4XUJC

Nucleosome core particle containing adducts from treatment with a thiomorpholine-substituted [(eta-6-p-cymene)ru(3-hydroxy-2-pyridone)cl] compound
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
106
structure length
106
Chain Sequence
AKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna-binding protein/dna
molecule keywords Histone H3.2
publication title Contrasting Cytotoxicity and Reactivity of RuII-Arene Complexes of Morpholine vs Thiomorpholine Substituted 3-Hydroxy-2-pyridone Ligands
rcsb
source organism Xenopus laevis
total genus 30
structure length 106
sequence length 106
chains with identical sequence G
ec nomenclature
pdb deposition date 2015-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4xujC00
5GSUB 5AY8B 5CPJA 1U35D 3MVDC 3X1SD 3REHB 3WKJD 3W98D 4WU8C 5DNMA 3LZ0B 1P3LD 3MGQA 1KX5B 1BH8B 3MGRB 3MNNA 2BYMB 4J8VA 5C3IB 1EQZA 3B6FB 4G92C 4J8WC 1M19C 3AZIA 1F66C 1P3OA 3LJAA 5BS7C 3LZ1A 3V9RA 3UT9B 1H3OB 5B24A 5JA4A 5B2JC 3WA9C 5AV8B 5B40B 4X23C 3REKD 3AZGA 3NQJA 3TU4C 5B0ZB 1BH9A 3AZJB 3X1UC 5DNNC 3AYWB 4ZUXC 5AY8A 1M18B 3MGSB 3C1CB 1TZYD 5AV9A 4E45A 5GT0C 5E5AC 2IO5C 4KHAB 4R8PB 5AVBA 4H9PA 4YS3D 5DNMD 1TZYC 3MNND 3LELB 5AVCB 4WU9B 1P3KD 4JJNB 1F1EA 4H9QA 2RVQD 2BYKA 1P3OD 3X1VC 4YS3C 1S32A 3MVDB 3LJAD 1H3OA 3LZ1D 4WU8B 4J8XC 5B24D 3REJD 3AZJA 1P3FC 1P3PB 5CPKC 1M19B 4LD9C 2YFWB 3RELC 1KX3C 3MGPD 2F8NA 4XUJC 3A6NA 5AY8D 4J8UC 2CV5B 1P3MC 1JFIA 1Q9CA 5B2JB 5B0YC 1P3BC 2NZDC 3WA9B 2CWEA 5AV9D 3LZ0D 5B32A 3MGPC 3C1BC 4X23B 5GSUC 1KX5D 3MGRD 5AV5C 3B6FD 3X1UB 4WU9A 5B1MB 4JJNA 3KXBB 3REHC 3AZNB 2F8NH 4Z2MH 1KX5C 3MGRC 5KDMA 4XZQC 3B6FC 4WU8A 3UT9D 3KSYA 5GT0B 1ID3C 5E5AB 1WWIA 4J8WA 3WKJA 3W98A 3AZJD 1F66A 2YFWA 4YM6C 2HUEC 5BS7A 4UUZA 3VH6A 5BNVB 3X1VB 4WNNB 3AZEC 5AV8C 5B40C 5B2IB 3MGSD 5B2JA 5B0ZC 3A6ND 2F8ND 4NE5A 4J8XB 3WA9A 5AV6C 3AYWC 3TU4A 1M18C 5CPKB 2LY8A 5B32D 3C1CC 5DNNA 4LD9B 4CAYA 4ZUXA 5BO0B 3RELB 5AVCD 5B31G 4WU9D 3UTAC 4JJND 1KX3B 4R8PC 3W96B 4J8UB 3MVDD 1P3MB 5E5AA 5B0YB 3LELC 3KUYB 1P3BB 4WU8D 1TZYA 1P34C 5AV5B 2HIOB 5F99C 4J8WD 1M19D 1F66D 3X1VA 4WNNA 4YS3A 3REIC 1P3AC 1AOIC 4XZQB 5GT3C 1P3KA 1P3PC 1ID3B 5B2JD 3AZLC 3WA9D 1P3FA 5CPKA 4X23D 3TU4D 2CV5C 4YM6B 5BO0A 1N1JA 3X1UD 2HUEB 3RELA 5B1MD 4CSRA 5DNND 3AZMC 3REJA 1M1AB 4ZUXD 3AZEB 4XUJA 4J8UA 5B0YA 3WAAB 2NZDA 5B1MC 5AV6B 3KXBC 5GT0D 3MGPA 3C1BA 5E5AD 3AZNC 5GSUA 5AV5A 4KUDC 3AN2B 2PYOC 4KGCC 3REHA 3UTBB 3UTAB 3LZ0A 2NQBB 3AZKC 1KX5A 5JRGB 1BH8A 3MGRA 2BYMA 3X1VD 3B6FA 4H9SC 3AZFB 1B6WA 4NE3A 4J8XD 5CPIC 3WTPC 1TAFB 1P34B 2FJ7B 3UT9A 5F99B 1P3FD 5CPKD 5B2IC 4JJNC 1KU5A 1HQ3B 4LD9D 3REIB 3RELD 4Z66B 5AV8A 5B40A 1KX3D 4H9OB 1P3AB 2AROC 1AOIB 5FUGB 5B0ZA 4XUJD 5GT3B 4J8UD 4H9RB 1P3MD 3AYWA 5B0YD 1P3BD 3KUYD 2NZDD 3AZLB 5CPJC 1M18A 3C1BD 3MGSA 3C1CA 3W96C 5GSUD 3X1TB 3AFAC 1ZLAB 5AV5D 5B31C 3VH6T 4M6BA 3UTAA 3REHD 3AZMB 3KUYC 4QLCC 4KHAA 4R8PA 4J8VC 1EQZC 2L5AA 5GXQB 2HIOC 4XZQD 3LELA 3NQUB 5AVCA 