3AZNB

Crystal structure of human nucleosome core particle containing h4k91q mutation
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
78
structure length
78
Chain Sequence
NIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALQRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords Histone H3.1
publication title Comprehensive Structural Analysis of Mutant Nucleosomes Containing Lysine to Glutamine (KQ) Substitutions in the H3 and H4 Histone-Fold Domains
pubmed doi rcsb
source organism Homo sapiens
total genus 27
structure length 78
sequence length 78
chains with identical sequence F
ec nomenclature
pdb deposition date 2011-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3aznB00
3O62B 2AROB 3B6FB 1P3GC 1P3AD 3LELC 2CV5C 1AOIA 1S32B 1EQZA 3WTPA 3WKJA 2AROA 5CPKC 3MGQB 3B6FA 2FJ7C 4KGCB 5E5AB 3RELB 5CPJB 5F99C 3NQUB 5B40B 1M18B 1S32A 3W97A 1P3BA 3REHC 4JJNA 4Z2MG 3UTBB 4E45A 5B1MB 3MGQA 4KGCA 3AZHD 5E5AA 1F66B 3RELA 5CPJA 3NQUA 5B40A 3AZJD 3MGPB 1M18A 1ZLAD 3B0CT 5B2IA 3C1BC 3AV2D 5AV5C 5B1MA 5GT3A 1P3KC 1F66A 5B32G 3MGPA 3AZIB 4KUDC 5BNXB 5B0YC 5CPKD 2F8NG 5C3IC 5CP6B 3REHD 1P3AB 5B31A 5BO0B 5B24C 5GXQC 5GSUD 5AVCD 4QLCA 5CP6A 3VH5T 5B0ZC 3LZ1B 5B2JA 3C1BD 3B6GA 4AWLC 5AV8C 3AZLC 3AZGA 5BO0A 3REKC 4CSRB 3MNNC 1P3KD 4J8UB 2HIOC 1P3LA 4YS3B 3LZ1A 3AZKB 5JRGC 3AZHB 3AZFD 4KUDD 4CSRA 3W99B 4J8UA 5B1LD 3REJD 4YM6B 3B0DC 3UTAD 3AZKA 5BT1C 4YS3A 4HGAC 1KX5B 4J8XC 4NE6A 5B24D 3W99A 3AZMC 4WNNB 3LJAD 1HQ3C 4YM6A 4X23B 4WU9A 3KUYC 2YFWA 5B32A 1KX5A 3AZLD 5GT0C 3WTPC 4WNNA 3V9RA 5DNNC 3AFAA 4X23A 4J8WD 4NE5A 5B33D 5GSUB 5AVCB 1P3FB 2NZDA 4CAYB 3W97C 1P3BC 5AV9C 3X1TC 4JJNC 3W98A 4R8PB 5BT1D 3AV1D 1P3FA 2JSSA 4CAYA 5AVBD 5B2IC 2F8NK 3AZMD 3AZFB 1TZYB 3WA9B 1HQ3D 4R8PA 1KX4D 4M6BA 3KUYD 5GT3C 1N1JA 5B1LB 4ZUXB 3REJB 2IO5C 3MVDB 1U35C 1P3OC 3UTAB 1BH9A 5GT0D 3AYWC 3AZFA 5CPIB 1TZYA 3C1CB 5DNND 3WA9A 3UT9C 2NQBB 3W96D 5B1LA 1P3MC 4ZUXA 4H9SC 3LJAB 3MVDA 3REJA 3KSYA 5CPIA 3X1TD 4H9PA 3C1CA 1P3IC 2NQBA 5B31C 3MGSB 3MGRD 2PYOA 5DNMA 2BYKB 4G92C 4QLCC 1B6WA 4J8WB 3B6GC 5B2JC 5B33B 4EO5C 1BH8B 4Z5TC 1KX3D 3MGSA 3AZGC 1M19C 5JA4B 1P3LC 2BYKA 4XUJC 1U35D 3X1VD 4H9RB 4XZQA 3X1SB 3A6NC 3AYWD 3AV1B 5B33A 5CHLB 3LZ0C 4WV4B 5AVBB 3O62A 1P3MD 1KX4B 3AV1A 3X1SA 3AN2D 4E44A 3AZED 3VH5A 3X1UB 1HTAA 2HUEC 3W96B 4WU9C 1M1AC 4H9QB 4Z66C 4LD9C 5B32C 4Z5TD 3WAAB 3UTBA 1M19D 4H9NB 3X1UA 3AFAC 1P3GD 3TU4B 3LELD 3AZNB 3KXBB 3KWQC 2CV5D 4H9QA 3MGRB 3WAAA 3LZ0D 4NE3A 2NZDC 2FJ7D 3B0CW 1P3PB 3W98C 5F99D 3TU4A 3AZNA 1P34B 1KX3B 3KXBA 3MGRA 3AZIA 2L5AA 5BNXA 1TAFB 1P34D 2CWEA 2BYMB 2RVQC 4R8PC 1P34A 1A7WA 1P3PA 1KX3A 1M1AD 4LD9D 1P3AA 5AV5D 3AN2B 5AY8C 1TZYC 3AZEB 3KWQD 1ID3C 5AV6C 3REIC 4G91B 5B0YD 3AZJB 1ZLAB 3AV2B 4ZBJC 3VH5W 4WZSB 3AZHA 2PYOC 5DNMC 1P3GB 3AZJA 3LELB 1ZLAA 2CV5B 3AV2A 2YFVB 5GXQD 2RVQD 4J8VC 5BS7A 4WU8C 5CPKB 5B0ZD 2FJ7B 5AV8D 5F99B 4XZQC 3REKD 1AOIC 3MNND 3REHB 2HIOD 1EQZC 3WKJC 5CPKA 3O62C 1ID3D 2AROC 3NQJB 5JRGD 5AV6D 3B6FC 3VH6T 5F99A 4UUZB 5FUGB 1S32C 5G49B 3C1BB 3REHA 5KDMB 3R45B 5AV5B 3MGQC 1P3KB 4KGCC 5E5AC 5GSUA 3RELC 5CPJC 5AVCA 1B67A 5B40C 1M18C 5FUGA 4DRBA 4J8XD 5G49A 3C1BA 4J8VD 4KUDB 5B0YB 4WU8D 3UTBC 5B1MC 1P3KA 1F66C 3MGPC 5C3IB 1EQZD 3WTPD 3WKJD 4KUDA 2AROD 5B24B 3UTAA 5B0ZB 1S32D 3AZIC 3W97D 4AWLB 1P3BD 5AV9D 5AV8B 4JJND 1H3OB 3AZLB 3REKB 5B24A 3MNNB 3MGQD 4KGCD 2HIOB 3LJAA 1Q9CA 3RELD 1WWIA 5B40D 5B0ZA 1M18D 5CP6C 5B2ID 5AV8A 1H3OA 3AZLA 1P3AC 4NFTA 5B1MD 2LY8A 4Z2MH 5GT3D 2HIOA 1F66D 3WTPE 1P3OD 3B0DB 3MGPD 4J8WA 3LZ1C 4HGAB 1BH8A 3UT9D 4J8XB 5JA4A 4J8UC 3AZMB 1HQ3B 4YS3C 4H9RA 3KUYB 3AZKC 3AZHC 1P3ID 5B31D 5AVBA 4J8XA 5GT0B 3W99C 3AZMA 3WTPB 1HQ3A 5DNNB 1KX4A 4YM6C 3KUYA 4QLCD 5CP6D 3B6GD 2F8NH 5B2JD 1KX5C 5GT0A 3AZGD 3W97B 1P3BB 5AV9B 3X1TB 5DNNA 4JJNB 1P3LD 4XUJD 4X23C 3W96A 3LZ1D 3A6ND 1BFMA 5B2IB 4H9NA 5AV9A 3X1TA 4J8UD 4YS3D 5GT3B 3AZKD 1ULYA 2IO5B 5GSUC 1U35B 5AVCC 1P3FC 1P3OB 5BNVB 3X1VB 3AYWB 3W99D 3UT9B 4YM6D 4WU9D 4Z66D 1P3MB 1F1EA 1U35A 5B32D 1P3OA 1TAFA 5BNVA 3X1VA 1KX5D 3AYWA 3AZFC 1P3IB 2BYMA 3UT9A 3AFAD 3WA9C 3VH6A 5B31B 4X23D 1P3MA 4H9SA 5B1LC 4ZUXC 3REJC 1WWSA 3MVDC 4G92B 3UTAC 2NZDD 4QLCB 3AN2A 2F8ND 3B6GB 5B2JB 4EO5B 5CPIC 1P3IA 3C1CC 2NQBC 4Z5TB 3W98D 3AZEA 3AZGB 1M19B 1P3LB 3LJAC 4XUJB 1P3FD 3A6NB 4Z5TA 3LZ0B 4R8PD 1M19A 3MGSC 4XUJA 1P3GA 3LELA 2CV5A 4J8WC 3A6NA 2YFVA 4H9OB 5B33C 5AY8D 1TZYD 3LZ0A 3WA9D 2FJ7A 3REID 4ZUXD 2HUEB 3MVDD 4WU9B 3AV1C 2YFWB 3X1SC 1M1AB 4Z66B 4H9OA 5CPID 3C1CD 5B32B 2NQBD 4LD9B 5AVBC 3NQJA 2PYOD 5DNMD 3V9RB 3AFAB 1KX4C 4UUZA 3KWQB 1M1AA 1JFIB 4Z66A 4LD9A 5KDMA 3R45A 5AV5A 3MGSD 2F8NB 3VH6W 2NZDB 3X1UC 3W98B 3KWQA 3W96C 4KHAB 4XZQD 1JFIA 1AOID 3WAAC 4DRAA 5B0YA 2F8NA 3O62D 3B6FD 5GXQB 3TU4C 3AZNC 4KHAA 3KXBC 3X1SD 3MGRC 1N1JB 1R4VA 1BH9B 5AY8B 5GXQA 5E5AD 5CPJD 1P3PC 1P34C 1KX3C 1ID3B 5JRGB 5AV6B 3REIB 3X1VC 3REKA 3UTBD 3MNNA 3B0BA 4ZBJB 4H9PB 5AY8A 3X1UD 1KU5A 1ID3A 5JRGA 5AV6A 5DNMB 3REIA 2PYOB 3WAAD 3AN2C 4J8VB 4WU8B 3TU4D 3AZEC 3AZND 3KXBD 3AZID 4G91C 3AZJC 5B31G 1ZLAC 4XZQB 1AOIB 3AV2C 1EQZB 4J8VA 3WKJB 1P3PD 4WU8A 5BS7C
