4XUJC

Nucleosome core particle containing adducts from treatment with a thiomorpholine-substituted [(eta-6-p-cymene)ru(3-hydroxy-2-pyridone)cl] compound
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
106
structure length
106
Chain Sequence
AKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.2
publication title Contrasting Cytotoxicity and Reactivity of RuII-Arene Complexes of Morpholine vs Thiomorpholine Substituted 3-Hydroxy-2-pyridone Ligands
rcsb
source organism Xenopus laevis
molecule tags Dna-binding protein/dna
total genus 30
structure length 106
sequence length 106
chains with identical sequence G
ec nomenclature
pdb deposition date 2015-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4xujC00
3X1TC 1M19C 5B1LB 5GT0D 4NE6A 2YFVA 1ID3A 5CP6C 5B2JA 1F66C 2BYKA 1ID3B 2YFVB 5B2JB 2F8NH 2BYKB 3B6GA 3X1UC 4R8PA 5BNXA 3O62A 5B24A 5AVCC 3B6GB 5B32D 4R8PB 5BNXB 3O62B 3VH6A 5B24B 1P3FD 3AZGA 4LD9C 4Z2MG 2PYOC 3AZGB 5BO0A 1M19B 3W97C 4G92C 3AZKC 5BO0B 3W98C 3UTBA 2FJ7D 3WAAA 1M1AA 5AV5D 1ULYA 3UTBB 3WAAB 1M1AB 4H9PA 3AZLA 3A6NC 1P3OA 4YM6D 4H9PB 3AZLB 2IO5C 3AFAD 1P3OB 3MGPC 3MGSA 3REKA 3TU4D 3WTPA 5B0YD 3AV1A 3MGSB 3REJC 4G92B 1AOID 3WTPB 3X1SA 3C1BD 3AV1B 4XZQD 1A7WA 5C3IC 1KU5A 3X1SB 1M18C 1KX3D 1P3MD 1TZYD 5B31G 3LZ0D 5BS7C 5CPKD 4H9RA 4E45A 4Z5TD 2AROD 2RVQC 4H9RB 1P3PA 4KUDD 3UTAA 1U35A 5GSUC 3AZNC 1P3PB 3VH5T 4E44A 2CV5C 3UTAB 2NZDC 1U35B 4XUJD 1P3LC 5KDMA 5CPID 3AZED 3LZ1D 5B2IA 5KDMB 1WWSA 2YFWA 2HUEB 3MNNC 5B2IB 1S32C 2YFWB 3REIC 3AZJC 5JRGD 5B32A 3W99D 1P3FA 5B32B 5AV9C 1P3FB 4J8VA 3B0DC 5GT3C 5B1LD 1P3BC 4J8VB 5AVBC 1ID3D 2FJ7A 5B2JD 5AV5A 3MNNB 2FJ7B 1JFIA 5AV5B 3REIB 3O62D 1ZLAD 5B24D 4YM6A 1JFIB 3WA9C 3MVDD 3AFAA 1P34C 4G91C 4H9SC 4YM6B 3MGQC 3X1TD 3TU4A 3AZGD 3AZFC 3AFAB 1M19D 5B0YA 3VH6W 3REHA 4NE3A 5F99C 1AOIA 5B33C 3REHB 4XZQA 3UT9C 5B31C 1N1JA 4XZQB 4KHAA 1M1AD 4J8WC 3AV2A 4KHAB 1TZYA 5CPKA 3AZLD 3AV2B 1P3OD 3RELC 5CPKB 5B0ZC 4Z5TA 3MGQB 4J8UB 4KUDA 1F1EA 1HQ3C 4Z5TB 2F8NG 5BNVA 3AZKD 3WTPD 3AV1D 4KUDB 4Z66C 4WU8C 5BNVB 4XUJA 3AZEA 5CPJC 1P3GC 4XUJB 3AZEB 1BH8A 4YS3C 3B6FC 3NQUA 4DRAA 1BH8B 5JRGA 3MGPD 3NQUB 5B0ZB 3W99A 5JRGB 5AV6C 5B1MC 3W99B 1P3PD 3VH5A 4NE5A 3KXBC 4QLCC 3AZIC 3AYWB 5B2ID 1Q9CA 1BFMA 1ZLAA 2RVQD 3AZHC 3MVDA 1ZLAB 5GSUD 4H9QA 4ZUXA 3X1TA 3B0BA 3MVDB 4ZBJC 2CV5D 1M19A 1KX5C 4J8VD 4ZUXB 4H9QB 3X1TB 5CP6A 4HGAC 1F66A 3MNND 5CP6B 1F66B 3X1UA 1S32D 3REID 5AVCA 3X1UB 5AV8C 3KSYA 2JSSA 5AVCB 4LD9A 1B67A 2PYOA 5GT3D 4ZBJB 4LD9B 3W97A 2PYOB 4J8XC 3AZKA 3W98A 3REHD 3KWQC 3W97B 3X1VC 3AZKB 3W98B 5E5AC 2NQBC 3A6NA 2HIOC 5DNNC 1R4VA 3B0CT 3AV2D 3WA9D 3A6NB 5AY8C 3MGPA 3MGQD 4J8UD 2IO5B 2LY8A 3AZFD 3MGPB 3REJA 5B33D 3KUYC 3REJB 3UT9D 1P3KC 5C3IB 1M18A 4DRBA 1M18B 2HIOB 5BS7A 5DNNB 1P3IC 5GT0C 4AWLC 4UUZA 5B0ZD 4UUZB 5GSUA 5GXQC 3AZNA 2NZDA 2CV5A 4JJNC 4WU8D 5GSUB 3LJAC 3AZMC 3AZNB 1P3LA 2CV5B 2NZDB 3WKJC 5CPJD 1P3LB 3VH5W 4WU9C 3AYWD 3MNNA 1TAFA 3W96C 4YS3D 2L5AA 1S32A 3AZJA 3REIA 1TAFB 1S32B 3AZJB 3V9RA 4EO5C 5AV6D 5AV9A 3V9RB 5GT3A 3WTPE 1P3BA 1P3AC 4ZUXD 5AV9B 3KXBD 3B0DB 5GT3B 3LJAB 1P3BB 5AVBA 4QLCD 3AZID 5DNMC 5B40C 5AVBB 5CP6D 1F66D 4KGCC 3X1UD 3C1BC 3WA9A 5AVCD 1P34A 4H9SA 3MGQA 1EQZC 3WA9B 4J8UA 3AZFA 1P34B 4LD9D 4G91B 1P3AB 1KX3C 2PYOD 1P3MC 5CHLB 5F99A 1TZYC 3LZ0C 5B33A 3AZFB 1KX4C 3W97D 3AN2C 5F99B 3W98D 5DNMB 5B33B 3UT9A 5B31A 4WZSB 2AROC 1BH9A 4J8WA 3UT9B 5B31B 4X23C 1BH9B 4J8WB 3A6ND 3C1CC 3RELA 5CPIC 5B0ZA 3LZ1C 5FUGA 3RELB 1HQ3A 4M6BA 3MGRC 5FUGB 1HQ3B 4Z66A 4WU8A 3LELC 3REJD 3X1VD 3AN2B 4Z66B 4WU8B 5CPJA 1P3GA 3NQJA 3AYWA 5CPJB 1P3GB 1M18D 4X23B 2HIOD 5DNND 4YS3A 3NQJB 3B6FA 5B1LC 3R45B 4YS3B 3B6FB 5BT1C 1ID3C 5AV6A 5B1MA 5B2JC 3MGRB 1WWIA 3KUYD 5AV6B 5B1MB 3LELB 3AZND 3KXBA 2NZDD 4CAYA 3B6GC 4R8PC 3O62C 1P3KD 4QLCA 5B24C 3AZIA 1P3LD 4WV4B 3KXBB 4CAYB 4QLCB 3AZIB 3AZGC 1P3ID 5B32G 2F8NK 3AZJD 3AZHA 5GXQD 3AZHB 3UTBC 1KX5A 3WAAC 1M1AC 5AV9D 4JJND 3LJAD 3AZMD 1P3BD 1KX5B 3WKJD 3AZLC 4WU9D 5AVBD 1P3OC 4H9NA 3W96D 4HGAB 2CWEA 3MGSC 4H9NB 3REKC 3WTPC 3AV1C 5AV8A 2F8NA 3X1SC 1H3OA 5AV8B 2F8NB 1P34D 1P3AD 1H3OB 4J8XA 3KWQA 3X1VA 5F99D 5B40D 5DNMD 4J8XB 3KWQB 3X1VB 5E5AA 2NQBA 4KGCD 5B31D 5E5AB 3REKB 2NQBB 2HIOA 5DNNA 4J8WD 1P3PC 3UTAC 1U35C 4H9OA 5AY8A 1EQZD 4H9OB 3RELD 5AY8B 3B0CW 2HUEC 4Z2MH 5B2IC 1KX4D 1HQ3D 3KUYA 3AN2D 4Z66D 3KUYB 1P3KA 5B32C 1P3GD 1P3KB 1P3FC 4X23D 5G49A 1P3IA 3C1CD 4J8VC 3B6FD 5GT0A 5G49B 1P3IB 5GT0B 