3AZNB

Crystal structure of human nucleosome core particle containing h4k91q mutation
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
78
structure length
78
Chain Sequence
NIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALQRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Comprehensive Structural Analysis of Mutant Nucleosomes Containing Lysine to Glutamine (KQ) Substitutions in the H3 and H4 Histone-Fold Domains
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
molecule keywords Histone H3.1
total genus 27
structure length 78
sequence length 78
chains with identical sequence F
ec nomenclature
pdb deposition date 2011-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3aznB00
3AZJB 4XUJD 5AV5B 3X1UD 4H9OA 3KUYC 1P3FC 3X1TB 3MGPC 3AV2B 3LZ0B 3WTPD 5B33C 4WU9A 3KWQC 5G49A 3WTPC 1P3AB 2FJ7C 3WAAC 4AWLB 5AV8B 3AZHC 1A7WA 3W99D 1U35C 5GXQD 3B6GA 3LELA 1EQZA 3A6NC 5B32D 1M19C 5JRGC 1BH8B 3C1CD 1TZYA 3AV1C 1H3OB 1ID3A 4H9OB 3REKC 3RELA 3VH6A 5B40C 2F8NG 1S32B 4XZQB 3AV1B 5DNMB 1TZYD 1KX4B 1P3KB 4WU8C 3TU4B 1M1AA 5BNVA 3MGRA 5B32C 1P3GD 3AZFB 5BNXB 3RELB 3B6GD 4WU8B 5B0ZB 5B24A 1P3OA 5AY8D 3W98B 4LD9C 3AV2A 3AN2C 1P34A 3B0DC 3WKJC 4H9NB 4LD9D 4YS3C 3MGRB 1ID3D 3KWQB 2HIOC 3AZID 3C1CA 3UTBB 5AVBC 3MGQC 1P3MC 4KUDD 3W97A 5FUGB 4E44A 5CPJB 1HQ3D 1P3BD 2HIOB 4E45A 3WA9B 5AV5C 1P3MB 2AROB 1P3AA 1TAFB 1F66D 3AN2D 4YM6B 5CPIC 3AZNC 2AROC 3UTAB 3AYWB 4QLCC 1M19B 1WWSA 5AV8C 5B24B 1P3OB 3W98A 3KXBA 3MGPD 4WNNA 3AZGA 3UTAC 3AYWC 1TAFA 2CV5A 1KX5B 3VH6T 1Q9CA 4G91C 3AZLD 1AOID 3X1SB 5B40B 3W96B 4ZUXA 1N1JA 5AY8C 5AVCC 1BH9B 5KDMB 4X23C 5DNNA 4ZUXD 4J8UB 3AZFC 3MGSB 4JJNB 4X23B 3REJB 5B32A 4EO5C 3AFAB 1P3IB 4KHAA 5CHLB 3MGRC 1M1AC 3NQJA 5CPIA 5GT3A 2FJ7D 2CV5B 4J8VB 3UT9A 5F99A 5E5AB 3NQUA 1F66A 4QLCD 3X1VA 2IO5B 5B33D 4Z5TD 3B0DB 4J8VC 5AV6C 5AV5A 1KX3A 3R45B 5AVBA 3MGQA 2RVQD 3AZHB 4WU9B 4YS3A 4H9RA 3B0CT 3REIA 3C1CC 4XUJB 5JA4A 5AV5D 3X1UB 4J8WC 5B24C 1P3OC 1ZLAD 3WA9C 3AV2D 5B2JB 3WTPB 1P34C 3AN2A 2BYKA 4KUDC 2LY8A 4J8WB 1S32A 2FJ7A 5CPIB 4H9NA 5BS7A 1KX3C 5B0YC 2RVQC 5F99D 3X1VC 5CP6D 1P3PD 4NE6A 4J8UC 3A6NB 3UT9C 3LZ1D 1BH9A 2NZDB 5B31B 5B32B 2BYMB 1B6WA 1ID3C 1KX4A 3AV1A 3MVDB 4KGCB 3A6NA 3AZMB 1AOIA 5B1LA 1S32D 4CAYB 1BH8A 4XZQD 4H9QA 3AV1D 5DNNC 4UUZB 5DNMD 2PYOB 1P3KD 3TU4D 3LZ1C 5AV9B 1P3GB 2F8NH 4WU9C 3KXBD 3MGPA 3AZGD 5B0ZD 3W98D 3KXBC 3AZGC 4CSRB 1KX3D 3REHD 3KWQD 3AZIB 1JFIA 1F1EA 4KUDB 3REHC 4YM6A 3UT9D 1HQ3B 1P3BB 5C3IC 3X1TA 2HIOD 3AZIC 3WTPE 5B0YD 3V9RA 1P3KA 3W96C 5CPJA 1M18C 5B1LC 1AOIC 5B31A 3W97C 1P3MA 5GT0D 3UTAD 3AYWD 5CPKD 3REJA 5B24D 1P3OD 2F8NK 4XZQA 1KX5D 2NQBC 2NZDA 3WKJD 4CAYA 3VH6W 3AZLB 4J8UA 5B40D 1P3IC 3MNNB 5AV6D 5B2IA 4J8XB 1ULYA 4WU8A 5BS7C 3VH5W 3TU4C 4J8UD 3MNNC 3LELB 3MGSD 4J8XC 3AZEA 3UTBC 1P3IA 3AZMC 3REKA 4Z66B 4JJND 3B0BA 2YFVA 5B0ZC 3REJD 3W99C 1U35D 4Z2MG 3AFAD 1M19A 1EQZC 5GSUA 2FJ7B 3KSYA 2CV5D 3W99A 5B0ZA 5AVBB 3MGQB 3AZNB 5B2JC 3AZIA 1JFIB 4WZSB 5BT1C 3W96A 5GT3B 3X1TC 4QLCB 5CPJC 5B33B 3LZ0C 4Z5TB 5JA4B 3TU4A 1M18B 2YFWA 5B1MB 2JSSA 3O62C 5FUGA 3AZHD 5GT3C 4WU9D 3WTPA 4G91B 4ZBJB 4AWLC 4Z5TC 3REHA 3WAAB 3X1SC 3AZEB 4R8PD 2L5AA 5AV9A 5JRGD 1P34B 5C3IB 4H9PA 1ZLAB 3AZJA 5B2JD 2YFVB 4NE5A 2F8NB 4XZQC 5B2ID 5B1LB 4J8WD 1P3PC 1P3LC 5CPID 3LZ1A 4JJNC 5AY8A 5E5AA 5F99B 5CP6B 1P3PB 4WNNB 5BO0A 3B6FD 3A6ND 3AZKA 1EQZD 3B6FC 5DNND 5DNMC 5GT0C 5CPKC 3UTAA 3LZ1B 3AYWA 2CV5C 1KX4C 2NZDD 5B31D 4YS3B 4H9QB 3B0CW 3MVDD 4KGCD 4H9PB 3AZMD 3LJAB 5B0YA 2PYOD 3LJAC 5AV9D 3NQJB 4NFTA 4CSRA 3X1VD 4XUJA 3X1UA 4H9SA 3O62B 2PYOA 3KXBB 3AZGB 4HGAB 1P3LD 3REKD 4KUDA 4DRAA 5BNXA 1KX5C 1KX3B 2NQBD 4LD9A 3WA9A 3REID 1HQ3A 1P3BA 3REHB 3MVDA 3REIC 3W97D 4Z66A 4KGCA 5AV6A 4J8VA 5GSUD 3UT9B 4ZBJC 5BNVB 3AZKD 5F99C 2HUEB 1M1AD 3C1BD 5B0YB 1P3GA 1R4VA 5GT0B 5CPKB 3VH5A 4R8PC 3AZLA 5AVCB 1B67A 3KUYD 1P3FD 1S32C 5CP6C 4Z66C 3AZJD 3WKJB 3MVDC 3AZFA 3AZKC 4KGCC 5BT1D 3X1TD 4J8WA 2IO5C 3LZ0D 1KX5A 3MNND 5AV6B 4J8XD 4X23A 3AZHA 3LJAA 1P3AD 2PYOC 3VH5T 5B32G 4G92B 5AV8D 3LELD 5KDMA 5G49B 3W99B 4Z66D 3AZJC 1F66C 5GXQB 1ZLAA 1U35B 1HTAA 2AROA 3X1SA 5AV8A 4Z5TA 4QLCA 1P3AC 1ZLAC 3C1CB 2YFWB 3V9RB 5DNMA 5AVBD 3MGQD 3AZND 3LZ0A 5GT3D 5B1MC 1M18D 1TZYB 5B1MD 4JJNA 1KX4D 5GSUC 5AVCA 3R45A 3WAAD 3AZED 3MGSC 4R8PB 4ZUXC 5JRGB 3AZFD 3RELD 1P34D 3B6GB 3WKJA 4WU8D 5AY8B 3UTBA 4EO5B 5CP6A 5B2IB 3AFAC 2F8ND 5B1LD 3W98C 4LD9B 3MGRD 3AZLC 4R8PA 1ID3B 5AV9C 3UTBD 2F8NA 5B2IC 3AZNA 1P3GC 5CPJD 3B6FB 3O62A 3RELC 3WA9D 1EQZB 1P3MD 5DNNB 2AROD 2NQBA 4DRBA 5BO0B 3NQUB 1F66B 4YS3D 3AN2B 4YM6D 5GXQC 2BYKB 5B2JA 5JRGA 2HIOA 4G92C 4WV4B 4KHAB 1M19D 1HQ3C 5GXQA 1P3BC 1U35A 3LJAD 4H9RB 3MGPB 3AV2C 3MNNA 5B31G 4J8XA 3AZEC 3AZMA 1AOIB 3X1SD 4H9SC 3W96D 4XUJC 3X1UC 3X1VB 4HGAC 4M6BA 4YM6C 3O62D 2BYMA 3KUYA 3REKB 1P3LB 1P3FA 4ZUXB 2NQBB 5B33A 5B40A 2NZDC 3AFAA 3REIB 4X23D 4Z2MH 3W97B 1TZYC 4UUZA 3C1BC 5GSUB 1BFMA 3MGSA 1P3ID 2HUEC 3REJC 5GT0A 3AZKB 1H3OA 5CPKA 3B6FA 1M1AB 3C1BB 4J8VD 3LELC 3B6GC 5B31C 5E5AD 1KU5A 5B1MA 1M18A 1N1JB 1P3KC 1WWIA 5E5AC 3WAAA 5AVCD 2CWEA 3KUYB 1P3FB 1P3LA 1P3PA 4NE3A 3C1BA 3KWQA