1ID3D 1P34A 3MVDA 4DRBA 3C1BB 4KUDB 4DRAA 5F99A 2PYOB 5BNXB 4AWLC 4KGCB 1P3LB 5G49B 4YM6D 3REIA 3W97C 3AZKB 1P3AA 1AOIA 1M1AD 5FUGA 3AZED 5AV8D 5B40D 1P3PA 1M19A 5B0ZD 5CPIB 1B67A 5AV6D 3AYWD 3WTPB 1M1AC 2CV5A 1M18D 3C1CD 3WAAC 3AZMA 3REKB 5BT1D 5AVBC 1P3IC 3UTAD 5B1LC 2AROB 4X23A 5CP6B 4Z5TC 4G91B 4R8PD 3AV1C 4H9NB 3X1UA 1KX4C 5B1MA 3AN2C 3B6GC 3KXBA 3AV2C 3AZNA 3B0CT 3LELD 3UTBC 5BT1C 3AZHC 5CPJB 1S32C 2NQBC 4NE6A 4KUDA 5JRGC 2PYOA 3AFAB 1P34D 5G49A 5B31B 5F99D 5DNMB 3AZFC 5GT0A 3AZKA 3VH6W 3MGQB 4QLCB 4J8VB 1EQZB 3REID 1P3AD 4H9SA 2FJ7C 3B0BA 1AOID 3AZIB 5GT3D 4HGAC 1P3OB 1P3PD 5CPIA 3LJAB 1HQ3C 1HTAA 5BNVA 3WTPA 3V9RB 4Z66C 3AZLD 1P3GC 3W99C 5B2IA 4AWLB 3X1TD 5JA4B 4J8XA 2CV5D 3W97B 5B33C 3AZMD 2AROA 3AZGB 3NQJB 1BH9B 4NFTA 4H9NA 3X1TC 1ZLAC 4LD9A 3O62C 4E44A 1KX3A 3KWQC 3KXBD 3AZND 3W96A 3AFAA 5B31A 1P3MA 3VH5A 4KUDD 5GXQC 5AV9B 2PYOD 4KGCD 1P3BA 2YFVB 3KUYA 4QLCA 5AVBB 4H9PB 1U35C 3X1SC 1P3IB 5B1LB 3AZKD 4Z5TB 3AV1B 3WKJC 2HIOA 3W98C 1KX4B 3B6GB 3AV2B 1P3LC 5CHLB 4H9QB 2BYKB 3AZHB 1S32B 5CPID 3B0CW 3WTPD 4XZQA 3R45B 1ULYA 5B2ID 3B0DC 3W97A 1ID3A 4ZBJC 3VH5W 2AROD 5CP6D 4HGAB 4YM6A 2F8NG 4Z2MG 3REKC 1M1AA 4EO5C 3AZEA 2F8NB 3A6NB 5CPJD 1P3GB 3W99B 5CP6C 1JFIB 4G91C 5B32G 3W96D 2F8NK 2JSSA 3AFAD 2YFVA 3WAAA 5B31D 1BFMA 5AV6A 1P3IA 5B33B 5B1LA 5B32B 3MGQD 4QLCD 4Z5TA 3AV1A 4J8VD 1EQZD 1KX4A 3AN2A 3B6GA 3AV2A 2HIOD 3O62B 3UTBA 3AZID 3AZHA 5DNMC 2NQBA 3KWQB 3MGQC 5JRGA 5KDMB 3MNNC 3R45A 1P3KC 3AZFA 2RVQC 3AZIC 1P3OC 1U35B 3LJAC 3X1SB 3W97D 4G92B 1TAFA 4J8WB 3LZ1C 2FJ7A 3WKJB 3AZGD 3W98B 1F66B 5B24C 1HQ3A 4UUZB 3REJC 4Z66A 1P3GA 4H9OA 3W99A 3AZGC 5GT3A 4H9RA 3B0DB 5B33A 1A7WA 3WAAD 4ZBJB 3TU4B 5AY8C 3AZLA 5AVBD 1P3ID 5B1LD 4WV4B 3X1TA 4Z5TD 5DNNB 3AV1D 1ZLAA 4CAYB 3O62A 4ZUXB 1KX4D 5AV9C 3AN2D 3B6GD 3LZ0C 3KWQA 3AV2D 3UTBD 4EO5B 3AZHD 5C3IC 1S32D 2NQBD 5JRGD 5GXQA 3NQUA 2IO5B 4WZSB 1U35A 3X1SA 3AZFD 1TZYB 1WWSA 3UT9C 5BNXA 4KGCA 1P3LA 2FJ7D 4YS3B 1HQ3D 3VH5T 3MNNB 3AZJC 4Z66D 1P3KB 1P3GD 3W99D 1P3FB 5B33D 3MGSC 3LZ1B 3A6NC 3WTPE 1R4VA 1N1JB 5B24B 4CSRB 1ZLAD 3REJB 3REKA 3O62D 4XUJB 3KWQD 5B32C 5CP6A 2NZDB 5AVCC 4WU9C 5GXQD 3MGPB
chains in the Genus database with same CATH superfamily
5GSUB 5AY8B 5CPJA 1U35D 3MVDC 3X1SD 3REHB 3WKJD 3W98D 4WU8C 2DQNC 5DNMA 3LZ0B 1P3LD 3MGQA 1KX5B 1BH8B 3MGRB 3MNNA 2BYMB 4J8VA 5C3IB 1EQZA 3B6FB 4G92C 4J8WC 1M19C 3AZIA 1F66C 1P3OA 2JCHA 3LJAA 5BS7C 3LZ1A 3V9RA 2ZY4A 3UT9B 1H3OB 5B24A 5JA4A 5B2JC 3WA9C 5AV8B 5B40B 4X23C 3REKD 3AZGA 3NQJA 3TU4C 5B0ZB 1BH9A 3AZJB 3X1UC 5DNNC 3AYWB 4ZUXC 2Y2LA 5AY8A 1M18B 3MGSB 3C1CB 1TZYD 5AV9A 4E45A 5GT0C 5E5AC 2IO5C 4KHAB 4R8PB 5AVBA 4H9PA 4YS3D 5DNMD 1TZYC 2UWXA 3MNND 3LELB 5AVCB 4WU9B 1P3KD 4JJNB 1F1EA 2RVQD 2BYKA 4H9QA 1P3OD 3X1VC 4YS3C 1S32A 3MVDB 3LJAD 1H3OA 3LZ1D 3P5JB 2XD1A 4WU8B 4J8XC 5B24D 3REJD 2ZY2A 3AZJA 1P3FC 1P3PB 5CPKC 1M19B 4LD9C 2YFWB 3RELC 1KX3C 3MGPD 2F8NA 4XUJC 3A6NA 5AY8D 4J8UC 2CV5B 1P3MC 1JFIA 1Q9CA 5B2JB 