chains in the Genus database with same CATH superfamily
3O62B 2AROB 3B6FB 1P3GC 1P3AD 3LELC 2CV5C 1AOIA 1S32B 2Y2PA 1EQZA 3WTPA 3WKJA 2AROA 5CPKC 3MGQB 3B6FA 2FJ7C 4KGCB 5E5AB 3RELB 5CPJB 5F99C 3NQUB 5B40B 1M18B 1S32A 3W97A 1P3BA 3REHC 4JJNA 2ZY4A 4Z2MG 3UTBB 4E45A 5B1MB 3MGQA 4KGCA 3AZHD 5E5AA 1F66B 3RELA 5CPJA 2Y2HA 3NQUA 5B40A 3AZJD 3MGPB 1M18A 1ZLAD 3B0CT 5B2IA 3C1BC 3AV2D 2FFFB 5AV5C 5B1MA 5GT3A 1P3KC 1F66A 5B32G 4WJ3C 3MGPA 1W2EA 3AZIB 4KUDC 5BNXB 5B0YC 5CPKD 2Y2OA 2F8NG 5C3IC 5CP6B 3REHD 2W8SA 1P3AB 5B31A 5BO0B 5B24C 5GXQC 5GSUD 5AVCD 4QLCA 5CP6A 3VH5T 5B0ZC 3LZ1B 5B2JA 3C1BD 3B6GA 4AWLC 5AV8C 3AZLC 3AZGA 5BO0A 3REKC 4CSRB 3MNNC 1P3KD 4J8UB 2HIOC 1P3LA 4YS3B 3LZ1A 3AZKB 5JRGC 3AZHB 3AZFD 4KUDD 3IP4C 4CSRA 3W99B 4J8UA 3EPHA 5B1LD 3REJD 4YM6B 3B0DC 3UTAD 3AZKA 2UWXA 5BT1C 4YS3A 1T3UA 2F2AC 4HGAC 1KX5B 2ZY3A 4J8XC 4NE6A 5B24D 3W99A 3AZMC 4WNNB 3LJAD 1HQ3C 4YM6A 4X23B 2Y2KA 3KUYC 2YFWA 4WU9A 5B32A 1KX5A 3AZLD 5GT0C 4WNNA 3WTPC 3V9RA 5DNNC 3AFAA 4X23A 2BG1A 4J8WD 4NE5A 5B33D 5GSUB 5AVCB 1P3FB 2NZDA 4CAYB 3W97C 1P3BC 5AV9C 3X1TC 4JJNC 3W98A 4R8PB 3F6TA 3P5JB 5BT1D 1PZRA 3AV1D 1P3FA 2JSSA 4CAYA 5AVBD 5B2IC 4DQYB 2F8NK 3AZMD 3AZFB 1TZYB 3WA9B 1HQ3D 4R8PA 1KX4D 4M6BA 3KUYD 5GT3C 1N1JA 2G5IC 5B1LB 4ZUXB 3REJB 2IO5C 2XD1A 3MVDB 2ZM5A 1U35C 3UTAB 1P3OC 1BH9A 2DQNC 5GT0D 3AYWC 3AZFA 5CPIB 1TZYA 3C1CB 5DNND 3WA9A 3UT9C 2NQBB 3A1KA 3W96D 5B1LA 1P3MC 4ZUXA 4H9SC 3LJAB 3MVDA 3REJA 3KSYA 5CPIA 3X1TD 4H9PA 3C1CA 1P3IC 2NQBA 5B31C 3MGSB 3MGRD 2PYOA 5DNMA 2BYKB 4G92C 4QLCC 1B6WA 4J8WB 3B6GC 5B2JC 5B33B 4EO5C 1BH8B 3H0RC 4Z5TC 1KX3D 3MGSA 3AZGC 1M19C 5JA4B 1P3LC 2BYKA 4XUJC 1U35D 3X1VD 2Y2IA 4H9RB 4XZQA 3X1SB 3A6NC 3AYWD 5B33A 3AV1B 5CHLB 3LZ0C 4WV4B 5AVBB 3O62A 1P3MD 1KX4B 3AV1A 3X1SA 3AN2D 4E44A 3AZED 3VH5A 3X1UB 1HTAA 2HUEC 3W96B 4WU9C 1M1AC 4H9QB 4Z66C 4LD9C 5B32C 4Z5TD 3WAAB 3UTBA 1M19D 4H9NB 3X1UA 3AFAC 1P3GD 3TU4B 3LELD 3AZNB 3KXBB 3KWQC 2CV5D 4H9QA 2Y2GA 3MGRB 3WAAA 3LZ0D 4NE3A 2NZDC 3H0LC 2FJ7D 3B0CW 1P3PB 3W98C 5F99D 3TU4A 3AZNA 1P34B 1KX3B 3KXBA 3MGRA 3AZIA 2L5AA 5BNXA 1TAFB 1P34D 2CWEA 2BYMB 2RVQC 4R8PC 1P34A 1A7WA 1P3PA 1KX3A 1M1AD 4LD9D 1P3AA 5AV5D 3AN2B 5AY8C 1TZYC 4UPKA 3AZEB 3KWQD 1ID3C 5AV6C 3REIC 4G91B 5B0YD 3AZJB 1ZLAB 3AV2B 4ZBJC 3VH5W 3KFUG 4WZSB 3AZHA 2PYOC 5DNMC 1P3GB 3H0MC 3AZJA 3LELB 1ZLAA 2CV5B 3AV2A 2YFVB 5GXQD 2RVQD 4J8VC 5BS7A 4WU8C 5CPKB 5B0ZD 2FJ7B 5AV8D 5F99B 4XZQC 3REKD 1AOIC 3MNND 3REHB 2DF4C 2HIOD 1EQZC 3WKJC 5CPKA 3O62C 1ID3D 2AROC 3NQJB 5JRGD 5AV6D 3B6FC 3VH6T 5F99A 4UUZB 2RIQA 5FUGB 1S32C 5G49B 3C1BB 3REHA 5KDMB 3R45B 5AV5B 3MGQC 1P3KB 4KGCC 5E5AC 5GSUA 3RELC 5CPJC 5AVCA 1B67A 5B40C 1M18C 5FUGA 4DRBA 4J8XD 5G49A 3C1BA 4J8VD 4KUDB 5B0YB 4WU8D 2J8PA 3UTBC 5B1MC 1P3KA 3EPKA 1F66C 3MGPC 5C3IB 1EQZD 3WTPD 3WKJD 4KUDA 2Y2MA 2AROD 5B24B 2Y2LA 3UTAA 5B0ZB 1S32D 3AZIC 3W97D 4AWLB 1P3BD 5AV9D 5AV8B 4JJND 1H3OB 3AZLB 3REKB 5B24A 3MNNB 3MGQD 4KGCD 2HIOB 3LJAA 1Q9CA 3RELD 1WWIA 5B40D 5B0ZA 1M18D 5CP6C 5B2ID 5AV8A 1H3OA 3AZLA 1P3AC 4NFTA 5B1MD 2LY8A 4Z2MH 5GT3D 2HIOA 1F66D 3WTPE 1P3OD 3B0DB 3MGPD 4J8WA 3LZ1C 4HGAB 1BH8A 3UT9D 4J8XB 5JA4A 4J8UC 3AZMB 1HQ3B 4YS3C 4H9RA 3KUYB 3AZKC 3AZHC 1P3ID 5B31D 5AVBA 4J8XA 5GT0B 3W99C 3AZMA 3WTPB 1HQ3A 5DNNB 3EPLA 1KX4A 4YM6C 3KUYA 4QLCD 5CP6D 3B6GD 2F8NH 5B2JD 1KX5C 5GT0A 3AZGD 3W97B 1P3BB 5AV9B 3X1TB 5DNNA 4JJNB 1P3LD 4XUJD 4X23C 3W96A 3LZ1D 3A6ND 1BFMA 2VQRA 5B2IB 4H9NA 5AV9A 3X1TA 4J8UD 4YS3D 5GT3B 3AZKD 1ULYA 2IO5B 5GSUC 1U35B 5AVCC 1P3FC 1P3OB 5BNVB 3X1VB 3AYWB 3W99D 3UT9B 4YM6D 4WU9D 4Z66D 1P3MB 3AL0C 1F1EA 1U35A 5B32D 1P3OA 1TAFA 5BNVA 3X1VA 1KX5D 3AYWA 3AZFC 2Y2NA 1P3IB 2BYMA 3UT9A 3AFAD 3WA9C 3VH6A 5B31B 4X23D 1P3MA 4H9SA 5B1LC 4ZUXC 3REJC 1WWSA 3MVDC 4G92B 3UTAC 2NZDD 4QLCB 3AN2A 2F8ND 3B6GB 