4AWLB 3MGRD 5GXQA 2FJ7C 5B1MD 3LELD 4JJNA 5AV5C 5GXQB 3LJAA 3AZMA 3WKJA 4JJNB 3AZMB 4WU9A 3WKJB 4YM6C 3VH6T 3W96A 3AFAC 4WU9B 3W96B 3TU4C 5BT1D 5B0YC 3REHC 1AOIC 1HTAA 4WNNA 4XZQC 3AZHD 4EO5B 1P3AA 4WNNB 1KX5D 3B6GD 4R8PD 3AV2C 5B40A 5DNMA 5CPKC 5B40B 4J8UC 4KGCA 2BYMA 4Z5TC 3TU4B 4KGCB 4KUDC 2BYMB 5B0YB 3C1BA 1AOIB 5AV8D 3C1BB 1EQZA 2F8ND 3UTBD 4XUJC 3WAAD 3AZEC 1KX3A 1EQZB 1P3MA 1N1JB 1KX4A 3LZ0A 1KX3B 1B6WA 1P3MB 4J8XD 3AN2A 1KX4B 1TZYB 3LZ0B 3KWQD 4NFTA 5JRGC 2AROA 5JA4A 3MGSD 5E5AD 3REKD 3W99C 4X23A 2NQBD 2AROB 5JA4B 3R45A 3C1CA 4CSRA 3X1SD 5CPIA 3C1CB 3LZ1A 5AY8D 4CSRB 5CPIB 3AYWC 3MGRA 3LZ1B 3LELA 1ZLAC 3MVDC 3UTAD 5B1LA 1U35D 4ZUXC
chains in the Genus database with same CATH superfamily
3X1TC 1M19C 5B1LB 2DF4C 3EPLA 5GT0D 2Y2LA 4NE6A 2YFVA 1ID3A 5CP6C 5B2JA 1F66C 2BYKA 1ID3B 2YFVB 5B2JB 2F8NH 2BYKB 3B6GA 3FDDA 3X1UC 4R8PA 5BNXA 3O62A 5B24A 5AVCC 3B6GB 5B32D 4R8PB 5BNXB 3O62B 3VH6A 5B24B 1P3FD 3AZGA 4LD9C 4Z2MG 2PYOC 3AZGB 5BO0A 1M19B 3W97C 4G92C 3AZKC 5BO0B 3W98C 3UTBA 2FJ7D 3WAAA 1M1AA 5AV5D 1ULYA 3UTBB 3WAAB 1M1AB 4H9PA 2ZY2A 3AZLA 3A6NC 2Y2HA 1P3OA 4YM6D 4H9PB 3AZLB 2IO5C 3AFAD 1P3OB 3MGPC 2ZY3A 3MGSA 3REKA 3TU4D 3AL0C 3WTPA 5B0YD 3AV1A 3MGSB 3REJC 4G92B 1AOID 3WTPB 3X1SA 3C1BD 3AV1B 4XZQD 1A7WA 2ZM5A 5C3IC 1KU5A 3X1SB 1M18C 3H0LC 1KX3D 2UWXA 1P3MD 1TZYD 5B31G 3LZ0D 1PZRA 5BS7C 5CPKD 4H9RA 4E45A 4Z5TD 2AROD 2RVQC 4H9RB 3H0RC 1P3PA 4KUDD 3UTAA 1U35A 5GSUC 3AZNC 1P3PB 3VH5T 4E44A 2CV5C 3H0MC 3UTAB 2NZDC 1U35B 4XUJD 1P3LC 5KDMA 5CPID 3AZED 3LZ1D 5B2IA 5KDMB 1WWSA 2YFWA 2HUEB 3MNNC 5B2IB 1S32C 2YFWB 3REIC 3F6TA 3AZJC 5JRGD 5B32A 3W99D 1P3FA 5B32B 5AV9C 1P3FB 4J8VA 3B0DC 5GT3C 5B1LD 1P3BC 2Y2IA 4J8VB 2XD1A 5AVBC 1ID3D 2FJ7A 5B2JD 5AV5A 3MNNB 2FJ7B 1JFIA 5AV5B 3REIB 3O62D 1ZLAD 5B24D 4YM6A 1JFIB 3WA9C 2G5IC 3MVDD 3AFAA 1P34C 4G91C 4H9SC 4YM6B 3MGQC 3X1TD 3TU4A 3AZGD 3AZFC 3AFAB 1M19D 5B0YA 3VH6W 3REHA 4NE3A 5F99C 1AOIA 5B33C 3REHB 4XZQA 3UT9C 5B31C 1N1JA 4XZQB 4KHAA 1M1AD 4J8WC 3AV2A 4KHAB 1TZYA 5CPKA 3AZLD 3AV2B 1P3OD 3RELC 5CPKB 5B0ZC 4Z5TA 3MGQB 4J8UB 2Y2KA 4KUDA 1F1EA 1HQ3C 4Z5TB 2F8NG 5BNVA 3AZKD 3WTPD 3AV1D 4KUDB 4Z66C 4WU8C 5BNVB 4XUJA 3AZEA 5CPJC 1P3GC 4XUJB 3AZEB 1BH8A 4YS3C 3B6FC 3NQUA 4DRAA 1BH8B 5JRGA 3MGPD 3NQUB 5B0ZB 3W99A 5JRGB 5AV6C 5B1MC 3W99B 1P3PD 3VH5A 4NE5A 3KXBC 4QLCC 3AZIC 3AYWB 5B2ID 1Q9CA 1BFMA 2ZY4A 1ZLAA 2RVQD 3AZHC 3MVDA 1ZLAB 2Y2GA 5GSUD 4H9QA 4ZUXA 3X1TA 3B0BA 3MVDB 4ZBJC 2CV5D 1M19A 1KX5C 4J8VD 4ZUXB 4H9QB 3X1TB 5CP6A 4HGAC 1F66A 3MNND 5CP6B 1F66B 3X1UA 1S32D 3REID 5AVCA 3X1UB 4WJ3C 5AV8C 3KSYA 2JSSA 5AVCB 4LD9A 1B67A 3A1KA 2PYOA 5GT3D 4ZBJB 4LD9B 3W97A 2PYOB 4J8XC 3AZKA 3W98A 3REHD 3KWQC 3W97B 3X1VC 3AZKB 3W98B 5E5AC 2NQBC 3A6NA 2HIOC 5DNNC 1R4VA 3B0CT 3AV2D 3WA9D 3A6NB 5AY8C 3MGPA 3MGQD 4J8UD 2IO5B 2LY8A 3AZFD 3MGPB 3REJA 3EPHA 5B33D 3KUYC 3REJB 3IP4C 2RIQA 3UT9D 2Y2OA 2Y2NA 1P3KC 5C3IB 1M18A 4DRBA 1M18B 2HIOB 5BS7A 5DNNB 1P3IC 5GT0C 4AWLC 4UUZA 5B0ZD 4UUZB 2VQRA 5GSUA 2FFFB 5GXQC 3AZNA 2NZDA 2CV5A 2JE5A 4JJNC 4WU8D 5GSUB 3LJAC 3AZMC 3AZNB 1P3LA 2CV5B 2NZDB 3WKJC 5CPJD 1P3LB 2BG1A 3VH5W 4WU9C 3AYWD 3MNNA 1TAFA 3W96C 4YS3D 2L5AA 2Y2MA 3AZJA 3REIA 1TAFB 1S32A 1S32B 3AZJB 3V9RA 4EO5C 5AV6D 5AV9A 3V9RB 5GT3A 3WTPE 1P3BA 1P3AC 4ZUXD 5AV9B 3KXBD 3B0DB 5GT3B 3LJAB 1P3BB 5AVBA 4QLCD 3AZID 5DNMC 5B40C 5AVBB 5CP6D 1F66D 4KGCC 1W2EA 3X1UD 3C1BC 3WA9A 5AVCD 1P34A 4H9SA 3MGQA 1EQZC 3WA9B 2W8SA 4J8UA 3AZFA 1P34B 4LD9D 4G91B 1P3AB 1KX3C 2PYOD 1P3MC 5CHLB 5F99A 1TZYC 3LZ0C 5B33A 3AZFB 1KX4C 3W97D 3AN2C 5F99B 3W98D 5DNMB 5B33B 3UT9A 5B31A 4WZSB 2AROC 1BH9A 4J8WA 3UT9B 5B31B 3EG5B 4X23C 1BH9B 4J8WB 3A6ND 3C1CC 3RELA 5CPIC 5B0ZA 3LZ1C 5FUGA 2DQNC 3RELB 1HQ3A 4M6BA 3MGRC 5FUGB 1HQ3B 4Z66A 4WU8A 3LELC 3REJD 3X1VD 3AN2B 4Z66B 4WU8B 5CPJA 1P3GA 3NQJA 3AYWA 5CPJB 1P3GB 1M18D 4X23B 2HIOD 5DNND 4UPKA 2XD5A 3NQJB 4YS3A 5B1LC 3B6FA 3R45B 3P5JB 4YS3B 3B6FB 5BT1C 1ID3C 5AV6A 5B1MA 5B2JC 3MGRB 1WWIA 3KUYD 5AV6B 5B1MB 3LELB 3AZND 3KXBA 2NZDD 4CAYA 3B6GC 4R8PC 3O62C 1P3KD 4QLCA 5B24C 3AZIA 1P3LD 4WV4B 3KXBB 4CAYB 3A1IA 4QLCB 3AZIB 3AZGC 1P3ID 5B32G 2F8NK 3AZJD 3AZHA 5GXQD 3AZHB 3UTBC 1KX5A 3WAAC 1M1AC 5AV9D 4JJND 3LJAD 3AZMD 1P3BD 1KX5B 3WKJD 3AZLC 2J8PA 4WU9D 5AVBD 1P3OC 4H9NA 3W96D 4HGAB 2CWEA 3MGSC 4H9NB 3REKC 3WTPC 3AV1C 3KFUG 5AV8A 2F8NA 3X1SC 1H3OA 5AV8B 2F8NB 1P34D 1P3AD 1H3OB 4J8XA 3KWQA 3X1VA 5F99D 5B40D 5DNMD 4J8XB 3KWQB 3X1VB 5E5AA 2NQBA 4KGCD 5B31D 