chains in the Genus database with same CATH superfamily
3AZJB 4XUJD 5AV5B 2Y2IA 3X1UD 4H9OA 3KUYC 1P3FC 3X1TB 3MGPC 3AV2B 3LZ0B 3WTPD 5B33C 4WU9A 3KWQC 5G49A 3WTPC 3IP4C 1P3AB 3F6TA 1W2EA 2FJ7C 3WAAC 4AWLB 5AV8B 3AZHC 1A7WA 3W99D 1U35C 5GXQD 3B6GA 3LELA 1EQZA 3A6NC 5B32D 3EPKA 1M19C 5JRGC 2Y2QA 1BH8B 3C1CD 1TZYA 3AV1C 1H3OB 1ID3A 2XD1A 4H9OB 3REKC 3RELA 3VH6A 5B40C 2F8NG 1S32B 4XZQB 3AV1B 5DNMB 1TZYD 1KX4B 1P3KB 4WU8C 3TU4B 1M1AA 5BNVA 3MGRA 5B32C 1P3GD 3AZFB 5BNXB 3RELB 3B6GD 4WU8B 5B0ZB 5B24A 1P3OA 5AY8D 3W98B 4LD9C 3AV2A 3AN2C 1P34A 3B0DC 3WKJC 4H9NB 4LD9D 4YS3C 3MGRB 1ID3D 3KWQB 2HIOC 3AZID 3C1CA 3UTBB 5AVBC 3MGQC 1P3MC 4KUDD 3W97A 5FUGB 2BG1A 4E44A 5CPJB 1HQ3D 1P3BD 3EPJA 2HIOB 4E45A 3WA9B 5AV5C 1P3MB 2AROB 1P3AA 1TAFB 1F66D 3AN2D 4YM6B 2Y2OA 5CPIC 3AZNC 2AROC 3UTAB 3AYWB 4QLCC 1M19B 1WWSA 5AV8C 5B24B 1P3OB 3W98A 3KXBA 3MGPD 2Y2NA 4WNNA 3UTAC 3AZGA 1TAFA 3AYWC 2CV5A 1KX5B 3VH6T 1Q9CA 4G91C 3AZLD 1AOID 3X1SB 5B40B 3W96B 4ZUXA 1N1JA 5AY8C 5AVCC 1BH9B 5KDMB 4X23C 5DNNA 4ZUXD 4J8UB 3AZFC 3MGSB 4JJNB 4X23B 3REJB 5B32A 4EO5C 3AFAB 1P3IB 4KHAA 5CHLB 3MGRC 1M1AC 3NQJA 5CPIA 5GT3A 2FJ7D 2CV5B 4J8VB 3UT9A 2DQNC 5F99A 5E5AB 3H0MC 3NQUA 1F66A 2Y2LA 2UWXA 4QLCD 3X1VA 2IO5B 5B33D 4Z5TD 3B0DB 4J8VC 5AV6C 5AV5A 1KX3A 3R45B 5AVBA 3MGQA 2RVQD 3AZHB 4WU9B 4YS3A 4H9RA 3B0CT 3REIA 3C1CC 4XUJB 5JA4A 5AV5D 3X1UB 4J8WC 5B24C 1P3OC 1ZLAD 3WA9C 3AV2D 5B2JB 3WTPB 1P34C 3AN2A 2BYKA 4KUDC 2LY8A 4J8WB 1S32A 2FJ7A 5CPIB 4H9NA 5BS7A 1KX3C 5B0YC 2RVQC 5F99D 3X1VC 5CP6D 1P3PD 4NE6A 4J8UC 3A6NB 3UT9C 3LZ1D 1BH9A 2NZDB 2J8PA 5B31B 5B32B 2BYMB 1B6WA 1ID3C 1KX4A 1PZRA 3AV1A 3MVDB 4KGCB 3A6NA 3AZMB 1AOIA 5B1LA 1S32D 4CAYB 1BH8A 4XZQD 4H9QA 3AV1D 5DNNC 4UUZB 5DNMD 2PYOB 1P3KD 3TU4D 3LZ1C 5AV9B 2ZY2A 1P3GB 2F8NH 4WU9C 3KXBD 3MGPA 3AZGD 5B0ZD 3W98D 3KXBC 3AZGC 4CSRB 1KX3D 3REHD 3KWQD 3AZIB 1JFIA 1F1EA 2Y2JA 4KUDB 3REHC 4YM6A 3UT9D 1HQ3B 1P3BB 5C3IC 3X1TA 2HIOD 3AZIC 3WTPE 2FFFB 5B0YD 3V9RA 1P3KA 3W96C 5CPJA 2JE5A 1M18C 5B1LC 1AOIC 5B31A 3W97C 1P3MA 5GT0D 3UTAD 3AYWD 5CPKD 3REJA 5B24D 1P3OD 2F8NK 4XZQA 1KX5D 2NQBC 2NZDA 3WKJD 4CAYA 3VH6W 3AZLB 4J8UA 5B40D 1P3IC 3MNNB 5AV6D 5B2IA 4J8XB 1ULYA 4WU8A 5BS7C 3VH5W 3TU4C 4J8UD 3MNNC 3LELB 2F2AC 3MGSD 4J8XC 3UTBC 3AZEA 1P3IA 3AZMC 3REKA 4Z66B 4JJND 3B0BA 2YFVA 5B0ZC 3REJD 3W99C 1U35D 4Z2MG 3AFAD 1M19A 1EQZC 5GSUA 2FJ7B 3KSYA 2CV5D 3W99A 5B0ZA 3AL0C 5AVBB 3MGQB 3AZNB 5B2JC 3AZIA 1JFIB 4WZSB 5BT1C 3W96A 5GT3B 3X1TC 4QLCB 5CPJC 5B33B 3LZ0C 4Z5TB 3EPLA 5JA4B 3TU4A 1M18B 2YFWA 5B1MB 2JSSA 2Y2KA 3O62C 5FUGA 3AZHD 5GT3C 4WU9D 3WTPA 4G91B 4ZBJB 4AWLC 4Z5TC 3REHA 3WAAB 3X1SC 3AZEB 4R8PD 2L5AA 5AV9A 5JRGD 1P34B 5C3IB 4WJ3C 4H9PA 1ZLAB 3AZJA 5B2JD 2YFVB 3FDDA 4NE5A 2F8NB 4XZQC 5B2ID 5B1LB 4J8WD 1P3PC 1P3LC 5CPID 3LZ1A 2RIQA 4JJNC 5AY8A 5E5AA 5F99B 5CP6B 1P3PB 4WNNB 2Y2MA 5BO0A 3B6FD 3A6ND 3AZKA 1EQZD 2Y2PA 5DNND 5DNMC 5GT0C 5CPKC 3UTAA 3LZ1B 3AYWA 2CV5C 1KX4C 2NZDD 5B31D 4YS3B 4H9QB 3B0CW 3MVDD 4KGCD 2ZM5A 4H9PB 3A1KA 3AZMD 3LJAB 5B0YA 2PYOD 3LJAC 5AV9D 3NQJB 4NFTA 4CSRA 2ZY5A 3X1VD 4XUJA 3X1UA 4H9SA 3O62B 2PYOA 3KXBB 2Y2HA 4HGAB 3AZGB 1P3LD 3REKD 4KUDA 4DRAA 5BNXA 1KX5C 1KX3B 2NQBD 4LD9A 3WA9A 3REID 1HQ3A 1P3BA 3REHB 3MVDA 3REIC 3W97D 4Z66A 4KGCA 5AV6A 4J8VA 5GSUD 3UT9B 4ZBJC 5BNVB 3AZKD 5F99C 2HUEB 1M1AD 3C1BD 3H0LC 5B0YB 1P3GA 1R4VA 5GT0B 5CPKB 3VH5A 4R8PC 3AZLA 5AVCB 1B67A 3KUYD 1P3FD 1S32C 5CP6C 2G5IC 4Z66C 3AZJD 3MVDC 3AZFA 3AZKC 3WKJB 4KGCC 3A1IA 2DF4C 5BT1D 3X1TD 4J8WA 2VQRA 2IO5C 3LZ0D 3P5JB 1KX5A 3MNND 5AV6B 4J8XD 4X23A 3AZHA 2ZY3A 2Y2GA 3LJAA 1P3AD 2XD5A 2PYOC 3VH5T 5B32G 4G92B 5AV8D 3LELD 3EG5B 1Z2CB 5KDMA 5G49B 3W99B 4Z66D 3AZJC 1F66C 5GXQB 1ZLAA 1U35B 1HTAA 2AROA 3X1SA 5AV8A 4Z5TA 4QLCA 1P3AC 1ZLAC 3C1CB 2YFWB 3V9RB 5DNMA 5AVBD 3MGQD 