5B2JB 4EO5B 2JE5A 5CPIC 1P3IA 3C1CC 2NQBC 4Z5TB 3W98D 3AZEA 3AZGB 1M19B 1P3LB 3LJAC 4XUJB 1P3FD 3A6NB 4Z5TA 3LZ0B 4R8PD 1M19A 3MGSC 4XUJA 2G5HC 1P3GA 3EG5B 3LELA 2CV5A 4J8WC 3A6NA 2YFVA 4H9OB 5B33C 5AY8D 1TZYD 3LZ0A 3WA9D 2FJ7A 3REID 4ZUXD 2HUEB 3MVDD 4WU9B 3AV1C 2YFWB 3X1SC 1M1AB 4Z66B 4H9OA 5CPID 3C1CD 5B32B 2NQBD 4LD9B 5AVBC 3NQJA 2PYOD 5DNMD 3V9RB 3AFAB 1KX4C 4UUZA 3KWQB 1M1AA 1JFIB 4Z66A 4LD9A 5KDMA 3R45A 5AV5A 3MGSD 2F8NB 3VH6W 2NZDB 2Y2JA 3X1UC 3W98B 3KWQA 3W96C 4KHAB 4XZQD 1JFIA 3FDDA 1AOID 3WAAC 4DRAA 5B0YA 2F8NA 3O62D 2Y2QA 3B6FD 5GXQB 3TU4C 3AZNC 4KHAA 3KXBC 3X1SD 3MGRC 1N1JB 1R4VA 1BH9B 2ZY2A 5AY8B 2XD5A 5E5AD 5GXQA 5CPJD 1P3PC 1P34C 1KX3C 1ID3B 5JRGB 5AV6B 3REIB 3A1IA 3X1VC 3REKA 3UTBD 3MNNA 3B0BA 4ZBJB 4H9PB 5AY8A 3X1UD 1KU5A 1ID3A 3EPJA 5JRGA 5AV6A 5DNMB 1Z2CB 3REIA 2PYOB 3WAAD 3AN2C 2JCHA 4J8VB 2ZY5A 4WU8B 3TU4D 3AZEC 3AZND 3KXBD 3AZID 4G91C 3AZJC 5B31G 1ZLAC 4XZQB 1AOIB 3AV2C 1EQZB 4J8VA 3WKJB 1P3PD 4WU8A 5BS7C
chains in the Genus database with same CATH topology
3O62B 2AROB 3B6FB 1P3GC 1P3AD 3LELC 2CV5C 1AOIA 1S32B 2Y2PA 1EQZA 3WTPA 3WKJA 2AROA 5CPKC 3MGQB 3B6FA 2FJ7C 4KGCB 5E5AB 3RELB 5CPJB 5F99C 3NQUB 5B40B 1M18B 1S32A 3W97A 1P3BA 3REHC 4JJNA 2ZY4A 4Z2MG 3UTBB 4E45A 5B1MB 3MGQA 4KGCA 3AZHD 5E5AA 1F66B 3RELA 5CPJA 2Y2HA 3NQUA 5B40A 3AZJD 3MGPB 1M18A 1ZLAD 3B0CT 5B2IA 3C1BC 3AV2D 2FFFB 5AV5C 5B1MA 5GT3A 1P3KC 1F66A 5B32G 4WJ3C 3MGPA 1W2EA 3AZIB 4KUDC 5BNXB 5B0YC 5CPKD 2Y2OA 2F8NG 5C3IC 5CP6B 3REHD 2W8SA 1P3AB 5B31A 5BO0B 5B24C 5GXQC 5GSUD 5AVCD 4QLCA 5CP6A 3VH5T 5B0ZC 3LZ1B 5B2JA 3C1BD 3B6GA 4AWLC 5AV8C 3AZLC 3AZGA 5BO0A 3REKC 4CSRB 3MNNC 1P3KD 4J8UB 2HIOC 1P3LA 4YS3B 3LZ1A 3AZKB 5JRGC 3AZHB 3AZFD 4KUDD 3IP4C 4CSRA 3W99B 4J8UA 3EPHA 5B1LD 3REJD 4YM6B 3B0DC 3UTAD 3AZKA 2UWXA 5BT1C 4YS3A 1T3UA 2F2AC 4HGAC 1KX5B 2ZY3A 4J8XC 4NE6A 5B24D 3W99A 3AZMC 4WNNB 3LJAD 1HQ3C 4YM6A 4X23B 2Y2KA 3KUYC 2YFWA 4WU9A 5B32A 1KX5A 3AZLD 5GT0C 4WNNA 3WTPC 3V9RA 5DNNC 3AFAA 4X23A 2BG1A 4J8WD 4NE5A 5B33D 5GSUB 5AVCB 1P3FB 2NZDA 4CAYB 3W97C 1P3BC 5AV9C 3X1TC 4JJNC 3W98A 4R8PB 3F6TA 3P5JB 5BT1D 1PZRA 3AV1D 1P3FA 2JSSA 4CAYA 5AVBD 5B2IC 4DQYB 2F8NK 3AZMD 3AZFB 1TZYB 3WA9B 1HQ3D 4R8PA 1KX4D 4M6BA 3KUYD 5GT3C 1N1JA 2G5IC 5B1LB 4ZUXB 3REJB 2IO5C 2XD1A 3MVDB 2ZM5A 1U35C 3UTAB 1P3OC 1BH9A 2DQNC 5GT0D 3AYWC 3AZFA 5CPIB 1TZYA 3C1CB 5DNND 3WA9A 3UT9C 2NQBB 3A1KA 3W96D 5B1LA 1P3MC 4ZUXA 4H9SC 3LJAB 3MVDA 3REJA 3KSYA 5CPIA 3X1TD 4H9PA 3C1CA 1P3IC 2NQBA 5B31C 3MGSB 3MGRD 2PYOA 5DNMA 2BYKB 4G92C 4QLCC 1B6WA 4J8WB 3B6GC 5B2JC 5B33B 4EO5C 1BH8B 3H0RC 4Z5TC 1KX3D 3MGSA 3AZGC 1M19C 5JA4B 1P3LC 2BYKA 4XUJC 1U35D 3X1VD 2Y2IA 4H9RB 4XZQA 3X1SB 3A6NC 3AYWD 5B33A 3AV1B 5CHLB 3LZ0C 4WV4B 5AVBB 3O62A 1P3MD 1KX4B 3AV1A 3X1SA 3AN2D 4E44A 3AZED 3VH5A 3X1UB 1HTAA 2HUEC 3W96B 4WU9C 1M1AC 4H9QB 4Z66C 4LD9C 5B32C 4Z5TD 3WAAB 3UTBA 1M19D 4H9NB 3X1UA 3AFAC 1P3GD 3TU4B 3LELD 3AZNB 3KXBB 3KWQC 2CV5D 4H9QA 2Y2GA 3MGRB 3WAAA 3LZ0D 4NE3A 2NZDC 3H0LC 2FJ7D 3B0CW 1P3PB 3W98C 5F99D 3TU4A 3AZNA 1P34B 1KX3B 3KXBA 3MGRA 3AZIA 2L5AA 5BNXA 1TAFB 1P34D 2CWEA 2BYMB 2RVQC 4R8PC 1P34A 1A7WA 1P3PA 1KX3A 1M1AD 4LD9D 1P3AA 5AV5D 3AN2B 5AY8C 1TZYC 4UPKA 3AZEB 3KWQD 1ID3C 5AV6C 3REIC 4G91B 5B0YD 3AZJB 1ZLAB 3AV2B 4ZBJC 3VH5W 3KFUG 4WZSB 3AZHA 2PYOC 5DNMC 1P3GB 3H0MC 3AZJA 3LELB 1ZLAA 2CV5B 3AV2A 2YFVB 5GXQD 2RVQD 4J8VC 5BS7A 4WU8C 5CPKB 5B0ZD 2FJ7B 5AV8D 5F99B 4XZQC 3REKD 1AOIC 3MNND 3REHB 2DF4C 2HIOD 1EQZC 3WKJC 5CPKA 3O62C 1ID3D 2AROC 3NQJB 5JRGD 5AV6D 3B6FC 3VH6T 5F99A 4UUZB 2RIQA 5FUGB 1S32C 5G49B 3C1BB 3REHA 5KDMB 3R45B 5AV5B 3MGQC 1P3KB 4KGCC 5E5AC 5GSUA 3RELC 5CPJC 5AVCA 1B67A 5B40C 1M18C 5FUGA 4DRBA 4J8XD 5G49A 3C1BA 4J8VD 4KUDB 5B0YB 4WU8D 2J8PA 3UTBC 5B1MC 1P3KA 3EPKA 1F66C 3MGPC 5C3IB 1EQZD 3WTPD 3WKJD 4KUDA 2Y2MA 2AROD 5B24B 2Y2LA 3UTAA 5B0ZB 1S32D 3AZIC 3W97D 4AWLB 1P3BD 5AV9D 5AV8B 4JJND 1H3OB 3AZLB 3REKB 5B24A 3MNNB 3MGQD 4KGCD 2HIOB 3LJAA 1Q9CA 3RELD 1WWIA 5B40D 5B0ZA 1M18D 5CP6C 5B2ID 5AV8A 1H3OA 3AZLA 1P3AC 4NFTA 5B1MD 2LY8A 4Z2MH 5GT3D 2HIOA 1F66D 3WTPE 1P3OD 3B0DB 3MGPD 4J8WA 3LZ1C 4HGAB 1BH8A 3UT9D 4J8XB 5JA4A 4J8UC 3AZMB 1HQ3B 4YS3C 4H9RA 3KUYB 3AZKC 3AZHC 1P3ID 5B31D 5AVBA 4J8XA 5GT0B 3W99C 3AZMA 3WTPB 1HQ3A 5DNNB 3EPLA 1KX4A 4YM6C 3KUYA 4QLCD 5CP6D 3B6GD 2F8NH 5B2JD 1KX5C 5GT0A 3AZGD 3W97B 1P3BB 5AV9B 3X1TB 5DNNA 4JJNB 1P3LD 4XUJD 4X23C 3W96A 3LZ1D 3A6ND 1BFMA 2VQRA 5B2IB 4H9NA 5AV9A 3X1TA 4J8UD 4YS3D 