5E5AB 3REKB 2NQBB 2HIOA 5DNNA 4J8WD 1P3PC 2Y2QA 3UTAC 1U35C 4H9OA 5AY8A 1EQZD 4H9OB 3RELD 5AY8B 3B0CW 2HUEC 4Z2MH 5B2IC 1KX4D 1HQ3D 3KUYA 3AN2D 4DQYB 4Z66D 2F2AC 3KUYB 1P3KA 5B32C 1P3GD 1P3KB 1P3FC 4X23D 5G49A 1P3IA 3C1CD 4J8VC 3B6FD 5GT0A 5G49B 1P3IB 5GT0B 4AWLB 1T3UA 3MGRD 5GXQA 2FJ7C 5B1MD 3LELD 4JJNA 5AV5C 5GXQB 3LJAA 3AZMA 3WKJA 4JJNB 3AZMB 4WU9A 3WKJB 4YM6C 2ZY5A 3VH6T 3W96A 3AFAC 4WU9B 2JCHA 3W96B 3TU4C 5BT1D 5B0YC 3REHC 1AOIC 1HTAA 4WNNA 4XZQC 3AZHD 4EO5B 1P3AA 2Y2JA 4WNNB 1KX5D 3B6GD 4R8PD 3AV2C 5B40A 5DNMA 5CPKC 5B40B 4J8UC 4KGCA 2BYMA 4Z5TC 3EPJA 3TU4B 4KGCB 4KUDC 2BYMB 5B0YB 3C1BA 1AOIB 5AV8D 3C1BB 1EQZA 2F8ND 3UTBD 4XUJC 3WAAD 2Y2PA 3AZEC 1KX3A 1EQZB 1P3MA 1N1JB 1KX4A 3LZ0A 1KX3B 1B6WA 1P3MB 4J8XD 3AN2A 2G5HC 1TZYB 3LZ0B 1KX4B 3KWQD 4NFTA 5JRGC 2AROA 5JA4A 3MGSD 5E5AD 3REKD 3W99C 4X23A 2NQBD 3EPKA 2AROB 5JA4B 3R45A 3C1CA 4CSRA 3X1SD 5CPIA 3C1CB 3LZ1A 5AY8D 4CSRB 5CPIB 1Z2CB 3AYWC 3MGRA 3LZ1B 3LELA 1ZLAC 3MVDC 3UTAD 5B1LA 1U35D 4ZUXC
chains in the Genus database with same CATH topology
3X1TC 1M19C 5B1LB 2DF4C 3EPLA 5GT0D 2Y2LA 4NE6A 2YFVA 1ID3A 5CP6C 5B2JA 1F66C 2BYKA 1ID3B 2YFVB 5B2JB 2F8NH 2BYKB 3B6GA 3FDDA 3X1UC 4R8PA 5BNXA 3O62A 5B24A 5AVCC 3B6GB 5B32D 4R8PB 5BNXB 3O62B 3VH6A 5B24B 1P3FD 3AZGA 4LD9C 4Z2MG 2PYOC 3AZGB 5BO0A 1M19B 3W97C 4G92C 3AZKC 5BO0B 3W98C 3UTBA 2FJ7D 3WAAA 1M1AA 5AV5D 1ULYA 3UTBB 3WAAB 1M1AB 4H9PA 2ZY2A 3AZLA 3A6NC 2Y2HA 1P3OA 4YM6D 4H9PB 3AZLB 2IO5C 3AFAD 1P3OB 3MGPC 2ZY3A 3MGSA 3REKA 3TU4D 3AL0C 3WTPA 5B0YD 3AV1A 3MGSB 3REJC 4G92B 1AOID 3WTPB 3X1SA 3C1BD 3AV1B 4XZQD 1A7WA 2ZM5A 5C3IC 1KU5A 3X1SB 1M18C 3H0LC 1KX3D 2UWXA 1P3MD 1TZYD 5B31G 3LZ0D 1PZRA 5BS7C 5CPKD 4H9RA 4E45A 4Z5TD 2AROD 2RVQC 4H9RB 3H0RC 1P3PA 4KUDD 3UTAA 1U35A 5GSUC 3AZNC 1P3PB 3VH5T 4E44A 2CV5C 3H0MC 3UTAB 2NZDC 1U35B 4XUJD 1P3LC 5KDMA 5CPID 3AZED 3LZ1D 5B2IA 5KDMB 1WWSA 2YFWA 2HUEB 3MNNC 5B2IB 1S32C 2YFWB 3REIC 3F6TA 3AZJC 5JRGD 5B32A 3W99D 1P3FA 5B32B 5AV9C 1P3FB 4J8VA 3B0DC 5GT3C 5B1LD 1P3BC 2Y2IA 4J8VB 2XD1A 5AVBC 1ID3D 2FJ7A 5B2JD 5AV5A 3MNNB 2FJ7B 1JFIA 5AV5B 3REIB 3O62D 1ZLAD 5B24D 4YM6A 1JFIB 3WA9C 2G5IC 3MVDD 3AFAA 1P34C 4G91C 4H9SC 4YM6B 3MGQC 3X1TD 3TU4A 3AZGD 3AZFC 3AFAB 1M19D 5B0YA 3VH6W 3REHA 4NE3A 5F99C 1AOIA 5B33C 3REHB 4XZQA 3UT9C 5B31C 1N1JA 4XZQB 4KHAA 1M1AD 4J8WC 3AV2A 4KHAB 1TZYA 5CPKA 3AZLD 3AV2B 1P3OD 3RELC 5CPKB 5B0ZC 4Z5TA 3MGQB 4J8UB 2Y2KA 4KUDA 1F1EA 1HQ3C 4Z5TB 2F8NG 5BNVA 3AZKD 3WTPD 3AV1D 4KUDB 4Z66C 4WU8C 5BNVB 4XUJA 3AZEA 5CPJC 1P3GC 4XUJB 3AZEB 1BH8A 4YS3C 3B6FC 3NQUA 4DRAA 1BH8B 5JRGA 3MGPD 3NQUB 5B0ZB 3W99A 5JRGB 5AV6C 5B1MC 3W99B 1P3PD 3VH5A 4NE5A 3KXBC 4QLCC 3AZIC 3AYWB 5B2ID 1Q9CA 1BFMA 2ZY4A 1ZLAA 2RVQD 3AZHC 3MVDA 1ZLAB 2Y2GA 5GSUD 4H9QA 4ZUXA 3X1TA 3B0BA 3MVDB 4ZBJC 2CV5D 1M19A 1KX5C 4J8VD 4ZUXB 4H9QB 3X1TB 5CP6A 4HGAC 1F66A 3MNND 5CP6B 1F66B 3X1UA 1S32D 3REID 5AVCA 3X1UB 4WJ3C 5AV8C 3KSYA 2JSSA 5AVCB 4LD9A 1B67A 3A1KA 2PYOA 5GT3D 4ZBJB 4LD9B 3W97A 2PYOB 4J8XC 3AZKA 3W98A 3REHD 3KWQC 3W97B 3X1VC 3AZKB 3W98B 5E5AC 2NQBC 3A6NA 2HIOC 5DNNC 1R4VA 3B0CT 3AV2D 3WA9D 3A6NB 5AY8C 3MGPA 3MGQD 4J8UD 2IO5B 2LY8A 3AZFD 3MGPB 3REJA 3EPHA 5B33D 3KUYC 3REJB 3IP4C 2RIQA 3UT9D 2Y2OA 2Y2NA 1P3KC 5C3IB 1M18A 4DRBA 1M18B 2HIOB 5BS7A 5DNNB 1P3IC 5GT0C 4AWLC 4UUZA 5B0ZD 4UUZB 2VQRA 5GSUA 2FFFB 5GXQC 3AZNA 2NZDA 2CV5A 2JE5A 4JJNC 4WU8D 5GSUB 3LJAC 3AZMC 3AZNB 1P3LA 2CV5B 2NZDB 3WKJC 5CPJD 1P3LB 2BG1A 3VH5W 4WU9C 3AYWD 3MNNA 1TAFA 3W96C 4YS3D 2L5AA 2Y2MA 3AZJA 3REIA 1TAFB 1S32A 1S32B 3AZJB 3V9RA 4EO5C 5AV6D 5AV9A 3V9RB 5GT3A 3WTPE 1P3BA 1P3AC 4ZUXD 5AV9B 3KXBD 3B0DB 5GT3B 3LJAB 1P3BB 5AVBA 4QLCD 3AZID 5DNMC 5B40C 5AVBB 5CP6D 1F66D 4KGCC 1W2EA 3X1UD 3C1BC 3WA9A 5AVCD 1P34A 4H9SA 3MGQA 1EQZC 3WA9B 2W8SA 4J8UA 3AZFA 1P34B 4LD9D 4G91B 1P3AB 1KX3C 2PYOD 1P3MC 5CHLB 5F99A 1TZYC 3LZ0C 5B33A 3AZFB 1KX4C 3W97D 3AN2C 5F99B 3W98D 5DNMB 5B33B 3UT9A 5B31A 4WZSB 2AROC 1BH9A 4J8WA 3UT9B 5B31B 3EG5B 4X23C 1BH9B 4J8WB 3A6ND 3C1CC 3RELA 5CPIC 5B0ZA 3LZ1C 5FUGA 2DQNC 3RELB 1HQ3A 4M6BA 3MGRC 5FUGB 1HQ3B 4Z66A 4WU8A 3LELC 3REJD 3X1VD 3AN2B 4Z66B 4WU8B 5CPJA 1P3GA 3NQJA 3AYWA 5CPJB 1P3GB 1M18D 4X23B 2HIOD 5DNND 4UPKA 2XD5A 3NQJB 4YS3A 5B1LC 3B6FA 3R45B 3P5JB 4YS3B 3B6FB 5BT1C 1ID3C 5AV6A 5B1MA 5B2JC 3MGRB 1WWIA 3KUYD 5AV6B 5B1MB 3LELB 3AZND 3KXBA 2NZDD 4CAYA 3B6GC 4R8PC 3O62C 1P3KD 4QLCA 5B24C 3AZIA 1P3LD 4WV4B 3KXBB 4CAYB 3A1IA 4QLCB 3AZIB 3AZGC 1P3ID 5B32G 2F8NK 3AZJD 