5B0YC 1P3BC 2NZDC 3WA9B 2CWEA 5AV9D 3LZ0D 5B32A 3MGPC 3C1BC 4X23B 5GSUC 1KX5D 2G5IC 5AV5C 3MGRD 3B6FD 3X1UB 4WU9A 5B1MB 2Y2JA 4JJNA 3KXBB 3REHC 3AZNB 2F8NH 2Y2NA 4Z2MH 3AL0C 1KX5C 3MGRC 5KDMA 4XZQC 3B6FC 4WU8A 3UT9D 3KSYA 5GT0B 1ID3C 5E5AB 1WWIA 4J8WA 3WKJA 3W98A 3AZJD 1F66A 2YFWA 4YM6C 2HUEC 5BS7A 4UUZA 3VH6A 5BNVB 3X1VB 4WNNB 3AZEC 2ZM5A 5AV8C 5B40C 5B2IB 4WJ3C 3MGSD 5B2JA 5B0ZC 3A6ND 2F8ND 4NE5A 4J8XB 3WA9A 5AV6C 3AYWC 3TU4A 1M18C 5CPKB 2LY8A 2RIQA 5B32D 3C1CC 5DNNA 4LD9B 4CAYA 4ZUXA 5BO0B 3RELB 5AVCD 5B31G 4WU9D 3UTAC 4JJND 1KX3B 4R8PC 3W96B 4J8UB 3MVDD 1P3MB 2DF4C 5E5AA 5B0YB 3LELC 3KUYB 1P3BB 4WU8D 1TZYA 1P34C 5AV5B 2HIOB 5F99C 4J8WD 1M19D 1F66D 3X1VA 4WNNA 4YS3A 3REIC 3KFUG 1P3AC 1AOIC 2JE5A 1W2EA 4XZQB 5GT3C 2FFFB 1P3KA 1P3PC 1ID3B 5B2JD 3AZLC 3WA9D 1P3FA 5CPKA 4X23D 3TU4D 2CV5C 4YM6B 5BO0A 1N1JA 3X1UD 2HUEB 3RELA 5B1MD 4CSRA 5DNND 3AZMC 3REJA 1M1AB 4ZUXD 3AZEB 4XUJA 4J8UA 5B0YA 3WAAB 2NZDA 5B1MC 5AV6B 2ZY5A 3KXBC 3H0LC 5GT0D 3MGPA 3C1BA 5E5AD 3AZNC 5GSUA 3H0RC 5AV5A 4KUDC 3AN2B 2PYOC 4KGCC 3REHA 3UTBB 3UTAB 3LZ0A 2NQBB 3AZKC 1KX5A 5JRGB 1BH8A 2ZY3A 3MGRA 2Y2IA 2BYMA 3X1VD 3B6FA 4H9SC 3AZFB 1B6WA 3H0MC 2F2AC 4NE3A 4J8XD 5CPIC 3WTPC 1TAFB 1P34B 2FJ7B 3UT9A 5F99B 1P3FD 5CPKD 5B2IC 4JJNC 1PZRA 2J8PA 1KU5A 1HQ3B 4LD9D 3REIB 3RELD 4Z66B 5AV8A 5B40A 1KX3D 4H9OB 1P3AB 2AROC 1AOIB 5FUGB 5B0ZA 4XUJD 5GT3B 4J8UD 2Y2QA 4H9RB 1P3MD 3AYWA 5B0YD 1P3BD 3KUYD 2NZDD 3AZLB 5CPJC 1M18A 3C1BD 3MGSA 2Y2MA 3C1CA 1T3UA 3W96C 5GSUD 3X1TB 3AFAC 1ZLAB 5AV5D 5B31C 3VH6T 4M6BA 3UTAA 3REHD 3AZMB 3KUYC 4QLCC 4KHAA 4R8PA 4J8VC 1EQZC 3F6TA 2L5AA 5GXQB 2HIOC 4XZQD 3LELA 3NQUB 5AVCA 1ID3D 1P34A 3MVDA 4DRBA 3C1BB 4KUDB 4DRAA 5F99A 2PYOB 5BNXB 4AWLC 4KGCB 1P3LB 5G49B 4YM6D 3REIA 3W97C 3AZKB 1P3AA 1AOIA 1M1AD 5FUGA 3AZED 2Y2HA 5B40D 5AV8D 1P3PA 1M19A 5B0ZD 5CPIB 1B67A 5AV6D 3AYWD 3WTPB 1M1AC 2Y2GA 2Y2PA 2CV5A 1M18D 3C1CD 3WAAC 3AZMA 3REKB 5BT1D 5AVBC 1P3IC 3UTAD 5B1LC 2AROB 4X23A 5CP6B 4Z5TC 4G91B 4R8PD 3AV1C 4H9NB 3X1UA 1KX4C 5B1MA 3AN2C 3B6GC 3KXBA 3AV2C 3AZNA 3B0CT 3LELD 3UTBC 5BT1C 3AZHC 5CPJB 1S32C 2NQBC 4NE6A 4KUDA 5JRGC 2PYOA 3AFAB 1P34D 5G49A 5B31B 5F99D 5DNMB 3AZFC 5GT0A 3AZKA 3VH6W 3MGQB 4QLCB 4J8VB 1EQZB 3REID 1P3AD 4H9SA 2FJ7C 3B0BA 4UPKA 1AOID 3AZIB 5GT3D 4HGAC 1P3OB 1P3PD 5CPIA 3LJAB 1HQ3C 1HTAA 5BNVA 3WTPA 3V9RB 4Z66C 3AZLD 1P3GC 3W99C 5B2IA 4AWLB 3X1TD 5JA4B 4J8XA 2CV5D 3W97B 5B33C 3AZMD 2AROA 3AZGB 3NQJB 1BH9B 4NFTA 4H9NA 3X1TC 1ZLAC 4LD9A 3O62C 4E44A 1KX3A 1Z2CB 3KXBD 3KWQC 3AZND 3W96A 3AFAA 5B31A 1P3MA 3VH5A 4KUDD 5GXQC 5AV9B 2PYOD 4KGCD 1P3BA 2YFVB 3KUYA 4QLCA 5AVBB 4H9PB 1U35C 3X1SC 1P3IB 5B1LB 3AZKD 4Z5TB 3AV1B 3WKJC 2HIOA 3W98C 1KX4B 3B6GB 3AV2B 1P3LC 5CHLB 4H9QB 2BYKB 3AZHB 1S32B 5CPID 3FDDA 3B0CW 3WTPD 4XZQA 3R45B 1ULYA 5B2ID 3B0DC 3W97A 1ID3A 4ZBJC 3VH5W 3A1IA 2AROD 5CP6D 3EPJA 4HGAB 4YM6A 2F8NG 4Z2MG 3REKC 1M1AA 4EO5C 3AZEA 2F8NB 3A6NB 5CPJD 1P3GB 3W99B 2Y2KA 5CP6C 2XD5A 1JFIB 4G91C 5B32G 3W96D 