5GT3B 3AZKD 1ULYA 2IO5B 5GSUC 1U35B 5AVCC 1P3FC 1P3OB 5BNVB 3X1VB 3AYWB 3W99D 3UT9B 4YM6D 4WU9D 4Z66D 1P3MB 3AL0C 1F1EA 1U35A 5B32D 1P3OA 1TAFA 5BNVA 3X1VA 1KX5D 3AYWA 3AZFC 2Y2NA 1P3IB 2BYMA 3UT9A 3AFAD 3WA9C 3VH6A 5B31B 4X23D 1P3MA 4H9SA 5B1LC 4ZUXC 3REJC 1WWSA 3MVDC 4G92B 3UTAC 2NZDD 4QLCB 3AN2A 2F8ND 3B6GB 5B2JB 4EO5B 2JE5A 5CPIC 1P3IA 3C1CC 2NQBC 4Z5TB 3W98D 3AZEA 3AZGB 1M19B 1P3LB 3LJAC 4XUJB 1P3FD 3A6NB 4Z5TA 3LZ0B 4R8PD 1M19A 3MGSC 4XUJA 2G5HC 1P3GA 3EG5B 3LELA 2CV5A 4J8WC 3A6NA 2YFVA 4H9OB 5B33C 5AY8D 1TZYD 3LZ0A 3WA9D 2FJ7A 3REID 4ZUXD 2HUEB 3MVDD 4WU9B 3AV1C 2YFWB 3X1SC 1M1AB 4Z66B 4H9OA 5CPID 3C1CD 5B32B 2NQBD 4LD9B 5AVBC 3NQJA 2PYOD 5DNMD 3V9RB 3AFAB 1KX4C 4UUZA 3KWQB 1M1AA 1JFIB 4Z66A 4LD9A 5KDMA 3R45A 5AV5A 3MGSD 2F8NB 3VH6W 2NZDB 2Y2JA 3X1UC 3W98B 3KWQA 3W96C 4KHAB 4XZQD 1JFIA 3FDDA 1AOID 3WAAC 4DRAA 5B0YA 2F8NA 3O62D 2Y2QA 3B6FD 5GXQB 3TU4C 3AZNC 4KHAA 3KXBC 3X1SD 3MGRC 1N1JB 1R4VA 1BH9B 2ZY2A 5AY8B 2XD5A 5E5AD 5GXQA 5CPJD 1P3PC 1P34C 1KX3C 1ID3B 5JRGB 5AV6B 3REIB 3A1IA 3X1VC 3REKA 3UTBD 3MNNA 3B0BA 4ZBJB 4H9PB 5AY8A 3X1UD 1KU5A 1ID3A 3EPJA 5JRGA 5AV6A 5DNMB 1Z2CB 3REIA 2PYOB 3WAAD 3AN2C 2JCHA 4J8VB 2ZY5A 4WU8B 3TU4D 3AZEC 3AZND 3KXBD 3AZID 4G91C 3AZJC 5B31G 1ZLAC 4XZQB 1AOIB 3AV2C 1EQZB 4J8VA 3WKJB 1P3PD 4WU8A 5BS7C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3O62 B;  2ARO B;  3B6F B;  1P3G C;  1P3A D;  3LEL C;  2CV5 C;  1AOI A;  1S32 B;  1EQZ A;  3WTP A;  3WKJ A;  2ARO A;  5CPK C;  3MGQ B;  3B6F A;  2FJ7 C;  4KGC B;  5E5A B;  3REL B;  5CPJ B;  5F99 C;  3NQU B;  5B40 B;  1M18 B;  1S32 A;  3W97 A;  1P3B A;  3REH C;  4JJN A;  4Z2M G;  3UTB B;  4E45 A;  5B1M B;  3MGQ A;  4KGC A;  3AZH D;  5E5A A;  1F66 B;  3REL A;  5CPJ A;  3NQU A;  5B40 A;  3AZJ D;  3MGP B;  1M18 A;  1ZLA D;  3B0C T;  5B2I A;  3C1B C;  3AV2 D;  5AV5 C;  5B1M A;  5GT3 A;  1P3K C;  1F66 A;  5B32 G;  3MGP A;  3AZI B;  4KUD C;  5BNX B;  5B0Y C;  5CPK D;  2F8N G;  5C3I C;  5CP6 B;  3REH D;  1P3A B;  5B31 A;  5BO0 B;  5B24 C;  5GXQ C;  5GSU D;  5AVC D;  4QLC A;  5CP6 A;  3VH5 T;  5B0Z C;  3LZ1 B;  5B2J A;  3C1B D;  3B6G A;  4AWL C;  5AV8 C;  3AZL C;  3AZG A;  5BO0 A;  3REK C;  4CSR B;  3MNN C;  1P3K D;  4J8U B;  2HIO C;  1P3L A;  4YS3 B;  3LZ1 A;  3AZK B;  5JRG C;  3AZH B;  3AZF D;  4KUD D;  4CSR A;  3W99 B;  4J8U A;  5B1L D;  3REJ D;  4YM6 B;  3B0D C;  3UTA D;  3AZK A;  5BT1 C;  4YS3 A;  4HGA C;  1KX5 B;  4J8X C;  4NE6 A;  5B24 D;  3W99 A;  3AZM C;  4WNN B;  3LJA D;  1HQ3 C;  4YM6 A;  4X23 B;  4WU9 A;  3KUY C;  2YFW A;  5B32 A;  1KX5 A;  3AZL D;  5GT0 C;  3WTP C;  4WNN A;  3V9R A;  5DNN C;  3AFA A;  4X23 A;  4J8W D;  4NE5 A;  5B33 D;  5GSU B;  5AVC B;  1P3F B;  2NZD A;  4CAY B;  3W97 C;  1P3B C;  5AV9 C;  3X1T C;  4JJN C;  3W98 A;  4R8P B;  5BT1 D;  3AV1 D;  1P3F A;  2JSS A;  4CAY A;  5AVB D;  5B2I C;  2F8N K;  3AZM D;  3AZF B;  1TZY B;  3WA9 B;  1HQ3 D;  4R8P A;  1KX4 D;  4M6B A;  3KUY D;  5GT3 C;  1N1J A;  5B1L B;  4ZUX B;  3REJ B;  2IO5 C;  3MVD B;  1U35 C;  1P3O C;  3UTA B;  1BH9 A;  5GT0 D;  3AYW C;  3AZF A;  5CPI B;  1TZY A;  3C1C B;  5DNN D;  3WA9 A;  3UT9 C;  2NQB B;  3W96 D;  5B1L A;  1P3M C;  4ZUX A;  4H9S C;  3LJA B;  3MVD A;  3REJ A;  3KSY A;  5CPI A;  3X1T D;  4H9P A;  3C1C A;  1P3I C;  2NQB A;  5B31 C;  3MGS B;  3MGR D;  2PYO A;  5DNM A;  2BYK B;  4G92 C;  4QLC C;  1B6W A;  4J8W B;  3B6G C;  5B2J C;  5B33 B;  4EO5 C;  1BH8 B;  4Z5T C;  1KX3 D;  3MGS A;  3AZG C;  1M19 C;  5JA4 B;  1P3L C;  2BYK A;  4XUJ C;  1U35 D;  3X1V D;  4H9R B;  4XZQ A;  3X1S B;  3A6N C;  3AYW D;  3AV1 B;  5B33 A;  5CHL B;  3LZ0 C;  4WV4 B;  5AVB B;  3O62 A;  1P3M D;  1KX4 B;  3AV1 A;  3X1S A;  3AN2 D;  4E44 A;  3AZE D;  3VH5 A;  3X1U B;  1HTA A;  2HUE C;  3W96 B;  4WU9 C;  1M1A C;  4H9Q B;  4Z66 C;  4LD9 C;  5B32 C;  4Z5T D;  3WAA B;  3UTB A;  1M19 D;  4H9N B;  3X1U A;  3AFA C;  1P3G D;  3TU4 B;  3LEL D;  3AZN B;  3KXB B;  3KWQ C;  2CV5 D;  4H9Q A;  3MGR B;  3WAA A;  3LZ0 D;  4NE3 A;  2NZD C;  2FJ7 D;  3B0C W;  1P3P B;  3W98 C;  5F99 D;  3TU4 A;  3AZN A;  1P34 B;  1KX3 B;  3KXB A;  3MGR A;  3AZI A;  2L5A A;  5BNX A;  1TAF B;  1P34 D;  2CWE A;  2BYM B;  2RVQ C;  4R8P C;  1P34 A;  1A7W A;  1P3P A;  1KX3 A;  1M1A D;  4LD9 D;  1P3A A;  5AV5 D;  3AN2 B;  5AY8 C;  1TZY C;  3AZE B;  3KWQ D;  1ID3 C;  5AV6 C;  3REI C;  4G91 B;  5B0Y D;  3AZJ B;  1ZLA B;  3AV2 B;  4ZBJ C;  3VH5 W;  4WZS B;  3AZH A;  2PYO