3AZND 3LZ0A 5GT3D 2ZY4A 5B1MC 1M18D 1TZYB 5B1MD 4JJNA 1KX4D 5GSUC 5AVCA 3R45A 3WAAD 3AZED 3MGSC 4R8PB 4UPKA 5JRGB 4ZUXC 3RELD 3AZFD 1P34D 3B6GB 3WKJA 4WU8D 5AY8B 3UTBA 4EO5B 5CP6A 5B2IB 3AFAC 2F8ND 5B1LD 3W98C 3B6FC 4LD9B 3MGRD 3AZLC 4R8PA 1ID3B 5AV9C 3UTBD 2F8NA 5B2IC 3AZNA 1P3GC 5CPJD 3B6FB 3O62A 3RELC 3WA9D 1EQZB 1P3MD 5DNNB 2AROD 2NQBA 4DRBA 5BO0B 3NQUB 1F66B 4YS3D 3AN2B 4YM6D 5GXQC 2BYKB 5B2JA 5JRGA 2HIOA 4G92C 4WV4B 4KHAB 1M19D 1HQ3C 5GXQA 1P3BC 2W8SA 1U35A 3LJAD 4H9RB 3MGPB 3AV2C 3EPHA 3MNNA 5B31G 4J8XA 3AZEC 3AZMA 1AOIB 3X1SD 4H9SC 3W96D 4XUJC 3X1UC 3X1VB 4HGAC 4M6BA 4YM6C 3O62D 2BYMA 3KUYA 4DQYB 3REKB 1P3LB 1P3FA 4ZUXB 2NQBB 5B33A 5B40A 2NZDC 3AFAA 3REIB 4X23D 4Z2MH 3W97B 1TZYC 4UUZA 3C1BC 5GSUB 1BFMA 3MGSA 1P3ID 3KFUG 2HUEC 3REJC 3H0RC 5GT0A 1H3OA 1T3UA 3AZKB 5CPKA 3B6FA 1M1AB 3C1BB 4J8VD 3LELC 3B6GC 5B31C 5E5AD 1KU5A 5B1MA 2JCHA 1M18A 1N1JB 1P3KC 1WWIA 5E5AC 2G5HC 3WAAA 5AVCD 2CWEA 3KUYB 1P3FB 1P3LA 1P3PA 4NE3A 3C1BA 3KWQA
chains in the Genus database with same CATH topology
3AZJB 4XUJD 5AV5B 2Y2IA 3X1UD 4H9OA 3KUYC 1P3FC 3X1TB 3MGPC 3AV2B 3LZ0B 3WTPD 5B33C 4WU9A 3KWQC 5G49A 3WTPC 3IP4C 1P3AB 3F6TA 1W2EA 2FJ7C 3WAAC 4AWLB 5AV8B 3AZHC 1A7WA 3W99D 1U35C 5GXQD 3B6GA 3LELA 1EQZA 3A6NC 5B32D 3EPKA 1M19C 5JRGC 2Y2QA 1BH8B 3C1CD 1TZYA 3AV1C 1H3OB 1ID3A 2XD1A 4H9OB 3REKC 3RELA 3VH6A 5B40C 2F8NG 1S32B 4XZQB 3AV1B 5DNMB 1TZYD 1KX4B 1P3KB 4WU8C 3TU4B 1M1AA 5BNVA 3MGRA 5B32C 1P3GD 3AZFB 5BNXB 3RELB 3B6GD 4WU8B 5B0ZB 5B24A 1P3OA 5AY8D 3W98B 4LD9C 3AV2A 3AN2C 1P34A 3B0DC 3WKJC 4H9NB 4LD9D 4YS3C 3MGRB 1ID3D 3KWQB 2HIOC 3AZID 3C1CA 3UTBB 5AVBC 3MGQC 1P3MC 4KUDD 3W97A 5FUGB 2BG1A 4E44A 5CPJB 1HQ3D 1P3BD 3EPJA 2HIOB 4E45A 3WA9B 5AV5C 1P3MB 2AROB 1P3AA 1TAFB 1F66D 3AN2D 4YM6B 2Y2OA 5CPIC 3AZNC 2AROC 3UTAB 3AYWB 4QLCC 1M19B 1WWSA 5AV8C 5B24B 1P3OB 3W98A 3KXBA 3MGPD 2Y2NA 4WNNA 3UTAC 3AZGA 1TAFA 3AYWC 2CV5A 1KX5B 3VH6T 1Q9CA 4G91C 3AZLD 1AOID 3X1SB 5B40B 3W96B 4ZUXA 1N1JA 5AY8C 5AVCC 1BH9B 5KDMB 4X23C 5DNNA 4ZUXD 4J8UB 3AZFC 3MGSB 4JJNB 4X23B 3REJB 5B32A 4EO5C 3AFAB 1P3IB 4KHAA 5CHLB 3MGRC 1M1AC 3NQJA 5CPIA 5GT3A 2FJ7D 2CV5B 4J8VB 3UT9A 2DQNC 5F99A 5E5AB 3H0MC 3NQUA 1F66A 2Y2LA 2UWXA 4QLCD 3X1VA 2IO5B 5B33D 4Z5TD 3B0DB 4J8VC 5AV6C 5AV5A 1KX3A 3R45B 5AVBA 3MGQA 2RVQD 3AZHB 4WU9B 4YS3A 4H9RA 3B0CT 3REIA 3C1CC 4XUJB 5JA4A 5AV5D 3X1UB 4J8WC 5B24C 1P3OC 1ZLAD 3WA9C 3AV2D 5B2JB 3WTPB 1P34C 3AN2A 2BYKA 4KUDC 2LY8A 4J8WB 1S32A 2FJ7A 5CPIB 4H9NA 5BS7A 1KX3C 5B0YC 2RVQC 5F99D 3X1VC 5CP6D 1P3PD 4NE6A 4J8UC 3A6NB 3UT9C 3LZ1D 1BH9A 2NZDB 2J8PA 5B31B 5B32B 2BYMB 1B6WA 1ID3C 1KX4A 1PZRA 3AV1A 3MVDB 4KGCB 3A6NA 3AZMB 1AOIA 5B1LA 1S32D 4CAYB 1BH8A 4XZQD 4H9QA 3AV1D 5DNNC 4UUZB 5DNMD 2PYOB 1P3KD 3TU4D 3LZ1C 5AV9B 2ZY2A 1P3GB 2F8NH 4WU9C 3KXBD 3MGPA 3AZGD 5B0ZD 3W98D 3KXBC 3AZGC 4CSRB 1KX3D 3REHD 3KWQD 3AZIB 1JFIA 1F1EA 2Y2JA 4KUDB 3REHC 4YM6A 3UT9D 1HQ3B 1P3BB 5C3IC 3X1TA 2HIOD 3AZIC 3WTPE 2FFFB 5B0YD 3V9RA 1P3KA 3W96C 5CPJA 2JE5A 1M18C 5B1LC 1AOIC 5B31A 3W97C 1P3MA 5GT0D 3UTAD 3AYWD 5CPKD 3REJA 5B24D 1P3OD 2F8NK 4XZQA 1KX5D 2NQBC 2NZDA 3WKJD 4CAYA 3VH6W 3AZLB 4J8UA 5B40D 1P3IC 3MNNB 5AV6D 5B2IA 4J8XB 1ULYA 4WU8A 5BS7C 3VH5W 3TU4C 4J8UD 3MNNC 3LELB 2F2AC 3MGSD 4J8XC 3UTBC 3AZEA 1P3IA 3AZMC 3REKA 4Z66B 4JJND 3B0BA 2YFVA 5B0ZC 3REJD 3W99C 1U35D 4Z2MG 3AFAD 1M19A 1EQZC 5GSUA 2FJ7B 3KSYA 2CV5D 3W99A 5B0ZA 3AL0C 5AVBB 3MGQB 3AZNB 5B2JC 3AZIA 1JFIB 4WZSB 5BT1C 3W96A 5GT3B 3X1TC 4QLCB 5CPJC 5B33B 3LZ0C 4Z5TB 3EPLA 5JA4B 3TU4A 1M18B 2YFWA 5B1MB 2JSSA 2Y2KA 3O62C 5FUGA 3AZHD 5GT3C 4WU9D 3WTPA 4G91B 4ZBJB 4AWLC 4Z5TC 3REHA 3WAAB 3X1SC 3AZEB 4R8PD 2L5AA 5AV9A 5JRGD 1P34B 5C3IB 4WJ3C 4H9PA 1ZLAB 3AZJA 5B2JD 2YFVB 3FDDA 4NE5A 2F8NB 4XZQC 5B2ID 5B1LB 4J8WD 1P3PC 1P3LC 5CPID 3LZ1A 2RIQA 4JJNC 5AY8A 5E5AA 5F99B 5CP6B 1P3PB 4WNNB 2Y2MA 5BO0A 3B6FD 3A6ND 3AZKA 1EQZD 2Y2PA 5DNND 5DNMC 5GT0C 5CPKC 3UTAA 3LZ1B 3AYWA 2CV5C 1KX4C 2NZDD 5B31D 4YS3B 4H9QB 3B0CW 3MVDD 4KGCD 2ZM5A 4H9PB 3A1KA 3AZMD 3LJAB 5B0YA 2PYOD 3LJAC 5AV9D 3NQJB 4NFTA 4CSRA 2ZY5A 3X1VD 4XUJA 3X1UA 4H9SA 3O62B 2PYOA 3KXBB 2Y2HA 4HGAB 3AZGB 1P3LD 3REKD 4KUDA 4DRAA 5BNXA 1KX5C 1KX3B 2NQBD 4LD9A 3WA9A 3REID 1HQ3A 1P3BA 3REHB 3MVDA 3REIC 3W97D 4Z66A 4KGCA 5AV6A 4J8VA 5GSUD 3UT9B 4ZBJC 5BNVB 3AZKD 5F99C 2HUEB 1M1AD 3C1BD 3H0LC 5B0YB 1P3GA 1R4VA 5GT0B 5CPKB 3VH5A 4R8PC 3AZLA 5AVCB 1B67A 3KUYD 1P3FD 1S32C 5CP6C 2G5IC 4Z66C 3AZJD 3MVDC 3AZFA 3AZKC 3WKJB 4KGCC 