3AZHA 5GXQD 3AZHB 3UTBC 1KX5A 3WAAC 1M1AC 5AV9D 4JJND 3LJAD 3AZMD 1P3BD 1KX5B 3WKJD 3AZLC 2J8PA 4WU9D 5AVBD 1P3OC 4H9NA 3W96D 4HGAB 2CWEA 3MGSC 4H9NB 3REKC 3WTPC 3AV1C 3KFUG 5AV8A 2F8NA 3X1SC 1H3OA 5AV8B 2F8NB 1P34D 1P3AD 1H3OB 4J8XA 3KWQA 3X1VA 5F99D 5B40D 5DNMD 4J8XB 3KWQB 3X1VB 5E5AA 2NQBA 4KGCD 5B31D 5E5AB 3REKB 2NQBB 2HIOA 5DNNA 4J8WD 1P3PC 2Y2QA 3UTAC 1U35C 4H9OA 5AY8A 1EQZD 4H9OB 3RELD 5AY8B 3B0CW 2HUEC 4Z2MH 5B2IC 1KX4D 1HQ3D 3KUYA 3AN2D 4DQYB 4Z66D 2F2AC 3KUYB 1P3KA 5B32C 1P3GD 1P3KB 1P3FC 4X23D 5G49A 1P3IA 3C1CD 4J8VC 3B6FD 5GT0A 5G49B 1P3IB 5GT0B 4AWLB 1T3UA 3MGRD 5GXQA 2FJ7C 5B1MD 3LELD 4JJNA 5AV5C 5GXQB 3LJAA 3AZMA 3WKJA 4JJNB 3AZMB 4WU9A 3WKJB 4YM6C 2ZY5A 3VH6T 3W96A 3AFAC 4WU9B 2JCHA 3W96B 3TU4C 5BT1D 5B0YC 3REHC 1AOIC 1HTAA 4WNNA 4XZQC 3AZHD 4EO5B 1P3AA 2Y2JA 4WNNB 1KX5D 3B6GD 4R8PD 3AV2C 5B40A 5DNMA 5CPKC 5B40B 4J8UC 4KGCA 2BYMA 4Z5TC 3EPJA 3TU4B 4KGCB 4KUDC 2BYMB 5B0YB 3C1BA 1AOIB 5AV8D 3C1BB 1EQZA 2F8ND 3UTBD 4XUJC 3WAAD 2Y2PA 3AZEC 1KX3A 1EQZB 1P3MA 1N1JB 1KX4A 3LZ0A 1KX3B 1B6WA 1P3MB 4J8XD 3AN2A 2G5HC 1TZYB 3LZ0B 1KX4B 3KWQD 4NFTA 5JRGC 2AROA 5JA4A 3MGSD 5E5AD 3REKD 3W99C 4X23A 2NQBD 3EPKA 2AROB 5JA4B 3R45A 3C1CA 4CSRA 3X1SD 5CPIA 3C1CB 3LZ1A 5AY8D 4CSRB 5CPIB 1Z2CB 3AYWC 3MGRA 3LZ1B 3LELA 1ZLAC 3MVDC 3UTAD 5B1LA 1U35D 4ZUXC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3X1T C;  1M19 C;  5B1L B;  5GT0 D;  4NE6 A;  2YFV A;  1ID3 A;  5CP6 C;  5B2J A;  1F66 C;  2BYK A;  1ID3 B;  2YFV B;  5B2J B;  2F8N H;  2BYK B;  3B6G A;  3X1U C;  4R8P A;  5BNX A;  3O62 A;  5B24 A;  5AVC C;  3B6G B;  5B32 D;  4R8P B;  5BNX B;  3O62 B;  3VH6 A;  5B24 B;  1P3F D;  3AZG A;  4LD9 C;  4Z2M G;  2PYO C;  3AZG B;  5BO0 A;  1M19 B;  3W97 C;  4G92 C;  3AZK C;  5BO0 B;  3W98 C;  3UTB A;  2FJ7 D;  3WAA A;  1M1A A;  5AV5 D;  1ULY A;  3UTB B;  3WAA B;  1M1A B;  4H9P A;  3AZL A;  3A6N C;  1P3O A;  4YM6 D;  4H9P B;  3AZL B;  2IO5 C;  3AFA D;  1P3O B;  3MGP C;  3MGS A;  3REK A;  3TU4 D;  3WTP A;  5B0Y D;  3AV1 A;  3MGS B;  3REJ C;  4G92 B;  1AOI D;  3WTP B;  3X1S A;  3C1B D;  3AV1 B;  4XZQ D;  1A7W A;  5C3I C;  1KU5 A;  3X1S B;  1M18 C;  1KX3 D;  1P3M D;  1TZY D;  5B31 G;  3LZ0 D;  5BS7 C;  5CPK D;  4H9R A;  4E45 A;  4Z5T D;  2ARO D;  2RVQ C;  4H9R B;  1P3P A;  4KUD D;  3UTA A;  1U35 A;  5GSU C;  3AZN C;  1P3P B;  3VH5 T;  4E44 A;  2CV5 C;  3UTA B;  2NZD C;  1U35 B;  4XUJ D;  1P3L C;  5KDM A;  5CPI D;  3AZE D;  3LZ1 D;  5B2I A;  5KDM B;  1WWS A;  2YFW A;  2HUE B;  3MNN C;  5B2I B;  1S32 C;  2YFW B;  3REI C;  3AZJ C;  5JRG D;  5B32 A;  3W99 D;  1P3F A;  5B32 B;  5AV9 C;  1P3F B;  4J8V A;  3B0D C;  5GT3 C;  5B1L D;  1P3B C;  4J8V B;  5AVB C;  1ID3 D;  2FJ7 A;  5B2J D;  5AV5 A;  3MNN B;  2FJ7 B;  1JFI A;  5AV5 B;  3REI B;  3O62 D;  1ZLA D;  5B24 D;  4YM6 A;  1JFI B;  3WA9 C;  3MVD D;  3AFA A;  1P34 C;  4G91 C;  4H9S C;  4YM6 B;  3MGQ C;  3X1T D;  3TU4 A;  3AZG D;  3AZF C;  3AFA B;  1M19 D;  5B0Y A;  3VH6 W;  3REH A;  4NE3 A;  5F99 C;  1AOI A;  5B33 C;  3REH B;  4XZQ A;  3UT9 C;  5B31 C;  1N1J A;  4XZQ B;  4KHA A;  1M1A D;  4J8W C;  3AV2 A;  4KHA B;  1TZY A;  5CPK A;  3AZL D;  3AV2 B;  1P3O D;  3REL C;  5CPK B;  5B0Z C;  4Z5T A;  3MGQ B;  4J8U B;  4KUD A;  1F1E A;  1HQ3 C;  4Z5T B;  2F8N G;  5BNV A;  3AZK D;  3WTP D;  3AV1 D;  4KUD B;  4Z66 C;  4WU8 C;  5BNV B;  4XUJ A;  3AZE A;  5CPJ C;  1P3G C;  4XUJ B;  3AZE B;  1BH8 A;  4YS3 C;  3B6F C;  3NQU A;  4DRA A;  1BH8 B;  5JRG A;  3MGP D;  3NQU B;  5B0Z B;  3W99 A;  5JRG B;  5AV6 C;  5B1M C;  3W99 B;  1P3P D;  3VH5 A;  4NE5 A;  3KXB C;  4QLC C;  3AZI C;  3AYW B;  5B2I D;  1Q9C A;  1BFM A;  1ZLA A;  2RVQ D;  3AZH C;  3MVD A;  1ZLA B;  5GSU D;  4H9Q A;  4ZUX A;  3X1T A;  3B0B A;  3MVD B;  4ZBJ C;  2CV5 D;  1M19 A;  1KX5 C;  4J8V D;  4ZUX B;  4H9Q B;  3X1T B;  5CP6 A;  4HGA C;  1F66 A;  3MNN D;  5CP6 B;  1F66 B;  3X1U A;  1S32 D;  3REI D;  5AVC A;  3X1U B;  5AV8 C;  3KSY A;  2JSS A;  5AVC B;  4LD9 A;  1B67 A;  2PYO A;  5GT3 D;  4ZBJ B;  4LD9 B;  3W97 A;  2PYO B;  4J8X C;  3AZK A;  3W98 A;  3REH D;  3KWQ C;  3W97 B;  3X1V C;  3AZK B;  3W98 B;  5E5A C;  2NQB C;  3A6N A;  2HIO C;  5DNN C;  1R4V A;  3B0C T;  3AV2 D;  3WA9 D;  3A6N B;  5AY8 C;  3MGP A;  3MGQ D;  4J8U D;  2IO5 B;  2LY8 A;  3AZF D;  3MGP B;  3REJ A;  5B33 D;  3KUY C;  3REJ B;  3UT9 D;  1P3K C;  5C3I B;  1M18 A;  4DRB A;  1M18 B;  2HIO B;  5BS7 A;  5DNN B;  1P3I C;  5GT0 C;  4AWL