ0 B;  4Z2M H;  4XZQ B;  4KGC C;  5AV5 A;  5CPI C;  4XUJ A;  3AZN A;  5B33 A;  4XUJ B;  3A1K A;  3X1V D;  2NQB C;  2NZD A;  1P3I A;  4DRA A;  2NZD B;  3REJ C;  5JA4 A;  1P3I B;  1ID3 B;  3AV2 D;  4UUZ A;  3C1C A;  4LD9 D;  2IO5 B;  5GT0 A;  3MGQ A;  4Z2M G;  3KUY C;  5BO0 A;  3AZM A;  3MGP A;  2RVQ C;  3TU4 C;  5AV5 D;  3VH5 T;  3W98 B;  4H9R B;  4EO5 B;  3AZN D;  1JFI A;  3UTB B;  1M1A D;  1JFI B;  3B0C W;  4H9N B;  3WKJ C;  5GT0 D;  3AZM D;  3MGP D;  3AZE C;  3KXB A;  3REH A;  4J8X B;  3W96 B;  4Z5T B;  5AVB A;  4WZS B;  4KUD C;  3AZF B;  4Z66 C;  1P3O C;  3B6G B;  2F2A C;  5CP6 B;  1S32 A;  1P3B A;  1P3F A;  1ULY A;  3A6N A;  3X1T A;  3REH D;  4J8V A;  4J8V B;  5AVB D;  5DNN A;  3W97 B;  5GT3 A;  3WTP C;  5JRG A;  3AYW A;  5JRG B;  3AYW B;  2F8N A;  1M19 A;  5E5A B;  1S32 D;  5B0Y A;  2JSS A;  2Y2N A;  1P3B D;  1P3F D;  5B0Y B;  5B0Z A;  3B6F A;  3X1T D;  2ZY2 A;  3A6N D;  1U35 C;  2ARO A;  3B6F B;  3LJA A;  3AZH D;  3LJA B;  5DNN D;  2CV5 C;  3X1U B;  4KGC A;  1M19 D;  5CPI A;  3LEL B;  1P3M C;  3WAA B;  5G49 B;  5B0Z D;  2NQB A;  5B2J C;  5GSU D;  5AV9 B;  3MVD C;  5AY8 D;  3AL0 C;  3KWQ D;  3KUY A;  1TZY B;  1BH8 A;  5B1M A;  4H9S C;  3TU4 A;  4X23 D;  2HIO B;  2ZY4 A;  5B1M B;  4KGC D;  1HQ3 D;  3AZL C;  3R45 A;  5F99 B;  5B32 D;  2NQB D;  4WU8 B;  3REJ D;  2Y2Q A;  3VH6 A;  4YS3 C;  3NQU A;  3NQU B;  2RVQ D;  1P3P B;  3AZK B;  5BT1 D;  4JJN C;  4ZUX B;  2CWE A;  1M1A C;  2YFW B;  3WKJ D;  4WV4 B;  4Z66 A;  1P3O A;  2PYO B;  3AZE D;  1PZR A;  1KX3 B;  4WJ3 C;  1KX5 D;  1AOI B;  3REL B;  5B24 D;  3WTP A;  4KUD D;  2Y2I A;  1P3O D;  2Y2H A;  4YM6 B;  1F66 C;  4WNN A;  5CPK B;  4M6B A;  1P34 D;  5B2I C;  5DNM C;  3AZI D;  2CV5 A;  3WTP D;  3UTA A;  3AN2 B;  3H0L C;  4G91 B;  3UTA B;  5FUG A;  1Z2C B;  4WU9 B;  1P3A C;  1P3L C;  1KX4 C;  3AFA B;  4J8U B;  1P3M A;  3FDD A;  1EQZ B;  5B2J A;  1U35 D;  3AZH C;  5B40 A;  4R8P D;  1W2E A;  2ZM5 A;  5B40 B;  3REK B;  1P3M D;  4NE3 A;  4G92 C;  3AZL A;  4CSR A;  4QLC C;  3MGR D;  4CSR B;  3X1V B;  5GSU C;  5B2J D;  1B67 A;  3LZ1 B;  4KHA B;  3MVD D;  5AY8 C;  3AV2 B;  4LD9 A;  3KWQ C;  4LD9 B;  4YS3 A;  4X23 C;  5AV5 B;  1HQ3 C;  2G5H C;  4JJN A;  5B31 C;  3AZL D;  2YFV A;  3AZN B;  2J8P A;  5B33 B;  5B32 C;  2YFV B;  1M1A A;  1M1A B;  4AWL B;  5JA4 B;  4UUZ B;  3AZG D;  3C1C B;  4YS3 D;  4ZBJ B;  5GT0 B;  3MGQ B;  3AZJ D;  3AZM B;  5BO0 B;  3MGP B;  5BT1 C;  5AV6 C;  4JJN D;  2DQN C;  3V9R A;  2JCH A;  2FJ7 C;  3WA9 D;  4NFT A;  2Y2K A;  5AVC C;  3WTP E;  1F66 A;  3B0D B;  3H0R C;  1M18 C;  3KXB B;  3REH B;  2VQR A;  1KX5 C;  5CPJ D;  5B2I A;  5B24 C;  5AVB B;  3AV1 C;  2Y2L A;  2JE5 A;  2W8S A;  1F66 D;  1S32 B;  1P3B B;  1P3F B;  3UT9 C;  4E44 A;  3W99 C;  3A6N B;  3AZH A;  