3A1IA 2DF4C 5BT1D 3X1TD 4J8WA 2VQRA 2IO5C 3LZ0D 3P5JB 1KX5A 3MNND 5AV6B 4J8XD 4X23A 3AZHA 2ZY3A 2Y2GA 3LJAA 1P3AD 2XD5A 2PYOC 3VH5T 5B32G 4G92B 5AV8D 3LELD 3EG5B 1Z2CB 5KDMA 5G49B 3W99B 4Z66D 3AZJC 1F66C 5GXQB 1ZLAA 1U35B 1HTAA 2AROA 3X1SA 5AV8A 4Z5TA 4QLCA 1P3AC 1ZLAC 3C1CB 2YFWB 3V9RB 5DNMA 5AVBD 3MGQD 3AZND 3LZ0A 5GT3D 2ZY4A 5B1MC 1M18D 1TZYB 5B1MD 4JJNA 1KX4D 5GSUC 5AVCA 3R45A 3WAAD 3AZED 3MGSC 4R8PB 4UPKA 5JRGB 4ZUXC 3RELD 3AZFD 1P34D 3B6GB 3WKJA 4WU8D 5AY8B 3UTBA 4EO5B 5CP6A 5B2IB 3AFAC 2F8ND 5B1LD 3W98C 3B6FC 4LD9B 3MGRD 3AZLC 4R8PA 1ID3B 5AV9C 3UTBD 2F8NA 5B2IC 3AZNA 1P3GC 5CPJD 3B6FB 3O62A 3RELC 3WA9D 1EQZB 1P3MD 5DNNB 2AROD 2NQBA 4DRBA 5BO0B 3NQUB 1F66B 4YS3D 3AN2B 4YM6D 5GXQC 2BYKB 5B2JA 5JRGA 2HIOA 4G92C 4WV4B 4KHAB 1M19D 1HQ3C 5GXQA 1P3BC 2W8SA 1U35A 3LJAD 4H9RB 3MGPB 3AV2C 3EPHA 3MNNA 5B31G 4J8XA 3AZEC 3AZMA 1AOIB 3X1SD 4H9SC 3W96D 4XUJC 3X1UC 3X1VB 4HGAC 4M6BA 4YM6C 3O62D 2BYMA 3KUYA 4DQYB 3REKB 1P3LB 1P3FA 4ZUXB 2NQBB 5B33A 5B40A 2NZDC 3AFAA 3REIB 4X23D 4Z2MH 3W97B 1TZYC 4UUZA 3C1BC 5GSUB 1BFMA 3MGSA 1P3ID 3KFUG 2HUEC 3REJC 3H0RC 5GT0A 1H3OA 1T3UA 3AZKB 5CPKA 3B6FA 1M1AB 3C1BB 4J8VD 3LELC 3B6GC 5B31C 5E5AD 1KU5A 5B1MA 2JCHA 1M18A 1N1JB 1P3KC 1WWIA 5E5AC 2G5HC 3WAAA 5AVCD 2CWEA 3KUYB 1P3FB 1P3LA 1P3PA 4NE3A 3C1BA 3KWQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AZJ B;  4XUJ D;  5AV5 B;  3X1U D;  4H9O A;  3KUY C;  1P3F C;  3X1T B;  3MGP C;  3AV2 B;  3LZ0 B;  3WTP D;  5B33 C;  4WU9 A;  3KWQ C;  5G49 A;  3WTP C;  1P3A B;  2FJ7 C;  3WAA C;  4AWL B;  5AV8 B;  3AZH C;  1A7W A;  3W99 D;  1U35 C;  5GXQ D;  3B6G A;  3LEL A;  1EQZ A;  3A6N C;  5B32 D;  1M19 C;  5JRG C;  1BH8 B;  3C1C D;  1TZY A;  3AV1 C;  1H3O B;  1ID3 A;  4H9O B;  3REK C;  3REL A;  3VH6 A;  5B40 C;  2F8N G;  1S32 B;  4XZQ B;  3AV1 B;  5DNM B;  1TZY D;  1KX4 B;  1P3K B;  4WU8 C;  3TU4 B;  1M1A A;  5BNV A;  3MGR A;  5B32 C;  1P3G D;  3AZF B;  5BNX B;  3REL B;  3B6G D;  4WU8 B;  5B0Z B;  5B24 A;  1P3O A;  5AY8 D;  3W98 B;  4LD9 C;  3AV2 A;  3AN2 C;  1P34 A;  3B0D C;  3WKJ C;  4H9N B;  4LD9 D;  4YS3 C;  3MGR B;  1ID3 D;  3KWQ B;  2HIO C;  3AZI D;  3C1C A;  3UTB B;  5AVB C;  3MGQ C;  1P3M C;  4KUD D;  3W97 A;  5FUG B;  4E44 A;  5CPJ B;  1HQ3 D;  1P3B D;  2HIO B;  4E45 A;  3WA9 B;  5AV5 C;  1P3M B;  2ARO B;  1P3A A;  1TAF B;  1F66 D;  3AN2 D;  4YM6 B;  5CPI C;  3AZN C;  2ARO C;  3UTA B;  3AYW B;  4QLC C;  1M19 B;  1WWS A;  5AV8 C;  5B24 B;  1P3O B;  3W98 A;  3KXB A;  3MGP D;  4WNN A;  3AZG A;  3UTA C;  3AYW C;  1TAF A;  2CV5 A;  1KX5 B;  3VH6 T;  1Q9C A;  4G91 C;  3AZL D;  1AOI D;  3X1S B;  5B40 B;  3W96 B;  4ZUX A;  1N1J A;  5AY8 C;  5AVC C;  1BH9 B;  5KDM B;  4X23 C;  5DNN A;  4ZUX D;  4J8U B;  3AZF C;  3MGS B;  4JJN B;  4X23 B;  3REJ B;  5B32 A;  4EO5 C;  3AFA B;  1P3I B;  4KHA A;  5CHL B;  3MGR C;  1M1A C;  3NQJ A;  5CPI A;  5GT3 A;  2FJ7 D;  2CV5 B;  4J8V B;  3UT9 A;  5F99 A;  5E5A B;  3NQU A;  1F66 A;  4QLC D;  3X1V A;  2IO5 B;  5B33 D;  4Z5T D;  3B0D B;  4J8V C;  5AV6 C;  5AV5 A;  1KX3 A;  3R45 B;  5AVB A;  3MGQ A;  2RVQ D;  3AZH B;  4WU9 B;  4YS3 A;  4H9R A;  3B0C T;  3REI A;  3C1C C;  4XUJ B;  5JA4 A;  5AV5 D;  3X1U B;  4J8W C;  5B24 C;  1P3O C;  1ZLA D;  3WA9 C;  3AV2 D;  5B2J B;  3WTP B;  1P34 C;  3AN2 A;  2BYK A;  4KUD C;  2LY8 A;  4J8W B;  1S32 A;  2FJ7 A;  5CPI B;  4H9N A;  5BS7 A;  1KX3 C;  5B0Y C;  2RVQ C;  5F99 D;  3X1V C;  5CP6 D;  1P3P D;  4NE6 A;  4J8U C;  3A6N B;  3UT9 C;  3LZ1 D;  1BH9 A;  2NZD B;  5B31 B;  5B32 B;  2BYM B;  1B6W A;  1ID3 C;  1KX4 A;  3AV1 A;  3MVD B;  4KGC B;  3A6N A;  3AZM B;  1AOI A;  5B1L A;  1S32 D;  4CAY B;  1BH8 A;  4XZQ D;  4H9Q A;  3AV1 D;  5DNN C;  4UUZ B;  5DNM D;  2PYO B;  1P3K D;  3TU4 D;  3LZ1 C;  5AV9 B;  1P3G B;  2F8N H;  4WU9 C;  3KXB D;  3MGP A;  3AZG D;  5B0Z D;  3W98 D;  3KXB C;  3AZG C;  4CSR B;  1KX3 D;  3REH D;  3KWQ D;  3AZI B;  1JFI A;  1F1E A;  4KUD B;  3REH C;  4YM6 A;  3UT9 D;  1HQ3 B;  1P3B B;  5C3I C;  3X1T A;  2HIO D;  3AZI C;  3WTP E;  5B0Y D;  3V9R A;  1P3K A;  3W96 C;  5CPJ A;  1M18 C;  5B1L C;  1AOI C;  5B31 A;  3W97 C;  1P3M A;  5GT0 D;  3UTA D;  3AYW D;  5CPK D;  3REJ A;  5B24 D;  1P3O D;  2F8N K;  4XZQ A;  1KX5 D;  2NQB C;  2NZD A;  3WKJ D;  4CAY A;  3VH6 W;  3AZL B;  4J8U A;  5B40 D;  1P3I C;  3MNN B;  5AV6 D;  5B2I A;  4J8X B;  1ULY A;  4WU8 A;  5BS7 C;  3VH5 W;  3TU4 C;  4J8U D;  3MNN C;  3LEL B;  3MGS D;  4J8X