2F8NK 2JSSA 3AFAD 2YFVA 3WAAA 5B31D 1BFMA 5AV6A 1P3IA 5B33B 5B1LA 5B32B 3MGQD 4QLCD 4Z5TA 3AV1A 4J8VD 1EQZD 1KX4A 3AN2A 3B6GA 3AV2A 2HIOD 3O62B 3UTBA 3AZID 3A1KA 3AZHA 5DNMC 2NQBA 3KWQB 3MGQC 5JRGA 2G5HC 5KDMB 3MNNC 3R45A 1P3KC 3AZFA 2RVQC 3AZIC 1P3OC 1U35B 3LJAC 3X1SB 3W97D 4G92B 1TAFA 4J8WB 3LZ1C 2FJ7A 3WKJB 3AZGD 3W98B 1F66B 5B24C 1HQ3A 4UUZB 3REJC 4Z66A 1P3GA 4H9OA 3W99A 3AZGC 5GT3A 4H9RA 3B0DB 5B33A 1A7WA 3WAAD 4ZBJB 2Y2OA 3TU4B 5AY8C 3AZLA 5AVBD 1P3ID 5B1LD 4WV4B 3X1TA 4Z5TD 5DNNB 3AV1D 1ZLAA 4CAYB 3O62A 2BG1A 4ZUXB 1KX4D 5AV9C 3AN2D 3B6GD 3LZ0C 3KWQA 3AV2D 4DQYB 3IP4C 4EO5B 3UTBD 3AZHD 5C3IC 1S32D 2NQBD 2W8SA 5JRGD 5GXQA 3NQUA 2IO5B 4WZSB 1U35A 3X1SA 3AZFD 1TZYB 1WWSA 3UT9C 5BNXA 4KGCA 1P3LA 2FJ7D 4YS3B 1HQ3D 3VH5T 3MNNB 3AZJC 3EPKA 4Z66D 1P3KB 1P3GD 3W99D 3EPHA 1P3FB 5B33D 3EG5B 3LZ1B 3MGSC 3A6NC 3WTPE 1R4VA 1N1JB 5B24B 4CSRB 3EPLA 3REJB 3REKA 3O62D 1ZLAD 4XUJB 3KWQD 2VQRA 5B32C 5CP6A 2NZDB 5AVCC 4WU9C 5GXQD 3MGPB
chains in the Genus database with same CATH topology
5GSUB 5AY8B 5CPJA 1U35D 3MVDC 3X1SD 3REHB 3WKJD 3W98D 4WU8C 2DQNC 5DNMA 3LZ0B 1P3LD 3MGQA 1KX5B 1BH8B 3MGRB 3MNNA 2BYMB 4J8VA 5C3IB 1EQZA 3B6FB 4G92C 4J8WC 1M19C 3AZIA 1F66C 1P3OA 2JCHA 3LJAA 5BS7C 3LZ1A 3V9RA 2ZY4A 3UT9B 1H3OB 5B24A 5JA4A 5B2JC 3WA9C 5AV8B 5B40B 4X23C 3REKD 3AZGA 3NQJA 3TU4C 5B0ZB 1BH9A 3AZJB 3X1UC 5DNNC 3AYWB 4ZUXC 2Y2LA 5AY8A 1M18B 3MGSB 3C1CB 1TZYD 5AV9A 4E45A 5GT0C 5E5AC 2IO5C 4KHAB 4R8PB 5AVBA 4H9PA 4YS3D 5DNMD 1TZYC 2UWXA 3MNND 3LELB 5AVCB 4WU9B 1P3KD 4JJNB 1F1EA 2RVQD 2BYKA 4H9QA 1P3OD 3X1VC 4YS3C 1S32A 3MVDB 3LJAD 1H3OA 3LZ1D 3P5JB 2XD1A 4WU8B 4J8XC 5B24D 3REJD 2ZY2A 3AZJA 1P3FC 1P3PB 5CPKC 1M19B 4LD9C 2YFWB 3RELC 1KX3C 3MGPD 2F8NA 4XUJC 3A6NA 5AY8D 4J8UC 2CV5B 1P3MC 1JFIA 1Q9CA 5B2JB 5B0YC 1P3BC 2NZDC 3WA9B 2CWEA 5AV9D 3LZ0D 5B32A 3MGPC 3C1BC 4X23B 5GSUC 1KX5D 2G5IC 5AV5C 3MGRD 3B6FD 3X1UB 4WU9A 5B1MB 2Y2JA 4JJNA 3KXBB 3REHC 3AZNB 2F8NH 2Y2NA 4Z2MH 3AL0C 1KX5C 3MGRC 5KDMA 4XZQC 3B6FC 4WU8A 3UT9D 3KSYA 5GT0B 1ID3C 5E5AB 1WWIA 4J8WA 3WKJA 3W98A 3AZJD 1F66A 2YFWA 4YM6C 2HUEC 5BS7A 4UUZA 3VH6A 5BNVB 3X1VB 4WNNB 3AZEC 2ZM5A 5AV8C 5B40C 5B2IB 4WJ3C 3MGSD 5B2JA 5B0ZC 3A6ND 2F8ND 4NE5A 4J8XB 3WA9A 5AV6C 3AYWC 3TU4A 1M18C 5CPKB 2LY8A 2RIQA 5B32D 3C1CC 5DNNA 4LD9B 4CAYA 4ZUXA 5BO0B 3RELB 5AVCD 5B31G 4WU9D 3UTAC 4JJND 1KX3B 4R8PC 3W96B 4J8UB 3MVDD 1P3MB 2DF4C 5E5AA 5B0YB 3LELC 3KUYB 1P3BB 4WU8D 1TZYA 1P34C 5AV5B 2HIOB 5F99C 4J8WD 1M19D 1F66D 3X1VA 4WNNA 4YS3A 3REIC 3KFUG 1P3AC 1AOIC 2JE5A 1W2EA 4XZQB 5GT3C 2FFFB 1P3KA 1P3PC 1ID3B 5B2JD 3AZLC 3WA9D 1P3FA 5CPKA 4X23D 3TU4D 2CV5C 4YM6B 5BO0A 1N1JA 3X1UD 2HUEB 3RELA 5B1MD 4CSRA 5DNND 3AZMC 3REJA 1M1AB 4ZUXD 3AZEB 4XUJA 4J8UA 5B0YA 3WAAB 2NZDA 5B1MC 5AV6B 2ZY5A 3KXBC 3H0LC 5GT0D 3MGPA 3C1BA 5E5AD 3AZNC 5GSUA 3H0RC 5AV5A 4KUDC 3AN2B 2PYOC 4KGCC 3REHA 3UTBB 3UTAB 3LZ0A 2NQBB 3AZKC 1KX5A 5JRGB 1BH8A 2ZY3A 3MGRA 2Y2IA 2BYMA 3X1VD 3B6FA 4H9SC 3AZFB 1B6WA 3H0MC 2F2AC 