C;  5DNM C;  1P3G B;  3AZJ A;  3LEL B;  1ZLA A;  2CV5 B;  3AV2 A;  2YFV B;  5GXQ D;  2RVQ D;  4J8V C;  5BS7 A;  4WU8 C;  5CPK B;  5B0Z D;  2FJ7 B;  5AV8 D;  5F99 B;  4XZQ C;  3REK D;  1AOI C;  3MNN D;  3REH B;  2HIO D;  1EQZ C;  3WKJ C;  5CPK A;  3O62 C;  1ID3 D;  2ARO C;  3NQJ B;  5JRG D;  5AV6 D;  3B6F C;  3VH6 T;  5F99 A;  4UUZ B;  5FUG B;  1S32 C;  5G49 B;  3C1B B;  3REH A;  5KDM B;  3R45 B;  5AV5 B;  3MGQ C;  1P3K B;  4KGC C;  5E5A C;  5GSU A;  3REL C;  5CPJ C;  5AVC A;  1B67 A;  5B40 C;  1M18 C;  5FUG A;  4DRB A;  4J8X D;  5G49 A;  3C1B A;  4J8V D;  4KUD B;  5B0Y B;  4WU8 D;  3UTB C;  5B1M C;  1P3K A;  1F66 C;  3MGP C;  5C3I B;  1EQZ D;  3WTP D;  3WKJ D;  4KUD A;  2ARO D;  5B24 B;  3UTA A;  5B0Z B;  1S32 D;  3AZI C;  3W97 D;  4AWL B;  1P3B D;  5AV9 D;  5AV8 B;  4JJN D;  1H3O B;  3AZL B;  3REK B;  5B24 A;  3MNN B;  3MGQ D;  4KGC D;  2HIO B;  3LJA A;  1Q9C A;  3REL D;  1WWI A;  5B40 D;  5B0Z A;  1M18 D;  5CP6 C;  5B2I D;  5AV8 A;  1H3O A;  3AZL A;  1P3A C;  4NFT A;  5B1M D;  2LY8 A;  4Z2M H;  5GT3 D;  2HIO A;  1F66 D;  3WTP E;  1P3O D;  3B0D B;  3MGP D;  4J8W A;  3LZ1 C;  4HGA B;  1BH8 A;  3UT9 D;  4J8X B;  5JA4 A;  4J8U C;  3AZM B;  1HQ3 B;  4YS3 C;  4H9R A;  3KUY B;  3AZK C;  3AZH C;  1P3I D;  5B31 D;  5AVB A;  4J8X A;  5GT0 B;  3W99 C;  3AZM A;  3WTP B;  1HQ3 A;  5DNN B;  1KX4 A;  4YM6 C;  3KUY A;  4QLC D;  5CP6 D;  3B6G D;  2F8N H;  5B2J D;  1KX5 C;  5GT0 A;  3AZG D;  3W97 B;  1P3B B;  5AV9 B;  3X1T B;  5DNN A;  4JJN B;  1P3L D;  4XUJ D;  4X23 C;  3W96 A;  3LZ1 D;  3A6N D;  1BFM A;  5B2I B;  4H9N A;  5AV9 A;  3X1T A;  4J8U D;  4YS3 D;  5GT3 B;  3AZK D;  1ULY A;  2IO5 B;  5GSU C;  1U35 B;  5AVC C;  1P3F C;  1P3O B;  5BNV B;  3X1V B;  3AYW B;  3W99 D;  3UT9 B;  4YM6 D;  4WU9 D;  4Z66 D;  1P3M B;  1F1E A;  1U35 A;  5B32 D;  1P3O A;  1TAF A;  5BNV A;  3X1V A;  1KX5 D;  3AYW A;  3AZF C;  1P3I B;  2BYM A;  3UT9 A;  3AFA D;  3WA9 C;  3VH6 A;  5B31 B;  4X23 D;  1P3M A;  4H9S A;  5B1L C;  4ZUX C;  3REJ C;  1WWS A;  3MVD C;  4G92 B;  3UTA C;  2NZD D;  4QLC B;  3AN2 A;  2F8N D;  3B6G B;  5B2J B;  4EO5 B;  5CPI C;  1P3I A;  3C1C C;  2NQB C;  4Z5T B;  3W98 D;  3AZE A;  3AZG B;  1M19 B;  1P3L B;  3LJA C;  4XUJ B;  1P3F D;  3A6N B;  4Z5T A;  3LZ0 B;  4R8P D;  1M19 A;  3MGS C;  4XUJ A;  1P3G A;  3LEL A;  2CV5 A;  4J8W C;  3A6N A;  2YFV A;  4H9O B;  5B33 C;  5AY8 D;  1TZY D;  3LZ0 A;  3WA9 D;  2FJ7 A;  3REI D;  4ZUX D;  2HUE B;  3MVD D;  4WU9 B;  3AV1 C;  2YFW B;  3X1S C;  1M1A B;  4Z66 B;  4H9O A;  5CPI D;  3C1C D;  5B32 B;  2NQB D;  4LD9 B;  5AVB C;  3NQJ A;  2PYO D;  5DNM D;  3V9R B;  3AFA B;  1KX4 C;  4UUZ A;  3KWQ B;  1M1A A;  1JFI B;  4Z66 A;  4LD9 A;  5KDM A;  3R45 A;  5AV5 A;  3MGS D;  2F8N B;  3VH6 W;  2NZD B;  3X1U C;  3W98 B;  3KWQ A;  3W96 C;  4KHA B;  4XZQ D;  1JFI A;  1AOI D;  3WAA C;  4DRA A;  5B0Y A;  2F8N A;  3O62 D;  3B6F D;  5GXQ B;  3TU4 C;  3AZN C;  4KHA A;  3KXB C;  3X1S D;  3MGR C;  1N1J B;  1R4V A;  1BH9 B;  5AY8 B;  5GXQ A;  5E5A D;  5CPJ D;  1P3P C;  1P34 C;  1KX3 C;  1ID3 B;  5JRG B;  5AV6 B;  3REI B;  3X1V C;  3REK A;  3UTB D;  3MNN A;  3B0B A;  4ZBJ B;  4H9P B;  5AY8 A;  3X1U D;  1KU5 A;  1ID3 A;  5JRG A;  5AV6 A;  5DNM B;  3REI A;  2PYO B;  3WAA D;  3AN2 C;  4J8V B;  4WU8 B;  3TU4 D;  3AZE C;  3AZN D;  3KXB D;  3AZI D;  4G91 C;  3AZJ C;  5B31 G;  1ZLA C;  4XZQ B;  1AOI B;  3AV2 C;  1EQZ B;  4J8V A;  3WKJ B;  1P3P D;  4WU8 A;  5BS7 C; 
#chains in the Genus database with same CATH topology
 3O62 B;  2ARO B;  3B6F B;  1P3G C;  1P3A D;  3LEL C;  2CV5 C;  1AOI A;  1S32 B;  2Y2P A;  1EQZ A;  3WTP A;  3WKJ A;  2ARO A;  5CPK C;  3MGQ B;  3B6F A;  2FJ7 C;  4KGC B;  5E5A B;  3REL B;  5CPJ B;  5F99 C;  3NQU B;  5B40 B;  1M18 B;  1S32 A;  3W97 A;  1P3B A;  3REH C;  4JJN A;  2ZY4 A;  4Z2M G;  3UTB B;  4E45 A;  5B1M B;  3MGQ A;  4KGC A;  3AZH D;  5E5A A;  1F66 B;  3REL A;  5CPJ A;  2Y2H A;  3NQU A;  5B40 A;  3AZJ D;  3MGP B;  1M18 A;  1ZLA D;  3B0C T;  5B2I A;  3C1B C;  3AV2 D;  2FFF B;  5AV5 C;  5B1M A;  5GT3 A;  1P3K C;  1F66 A;  5B32 G;  4WJ3 C;  3MGP A;  1W2E A;  3AZI B;  4KUD C;  5BNX B;  5B0Y C;  5CPK D;  2Y2O A;  2F8N G;  5C3I C;  5CP6 B;  3REH D;  2W8S A;  1P3A B;  5B31 A;  5BO0 B;  5B24 C;  5GXQ C;  5GSU D;  5AVC D;  4QLC A;  5CP6 A;  3VH5 T;  5B0Z C;  3LZ1 B;  5B2J A;  3C1B D;  3B6G A;  4AWL C;  5AV8 C;  3AZL C;  3AZG A;  5BO0 A;  3REK C;  4CSR B;  