C;  3AZE A;  3UTB C;  1P3I A;  3AZM C;  3REK A;  4Z66 B;  4JJN D;  3B0B A;  2YFV A;  5B0Z C;  3REJ D;  3W99 C;  1U35 D;  4Z2M G;  3AFA D;  1M19 A;  1EQZ C;  5GSU A;  2FJ7 B;  3KSY A;  2CV5 D;  3W99 A;  5B0Z A;  5AVB B;  3MGQ B;  3AZN B;  5B2J C;  3AZI A;  1JFI B;  4WZS B;  5BT1 C;  3W96 A;  5GT3 B;  3X1T C;  4QLC B;  5CPJ C;  5B33 B;  3LZ0 C;  4Z5T B;  5JA4 B;  3TU4 A;  1M18 B;  2YFW A;  5B1M B;  2JSS A;  3O62 C;  5FUG A;  3AZH D;  5GT3 C;  4WU9 D;  3WTP A;  4G91 B;  4ZBJ B;  4AWL C;  4Z5T C;  3REH A;  3WAA B;  3X1S C;  3AZE B;  4R8P D;  2L5A A;  5AV9 A;  5JRG D;  1P34 B;  5C3I B;  4H9P A;  1ZLA B;  3AZJ A;  5B2J D;  2YFV B;  4NE5 A;  2F8N B;  4XZQ C;  5B2I D;  5B1L B;  4J8W D;  1P3P C;  1P3L C;  5CPI D;  3LZ1 A;  4JJN C;  5AY8 A;  5E5A A;  5F99 B;  5CP6 B;  1P3P B;  4WNN B;  5BO0 A;  3B6F D;  3A6N D;  3AZK A;  1EQZ D;  3B6F C;  5DNN D;  5DNM C;  5GT0 C;  5CPK C;  3UTA A;  3LZ1 B;  3AYW A;  2CV5 C;  1KX4 C;  2NZD D;  5B31 D;  4YS3 B;  4H9Q B;  3B0C W;  3MVD D;  4KGC D;  4H9P B;  3AZM D;  3LJA B;  5B0Y A;  2PYO D;  3LJA C;  5AV9 D;  3NQJ B;  4NFT A;  4CSR A;  3X1V D;  4XUJ A;  3X1U A;  4H9S A;  3O62 B;  2PYO A;  3KXB B;  3AZG B;  4HGA B;  1P3L D;  3REK D;  4KUD A;  4DRA A;  5BNX A;  1KX5 C;  1KX3 B;  2NQB D;  4LD9 A;  3WA9 A;  3REI D;  1HQ3 A;  1P3B A;  3REH B;  3MVD A;  3REI C;  3W97 D;  4Z66 A;  4KGC A;  5AV6 A;  4J8V A;  5GSU D;  3UT9 B;  4ZBJ C;  5BNV B;  3AZK D;  5F99 C;  2HUE B;  1M1A D;  3C1B D;  5B0Y B;  1P3G A;  1R4V A;  5GT0 B;  5CPK B;  3VH5 A;  4R8P C;  3AZL A;  5AVC B;  1B67 A;  3KUY D;  1P3F D;  1S32 C;  5CP6 C;  4Z66 C;  3AZJ D;  3WKJ B;  3MVD C;  3AZF A;  3AZK C;  4KGC C;  5BT1 D;  3X1T D;  4J8W A;  2IO5 C;  3LZ0 D;  1KX5 A;  3MNN D;  5AV6 B;  4J8X D;  4X23 A;  3AZH A;  3LJA A;  1P3A D;  2PYO C;  3VH5 T;  5B32 G;  4G92 B;  5AV8 D;  3LEL D;  5KDM A;  5G49 B;  3W99 B;  4Z66 D;  3AZJ C;  1F66 C;  5GXQ B;  1ZLA A;  1U35 B;  1HTA A;  2ARO A;  3X1S A;  5AV8 A;  4Z5T A;  4QLC A;  1P3A C;  1ZLA C;  3C1C B;  2YFW B;  3V9R B;  5DNM A;  5AVB D;  3MGQ D;  3AZN D;  3LZ0 A;  5GT3 D;  5B1M C;  1M18 D;  1TZY B;  5B1M D;  4JJN A;  1KX4 D;  5GSU C;  5AVC A;  3R45 A;  3WAA D;  3AZE D;  3MGS C;  4R8P B;  4ZUX C;  5JRG B;  3AZF D;  3REL D;  1P34 D;  3B6G B;  3WKJ A;  4WU8 D;  5AY8 B;  3UTB A;  4EO5 B;  5CP6 A;  5B2I B;  3AFA C;  2F8N D;  5B1L D;  3W98 C;  4LD9 B;  3MGR D;  3AZL C;  4R8P A;  1ID3 B;  5AV9 C;  3UTB D;  2F8N A;  5B2I C;  3AZN A;  1P3G C;  5CPJ D;  3B6F B;  3O62 A;  3REL C;  3WA9 D;  1EQZ B;  1P3M D;  5DNN B;  2ARO D;  2NQB A;  4DRB A;  5BO0 B;  3NQU B;  1F66 B;  4YS3 D;  3AN2 B;  4YM6 D;  5GXQ C;  2BYK B;  5B2J A;  5JRG A;  2HIO A;  4G92 C;  4WV4 B;  4KHA B;  1M19 D;  1HQ3 C;  5GXQ A;  1P3B C;  1U35 A;  3LJA D;  4H9R B;  3MGP B;  3AV2 C;  3MNN A;  5B31 G;  4J8X A;  3AZE C;  3AZM A;  1AOI B;  3X1S D;  4H9S C;  3W96 D;  4XUJ C;  3X1U C;  3X1V B;  4HGA C;  4M6B A;  4YM6 C;  3O62 D;  2BYM A;  3KUY A;  3REK B;  1P3L B;  1P3F A;  4ZUX B;  2NQB B;  5B33 A;  5B40 A;  2NZD C;  3AFA A;  3REI B;  4X23 D;  4Z2M H;  3W97 B;  1TZY C;  4UUZ A;  3C1B C;  5GSU B;  1BFM A;  3MGS A;  1P3I D;  2HUE C;  3REJ C;  5GT0 A;  3AZK B;  1H3O A;  5CPK A;  3B6F A;  1M1A B;  3C1B B;  4J8V D;  3LEL C;  3B6G C;  5B31 C;  5E5A D;  1KU5 A;  5B1M A;  1M18 A;  1N1J B;  1P3K C;  1WWI A;  5E5A C;  3WAA A;  5AVC D;  2CWE A;  3KUY B;  1P3F B;  1P3L A;  1P3P A;  4NE3 A;  3C1B A;  3KWQ A; 
#chains in the Genus database with same CATH topology
 3AZJ B;  4XUJ D;  5AV5 B;  2Y2I A;  3X1U D;  4H9O A;  3KUY C;  1P3F C;  3X1T B;  3MGP C;  3AV2 B;  3LZ0 B;  3WTP D;  5B33 C;  4WU9 A;  3KWQ C;  5G49 A;  3WTP C;  3IP4 C;  1P3A B;  3F6T A;  1W2E A;  2FJ7 C;  3WAA C;  4AWL B;  5AV8 B;  3AZH C;  1A7W A;  3W99 D;  1U35 C;  5GXQ D;  3B6G A;  3LEL A;  1EQZ A;  3A6N C;  5B32 D;  3EPK A;  1M19 C;  5JRG C;  2Y2Q A;  1BH8 B;  3C1C D;  1TZY A;  3AV1 C;  1H3O B;  1ID3 A;  2XD1 A;  4H9O B;  3REK C;  3REL A;  3VH6 A;  5B40 C;  2F8N G;  1S32 B;  4XZQ B;  3AV1 B;  5DNM B;  1TZY D;  1KX4 B;  1P3K B;  4WU8 C;  3TU4 B;  1M1A A;  5BNV A;  3MGR A;  5B32 C;  1P3G D;  3AZF B;  5BNX B;  3REL B;  3B6G D;  4WU8 B;  5B0Z B;  5B24 A;  1P3O A;  5AY8 D;  3W98 B;  4LD9 C;  3AV2 A;  3AN2 C;  1P34 A;  3B0D C;  3WKJ C;  4H9N B;  4LD9 D;  4YS3 C;  3MGR B;  1ID3 D;  3KWQ B;  2HIO C;  3AZI D;  3C1C A;  3UTB B;  5AVB C;  3MGQ C;  1P3M C;  4KUD D;  