C;  4UUZ A;  5B0Z D;  4UUZ B;  5GSU A;  5GXQ C;  3AZN A;  2NZD A;  2CV5 A;  4JJN C;  4WU8 D;  5GSU B;  3LJA C;  3AZM C;  3AZN B;  1P3L A;  2CV5 B;  2NZD B;  3WKJ C;  5CPJ D;  1P3L B;  3VH5 W;  4WU9 C;  3AYW D;  3MNN A;  1TAF A;  3W96 C;  4YS3 D;  2L5A A;  1S32 A;  3AZJ A;  3REI A;  1TAF B;  1S32 B;  3AZJ B;  3V9R A;  4EO5 C;  5AV6 D;  5AV9 A;  3V9R B;  5GT3 A;  3WTP E;  1P3B A;  1P3A C;  4ZUX D;  5AV9 B;  3KXB D;  3B0D B;  5GT3 B;  3LJA B;  1P3B B;  5AVB A;  4QLC D;  3AZI D;  5DNM C;  5B40 C;  5AVB B;  5CP6 D;  1F66 D;  4KGC C;  3X1U D;  3C1B C;  3WA9 A;  5AVC D;  1P34 A;  4H9S A;  3MGQ A;  1EQZ C;  3WA9 B;  4J8U A;  3AZF A;  1P34 B;  4LD9 D;  4G91 B;  1P3A B;  1KX3 C;  2PYO D;  1P3M C;  5CHL B;  5F99 A;  1TZY C;  3LZ0 C;  5B33 A;  3AZF B;  1KX4 C;  3W97 D;  3AN2 C;  5F99 B;  3W98 D;  5DNM B;  5B33 B;  3UT9 A;  5B31 A;  4WZS B;  2ARO C;  1BH9 A;  4J8W A;  3UT9 B;  5B31 B;  4X23 C;  1BH9 B;  4J8W B;  3A6N D;  3C1C C;  3REL A;  5CPI C;  5B0Z A;  3LZ1 C;  5FUG A;  3REL B;  1HQ3 A;  4M6B A;  3MGR C;  5FUG B;  1HQ3 B;  4Z66 A;  4WU8 A;  3LEL C;  3REJ D;  3X1V D;  3AN2 B;  4Z66 B;  4WU8 B;  5CPJ A;  1P3G A;  3NQJ A;  3AYW A;  5CPJ B;  1P3G B;  1M18 D;  4X23 B;  2HIO D;  5DNN D;  4YS3 A;  3NQJ B;  3B6F A;  5B1L C;  3R45 B;  4YS3 B;  3B6F B;  5BT1 C;  1ID3 C;  5AV6 A;  5B1M A;  5B2J C;  3MGR B;  1WWI A;  3KUY D;  5AV6 B;  5B1M B;  3LEL B;  3AZN D;  3KXB A;  2NZD D;  4CAY A;  3B6G C;  4R8P C;  3O62 C;  1P3K D;  4QLC A;  5B24 C;  3AZI A;  1P3L D;  4WV4 B;  3KXB B;  4CAY B;  4QLC B;  3AZI B;  3AZG C;  1P3I D;  5B32 G;  2F8N K;  3AZJ D;  3AZH A;  5GXQ D;  3AZH B;  3UTB C;  1KX5 A;  3WAA C;  1M1A C;  5AV9 D;  4JJN D;  3LJA D;  3AZM D;  1P3B D;  1KX5 B;  3WKJ D;  3AZL C;  4WU9 D;  5AVB D;  1P3O C;  4H9N A;  3W96 D;  4HGA B;  2CWE A;  3MGS C;  4H9N B;  3REK C;  3WTP C;  3AV1 C;  5AV8 A;  2F8N A;  3X1S C;  1H3O A;  5AV8 B;  2F8N B;  1P34 D;  1P3A D;  1H3O B;  4J8X A;  3KWQ A;  3X1V A;  5F99 D;  5B40 D;  5DNM D;  4J8X B;  3KWQ B;  3X1V B;  5E5A A;  2NQB A;  4KGC D;  5B31 D;  5E5A B;  3REK B;  2NQB B;  2HIO A;  5DNN A;  4J8W D;  1P3P C;  3UTA C;  1U35 C;  4H9O A;  5AY8 A;  1EQZ D;  4H9O B;  3REL D;  5AY8 B;  3B0C W;  2HUE C;  4Z2M H;  5B2I C;  1KX4 D;  1HQ3 D;  3KUY A;  3AN2 D;  4Z66 D;  3KUY B;  1P3K A;  5B32 C;  1P3G D;  1P3K B;  1P3F C;  4X23 D;  5G49 A;  1P3I A;  3C1C D;  4J8V C;  3B6F D;  5GT0 A;  5G49 B;  1P3I B;  5GT0 B;  4AWL B;  3MGR D;  5GXQ A;  2FJ7 C;  5B1M D;  3LEL D;  4JJN A;  5AV5 C;  5GXQ B;  3LJA A;  3AZM A;  3WKJ A;  4JJN B;  3AZM B;  4WU9 A;  3WKJ B;  4YM6 C;  3VH6 T;  3W96 A;  3AFA C;  4WU9 B;  3W96 B;  3TU4 C;  5BT1 D;  5B0Y C;  3REH C;  1AOI C;  1HTA A;  4WNN A;  4XZQ C;  3AZH D;  4EO5 B;  1P3A A;  4WNN B;  1KX5 D;  3B6G D;  4R8P D;  3AV2 C;  5B40 A;  5DNM A;  5CPK C;  5B40 B;  4J8U C;  4KGC A;  2BYM A;  4Z5T C;  3TU4 B;  4KGC B;  4KUD C;  2BYM B;  5B0Y B;  3C1B A;  1AOI B;  5AV8 D;  3C1B B;  1EQZ A;  2F8N D;  3UTB D;  4XUJ C;  3WAA D;  3AZE C;  1KX3 A;  1EQZ B;  1P3M A;  1N1J B;  1KX4 A;  3LZ0 A;  1KX3 B;  1B6W A;  1P3M B;  4J8X D;  3AN2 A;  1KX4 B;  1TZY B;  3LZ0 B;  3KWQ D;  4NFT A;  5JRG C;  2ARO A;  5JA4 A;  3MGS D;  5E5A D;  3REK D;  3W99 C;  4X23 A;  2NQB D;  2ARO B;  5JA4 B;  3R45 A;  3C1C A;  4CSR A;  3X1S D;  5CPI A;  3C1C B;  3LZ1 A;  5AY8 D;  4CSR B;  5CPI B;  3AYW C;  3MGR A;  3LZ1 B;  3LEL A;  1ZLA C;  3MVD C;  3UTA D;  5B1L A;  1U35 D;  4ZUX C; 
#chains in the Genus database with same CATH topology
 3X1T C;  1M19 C;  5B1L B;  2DF4 C;  3EPL A;  5GT0 D;  2Y2L A;  4NE6 A;  2YFV A;  1ID3 A;  5CP6 C;  5B2J A;  1F66 C;  2BYK A;  1ID3 B;  2YFV B;  5B2J B;  2F8N H;  2BYK B;  3B6G A;  3FDD A;  3X1U C;  4R8P A;  5BNX A;  3O62 A;  5B24 A;  5AVC C;  3B6G B;  5B32 D;  4R8P B;  5BNX B;  3O62 B;  3VH6 A;  5B24 B;  1P3F D;  3AZG A;  4LD9 C;  4Z2M G;  2PYO C;  3AZG B;  5BO0 A;  1M19 B;  3W97 C;  4G92 C;  3AZK C;  5BO0 B;  3W98 C;  3UTB A;  2FJ7 D;  3WAA A;  1M1A A;  5AV5 D;  1ULY A;  3UTB B;  3WAA B;  1M1A B;  4H9P A;  2ZY2 A;  3AZL A;  3A6N C;  2Y2H A;  1P3O A;  4YM6 D;  4H9P B;  3AZL B;  2IO5 C;  3AFA D;  1P3O B;  3MGP C;  2ZY3 A;  3MGS A;  3REK A;  3TU4 D;  3AL0 C;  3WTP A;  5B0Y D;  3AV1 A;  3MGS B;  3REJ C;  4G92 B;  1AOI D;  3WTP B;  3X1S A;  3C1B D;  3AV1 B;  4XZQ D;  1A7W A;  2ZM5 A;  5C3I C;  1KU5 A;  3X1S B;  1M18 C;  3H0L C;  1KX3 D;  2UWX A;  1P3M D;  1TZY