4NE3A 4J8XD 5CPIC 3WTPC 1TAFB 1P34B 2FJ7B 3UT9A 5F99B 1P3FD 5CPKD 5B2IC 4JJNC 1PZRA 2J8PA 1KU5A 1HQ3B 4LD9D 3REIB 3RELD 4Z66B 5AV8A 5B40A 1KX3D 4H9OB 1P3AB 2AROC 1AOIB 5FUGB 5B0ZA 4XUJD 5GT3B 4J8UD 2Y2QA 4H9RB 1P3MD 3AYWA 5B0YD 1P3BD 3KUYD 2NZDD 3AZLB 5CPJC 1M18A 3C1BD 3MGSA 2Y2MA 3C1CA 1T3UA 3W96C 5GSUD 3X1TB 3AFAC 1ZLAB 5AV5D 5B31C 3VH6T 4M6BA 3UTAA 3REHD 3AZMB 3KUYC 4QLCC 4KHAA 4R8PA 4J8VC 1EQZC 3F6TA 2L5AA 5GXQB 2HIOC 4XZQD 3LELA 3NQUB 5AVCA 1ID3D 1P34A 3MVDA 4DRBA 3C1BB 4KUDB 4DRAA 5F99A 2PYOB 5BNXB 4AWLC 4KGCB 1P3LB 5G49B 4YM6D 3REIA 3W97C 3AZKB 1P3AA 1AOIA 1M1AD 5FUGA 3AZED 2Y2HA 5B40D 5AV8D 1P3PA 1M19A 5B0ZD 5CPIB 1B67A 5AV6D 3AYWD 3WTPB 1M1AC 2Y2GA 2Y2PA 2CV5A 1M18D 3C1CD 3WAAC 3AZMA 3REKB 5BT1D 5AVBC 1P3IC 3UTAD 5B1LC 2AROB 4X23A 5CP6B 4Z5TC 4G91B 4R8PD 3AV1C 4H9NB 3X1UA 1KX4C 5B1MA 3AN2C 3B6GC 3KXBA 3AV2C 3AZNA 3B0CT 3LELD 3UTBC 5BT1C 3AZHC 5CPJB 1S32C 2NQBC 4NE6A 4KUDA 5JRGC 2PYOA 3AFAB 1P34D 5G49A 5B31B 5F99D 5DNMB 3AZFC 5GT0A 3AZKA 3VH6W 3MGQB 4QLCB 4J8VB 1EQZB 3REID 1P3AD 4H9SA 2FJ7C 3B0BA 4UPKA 1AOID 3AZIB 5GT3D 4HGAC 1P3OB 1P3PD 5CPIA 3LJAB 1HQ3C 1HTAA 5BNVA 3WTPA 3V9RB 4Z66C 3AZLD 1P3GC 3W99C 5B2IA 4AWLB 3X1TD 5JA4B 4J8XA 2CV5D 3W97B 5B33C 3AZMD 2AROA 3AZGB 3NQJB 1BH9B 4NFTA 4H9NA 3X1TC 1ZLAC 4LD9A 3O62C 4E44A 1KX3A 1Z2CB 3KXBD 3KWQC 3AZND 3W96A 3AFAA 5B31A 1P3MA 3VH5A 4KUDD 5GXQC 5AV9B 2PYOD 4KGCD 1P3BA 2YFVB 3KUYA 4QLCA 5AVBB 4H9PB 1U35C 3X1SC 1P3IB 5B1LB 3AZKD 4Z5TB 3AV1B 3WKJC 2HIOA 3W98C 1KX4B 3B6GB 3AV2B 1P3LC 5CHLB 4H9QB 2BYKB 3AZHB 1S32B 5CPID 3FDDA 3B0CW 3WTPD 4XZQA 3R45B 1ULYA 5B2ID 3B0DC 3W97A 1ID3A 4ZBJC 3VH5W 3A1IA 2AROD 5CP6D 3EPJA 4HGAB 4YM6A 2F8NG 4Z2MG 3REKC 1M1AA 4EO5C 3AZEA 2F8NB 3A6NB 5CPJD 1P3GB 3W99B 2Y2KA 5CP6C 2XD5A 1JFIB 4G91C 5B32G 3W96D 2F8NK 2JSSA 3AFAD 2YFVA 3WAAA 5B31D 1BFMA 5AV6A 1P3IA 5B33B 5B1LA 5B32B 3MGQD 4QLCD 4Z5TA 3AV1A 4J8VD 1EQZD 1KX4A 3AN2A 3B6GA 3AV2A 2HIOD 3O62B 3UTBA 3AZID 3A1KA 3AZHA 5DNMC 2NQBA 3KWQB 3MGQC 5JRGA 2G5HC 5KDMB 3MNNC 3R45A 1P3KC 3AZFA 2RVQC 3AZIC 1P3OC 1U35B 3LJAC 3X1SB 3W97D 4G92B 1TAFA 4J8WB 3LZ1C 2FJ7A 3WKJB 3AZGD 3W98B 1F66B 5B24C 1HQ3A 4UUZB 3REJC 4Z66A 1P3GA 4H9OA 3W99A 3AZGC 5GT3A 4H9RA 3B0DB 5B33A 1A7WA 3WAAD 4ZBJB 2Y2OA 3TU4B 5AY8C 3AZLA 5AVBD 1P3ID 5B1LD 4WV4B 3X1TA 4Z5TD 5DNNB 3AV1D 1ZLAA 4CAYB 3O62A 2BG1A 4ZUXB 1KX4D 5AV9C 3AN2D 3B6GD 3LZ0C 3KWQA 3AV2D 4DQYB 3IP4C 4EO5B 3UTBD 3AZHD 5C3IC 1S32D 2NQBD 2W8SA 5JRGD 5GXQA 3NQUA 2IO5B 4WZSB 1U35A 3X1SA 3AZFD 1TZYB 1WWSA 3UT9C 5BNXA 4KGCA 1P3LA 2FJ7D 4YS3B 1HQ3D 3VH5T 3MNNB 3AZJC 3EPKA 4Z66D 1P3KB 1P3GD 3W99D 3EPHA 1P3FB 5B33D 3EG5B 3LZ1B 3MGSC 3A6NC 3WTPE 1R4VA 1N1JB 5B24B 4CSRB 3EPLA 3REJB 3REKA 3O62D 1ZLAD 4XUJB 3KWQD 2VQRA 5B32C 5CP6A 2NZDB 5AVCC 4WU9C 5GXQD 3MGPB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GSU B;  5AY8 B;  5CPJ A;  1U35 D;  3MVD C;  3X1S D;  3REH B;  3WKJ D;  3W98 D;  4WU8 C;  5DNM A;  3LZ0 B;  1P3L D;  3MGQ A;  1KX5 B;  1BH8 B;  3MGR