3W97 A;  5FUG B;  2BG1 A;  4E44 A;  5CPJ B;  1HQ3 D;  1P3B D;  3EPJ A;  2HIO B;  4E45 A;  3WA9 B;  5AV5 C;  1P3M B;  2ARO B;  1P3A A;  1TAF B;  1F66 D;  3AN2 D;  4YM6 B;  2Y2O A;  5CPI C;  3AZN C;  2ARO C;  3UTA B;  3AYW B;  4QLC C;  1M19 B;  1WWS A;  5AV8 C;  5B24 B;  1P3O B;  3W98 A;  3KXB A;  3MGP D;  2Y2N A;  4WNN A;  3UTA C;  3AZG A;  1TAF A;  3AYW C;  2CV5 A;  1KX5 B;  3VH6 T;  1Q9C A;  4G91 C;  3AZL D;  1AOI D;  3X1S B;  5B40 B;  3W96 B;  4ZUX A;  1N1J A;  5AY8 C;  5AVC C;  1BH9 B;  5KDM B;  4X23 C;  5DNN A;  4ZUX D;  4J8U B;  3AZF C;  3MGS B;  4JJN B;  4X23 B;  3REJ B;  5B32 A;  4EO5 C;  3AFA B;  1P3I B;  4KHA A;  5CHL B;  3MGR C;  1M1A C;  3NQJ A;  5CPI A;  5GT3 A;  2FJ7 D;  2CV5 B;  4J8V B;  3UT9 A;  2DQN C;  5F99 A;  5E5A B;  3H0M C;  3NQU A;  1F66 A;  2Y2L A;  2UWX A;  4QLC D;  3X1V A;  2IO5 B;  5B33 D;  4Z5T D;  3B0D B;  4J8V C;  5AV6 C;  5AV5 A;  1KX3 A;  3R45 B;  5AVB A;  3MGQ A;  2RVQ D;  3AZH B;  4WU9 B;  4YS3 A;  4H9R A;  3B0C T;  3REI A;  3C1C C;  4XUJ B;  5JA4 A;  5AV5 D;  3X1U B;  4J8W C;  5B24 C;  1P3O C;  1ZLA D;  3WA9 C;  3AV2 D;  5B2J B;  3WTP B;  1P34 C;  3AN2 A;  2BYK A;  4KUD C;  2LY8 A;  4J8W B;  1S32 A;  2FJ7 A;  5CPI B;  4H9N A;  5BS7 A;  1KX3 C;  5B0Y C;  2RVQ C;  5F99 D;  3X1V C;  5CP6 D;  1P3P D;  4NE6 A;  4J8U C;  3A6N B;  3UT9 C;  3LZ1 D;  1BH9 A;  2NZD B;  2J8P A;  5B31 B;  5B32 B;  2BYM B;  1B6W A;  1ID3 C;  1KX4 A;  1PZR A;  3AV1 A;  3MVD B;  4KGC B;  3A6N A;  3AZM B;  1AOI A;  5B1L A;  1S32 D;  4CAY B;  1BH8 A;  4XZQ D;  4H9Q A;  3AV1 D;  5DNN C;  4UUZ B;  5DNM D;  2PYO B;  1P3K D;  3TU4 D;  3LZ1 C;  5AV9 B;  2ZY2 A;  1P3G B;  2F8N H;  4WU9 C;  3KXB D;  3MGP A;  3AZG D;  5B0Z D;  3W98 D;  3KXB C;  3AZG C;  4CSR B;  1KX3 D;  3REH D;  3KWQ D;  3AZI B;  1JFI A;  1F1E A;  2Y2J A;  4KUD B;  3REH C;  4YM6 A;  3UT9 D;  1HQ3 B;  1P3B B;  5C3I C;  3X1T A;  2HIO D;  3AZI C;  3WTP E;  2FFF B;  5B0Y D;  3V9R A;  1P3K A;  3W96 C;  5CPJ A;  2JE5 A;  1M18 C;  5B1L C;  1AOI C;  5B31 A;  3W97 C;  1P3M A;  5GT0 D;  3UTA D;  3AYW D;  5CPK D;  3REJ A;  5B24 D;  1P3O D;  2F8N K;  4XZQ A;  1KX5 D;  2NQB C;  2NZD A;  3WKJ D;  4CAY A;  3VH6 W;  3AZL B;  4J8U A;  5B40 D;  1P3I C;  3MNN B;  5AV6 D;  5B2I A;  4J8X B;  1ULY A;  4WU8 A;  5BS7 C;  3VH5 W;  3TU4 C;  4J8U D;  3MNN C;  3LEL B;  2F2A C;  3MGS D;  4J8X C;  3UTB C;  3AZE A;  1P3I A;  3AZM C;  3REK A;  4Z66 B;  4JJN D;  3B0B A;  2YFV A;  5B0Z C;  3REJ D;  3W99 C;  1U35 D;  4Z2M G;  3AFA D;  1M19 A;  1EQZ C;  5GSU A;  2FJ7 B;  3KSY A;  2CV5 D;  3W99 A;  5B0Z A;  3AL0 C;  5AVB B;  3MGQ B;  3AZN B;  5B2J C;  3AZI A;  1JFI B;  4WZS B;  5BT1 C;  3W96 A;  5GT3 B;  3X1T C;  4QLC B;  5CPJ C;  5B33 B;  3LZ0 C;  4Z5T B;  3EPL A;  5JA4 B;  3TU4 A;  1M18 B;  2YFW A;  5B1M B;  2JSS A;  2Y2K A;  3O62 C;  5FUG A;  3AZH D;  5GT3 C;  4WU9 D;  3WTP A;  4G91 B;  4ZBJ B;  4AWL C;  4Z5T C;  3REH A;  3WAA B;  3X1S C;  3AZE B;  4R8P D;  2L5A A;  5AV9 A;  5JRG D;  1P34 B;  5C3I B;  4WJ3 C;  4H9P A;  1ZLA B;  3AZJ A;  5B2J D;  2YFV B;  3FDD A;  4NE5 A;  2F8N B;  4XZQ C;  5B2I D;  5B1L B;  4J8W D;  1P3P C;  1P3L C;  5CPI D;  3LZ1 A;  2RIQ A;  4JJN C;  5AY8 A;  5E5A A;  5F99 B;  5CP6 B;  1P3P B;  4WNN B;  2Y2M A;  5BO0 A;  3B6F D;  3A6N D;  3AZK A;  1EQZ D;  2Y2P A;  5DNN D;  5DNM C;  5GT0 C;  5CPK C;  3UTA A;  3LZ1 B;  3AYW A;  2CV5 C;  1KX4 C;  2NZD D;  5B31 D;  4YS3 B;  4H9Q B;  3B0C W;  3MVD D;  4KGC D;  2ZM5 A;  4H9P B;  3A1K A;  3AZM D;  3LJA B;  5B0Y A;  2PYO D;  3LJA C;  5AV9 D;  3NQJ B;  4NFT A;  4CSR A;  2ZY5 A;  3X1V D;  4XUJ A;  3X1U A;  4H9S A;  3O62 B;  2PYO A;  3KXB B;  2Y2H A;  4HGA B;  3AZG B;  1P3L D;  3REK D;  4KUD A;  4DRA A;  5BNX A;  1KX5 C;  1KX3 B;  2NQB D;  4LD9 A;  3WA9 A;  3REI D;  1HQ3 A;  1P3B A;  3REH B;  3MVD A;  3REI C;  3W97 D;  4Z66 A;  4KGC A;  5AV6 A;  4J8V A;  5GSU D;  3UT9 B;  4ZBJ C;  5BNV B;  3AZK D;  5F99 C;  2HUE B;  1M1A D;  3C1B D;  3H0L C;  5B0Y B;  1P3G A;  1R4V A;  5GT0 B;  5CPK B;  3VH5 A;  4R8P C;  3AZL A;  5AVC B;  1B67 A;  3KUY D;  1P3F D;  1S32 C;  5CP6 C;  2G5I C;  4Z66 C;  3AZJ D;  3MVD C;  3AZF A;  3AZK C;  3WKJ B;  4KGC C;  3A1I A;  2DF4 C;  5BT1 D;  3X1T D;  4J8W A;  2VQR A;  2IO5 C;  3LZ0 D;  3P5J B;  1KX5 A;  3MNN D;  5AV6 B;  4J8X D;  4X23 A;  3AZH A;  2ZY3 A;  2Y2G A;  3LJA A;  1P3A D;  2XD5 A;  2PYO C;  3VH5 T;  5B32 G;  4G92 B;  5AV8 D;  3LEL D;  3EG5 B;  1Z2C