D;  5B31 G;  3LZ0 D;  1PZR A;  5BS7 C;  5CPK D;  4H9R A;  4E45 A;  4Z5T D;  2ARO D;  2RVQ C;  4H9R B;  3H0R C;  1P3P A;  4KUD D;  3UTA A;  1U35 A;  5GSU C;  3AZN C;  1P3P B;  3VH5 T;  4E44 A;  2CV5 C;  3H0M C;  3UTA B;  2NZD C;  1U35 B;  4XUJ D;  1P3L C;  5KDM A;  5CPI D;  3AZE D;  3LZ1 D;  5B2I A;  5KDM B;  1WWS A;  2YFW A;  2HUE B;  3MNN C;  5B2I B;  1S32 C;  2YFW B;  3REI C;  3F6T A;  3AZJ C;  5JRG D;  5B32 A;  3W99 D;  1P3F A;  5B32 B;  5AV9 C;  1P3F B;  4J8V A;  3B0D C;  5GT3 C;  5B1L D;  1P3B C;  2Y2I A;  4J8V B;  2XD1 A;  5AVB C;  1ID3 D;  2FJ7 A;  5B2J D;  5AV5 A;  3MNN B;  2FJ7 B;  1JFI A;  5AV5 B;  3REI B;  3O62 D;  1ZLA D;  5B24 D;  4YM6 A;  1JFI B;  3WA9 C;  2G5I C;  3MVD D;  3AFA A;  1P34 C;  4G91 C;  4H9S C;  4YM6 B;  3MGQ C;  3X1T D;  3TU4 A;  3AZG D;  3AZF C;  3AFA B;  1M19 D;  5B0Y A;  3VH6 W;  3REH A;  4NE3 A;  5F99 C;  1AOI A;  5B33 C;  3REH B;  4XZQ A;  3UT9 C;  5B31 C;  1N1J A;  4XZQ B;  4KHA A;  1M1A D;  4J8W C;  3AV2 A;  4KHA B;  1TZY A;  5CPK A;  3AZL D;  3AV2 B;  1P3O D;  3REL C;  5CPK B;  5B0Z C;  4Z5T A;  3MGQ B;  4J8U B;  2Y2K A;  4KUD A;  1F1E A;  1HQ3 C;  4Z5T B;  2F8N G;  5BNV A;  3AZK D;  3WTP D;  3AV1 D;  4KUD B;  4Z66 C;  4WU8 C;  5BNV B;  4XUJ A;  3AZE A;  5CPJ C;  1P3G C;  4XUJ B;  3AZE B;  1BH8 A;  4YS3 C;  3B6F C;  3NQU A;  4DRA A;  1BH8 B;  5JRG A;  3MGP D;  3NQU B;  5B0Z B;  3W99 A;  5JRG B;  5AV6 C;  5B1M C;  3W99 B;  1P3P D;  3VH5 A;  4NE5 A;  3KXB C;  4QLC C;  3AZI C;  3AYW B;  5B2I D;  1Q9C A;  1BFM A;  2ZY4 A;  1ZLA A;  2RVQ D;  3AZH C;  3MVD A;  1ZLA B;  2Y2G A;  5GSU D;  4H9Q A;  4ZUX A;  3X1T A;  3B0B A;  3MVD B;  4ZBJ C;  2CV5 D;  1M19 A;  1KX5 C;  4J8V D;  4ZUX B;  4H9Q B;  3X1T B;  5CP6 A;  4HGA C;  1F66 A;  3MNN D;  5CP6 B;  1F66 B;  3X1U A;  1S32 D;  3REI D;  5AVC A;  3X1U B;  4WJ3 C;  5AV8 C;  3KSY A;  2JSS A;  5AVC B;  4LD9 A;  1B67 A;  3A1K A;  2PYO A;  5GT3 D;  4ZBJ B;  4LD9 B;  3W97 A;  2PYO B;  4J8X C;  3AZK A;  3W98 A;  3REH D;  3KWQ C;  3W97 B;  3X1V C;  3AZK B;  3W98 B;  5E5A C;  2NQB C;  3A6N A;  2HIO C;  5DNN C;  1R4V A;  3B0C T;  3AV2 D;  3WA9 D;  3A6N B;  5AY8 C;  3MGP A;  3MGQ D;  4J8U D;  2IO5 B;  2LY8 A;  3AZF D;  3MGP B;  3REJ A;  3EPH A;  5B33 D;  3KUY C;  3REJ B;  3IP4 C;  2RIQ A;  3UT9 D;  2Y2O A;  2Y2N A;  1P3K C;  5C3I B;  1M18 A;  4DRB A;  1M18 B;  2HIO B;  5BS7 A;  5DNN B;  1P3I C;  5GT0 C;  4AWL C;  4UUZ A;  5B0Z D;  4UUZ B;  2VQR A;  5GSU A;  2FFF B;  5GXQ C;  3AZN A;  2NZD A;  2CV5 A;  2JE5 A;  4JJN C;  4WU8 D;  5GSU B;  3LJA C;  3AZM C;  3AZN B;  1P3L A;  2CV5 B;  2NZD B;  3WKJ C;  5CPJ D;  1P3L B;  2BG1 A;  3VH5 W;  4WU9 C;  3AYW D;  3MNN A;  1TAF A;  3W96 C;  4YS3 D;  2L5A A;  2Y2M A;  3AZJ A;  3REI A;  1TAF B;  1S32 A;  1S32 B;  3AZJ B;  3V9R A;  4EO5 C;  5AV6 D;  5AV9 A;  3V9R B;  5GT3 A;  3WTP E;  1P3B A;  1P3A C;  4ZUX D;  5AV9 B;  3KXB D;  3B0D B;  5GT3 B;  3LJA B;  1P3B B;  5AVB A;  4QLC D;  3AZI D;  5DNM C;  5B40 C;  5AVB B;  5CP6 D;  1F66 D;  4KGC C;  1W2E A;  3X1U D;  3C1B C;  3WA9 A;  5AVC D;  1P34 A;  4H9S A;  3MGQ A;  1EQZ C;  3WA9 B;  2W8S A;  4J8U A;  3AZF A;  1P34 B;  4LD9 D;  4G91 B;  1P3A B;  1KX3 C;  2PYO D;  1P3M C;  5CHL B;  5F99 A;  1TZY C;  3LZ0 C;  5B33 A;  3AZF B;  1KX4 C;  3W97 D;  3AN2 C;  5F99 B;  3W98 D;  5DNM B;  5B33 B;  3UT9 A;  5B31 A;  4WZS B;  2ARO C;  1BH9 A;  4J8W A;  3UT9 B;  5B31 B;  3EG5 B;  4X23 C;  1BH9 B;  4J8W B;  3A6N D;  3C1C C;  3REL A;  5CPI C;  5B0Z A;  3LZ1 C;  5FUG A;  2DQN C;  3REL B;  1HQ3 A;  4M6B A;  3MGR C;  5FUG B;  1HQ3 B;  4Z66 A;  4WU8 A;  3LEL C;  3REJ D;  3X1V D;  3AN2 B;  4Z66 B;  4WU8 B;  5CPJ A;  1P3G A;  3NQJ A;  3AYW A;  5CPJ B;  1P3G B;  1M18 D;  4X23 B;  2HIO D;  5DNN D;  4UPK A;  2XD5 A;  3NQJ B;  4YS3 A;  5B1L C;  3B6F A;  3R45 B;  3P5J B;  4YS3 B;  3B6F B;  5BT1 C;  1ID3 C;  5AV6 A;  5B1M A;  5B2J C;  3MGR B;  1WWI A;  3KUY D;  5AV6 B;  5B1M B;  3LEL B;  3AZN D;  3KXB A;  2NZD D;  4CAY A;  3B6G C;  4R8P C;  3O62 C;  1P3K D;  4QLC A;  5B24 C;  3AZI A;  1P3L D;  4WV4 B;  3KXB B;  4CAY B;  3A1I A;  4QLC B;  3AZI B;  3AZG C;  1P3I D;  5B32 G;  2F8N K;  3AZJ D;  3AZH A;  5GXQ D;  3AZH B;  3UTB C;  1KX5 A;  3WAA C;  1M1A C;  5AV9 D;  4JJN D;  3LJA D;  3AZM D;  1P3B D;  1KX5 B;  3WKJ D;  3AZL C;  2J8P A;  4WU9 D;  5AVB D;  1P3O C;  4H9N A;  3W96 D;  4HGA B;  2CWE A;  3MGS C;  4H9N B;  3REK C;  3WTP C;  3AV1 C;  3KFU G;  