3X1T B;  3AZH B;  1P34 C;  5B2I D;  5DNN B;  5DNM D;  3AZI C;  5GT3 B;  1WWI A;  3NQJ A;  1P3A D;  1P3L D;  1KX4 D;  2F8N B;  1M19 B;  3W98 D;  2G5I C;  4QLC A;  5B0Z B;  5GSU A;  3O62 C;  2ARO B;  4R8P C;  5AY8 A;  3KWQ A;  2HUE C;  3KWQ B;  2F8N H;  4X23 A;  4KGC B;  1HQ3 A;  5CPI B;  5B31 A;  5BS7 C;  3EPH A;  3VH6 W;  4QLC D;  5BNV A;  5B32 A;  3MGR C;  2NQB B;  3REJ A;  4J8W C;  1P3K C;  3REJ B;  5GXQ C;  2Y2J A;  2F8N G;  3KUY B;  1N1J A;  3X1S C;  5CP6 D;  1N1J B;  4E45 A;  1BH8 B;  3TU4 B;  5B31 D;  4HGA C;  3R45 B;  2FJ7 A;  3A1I A;  5AV8 C;  5B1L C;  3WKJ A;  3WKJ B;  3MNN C;  3AZG C;  3AZJ C;  5AVC A;  5C3I C;  5E5A D;  3AZE A;  5AV6 D;  3B0B A;  1M18 A;  3AZE B;  3F6T A;  1B6W A;  3WA9 C;  1KX5 A;  2FJ7 D;  5B24 A;  4KUD A;  3MGS C;  3C1B C;  3REI C;  4DRB A;  3X1U D;  4KUD B;  4Z66 B;  5AVC D;  1P3O B;  3B0C T;  1M18 D;  3UT9 A;  1P3G C;  3W99 A;  5AV9 D;  1ZLA C;  5CPJ C;  1P34 A;  3LZ0 C;  3AZI A;  4XZQ C;  3AV1 D;  3WTP B;  5CHL B;  2HIO D;  4XUJ C;  5F99 D;  4WNN B;  3UT9 D;  1U35 A;  3W99 D;  3O62 A;  4WU8 D;  1U35 B;  1P3I C;  1ID3 C;  4R8P A;  2IO5 C;  2BG1 A;  5KDM A;  1H3O A;  4H9P A;  2CV5 B;  4DQY B;  3VH5 A;  1P3P D;  5FUG B;  3W98 C;  4EO5 C;  1P3M B;  3KSY A;  5BS7 A;  3UTB C;  3MGR A;  2BYK A;  2BYK B;  5B2J B;  3O62 D;  1P3K A;  3MVD A;  5GXQ A;  3MVD B;  3KFU G;  1TAF A;  2PYO D;  3X1S A;  4H9S A;  1KX3 D;  4J8X C;  3AZL B;  3W96 C;  4Z5T C;  3EPK A;  5AV8 A;  1AOI D;  5B1L A;  4J8W D;  3REL D;  1P3K D;  5GXQ D;  3AZF C;  3MNN A;  3AZG A;  3AZJ A;  2LY8 A;  4CAY A;  4YS3 B;  3B6G C;  3VH6 T;  1T3U A;  5CP6 C;  3X1S D;  4JJN B;  5CPK D;  2XD5 A;  4J8V C;  3WA9 A;  5AV8 D;  5B1L D;  3W97 C;  4UPK A;  3C1B A;  3REI A;  3MNN D;  5JRG C;  3AYW C;  4WU9 D;  3AFA D;  4NE6 A;  5E5A C;  5B0Y C;  3B6F C;  1P3G A;  3V9R B;  1ZLA A;  3LJA C;  5CPJ A;  3LZ0 A;  3REK D;  4XZQ A;  2BYM A;  3MGS D;  3X1U C;  3C1B D;  3REI D;  2BYM B;  3WAA C;  3LEL C;  1F66 B;  3H0M C;  1A7W A;  1P3G D;  5AV9 C;  3LZ1 D;  1ID3 A;  1ZLA D;  1BH9 A;  3LZ0 D;  5DNM A;  5B2I B;  1BH9 B;  1TZY C;  5DNM B;  4XZQ D;  1P3A A;  2ZY3 A;  2HIO C;  5B1M C;  1P3A B;  1P3L A;  1KX4 A;  1P3L B;  1KX4 B;  3W98 A;  4H9R A;  4XUJ D;  5F99 C;  5B33 D;  3UTB A;  2ZY5 A;  4WU8 C;  2NZD D;  4H9N A;  1P3I D;  1ID3 D;  3C1C D;  3MGQ D;  1WWS A;  3NQJ B;  1P3P C;  2FFF B;  3AZK C;  4ZUX C;  4J8X A;  3UTB D;  4G92 B;  3W96 A;  4Z5T A;  4QLC B;  5GSU B;  3AZF A;  5AY8 B;  3B6G A;  2PYO C;  5CP6 A;  3EPL A;  4X23 B;  1KX3 C;  1HQ3 B;  2RIQ A;  5B31 B;  3KXB D;  4J8X D;  3W96 D;  4Z5T D;  5B32 B;  1AOI C;  5BNV B;  3REL C;  3W97 A;  3EPJ A;  3AZF D;  3B6G D;  4YM6 C;  5E5A A;  5AV6 A;  5AV6 B;  4H9Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...