B;  5KDM A;  5G49 B;  3W99 B;  4Z66 D;  3AZJ C;  1F66 C;  5GXQ B;  1ZLA A;  1U35 B;  1HTA A;  2ARO A;  3X1S A;  5AV8 A;  4Z5T A;  4QLC A;  1P3A C;  1ZLA C;  3C1C B;  2YFW B;  3V9R B;  5DNM A;  5AVB D;  3MGQ D;  3AZN D;  3LZ0 A;  5GT3 D;  2ZY4 A;  5B1M C;  1M18 D;  1TZY B;  5B1M D;  4JJN A;  1KX4 D;  5GSU C;  5AVC A;  3R45 A;  3WAA D;  3AZE D;  3MGS C;  4R8P B;  4UPK A;  5JRG B;  4ZUX C;  3REL D;  3AZF D;  1P34 D;  3B6G B;  3WKJ A;  4WU8 D;  5AY8 B;  3UTB A;  4EO5 B;  5CP6 A;  5B2I B;  3AFA C;  2F8N D;  5B1L D;  3W98 C;  3B6F C;  4LD9 B;  3MGR D;  3AZL C;  4R8P A;  1ID3 B;  5AV9 C;  3UTB D;  2F8N A;  5B2I C;  3AZN A;  1P3G C;  5CPJ D;  3B6F B;  3O62 A;  3REL C;  3WA9 D;  1EQZ B;  1P3M D;  5DNN B;  2ARO D;  2NQB A;  4DRB A;  5BO0 B;  3NQU B;  1F66 B;  4YS3 D;  3AN2 B;  4YM6 D;  5GXQ C;  2BYK B;  5B2J A;  5JRG A;  2HIO A;  4G92 C;  4WV4 B;  4KHA B;  1M19 D;  1HQ3 C;  5GXQ A;  1P3B C;  2W8S A;  1U35 A;  3LJA D;  4H9R B;  3MGP B;  3AV2 C;  3EPH A;  3MNN A;  5B31 G;  4J8X A;  3AZE C;  3AZM A;  1AOI B;  3X1S D;  4H9S C;  3W96 D;  4XUJ C;  3X1U C;  3X1V B;  4HGA C;  4M6B A;  4YM6 C;  3O62 D;  2BYM A;  3KUY A;  4DQY B;  3REK B;  1P3L B;  1P3F A;  4ZUX B;  2NQB B;  5B33 A;  5B40 A;  2NZD C;  3AFA A;  3REI B;  4X23 D;  4Z2M H;  3W97 B;  1TZY C;  4UUZ A;  3C1B C;  5GSU B;  1BFM A;  3MGS A;  1P3I D;  3KFU G;  2HUE C;  3REJ C;  3H0R C;  5GT0 A;  1H3O A;  1T3U A;  3AZK B;  5CPK A;  3B6F A;  1M1A B;  3C1B B;  4J8V D;  3LEL C;  3B6G C;  5B31 C;  5E5A D;  1KU5 A;  5B1M A;  2JCH A;  1M18 A;  1N1J B;  1P3K C;  1WWI A;  5E5A C;  2G5H C;  3WAA A;  5AVC D;  2CWE A;  3KUY B;  1P3F B;  1P3L A;  1P3P A;  4NE3 A;  3C1B A;  3KWQ A; 
#chains in the Genus database with same CATH homology
 3AZJ B;  4XUJ D;  5AV5 B;  2Y2I A;  3X1U D;  4H9O A;  3KUY C;  1P3F C;  3X1T B;  3MGP C;  3AV2 B;  3LZ0 B;  3WTP D;  5B33 C;  4WU9 A;  3KWQ C;  5G49 A;  3WTP C;  3IP4 C;  1P3A B;  3F6T A;  1W2E A;  2FJ7 C;  3WAA C;  4AWL B;  5AV8 B;  3AZH C;  1A7W A;  3W99 D;  1U35 C;  5GXQ D;  3B6G A;  3LEL A;  1EQZ A;  3A6N C;  5B32 D;  3EPK A;  1M19 C;  5JRG C;  2Y2Q A;  1BH8 B;  3C1C D;  1TZY A;  3AV1 C;  1H3O B;  1ID3 A;  2XD1 A;  4H9O B;  3REK C;  3REL A;  3VH6 A;  5B40 C;  2F8N G;  1S32 B;  4XZQ B;  3AV1 B;  5DNM B;  1TZY D;  1KX4 B;  1P3K B;  4WU8 C;  3TU4 B;  1M1A A;  5BNV A;  3MGR A;  5B32 C;  1P3G D;  3AZF B;  5BNX B;  3REL B;  3B6G D;  4WU8 B;  5B0Z B;  5B24 A;  1P3O A;  5AY8 D;  3W98 B;  4LD9 C;  3AV2 A;  3AN2 C;  1P34 A;  3B0D C;  3WKJ C;  4H9N B;  4LD9 D;  4YS3 C;  3MGR B;  1ID3 D;  3KWQ B;  2HIO C;  3AZI D;  3C1C A;  3UTB B;  5AVB C;  3MGQ C;  1P3M C;  4KUD D;  3W97 A;  5FUG B;  2BG1 A;  4E44 A;  5CPJ B;  1HQ3 D;  1P3B D;  3EPJ A;  2HIO B;  4E45 A;  3WA9 B;  5AV5 C;  1P3M B;  2ARO B;  1P3A A;  1TAF B;  1F66 D;  3AN2 D;  4YM6 B;  2Y2O A;  5CPI C;  3AZN C;  2ARO C;  3UTA B;  3AYW B;  4QLC C;  1M19 B;  1WWS A;  5AV8 C;  5B24 B;  1P3O B;  3W98 A;  3KXB A;  3MGP D;  2Y2N A;  4WNN A;  3UTA C;  3AZG A;  1TAF A;  3AYW C;  2CV5 A;  1KX5 B;  3VH6 T;  1Q9C A;  4G91 C;  3AZL D;  1AOI D;  3X1S B;  5B40 B;  3W96 B;  4ZUX A;  1N1J A;  5AY8 C;  5AVC C;  1BH9 B;  5KDM B;  4X23 C;  5DNN A;  4ZUX D;  4J8U B;  3AZF C;  3MGS B;  4JJN B;  4X23 B;  3REJ B;  5B32 A;  4EO5 C;  3AFA B;  1P3I B;  4KHA A;  5CHL B;  3MGR C;  1M1A C;  3NQJ A;  5CPI A;  5GT3 A;  2FJ7 D;  2CV5 B;  4J8V B;  3UT9 A;  2DQN C;  5F99 A;  5E5A B;  3H0M C;  3NQU A;  1F66 A;  2Y2L A;  2UWX A;  4QLC D;  3X1V A;  2IO5 B;  5B33 D;  4Z5T D;  3B0D B;  4J8V C;  5AV6 C;  5AV5 A;  1KX3 A;  3R45 B;  5AVB A;  3MGQ A;  2RVQ D;  3AZH B;  4WU9 B;  4YS3 A;  4H9R A;  3B0C T;  3REI A;  3C1C C;  4XUJ B;  5JA4 A;  5AV5 D;  3X1U B;  4J8W C;  5B24 C;  1P3O C;  1ZLA D;  3WA9 C;  3AV2 D;  5B2J B;  3WTP B;  1P34 C;  3AN2 A;  2BYK A;  4KUD C;  2LY8 A;  4J8W B;  1S32 A;  2FJ7 A;  5CPI B;  4H9N A;  5BS7 A;  1KX3 C;  5B0Y C;  2RVQ C;  5F99 D;  3X1V C;  5CP6 D;  1P3P D;  4NE6 A;  4J8U C;  3A6N B;  3UT9 C;  3LZ1 D;  1BH9 A;  2NZD B;  2J8P A;  5B31 B;  5B32 B;  2BYM B;  1B6W A;  1ID3 C;  1KX4 A;  1PZR A;  3AV1 A;  3MVD B;  4KGC B;  3A6N A;  3AZM B;  1AOI A;  5B1L A;  1S32 D;  4CAY B;  1BH8 A;  4XZQ D;  4H9Q A;  3AV1 D;  5DNN C;  4UUZ B;  5DNM D;  2PYO B;  1P3K D;  3TU4 D;  3LZ1 C;  5AV9 B;  2ZY2 A;  1P3G B;  2F8N H;  4WU9 C;  3KXB D;  3MGP A;  3AZG D;  5B0Z D;  3W98 D;  3KXB C;  3AZG C;  4CSR B;  