5AV8 A;  2F8N A;  3X1S C;  1H3O A;  5AV8 B;  2F8N B;  1P34 D;  1P3A D;  1H3O B;  4J8X A;  3KWQ A;  3X1V A;  5F99 D;  5B40 D;  5DNM D;  4J8X B;  3KWQ B;  3X1V B;  5E5A A;  2NQB A;  4KGC D;  5B31 D;  5E5A B;  3REK B;  2NQB B;  2HIO A;  5DNN A;  4J8W D;  1P3P C;  2Y2Q A;  3UTA C;  1U35 C;  4H9O A;  5AY8 A;  1EQZ D;  4H9O B;  3REL D;  5AY8 B;  3B0C W;  2HUE C;  4Z2M H;  5B2I C;  1KX4 D;  1HQ3 D;  3KUY A;  3AN2 D;  4DQY B;  4Z66 D;  2F2A C;  3KUY B;  1P3K A;  5B32 C;  1P3G D;  1P3K B;  1P3F C;  4X23 D;  5G49 A;  1P3I A;  3C1C D;  4J8V C;  3B6F D;  5GT0 A;  5G49 B;  1P3I B;  5GT0 B;  4AWL B;  1T3U A;  3MGR D;  5GXQ A;  2FJ7 C;  5B1M D;  3LEL D;  4JJN A;  5AV5 C;  5GXQ B;  3LJA A;  3AZM A;  3WKJ A;  4JJN B;  3AZM B;  4WU9 A;  3WKJ B;  4YM6 C;  2ZY5 A;  3VH6 T;  3W96 A;  3AFA C;  4WU9 B;  2JCH A;  3W96 B;  3TU4 C;  5BT1 D;  5B0Y C;  3REH C;  1AOI C;  1HTA A;  4WNN A;  4XZQ C;  3AZH D;  4EO5 B;  1P3A A;  2Y2J A;  4WNN B;  1KX5 D;  3B6G D;  4R8P D;  3AV2 C;  5B40 A;  5DNM A;  5CPK C;  5B40 B;  4J8U C;  4KGC A;  2BYM A;  4Z5T C;  3EPJ A;  3TU4 B;  4KGC B;  4KUD C;  2BYM B;  5B0Y B;  3C1B A;  1AOI B;  5AV8 D;  3C1B B;  1EQZ A;  2F8N D;  3UTB D;  4XUJ C;  3WAA D;  2Y2P A;  3AZE C;  1KX3 A;  1EQZ B;  1P3M A;  1N1J B;  1KX4 A;  3LZ0 A;  1KX3 B;  1B6W A;  1P3M B;  4J8X D;  3AN2 A;  2G5H C;  1TZY B;  3LZ0 B;  1KX4 B;  3KWQ D;  4NFT A;  5JRG C;  2ARO A;  5JA4 A;  3MGS D;  5E5A D;  3REK D;  3W99 C;  4X23 A;  2NQB D;  3EPK A;  2ARO B;  5JA4 B;  3R45 A;  3C1C A;  4CSR A;  3X1S D;  5CPI A;  3C1C B;  3LZ1 A;  5AY8 D;  4CSR B;  5CPI B;  1Z2C B;  3AYW C;  3MGR A;  3LZ1 B;  3LEL A;  1ZLA C;  3MVD C;  3UTA D;  5B1L A;  1U35 D;  4ZUX C; 
#chains in the Genus database with same CATH homology
 3X1T C;  1M19 C;  5B1L B;  2DF4 C;  3EPL A;  5GT0 D;  2Y2L A;  4NE6 A;  2YFV A;  1ID3 A;  5CP6 C;  5B2J A;  1F66 C;  2BYK A;  1ID3 B;  2YFV B;  5B2J B;  2F8N H;  2BYK B;  3B6G A;  3FDD A;  3X1U C;  4R8P A;  5BNX A;  3O62 A;  5B24 A;  5AVC C;  3B6G B;  5B32 D;  4R8P B;  5BNX B;  3O62 B;  3VH6 A;  5B24 B;  1P3F D;  3AZG A;  4LD9 C;  4Z2M G;  2PYO C;  3AZG B;  5BO0 A;  1M19 B;  3W97 C;  4G92 C;  3AZK C;  5BO0 B;  3W98 C;  3UTB A;  2FJ7 D;  3WAA A;  1M1A A;  5AV5 D;  1ULY A;  3UTB B;  3WAA B;  1M1A B;  4H9P A;  2ZY2 A;  3AZL A;  3A6N C;  2Y2H A;  1P3O A;  4YM6 D;  4H9P B;  3AZL B;  2IO5 C;  3AFA D;  1P3O B;  3MGP C;  2ZY3 A;  3MGS A;  3REK A;  3TU4 D;  3AL0 C;  3WTP A;  5B0Y D;  3AV1 A;  3MGS B;  3REJ C;  4G92 B;  1AOI D;  3WTP B;  3X1S A;  3C1B D;  3AV1 B;  4XZQ D;  1A7W A;  2ZM5 A;  5C3I C;  1KU5 A;  3X1S B;  1M18 C;  3H0L C;  1KX3 D;  2UWX A;  1P3M D;  1TZY D;  5B31 G;  3LZ0 D;  1PZR A;  5BS7 C;  5CPK D;  4H9R A;  4E45 A;  4Z5T D;  2ARO D;  2RVQ C;  4H9R B;  3H0R C;  1P3P A;  4KUD D;  3UTA A;  1U35 A;  5GSU C;  3AZN C;  1P3P B;  3VH5 T;  4E44 A;  2CV5 C;  3H0M C;  3UTA B;  2NZD C;  1U35 B;  4XUJ D;  1P3L C;  5KDM A;  5CPI D;  3AZE D;  3LZ1 D;  5B2I A;  5KDM B;  1WWS A;  2YFW A;  2HUE B;  3MNN C;  5B2I B;  1S32 C;  2YFW B;  3REI C;  3F6T A;  3AZJ C;  5JRG D;  5B32 A;  3W99 D;  1P3F A;  5B32 B;  5AV9 C;  1P3F B;  4J8V A;  3B0D C;  5GT3 C;  5B1L D;  1P3B C;  2Y2I A;  4J8V B;  2XD1 A;  5AVB C;  1ID3 D;  2FJ7 A;  5B2J D;  5AV5 A;  3MNN B;  2FJ7 B;  1JFI A;  5AV5 B;  3REI B;  3O62 D;  1ZLA D;  5B24 D;  4YM6 A;  1JFI B;  3WA9 C;  2G5I C;  3MVD D;  3AFA A;  1P34 C;  4G91 C;  4H9S C;  4YM6 B;  3MGQ C;  3X1T D;  3TU4 A;  3AZG D;  3AZF C;  3AFA B;  1M19 D;  5B0Y A;  3VH6 W;  3REH A;  4NE3 A;  5F99 C;  1AOI A;  5B33 C;  3REH B;  4XZQ A;  3UT9 C;  5B31 C;  1N1J A;  4XZQ B;  4KHA A;  1M1A D;  4J8W C;  3AV2 A;  4KHA B;  1TZY A;  5CPK A;  3AZL D;  3AV2 B;  1P3O D;  3REL C;  5CPK B;  5B0Z C;  4Z5T A;  3MGQ B;  4J8U B;  2Y2K A;  4KUD A;  1F1E A;  1HQ3 C;  4Z5T B;  2F8N G;  5BNV A;  3AZK D;  3WTP D;  3AV1 D;  4KUD B;  4Z66 C;  4WU8 C;  5BNV B;  4XUJ A;  3AZE A;  5CPJ C;  1P3G C;  4XUJ B;  3AZE B;  1BH8 A;  4YS3 C;  3B6F C;  3NQU A;  4DRA A;  1BH8 B;  5JRG A;  3MGP D;  3NQU B;  5B0Z B;  3W99 A;  5JRG B;  5AV6 C;  5B1M C;  3W99 B;  1P3P D;  3VH5 A;  4NE5 A;  3KXB C;  4QLC C;  3AZI C;  3AYW B;  5B2I D;  1Q9C A;  1BFM A;  2ZY4 A;  1ZLA A;  2RVQ D;  3AZH C;  3MVD A;  1ZLA B;  2Y2G A;  5GSU D;  4H9Q A;  4ZUX A;  3X1T A;  3B0B A;  3MVD B;  4ZBJ C;  2CV5 D;  1M19 A;  1KX5 C;  4J8V D;  4ZUX B;  4H9Q B;  3X1T B;  5CP6 A;  4HGA C;  1F66 A;  