3MNN C;  1P3K D;  4J8U B;  2HIO C;  1P3L A;  4YS3 B;  3LZ1 A;  3AZK B;  5JRG C;  3AZH B;  3AZF D;  4KUD D;  3IP4 C;  4CSR A;  3W99 B;  4J8U A;  3EPH A;  5B1L D;  3REJ D;  4YM6 B;  3B0D C;  3UTA D;  3AZK A;  2UWX A;  5BT1 C;  4YS3 A;  1T3U A;  2F2A C;  4HGA C;  1KX5 B;  2ZY3 A;  4J8X C;  4NE6 A;  5B24 D;  3W99 A;  3AZM C;  4WNN B;  3LJA D;  1HQ3 C;  4YM6 A;  4X23 B;  2Y2K A;  3KUY C;  2YFW A;  4WU9 A;  5B32 A;  1KX5 A;  3AZL D;  5GT0 C;  4WNN A;  3WTP C;  3V9R A;  5DNN C;  3AFA A;  4X23 A;  2BG1 A;  4J8W D;  4NE5 A;  5B33 D;  5GSU B;  5AVC B;  1P3F B;  2NZD A;  4CAY B;  3W97 C;  1P3B C;  5AV9 C;  3X1T C;  4JJN C;  3W98 A;  4R8P B;  3F6T A;  3P5J B;  5BT1 D;  1PZR A;  3AV1 D;  1P3F A;  2JSS A;  4CAY A;  5AVB D;  5B2I C;  4DQY B;  2F8N K;  3AZM D;  3AZF B;  1TZY B;  3WA9 B;  1HQ3 D;  4R8P A;  1KX4 D;  4M6B A;  3KUY D;  5GT3 C;  1N1J A;  2G5I C;  5B1L B;  4ZUX B;  3REJ B;  2IO5 C;  2XD1 A;  3MVD B;  2ZM5 A;  1U35 C;  3UTA B;  1P3O C;  1BH9 A;  2DQN C;  5GT0 D;  3AYW C;  3AZF A;  5CPI B;  1TZY A;  3C1C B;  5DNN D;  3WA9 A;  3UT9 C;  2NQB B;  3A1K A;  3W96 D;  5B1L A;  1P3M C;  4ZUX A;  4H9S C;  3LJA B;  3MVD A;  3REJ A;  3KSY A;  5CPI A;  3X1T D;  4H9P A;  3C1C A;  1P3I C;  2NQB A;  5B31 C;  3MGS B;  3MGR D;  2PYO A;  5DNM A;  2BYK B;  4G92 C;  4QLC C;  1B6W A;  4J8W B;  3B6G C;  5B2J C;  5B33 B;  4EO5 C;  1BH8 B;  3H0R C;  4Z5T C;  1KX3 D;  3MGS A;  3AZG C;  1M19 C;  5JA4 B;  1P3L C;  2BYK A;  4XUJ C;  1U35 D;  3X1V D;  2Y2I A;  4H9R B;  4XZQ A;  3X1S B;  3A6N C;  3AYW D;  5B33 A;  3AV1 B;  5CHL B;  3LZ0 C;  4WV4 B;  5AVB B;  3O62 A;  1P3M D;  1KX4 B;  3AV1 A;  3X1S A;  3AN2 D;  4E44 A;  3AZE D;  3VH5 A;  3X1U B;  1HTA A;  2HUE C;  3W96 B;  4WU9 C;  1M1A C;  4H9Q B;  4Z66 C;  4LD9 C;  5B32 C;  4Z5T D;  3WAA B;  3UTB A;  1M19 D;  4H9N B;  3X1U A;  3AFA C;  1P3G D;  3TU4 B;  3LEL D;  3AZN B;  3KXB B;  3KWQ C;  2CV5 D;  4H9Q A;  2Y2G A;  3MGR B;  3WAA A;  3LZ0 D;  4NE3 A;  2NZD C;  3H0L C;  2FJ7 D;  3B0C W;  1P3P B;  3W98 C;  5F99 D;  3TU4 A;  3AZN A;  1P34 B;  1KX3 B;  3KXB A;  3MGR A;  3AZI A;  2L5A A;  5BNX A;  1TAF B;  1P34 D;  2CWE A;  2BYM B;  2RVQ C;  4R8P C;  1P34 A;  1A7W A;  1P3P A;  1KX3 A;  1M1A D;  4LD9 D;  1P3A A;  5AV5 D;  3AN2 B;  5AY8 C;  1TZY C;  4UPK A;  3AZE B;  3KWQ D;  1ID3 C;  5AV6 C;  3REI C;  4G91 B;  5B0Y D;  3AZJ B;  1ZLA B;  3AV2 B;  4ZBJ C;  3VH5 W;  3KFU G;  4WZS B;  3AZH A;  2PYO C;  5DNM C;  1P3G B;  3H0M C;  3AZJ A;  3LEL B;  1ZLA A;  2CV5 B;  3AV2 A;  2YFV B;  5GXQ D;  2RVQ D;  4J8V C;  5BS7 A;  4WU8 C;  5CPK B;  5B0Z D;  2FJ7 B;  5AV8 D;  5F99 B;  4XZQ C;  3REK D;  1AOI C;  3MNN D;  3REH B;  2DF4 C;  2HIO D;  1EQZ C;  3WKJ C;  5CPK A;  3O62 C;  1ID3 D;  2ARO C;  3NQJ B;  5JRG D;  5AV6 D;  3B6F C;  3VH6 T;  5F99 A;  4UUZ B;  2RIQ A;  5FUG B;  1S32 C;  5G49 B;  3C1B B;  3REH A;  5KDM B;  3R45 B;  5AV5 B;  3MGQ C;  1P3K B;  4KGC C;  5E5A C;  5GSU A;  3REL C;  5CPJ C;  5AVC A;  1B67 A;  5B40 C;  1M18 C;  5FUG A;  4DRB A;  4J8X D;  5G49 A;  3C1B A;  4J8V D;  4KUD B;  5B0Y B;  4WU8 D;  2J8P A;  3UTB C;  5B1M C;  1P3K A;  3EPK A;  1F66 C;  3MGP C;  5C3I B;  1EQZ D;  3WTP D;  3WKJ D;  4KUD A;  2Y2M A;  2ARO D;  5B24 B;  2Y2L A;  3UTA A;  5B0Z B;  1S32 D;  3AZI C;  3W97 D;  4AWL B;  1P3B D;  5AV9 D;  5AV8 B;  4JJN D;  1H3O B;  3AZL B;  3REK B;  5B24 A;  3MNN B;  3MGQ D;  4KGC D;  2HIO B;  3LJA A;  1Q9C A;  3REL D;  1WWI A;  5B40 D;  5B0Z A;  1M18 D;  5CP6 C;  5B2I D;  5AV8 A;  1H3O A;  3AZL A;  1P3A C;  4NFT A;  5B1M D;  2LY8 A;  4Z2M H;  5GT3 D;  2HIO A;  1F66 D;  3WTP E;  1P3O D;  3B0D B;  3MGP D;  4J8W A;  3LZ1 C;  4HGA B;  1BH8 A;  3UT9 D;  4J8X B;  5JA4 A;  4J8U C;  3AZM B;  1HQ3 B;  4YS3 C;  4H9R A;  3KUY B;  3AZK C;  3AZH C;  1P3I D;  5B31 D;  5AVB A;  4J8X A;  5GT0 B;  3W99 C;  3AZM A;  3WTP B;  1HQ3 A;  5DNN B;  3EPL A;  1KX4 A;  4YM6 C;  3KUY A;  4QLC D;  5CP6 D;  3B6G D;  2F8N H;  5B2J D;  1KX5 C;  5GT0 A;  3AZG D;  3W97 B;  1P3B B;  5AV9 B;  3X1T B;  5DNN A;  4JJN B;  1P3L D;  4XUJ D;  4X23 C;  3W96 A;  3LZ1 D;  3A6N D;  1BFM A;  2VQR A;  5B2I B;  4H9N A;  5AV9 A;  3X1T A;  4J8U D;  4YS3 D;  5GT3 B;  3AZK D;  1ULY A;  2IO5 B;  5GSU C;  1U35 B;  5AVC C;  1P3F C;  1P3O B;  5BNV B;  3X1V B;  3AYW B;  3W99 D;  3UT9 B;  4YM6 D;  4WU9 D;  4Z66 D;  1P3M B;  3AL0 C;  1F1E A;  1U35 A;  5B32 D;  1P3O A;  1TAF A;  5BNV A;  3X1V A;  1KX5 D;  3AYW