1KX3 D;  3REH D;  3KWQ D;  3AZI B;  1JFI A;  1F1E A;  2Y2J A;  4KUD B;  3REH C;  4YM6 A;  3UT9 D;  1HQ3 B;  1P3B B;  5C3I C;  3X1T A;  2HIO D;  3AZI C;  3WTP E;  2FFF B;  5B0Y D;  3V9R A;  1P3K A;  3W96 C;  5CPJ A;  2JE5 A;  1M18 C;  5B1L C;  1AOI C;  5B31 A;  3W97 C;  1P3M A;  5GT0 D;  3UTA D;  3AYW D;  5CPK D;  3REJ A;  5B24 D;  1P3O D;  2F8N K;  4XZQ A;  1KX5 D;  2NQB C;  2NZD A;  3WKJ D;  4CAY A;  3VH6 W;  3AZL B;  4J8U A;  5B40 D;  1P3I C;  3MNN B;  5AV6 D;  5B2I A;  4J8X B;  1ULY A;  4WU8 A;  5BS7 C;  3VH5 W;  3TU4 C;  4J8U D;  3MNN C;  3LEL B;  2F2A C;  3MGS D;  4J8X C;  3UTB C;  3AZE A;  1P3I A;  3AZM C;  3REK A;  4Z66 B;  4JJN D;  3B0B A;  2YFV A;  5B0Z C;  3REJ D;  3W99 C;  1U35 D;  4Z2M G;  3AFA D;  1M19 A;  1EQZ C;  5GSU A;  2FJ7 B;  3KSY A;  2CV5 D;  3W99 A;  5B0Z A;  3AL0 C;  5AVB B;  3MGQ B;  3AZN B;  5B2J C;  3AZI A;  1JFI B;  4WZS B;  5BT1 C;  3W96 A;  5GT3 B;  3X1T C;  4QLC B;  5CPJ C;  5B33 B;  3LZ0 C;  4Z5T B;  3EPL A;  5JA4 B;  3TU4 A;  1M18 B;  2YFW A;  5B1M B;  2JSS A;  2Y2K A;  3O62 C;  5FUG A;  3AZH D;  5GT3 C;  4WU9 D;  3WTP A;  4G91 B;  4ZBJ B;  4AWL C;  4Z5T C;  3REH A;  3WAA B;  3X1S C;  3AZE B;  4R8P D;  2L5A A;  5AV9 A;  5JRG D;  1P34 B;  5C3I B;  4WJ3 C;  4H9P A;  1ZLA B;  3AZJ A;  5B2J D;  2YFV B;  3FDD A;  4NE5 A;  2F8N B;  4XZQ C;  5B2I D;  5B1L B;  4J8W D;  1P3P C;  1P3L C;  5CPI D;  3LZ1 A;  2RIQ A;  4JJN C;  5AY8 A;  5E5A A;  5F99 B;  5CP6 B;  1P3P B;  4WNN B;  2Y2M A;  5BO0 A;  3B6F D;  3A6N D;  3AZK A;  1EQZ D;  2Y2P A;  5DNN D;  5DNM C;  5GT0 C;  5CPK C;  3UTA A;  3LZ1 B;  3AYW A;  2CV5 C;  1KX4 C;  2NZD D;  5B31 D;  4YS3 B;  4H9Q B;  3B0C W;  3MVD D;  4KGC D;  2ZM5 A;  4H9P B;  3A1K A;  3AZM D;  3LJA B;  5B0Y A;  2PYO D;  3LJA C;  5AV9 D;  3NQJ B;  4NFT A;  4CSR A;  2ZY5 A;  3X1V D;  4XUJ A;  3X1U A;  4H9S A;  3O62 B;  2PYO A;  3KXB B;  2Y2H A;  4HGA B;  3AZG B;  1P3L D;  3REK D;  4KUD A;  4DRA A;  5BNX A;  1KX5 C;  1KX3 B;  2NQB D;  4LD9 A;  3WA9 A;  3REI D;  1HQ3 A;  1P3B A;  3REH B;  3MVD A;  3REI C;  3W97 D;  4Z66 A;  4KGC A;  5AV6 A;  4J8V A;  5GSU D;  3UT9 B;  4ZBJ C;  5BNV B;  3AZK D;  5F99 C;  2HUE B;  1M1A D;  3C1B D;  3H0L C;  5B0Y B;  1P3G A;  1R4V A;  5GT0 B;  5CPK B;  3VH5 A;  4R8P C;  3AZL A;  5AVC B;  1B67 A;  3KUY D;  1P3F D;  1S32 C;  5CP6 C;  2G5I C;  4Z66 C;  3AZJ D;  3MVD C;  3AZF A;  3AZK C;  3WKJ B;  4KGC C;  3A1I A;  2DF4 C;  5BT1 D;  3X1T D;  4J8W A;  2VQR A;  2IO5 C;  3LZ0 D;  3P5J B;  1KX5 A;  3MNN D;  5AV6 B;  4J8X D;  4X23 A;  3AZH A;  2ZY3 A;  2Y2G A;  3LJA A;  1P3A D;  2XD5 A;  2PYO C;  3VH5 T;  5B32 G;  4G92 B;  5AV8 D;  3LEL D;  3EG5 B;  1Z2C B;  5KDM A;  5G49 B;  3W99 B;  4Z66 D;  3AZJ C;  1F66 C;  5GXQ B;  1ZLA A;  1U35 B;  1HTA A;  2ARO A;  3X1S A;  5AV8 A;  4Z5T A;  4QLC A;  1P3A C;  1ZLA C;  3C1C B;  2YFW B;  3V9R B;  5DNM A;  5AVB D;  3MGQ D;  3AZN D;  3LZ0 A;  5GT3 D;  2ZY4 A;  5B1M C;  1M18 D;  1TZY B;  5B1M D;  4JJN A;  1KX4 D;  5GSU C;  5AVC A;  3R45 A;  3WAA D;  3AZE D;  3MGS C;  4R8P B;  4UPK A;  5JRG B;  4ZUX C;  3REL D;  3AZF D;  1P34 D;  3B6G B;  3WKJ A;  4WU8 D;  5AY8 B;  3UTB A;  4EO5 B;  5CP6 A;  5B2I B;  3AFA C;  2F8N D;  5B1L D;  3W98 C;  3B6F C;  4LD9 B;  3MGR D;  3AZL C;  4R8P A;  1ID3 B;  5AV9 C;  3UTB D;  2F8N A;  5B2I C;  3AZN A;  1P3G C;  5CPJ D;  3B6F B;  3O62 A;  3REL C;  3WA9 D;  1EQZ B;  1P3M D;  5DNN B;  2ARO D;  2NQB A;  4DRB A;  5BO0 B;  3NQU B;  1F66 B;  4YS3 D;  3AN2 B;  4YM6 D;  5GXQ C;  2BYK B;  5B2J A;  5JRG A;  2HIO A;  4G92 C;  4WV4 B;  4KHA B;  1M19 D;  1HQ3 C;  5GXQ A;  1P3B C;  2W8S A;  1U35 A;  3LJA D;  4H9R B;  3MGP B;  3AV2 C;  3EPH A;  3MNN A;  5B31 G;  4J8X A;  3AZE C;  3AZM A;  1AOI B;  3X1S D;  4H9S C;  3W96 D;  4XUJ C;  3X1U C;  3X1V B;  4HGA C;  4M6B A;  4YM6 C;  3O62 D;  2BYM A;  3KUY A;  4DQY B;  3REK B;  1P3L B;  1P3F A;  4ZUX B;  2NQB B;  5B33 A;  5B40 A;  2NZD C;  3AFA A;  3REI B;  4X23 D;  4Z2M H;  3W97 B;  1TZY C;  4UUZ A;  3C1B C;  5GSU B;  1BFM A;  3MGS A;  1P3I D;  3KFU G;  2HUE C;  3REJ C;  3H0R C;  5GT0 A;  1H3O A;  1T3U A;  3AZK B;  5CPK A;  3B6F A;  1M1A B;  3C1B B;  4J8V D;  3LEL C;  3B6G C;  5B31 C;  5E5A D;  1KU5 A;  5B1M A;  2JCH A;  1M18 A;  1N1J B;  1P3K C;  1WWI A;  5E5A C;  2G5H C;  3WAA A;  5AVC D;  2CWE A;  3KUY B;  1P3F B;  1P3L A;  1P3P A;  4NE3 A;  3C1B A;  3KWQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...