B;  3MNN A;  2BYM B;  4J8V A;  5C3I B;  1EQZ A;  3B6F B;  4G92 C;  4J8W C;  1M19 C;  3AZI A;  1F66 C;  1P3O A;  3LJA A;  5BS7 C;  3LZ1 A;  3V9R A;  3UT9 B;  1H3O B;  5B24 A;  5JA4 A;  5B2J C;  3WA9 C;  5AV8 B;  5B40 B;  4X23 C;  3REK D;  3AZG A;  3NQJ A;  3TU4 C;  5B0Z B;  1BH9 A;  3AZJ B;  3X1U C;  5DNN C;  3AYW B;  4ZUX C;  5AY8 A;  1M18 B;  3MGS B;  3C1C B;  1TZY D;  5AV9 A;  4E45 A;  5GT0 C;  5E5A C;  2IO5 C;  4KHA B;  4R8P B;  5AVB A;  4H9P A;  4YS3 D;  5DNM D;  1TZY C;  3MNN D;  3LEL B;  5AVC B;  4WU9 B;  1P3K D;  4JJN B;  1F1E A;  4H9Q A;  2RVQ D;  2BYK A;  1P3O D;  3X1V C;  4YS3 C;  1S32 A;  3MVD B;  3LJA D;  1H3O A;  3LZ1 D;  4WU8 B;  4J8X C;  5B24 D;  3REJ D;  3AZJ A;  1P3F C;  1P3P B;  5CPK C;  1M19 B;  4LD9 C;  2YFW B;  3REL C;  1KX3 C;  3MGP D;  2F8N A;  4XUJ C;  3A6N A;  5AY8 D;  4J8U C;  2CV5 B;  1P3M C;  1JFI A;  1Q9C A;  5B2J B;  5B0Y C;  1P3B C;  2NZD C;  3WA9 B;  2CWE A;  5AV9 D;  3LZ0 D;  5B32 A;  3MGP C;  3C1B C;  4X23 B;  5GSU C;  1KX5 D;  3MGR D;  5AV5 C;  3B6F D;  3X1U B;  4WU9 A;  5B1M B;  4JJN A;  3KXB B;  3REH C;  3AZN B;  2F8N H;  4Z2M H;  1KX5 C;  3MGR C;  5KDM A;  4XZQ C;  3B6F C;  4WU8 A;  3UT9 D;  3KSY A;  5GT0 B;  1ID3 C;  5E5A B;  1WWI A;  4J8W A;  3WKJ A;  3W98 A;  3AZJ D;  1F66 A;  2YFW A;  4YM6 C;  2HUE C;  5BS7 A;  4UUZ A;  3VH6 A;  5BNV B;  3X1V B;  4WNN B;  3AZE C;  5AV8 C;  5B40 C;  5B2I B;  3MGS D;  5B2J A;  5B0Z C;  3A6N D;  2F8N D;  4NE5 A;  4J8X B;  3WA9 A;  5AV6 C;  3AYW C;  3TU4 A;  1M18 C;  5CPK B;  2LY8 A;  5B32 D;  3C1C C;  5DNN A;  4LD9 B;  4CAY A;  4ZUX A;  5BO0 B;  3REL B;  5AVC D;  5B31 G;  4WU9 D;  3UTA C;  4JJN D;  1KX3 B;  4R8P C;  3W96 B;  4J8U B;  3MVD D;  1P3M B;  5E5A A;  5B0Y B;  3LEL C;  3KUY B;  1P3B B;  4WU8 D;  1TZY A;  1P34 C;  5AV5 B;  2HIO B;  5F99 C;  4J8W D;  1M19 D;  1F66 D;  3X1V A;  4WNN A;  4YS3 A;  3REI C;  1P3A C;  1AOI C;  4XZQ B;  5GT3 C;  1P3K A;  1P3P C;  1ID3 B;  5B2J D;  3AZL C;  3WA9 D;  1P3F A;  5CPK A;  4X23 D;  3TU4 D;  2CV5 C;  4YM6 B;  5BO0 A;  1N1J A;  3X1U D;  2HUE B;  3REL A;  5B1M D;  4CSR A;  5DNN D;  3AZM C;  3REJ A;  1M1A B;  4ZUX D;  3AZE B;  4XUJ A;  4J8U A;  5B0Y A;  3WAA B;  2NZD A;  5B1M C;  5AV6 B;  3KXB C;  5GT0 D;  3MGP A;  3C1B A;  5E5A D;  3AZN C;  5GSU A;  5AV5 A;  4KUD C;  3AN2 B;  2PYO C;  4KGC C;  3REH A;  3UTB B;  3UTA B;  3LZ0 A;  2NQB B;  3AZK C;  1KX5 A;  5JRG B;  1BH8 A;  3MGR A;  2BYM A;  3X1V D;  3B6F A;  4H9S C;  3AZF B;  1B6W A;  4NE3 A;  4J8X D;  5CPI C;  3WTP C;  1TAF B;  1P34 B;  2FJ7 B;  3UT9 A;  5F99 B;  1P3F D;  5CPK D;  5B2I C;  4JJN C;  1KU5 A;  1HQ3 B;  4LD9 D;  3REI B;  3REL D;  4Z66 B;  5AV8 A;  5B40 A;  1KX3 D;  4H9O B;  1P3A B;  2ARO C;  1AOI B;  5FUG B;  5B0Z A;  4XUJ D;  5GT3 B;  4J8U D;  4H9R B;  1P3M D;  3AYW A;  5B0Y D;  1P3B D;  3KUY D;  2NZD D;  3AZL B;  5CPJ C;  1M18 A;  3C1B D;  3MGS A;  3C1C A;  3W96 C;  5GSU D;  3X1T B;  3AFA C;  1ZLA B;  5AV5 D;  5B31 