A;  3AZF C;  2Y2N A;  1P3I B;  2BYM A;  3UT9 A;  3AFA D;  3WA9 C;  3VH6 A;  5B31 B;  4X23 D;  1P3M A;  4H9S A;  5B1L C;  4ZUX C;  3REJ C;  1WWS A;  3MVD C;  4G92 B;  3UTA C;  2NZD D;  4QLC B;  3AN2 A;  2F8N D;  3B6G B;  5B2J B;  4EO5 B;  2JE5 A;  5CPI C;  1P3I A;  3C1C C;  2NQB C;  4Z5T B;  3W98 D;  3AZE A;  3AZG B;  1M19 B;  1P3L B;  3LJA C;  4XUJ B;  1P3F D;  3A6N B;  4Z5T A;  3LZ0 B;  4R8P D;  1M19 A;  3MGS C;  4XUJ A;  2G5H C;  1P3G A;  3EG5 B;  3LEL A;  2CV5 A;  4J8W C;  3A6N A;  2YFV A;  4H9O B;  5B33 C;  5AY8 D;  1TZY D;  3LZ0 A;  3WA9 D;  2FJ7 A;  3REI D;  4ZUX D;  2HUE B;  3MVD D;  4WU9 B;  3AV1 C;  2YFW B;  3X1S C;  1M1A B;  4Z66 B;  4H9O A;  5CPI D;  3C1C D;  5B32 B;  2NQB D;  4LD9 B;  5AVB C;  3NQJ A;  2PYO D;  5DNM D;  3V9R B;  3AFA B;  1KX4 C;  4UUZ A;  3KWQ B;  1M1A A;  1JFI B;  4Z66 A;  4LD9 A;  5KDM A;  3R45 A;  5AV5 A;  3MGS D;  2F8N B;  3VH6 W;  2NZD B;  2Y2J A;  3X1U C;  3W98 B;  3KWQ A;  3W96 C;  4KHA B;  4XZQ D;  1JFI A;  3FDD A;  1AOI D;  3WAA C;  4DRA A;  5B0Y A;  2F8N A;  3O62 D;  2Y2Q A;  3B6F D;  5GXQ B;  3TU4 C;  3AZN C;  4KHA A;  3KXB C;  3X1S D;  3MGR C;  1N1J B;  1R4V A;  1BH9 B;  2ZY2 A;  5AY8 B;  2XD5 A;  5E5A D;  5GXQ A;  5CPJ D;  1P3P C;  1P34 C;  1KX3 C;  1ID3 B;  5JRG B;  5AV6 B;  3REI B;  3A1I A;  3X1V C;  3REK A;  3UTB D;  3MNN A;  3B0B A;  4ZBJ B;  4H9P B;  5AY8 A;  3X1U D;  1KU5 A;  1ID3 A;  3EPJ A;  5JRG A;  5AV6 A;  5DNM B;  1Z2C B;  3REI A;  2PYO B;  3WAA D;  3AN2 C;  2JCH A;  4J8V B;  2ZY5 A;  4WU8 B;  3TU4 D;  3AZE C;  3AZN D;  3KXB D;  3AZI D;  4G91 C;  3AZJ C;  5B31 G;  1ZLA C;  4XZQ B;  1AOI B;  3AV2 C;  1EQZ B;  4J8V A;  3WKJ B;  1P3P D;  4WU8 A;  5BS7 C; 
#chains in the Genus database with same CATH homology
 3O62 B;  2ARO B;  3B6F B;  1P3G C;  1P3A D;  3LEL C;  2CV5 C;  1AOI A;  1S32 B;  2Y2P A;  1EQZ A;  3WTP A;  3WKJ A;  2ARO A;  5CPK C;  3MGQ B;  3B6F A;  2FJ7 C;  4KGC B;  5E5A B;  3REL B;  5CPJ B;  5F99 C;  3NQU B;  5B40 B;  1M18 B;  1S32 A;  3W97 A;  1P3B A;  3REH C;  4JJN A;  2ZY4 A;  4Z2M G;  3UTB B;  4E45 A;  5B1M B;  3MGQ A;  4KGC A;  3AZH D;  5E5A A;  1F66 B;  3REL A;  5CPJ A;  2Y2H A;  3NQU A;  5B40 A;  3AZJ D;  3MGP B;  1M18 A;  1ZLA D;  3B0C T;  5B2I A;  3C1B C;  3AV2 D;  2FFF B;  5AV5 C;  5B1M A;  5GT3 A;  1P3K C;  1F66 A;  5B32 G;  4WJ3 C;  3MGP A;  1W2E A;  3AZI B;  4KUD C;  5BNX B;  5B0Y C;  5CPK D;  2Y2O A;  2F8N G;  5C3I C;  5CP6 B;  3REH D;  2W8S A;  1P3A B;  5B31 A;  5BO0 B;  5B24 C;  5GXQ C;  5GSU D;  5AVC D;  4QLC A;  5CP6 A;  3VH5 T;  5B0Z C;  3LZ1 B;  5B2J A;  3C1B D;  3B6G A;  4AWL C;  5AV8 C;  3AZL C;  3AZG A;  5BO0 A;  3REK C;  4CSR B;  3MNN C;  1P3K D;  4J8U B;  2HIO C;  1P3L A;  4YS3 B;  3LZ1 A;  3AZK B;  5JRG C;  3AZH B;  3AZF D;  4KUD D;  3IP4 C;  4CSR A;  3W99 B;  4J8U A;  3EPH A;  5B1L D;  3REJ D;  4YM6 B;  3B0D C;  3UTA D;  3AZK A;  2UWX A;  5BT1 C;  4YS3 A;  1T3U A;  2F2A C;  4HGA C;  1KX5 B;  2ZY3 A;  4J8X C;  4NE6 A;  5B24 D;  3W99 A;  3AZM C;  4WNN B;  3LJA D;  1HQ3 C;  4YM6 A;  4X23 B;  2Y2K A;  3KUY C;  2YFW A;  4WU9 A;  5B32 A;  1KX5 A;  3AZL D;  5GT0 C;  4WNN A;  3WTP C;  3V9R A;  5DNN C;  3AFA A;  4X23 A;  2BG1 A;  4J8W D;  4NE5 A;  5B33 D;  5GSU B;  5AVC B;  1P3F B;  2NZD A;  4CAY B;  3W97 C;  1P3B C;  5AV9 C;  3X1T C;  4JJN C;  3W98 A;  4R8P B;  3F6T A;  3P5J B;  5BT1 D;  1PZR A;  3AV1 D;  1P3F A;  2JSS A;  4CAY A;  5AVB D;  5B2I C;  4DQY B;  2F8N K;  3AZM D;  3AZF B;  1TZY B;  3WA9 B;  1HQ3 D;  4R8P A;  1KX4 D;  4M6B A;  3KUY D;  5GT3 C;  1N1J A;  2G5I C;  5B1L B;  4ZUX B;  3REJ B;  2IO5 C;  2XD1 A;  3MVD B;  2ZM5 A;  1U35 C;  3UTA B;  1P3O C;  1BH9 A;  2DQN C;  5GT0 D;  3AYW C;  3AZF A;  5CPI B;  1TZY A;  3C1C B;  5DNN D;  3WA9 A;  3UT9 C;  2NQB B;  3A1K A;  3W96 D;  5B1L A;  1P3M C;  4ZUX A;  4H9S C;  3LJA B;  3MVD A;  3REJ A;  3KSY A;  5CPI A;  3X1T D;  4H9P A;  3C1C A;  1P3I C;  2NQB A;  5B31 C;  3MGS B;  3MGR D;  2PYO A;  5DNM A;  2BYK B;  4G92 C;  4QLC C;  1B6W A;  4J8W B;  3B6G C;  5B2J C;  5B33 B;  4EO5 C;  1BH8 B;  3H0R C;  4Z5T C;  1KX3 D;  3MGS A;  3AZG C;  1M19 C;  5JA4 B;  1P3L C;  2BYK A;  4XUJ C;  1U35 D;  3X1V D;  2Y2I A;  4H9R B;  4XZQ A;  3X1S B;  3A6N C;  3AYW D;  5B33 A;  3AV1 B;  5CHL B;  3LZ0 C;  4WV4 B;  5AVB B;  3O62 A;  1P3M D;  1KX4 B;  3AV1 A;  3X1S A;  3AN2 D;  4E44 A;  3AZE D;  3VH5 A;  3X1U B;  1HTA A;  2HUE C;  3W96 B;  4WU9 C;  1M1A C;  