3MNN D;  5CP6 B;  1F66 B;  3X1U A;  1S32 D;  3REI D;  5AVC A;  3X1U B;  4WJ3 C;  5AV8 C;  3KSY A;  2JSS A;  5AVC B;  4LD9 A;  1B67 A;  3A1K A;  2PYO A;  5GT3 D;  4ZBJ B;  4LD9 B;  3W97 A;  2PYO B;  4J8X C;  3AZK A;  3W98 A;  3REH D;  3KWQ C;  3W97 B;  3X1V C;  3AZK B;  3W98 B;  5E5A C;  2NQB C;  3A6N A;  2HIO C;  5DNN C;  1R4V A;  3B0C T;  3AV2 D;  3WA9 D;  3A6N B;  5AY8 C;  3MGP A;  3MGQ D;  4J8U D;  2IO5 B;  2LY8 A;  3AZF D;  3MGP B;  3REJ A;  3EPH A;  5B33 D;  3KUY C;  3REJ B;  3IP4 C;  2RIQ A;  3UT9 D;  2Y2O A;  2Y2N A;  1P3K C;  5C3I B;  1M18 A;  4DRB A;  1M18 B;  2HIO B;  5BS7 A;  5DNN B;  1P3I C;  5GT0 C;  4AWL C;  4UUZ A;  5B0Z D;  4UUZ B;  2VQR A;  5GSU A;  2FFF B;  5GXQ C;  3AZN A;  2NZD A;  2CV5 A;  2JE5 A;  4JJN C;  4WU8 D;  5GSU B;  3LJA C;  3AZM C;  3AZN B;  1P3L A;  2CV5 B;  2NZD B;  3WKJ C;  5CPJ D;  1P3L B;  2BG1 A;  3VH5 W;  4WU9 C;  3AYW D;  3MNN A;  1TAF A;  3W96 C;  4YS3 D;  2L5A A;  2Y2M A;  3AZJ A;  3REI A;  1TAF B;  1S32 A;  1S32 B;  3AZJ B;  3V9R A;  4EO5 C;  5AV6 D;  5AV9 A;  3V9R B;  5GT3 A;  3WTP E;  1P3B A;  1P3A C;  4ZUX D;  5AV9 B;  3KXB D;  3B0D B;  5GT3 B;  3LJA B;  1P3B B;  5AVB A;  4QLC D;  3AZI D;  5DNM C;  5B40 C;  5AVB B;  5CP6 D;  1F66 D;  4KGC C;  1W2E A;  3X1U D;  3C1B C;  3WA9 A;  5AVC D;  1P34 A;  4H9S A;  3MGQ A;  1EQZ C;  3WA9 B;  2W8S A;  4J8U A;  3AZF A;  1P34 B;  4LD9 D;  4G91 B;  1P3A B;  1KX3 C;  2PYO D;  1P3M C;  5CHL B;  5F99 A;  1TZY C;  3LZ0 C;  5B33 A;  3AZF B;  1KX4 C;  3W97 D;  3AN2 C;  5F99 B;  3W98 D;  5DNM B;  5B33 B;  3UT9 A;  5B31 A;  4WZS B;  2ARO C;  1BH9 A;  4J8W A;  3UT9 B;  5B31 B;  3EG5 B;  4X23 C;  1BH9 B;  4J8W B;  3A6N D;  3C1C C;  3REL A;  5CPI C;  5B0Z A;  3LZ1 C;  5FUG A;  2DQN C;  3REL B;  1HQ3 A;  4M6B A;  3MGR C;  5FUG B;  1HQ3 B;  4Z66 A;  4WU8 A;  3LEL C;  3REJ D;  3X1V D;  3AN2 B;  4Z66 B;  4WU8 B;  5CPJ A;  1P3G A;  3NQJ A;  3AYW A;  5CPJ B;  1P3G B;  1M18 D;  4X23 B;  2HIO D;  5DNN D;  4UPK A;  2XD5 A;  3NQJ B;  4YS3 A;  5B1L C;  3B6F A;  3R45 B;  3P5J B;  4YS3 B;  3B6F B;  5BT1 C;  1ID3 C;  5AV6 A;  5B1M A;  5B2J C;  3MGR B;  1WWI A;  3KUY D;  5AV6 B;  5B1M B;  3LEL B;  3AZN D;  3KXB A;  2NZD D;  4CAY A;  3B6G C;  4R8P C;  3O62 C;  1P3K D;  4QLC A;  5B24 C;  3AZI A;  1P3L D;  4WV4 B;  3KXB B;  4CAY B;  3A1I A;  4QLC B;  3AZI B;  3AZG C;  1P3I D;  5B32 G;  2F8N K;  3AZJ D;  3AZH A;  5GXQ D;  3AZH B;  3UTB C;  1KX5 A;  3WAA C;  1M1A C;  5AV9 D;  4JJN D;  3LJA D;  3AZM D;  1P3B D;  1KX5 B;  3WKJ D;  3AZL C;  2J8P A;  4WU9 D;  5AVB D;  1P3O C;  4H9N A;  3W96 D;  4HGA B;  2CWE A;  3MGS C;  4H9N B;  3REK C;  3WTP C;  3AV1 C;  3KFU G;  5AV8 A;  2F8N A;  3X1S C;  1H3O A;  5AV8 B;  2F8N B;  1P34 D;  1P3A D;  1H3O B;  4J8X A;  3KWQ A;  3X1V A;  5F99 D;  5B40 D;  5DNM D;  4J8X B;  3KWQ B;  3X1V B;  5E5A A;  2NQB A;  4KGC D;  5B31 D;  5E5A B;  3REK B;  2NQB B;  2HIO A;  5DNN A;  4J8W D;  1P3P C;  2Y2Q A;  3UTA C;  1U35 C;  4H9O A;  5AY8 A;  1EQZ D;  4H9O B;  3REL D;  5AY8 B;  3B0C W;  2HUE C;  4Z2M H;  5B2I C;  1KX4 D;  1HQ3 D;  3KUY A;  3AN2 D;  4DQY B;  4Z66 D;  2F2A C;  3KUY B;  1P3K A;  5B32 C;  1P3G D;  1P3K B;  1P3F C;  4X23 D;  5G49 A;  1P3I A;  3C1C D;  4J8V C;  3B6F D;  5GT0 A;  5G49 B;  1P3I B;  5GT0 B;  4AWL B;  1T3U A;  3MGR D;  5GXQ A;  2FJ7 C;  5B1M D;  3LEL D;  4JJN A;  5AV5 C;  5GXQ B;  3LJA A;  3AZM A;  3WKJ A;  4JJN B;  3AZM B;  4WU9 A;  3WKJ B;  4YM6 C;  2ZY5 A;  3VH6 T;  3W96 A;  3AFA C;  4WU9 B;  2JCH A;  3W96 B;  3TU4 C;  5BT1 D;  5B0Y C;  3REH C;  1AOI C;  1HTA A;  4WNN A;  4XZQ C;  3AZH D;  4EO5 B;  1P3A A;  2Y2J A;  4WNN B;  1KX5 D;  3B6G D;  4R8P D;  3AV2 C;  5B40 A;  5DNM A;  5CPK C;  5B40 B;  4J8U C;  4KGC A;  2BYM A;  4Z5T C;  3EPJ A;  3TU4 B;  4KGC B;  4KUD C;  2BYM B;  5B0Y B;  3C1B A;  1AOI B;  5AV8 D;  3C1B B;  1EQZ A;  2F8N D;  3UTB D;  4XUJ C;  3WAA D;  2Y2P A;  3AZE C;  1KX3 A;  1EQZ B;  1P3M A;  1N1J B;  1KX4 A;  3LZ0 A;  1KX3 B;  1B6W A;  1P3M B;  4J8X D;  3AN2 A;  2G5H C;  1TZY B;  3LZ0 B;  1KX4 B;  3KWQ D;  4NFT A;  5JRG C;  2ARO A;  5JA4 A;  3MGS D;  5E5A D;  3REK D;  3W99 C;  4X23 A;  2NQB D;  3EPK A;  2ARO B;  5JA4 B;  3R45 A;  3C1C A;  4CSR A;  3X1S D;  5CPI A;  3C1C B;  3LZ1 A;  5AY8 D;  4CSR B;  5CPI B;  1Z2C B;  3AYW C;  3MGR A;  3LZ1 B;  3LEL A;  1ZLA C;  3MVD C;  3UTA D;  5B1L A;  1U35 D;  4ZUX C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...