C;  3VH6 T;  4M6B A;  3UTA A;  3REH D;  3AZM B;  3KUY C;  4QLC C;  4KHA A;  4R8P A;  4J8V C;  1EQZ C;  2L5A A;  5GXQ B;  2HIO C;  4XZQ D;  3LEL A;  3NQU B;  5AVC A;  1ID3 D;  1P34 A;  3MVD A;  4DRB A;  3C1B B;  4KUD B;  4DRA A;  5F99 A;  2PYO B;  5BNX B;  4AWL C;  4KGC B;  1P3L B;  5G49 B;  4YM6 D;  3REI A;  3W97 C;  3AZK B;  1P3A A;  1AOI A;  1M1A D;  5FUG A;  3AZE D;  5AV8 D;  5B40 D;  1P3P A;  1M19 A;  5B0Z D;  5CPI B;  1B67 A;  5AV6 D;  3AYW D;  3WTP B;  1M1A C;  2CV5 A;  1M18 D;  3C1C D;  3WAA C;  3AZM A;  3REK B;  5BT1 D;  5AVB C;  1P3I C;  3UTA D;  5B1L C;  2ARO B;  4X23 A;  5CP6 B;  4Z5T C;  4G91 B;  4R8P D;  3AV1 C;  4H9N B;  3X1U A;  1KX4 C;  5B1M A;  3AN2 C;  3B6G C;  3KXB A;  3AV2 C;  3AZN A;  3B0C T;  3LEL D;  3UTB C;  5BT1 C;  3AZH C;  5CPJ B;  1S32 C;  2NQB C;  4NE6 A;  4KUD A;  5JRG C;  2PYO A;  3AFA B;  1P34 D;  5G49 A;  5B31 B;  5F99 D;  5DNM B;  3AZF C;  5GT0 A;  3AZK A;  3VH6 W;  3MGQ B;  4QLC B;  4J8V B;  1EQZ B;  3REI D;  1P3A D;  4H9S A;  2FJ7 C;  3B0B A;  1AOI D;  3AZI B;  5GT3 D;  4HGA C;  1P3O B;  1P3P D;  5CPI A;  3LJA B;  1HQ3 C;  1HTA A;  5BNV A;  3WTP A;  3V9R B;  4Z66 C;  3AZL D;  1P3G C;  3W99 C;  5B2I A;  4AWL B;  3X1T D;  5JA4 B;  4J8X A;  2CV5 D;  3W97 B;  5B33 C;  3AZM D;  2ARO A;  3AZG B;  3NQJ B;  1BH9 B;  4NFT A;  4H9N A;  3X1T C;  1ZLA C;  4LD9 A;  3O62 C;  4E44 A;  1KX3 A;  3KWQ C;  3KXB D;  3AZN D;  3W96 A;  3AFA A;  5B31 A;  1P3M A;  3VH5 A;  4KUD D;  5GXQ C;  5AV9 B;  2PYO D;  4KGC D;  1P3B A;  2YFV B;  3KUY A;  4QLC A;  5AVB B;  4H9P B;  1U35 C;  3X1S C;  1P3I B;  5B1L B;  3AZK D;  4Z5T B;  3AV1 B;  3WKJ C;  2HIO A;  3W98 C;  1KX4 B;  3B6G B;  3AV2 B;  1P3L C;  5CHL B;  4H9Q B;  2BYK B;  3AZH B;  1S32 B;  5CPI D;  3B0C W;  3WTP D;  4XZQ A;  3R45 B;  1ULY A;  5B2I D;  3B0D C;  3W97 A;  1ID3 A;  4ZBJ C;  3VH5 W;  2ARO D;  5CP6 D;  4HGA B;  4YM6 A;  2F8N G;  4Z2M G;  3REK C;  1M1A A;  4EO5 C;  3AZE A;  2F8N B;  3A6N B;  5CPJ D;  1P3G B;  3W99 B;  5CP6 C;  1JFI B;  4G91 C;  5B32 G;  3W96 D;  2F8N K;  2JSS A;  3AFA D;  2YFV A;  3WAA A;  5B31 D;  1BFM A;  5AV6 A;  1P3I A;  5B33 B;  5B1L A;  5B32 B;  3MGQ D;  4QLC D;  4Z5T A;  3AV1 A;  4J8V D;  1EQZ D;  1KX4 A;  3AN2 A;  3B6G A;  3AV2 A;  2HIO D;  3O62 B;  3UTB A;  3AZI D;  3AZH A;  5DNM C;  2NQB A;  3KWQ B;  3MGQ C;  5JRG A;  5KDM B;  3MNN C;  3R45 A;  1P3K C;  3AZF A;  2RVQ C;  3AZI C;  1P3O C;  1U35 B;  3LJA C;  3X1S B;  3W97 D;  4G92 B;  1TAF A;  4J8W B;  3LZ1 C;  2FJ7 A;  3WKJ B;  3AZG D;  3W98 B;  1F66 B;  5B24 C;  1HQ3 A;  4UUZ B;  3REJ C;  4Z66 A;  1P3G A;  4H9O A;  3W99 A;  3AZG C;  5GT3 A;  4H9R A;  3B0D B;  5B33 A;  1A7W A;  3WAA D;  4ZBJ B;  3TU4 B;  5AY8 C;  3AZL A;  5AVB D;  1P3I D;  5B1L D;  4WV4 B;  3X1T A;  4Z5T D;  5DNN B;  3AV1 D;  1ZLA A;  4CAY B;  3O62 A;  4ZUX B;  1KX4 D;  5AV9 C;  3AN2 D;  3B6G D;  3LZ0 C;  3KWQ A;  3AV2 D;  3UTB D;  4EO5 B;  3AZH D;  5C3I C;  1S32 D;  2NQB D;  5JRG D;  5GXQ A;  3NQU A;  2IO5 B;  4WZS B;  1U35 A;  3X1S A;  3AZF D;  1TZY B;  1WWS A;  3UT9 C;  5BNX A;  4KGC A;  1P3L A;  2FJ7 D;  4YS3 B;  1HQ3 D;  3VH5 T;  3MNN B;  3AZJ C;  4Z66 D;  1P3K B;  1P3G D;  3W99 D;  1P3F B;  5B33 D;  3MGS C;  3LZ1 B;  3A6N C;  3WTP E;  1R4V A;  1N1J B;  5B24 B;  4CSR B;  1ZLA D;  3REJ B;  3REK A;  3O62 D;  4XUJ B;  3KWQ D;  5B32 C;  5CP6 A;  2NZD B;  5AVC C;  4WU9 C;  5GXQ D;  3MGP B; 