4H9Q B;  4Z66 C;  4LD9 C;  5B32 C;  4Z5T D;  3WAA B;  3UTB A;  1M19 D;  4H9N B;  3X1U A;  3AFA C;  1P3G D;  3TU4 B;  3LEL D;  3AZN B;  3KXB B;  3KWQ C;  2CV5 D;  4H9Q A;  2Y2G A;  3MGR B;  3WAA A;  3LZ0 D;  4NE3 A;  2NZD C;  3H0L C;  2FJ7 D;  3B0C W;  1P3P B;  3W98 C;  5F99 D;  3TU4 A;  3AZN A;  1P34 B;  1KX3 B;  3KXB A;  3MGR A;  3AZI A;  2L5A A;  5BNX A;  1TAF B;  1P34 D;  2CWE A;  2BYM B;  2RVQ C;  4R8P C;  1P34 A;  1A7W A;  1P3P A;  1KX3 A;  1M1A D;  4LD9 D;  1P3A A;  5AV5 D;  3AN2 B;  5AY8 C;  1TZY C;  4UPK A;  3AZE B;  3KWQ D;  1ID3 C;  5AV6 C;  3REI C;  4G91 B;  5B0Y D;  3AZJ B;  1ZLA B;  3AV2 B;  4ZBJ C;  3VH5 W;  3KFU G;  4WZS B;  3AZH A;  2PYO C;  5DNM C;  1P3G B;  3H0M C;  3AZJ A;  3LEL B;  1ZLA A;  2CV5 B;  3AV2 A;  2YFV B;  5GXQ D;  2RVQ D;  4J8V C;  5BS7 A;  4WU8 C;  5CPK B;  5B0Z D;  2FJ7 B;  5AV8 D;  5F99 B;  4XZQ C;  3REK D;  1AOI C;  3MNN D;  3REH B;  2DF4 C;  2HIO D;  1EQZ C;  3WKJ C;  5CPK A;  3O62 C;  1ID3 D;  2ARO C;  3NQJ B;  5JRG D;  5AV6 D;  3B6F C;  3VH6 T;  5F99 A;  4UUZ B;  2RIQ A;  5FUG B;  1S32 C;  5G49 B;  3C1B B;  3REH A;  5KDM B;  3R45 B;  5AV5 B;  3MGQ C;  1P3K B;  4KGC C;  5E5A C;  5GSU A;  3REL C;  5CPJ C;  5AVC A;  1B67 A;  5B40 C;  1M18 C;  5FUG A;  4DRB A;  4J8X D;  5G49 A;  3C1B A;  4J8V D;  4KUD B;  5B0Y B;  4WU8 D;  2J8P A;  3UTB C;  5B1M C;  1P3K A;  3EPK A;  1F66 C;  3MGP C;  5C3I B;  1EQZ D;  3WTP D;  3WKJ D;  4KUD A;  2Y2M A;  2ARO D;  5B24 B;  2Y2L A;  3UTA A;  5B0Z B;  1S32 D;  3AZI C;  3W97 D;  4AWL B;  1P3B D;  5AV9 D;  5AV8 B;  4JJN D;  1H3O B;  3AZL B;  3REK B;  5B24 A;  3MNN B;  3MGQ D;  4KGC D;  2HIO B;  3LJA A;  1Q9C A;  3REL D;  1WWI A;  5B40 D;  5B0Z A;  1M18 D;  5CP6 C;  5B2I D;  5AV8 A;  1H3O A;  3AZL A;  1P3A C;  4NFT A;  5B1M D;  2LY8 A;  4Z2M H;  5GT3 D;  2HIO A;  1F66 D;  3WTP E;  1P3O D;  3B0D B;  3MGP D;  4J8W A;  3LZ1 C;  4HGA B;  1BH8 A;  3UT9 D;  4J8X B;  5JA4 A;  4J8U C;  3AZM B;  1HQ3 B;  4YS3 C;  4H9R A;  3KUY B;  3AZK C;  3AZH C;  1P3I D;  5B31 D;  5AVB A;  4J8X A;  5GT0 B;  3W99 C;  3AZM A;  3WTP B;  1HQ3 A;  5DNN B;  3EPL A;  1KX4 A;  4YM6 C;  3KUY A;  4QLC D;  5CP6 D;  3B6G D;  2F8N H;  5B2J D;  1KX5 C;  5GT0 A;  3AZG D;  3W97 B;  1P3B B;  5AV9 B;  3X1T B;  5DNN A;  4JJN B;  1P3L D;  4XUJ D;  4X23 C;  3W96 A;  3LZ1 D;  3A6N D;  1BFM A;  2VQR A;  5B2I B;  4H9N A;  5AV9 A;  3X1T A;  4J8U D;  4YS3 D;  5GT3 B;  3AZK D;  1ULY A;  2IO5 B;  5GSU C;  1U35 B;  5AVC C;  1P3F C;  1P3O B;  5BNV B;  3X1V B;  3AYW B;  3W99 D;  3UT9 B;  4YM6 D;  4WU9 D;  4Z66 D;  1P3M B;  3AL0 C;  1F1E A;  1U35 A;  5B32 D;  1P3O A;  1TAF A;  5BNV A;  3X1V A;  1KX5 D;  3AYW A;  3AZF C;  2Y2N A;  1P3I B;  2BYM A;  3UT9 A;  3AFA D;  3WA9 C;  3VH6 A;  5B31 B;  4X23 D;  1P3M A;  4H9S A;  5B1L C;  4ZUX C;  3REJ C;  1WWS A;  3MVD C;  4G92 B;  3UTA C;  2NZD D;  4QLC B;  3AN2 A;  2F8N D;  3B6G B;  5B2J B;  4EO5 B;  2JE5 A;  5CPI C;  1P3I A;  3C1C C;  2NQB C;  4Z5T B;  3W98 D;  3AZE A;  3AZG B;  1M19 B;  1P3L B;  3LJA C;  4XUJ B;  1P3F D;  3A6N B;  4Z5T A;  3LZ0 B;  4R8P D;  1M19 A;  3MGS C;  4XUJ A;  2G5H C;  1P3G A;  3EG5 B;  3LEL A;  2CV5 A;  4J8W C;  3A6N A;  2YFV A;  4H9O B;  5B33 C;  5AY8 D;  1TZY D;  3LZ0 A;  3WA9 D;  2FJ7 A;  3REI D;  4ZUX D;  2HUE B;  3MVD D;  4WU9 B;  3AV1 C;  2YFW B;  3X1S C;  1M1A B;  4Z66 B;  4H9O A;  5CPI D;  3C1C D;  5B32 B;  2NQB D;  4LD9 B;  5AVB C;  3NQJ A;  2PYO D;  5DNM D;  3V9R B;  3AFA B;  1KX4 C;  4UUZ A;  3KWQ B;  1M1A A;  1JFI B;  4Z66 A;  4LD9 A;  5KDM A;  3R45 A;  5AV5 A;  3MGS D;  2F8N B;  3VH6 W;  2NZD B;  2Y2J A;  3X1U C;  3W98 B;  3KWQ A;  3W96 C;  4KHA B;  4XZQ D;  1JFI A;  3FDD A;  1AOI D;  3WAA C;  4DRA A;  5B0Y A;  2F8N A;  3O62 D;  2Y2Q A;  3B6F D;  5GXQ B;  3TU4 C;  3AZN C;  4KHA A;  3KXB C;  3X1S D;  3MGR C;  1N1J B;  1R4V A;  1BH9 B;  2ZY2 A;  5AY8 B;  2XD5 A;  5E5A D;  5GXQ A;  5CPJ D;  1P3P C;  1P34 C;  1KX3 C;  1ID3 B;  5JRG B;  5AV6 B;  3REI B;  3A1I A;  3X1V C;  3REK A;  3UTB D;  3MNN A;  3B0B A;  4ZBJ B;  4H9P B;  5AY8 A;  3X1U D;  1KU5 A;  1ID3 A;  3EPJ A;  5JRG A;  5AV6 A;  5DNM B;  1Z2C B;  3REI A;  2PYO B;  3WAA D;  3AN2 C;  2JCH A;  4J8V B;  2ZY5 A;  4WU8 B;  3TU4 D;  3AZE C;  3AZN D;  3KXB D;  3AZI D;  4G91 C;  3AZJ C;  5B31 G;  1ZLA C;  4XZQ B;  1AOI B;  3AV2 C;  1EQZ B;  4J8V A;  3WKJ B;  1P3P D;  4WU8 A;  5BS7 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...