#chains in the Genus database with same CATH topology
 5GSU B;  5AY8 B;  5CPJ A;  1U35 D;  3MVD C;  3X1S D;  3REH B;  3WKJ D;  3W98 D;  4WU8 C;  2DQN C;  5DNM A;  3LZ0 B;  1P3L D;  3MGQ A;  1KX5 B;  1BH8 B;  3MGR B;  3MNN A;  2BYM B;  4J8V A;  5C3I B;  1EQZ A;  3B6F B;  4G92 C;  4J8W C;  1M19 C;  3AZI A;  1F66 C;  1P3O A;  2JCH A;  3LJA A;  5BS7 C;  3LZ1 A;  3V9R A;  2ZY4 A;  3UT9 B;  1H3O B;  5B24 A;  5JA4 A;  5B2J C;  3WA9 C;  5AV8 B;  5B40 B;  4X23 C;  3REK D;  3AZG A;  3NQJ A;  3TU4 C;  5B0Z B;  1BH9 A;  3AZJ B;  3X1U C;  5DNN C;  3AYW B;  4ZUX C;  2Y2L A;  5AY8 A;  1M18 B;  3MGS B;  3C1C B;  1TZY D;  5AV9 A;  4E45 A;  5GT0 C;  5E5A C;  2IO5 C;  4KHA B;  4R8P B;  5AVB A;  4H9P A;  4YS3 D;  5DNM D;  1TZY C;  2UWX A;  3MNN D;  3LEL B;  5AVC B;  4WU9 B;  1P3K D;  4JJN B;  1F1E A;  2RVQ D;  2BYK A;  4H9Q A;  1P3O D;  3X1V C;  4YS3 C;  1S32 A;  3MVD B;  3LJA D;  1H3O A;  3LZ1 D;  3P5J B;  2XD1 A;  4WU8 B;  4J8X C;  5B24 D;  3REJ D;  2ZY2 A;  3AZJ A;  1P3F C;  1P3P B;  5CPK C;  1M19 B;  4LD9 C;  2YFW B;  3REL C;  1KX3 C;  3MGP D;  2F8N A;  4XUJ C;  3A6N A;  5AY8 D;  4J8U C;  2CV5 B;  1P3M C;  1JFI A;  1Q9C A;  5B2J B;  5B0Y C;  1P3B C;  2NZD C;  3WA9 B;  2CWE A;  5AV9 D;  3LZ0 D;  5B32 A;  3MGP C;  3C1B C;  4X23 B;  5GSU C;  1KX5 D;  2G5I C;  5AV5 C;  3MGR D;  3B6F D;  3X1U B;  4WU9 A;  5B1M B;  2Y2J A;  4JJN A;  3KXB B;  3REH C;  3AZN B;  2F8N H;  2Y2N A;  4Z2M H;  3AL0 C;  1KX5 C;  3MGR C;  5KDM A;  4XZQ C;  3B6F C;  4WU8 A;  3UT9 D;  3KSY A;  5GT0 B;  1ID3 C;  5E5A B;  1WWI A;  4J8W A;  3WKJ A;  3W98 A;  3AZJ D;  1F66 A;  2YFW A;  4YM6 C;  2HUE C;  5BS7 A;  4UUZ A;  3VH6 A;  5BNV B;  3X1V B;  4WNN B;  3AZE C;  2ZM5 A;  5AV8 C;  5B40 C;  5B2I B;  4WJ3 C;  3MGS D;  5B2J A;  5B0Z C;  3A6N D;  2F8N D;  4NE5 A;  4J8X B;  3WA9 A;  5AV6 C;  3AYW C;  3TU4 A;  1M18 C;  5CPK B;  2LY8 A;  2RIQ A;  5B32 D;  3C1C C;  5DNN A;  4LD9 B;  4CAY A;  4ZUX A;  5BO0 B;  3REL B;  5AVC D;  5B31 G;  4WU9 D;  3UTA C;  4JJN D;  1KX3 B;  4R8P C;  3W96 B;  4J8U B;  3MVD D;  1P3M B;  2DF4 C;  5E5A A;  5B0Y B;  3LEL C;  3KUY B;  1P3B B;  4WU8 D;  1TZY A;  1P34 C;  5AV5 B;  2HIO B;  5F99 C;  4J8W D;  1M19 D;  1F66 D;  3X1V A;  4WNN A;  4YS3 A;  3REI C;  3KFU G;  1P3A C;  1AOI C;  2JE5 A;  1W2E A;  4XZQ B;  5GT3 C;  2FFF B;  1P3K A;  1P3P C;  1ID3 B;  5B2J D;  3AZL C;  3WA9 D;  1P3F A;  5CPK A;  4X23 D;  3TU4 D;  2CV5 C;  4YM6 B;  5BO0 A;  1N1J A;  3X1U D;  2HUE B;  3REL A;  5B1M D;  4CSR A;  5DNN D;  3AZM C;  3REJ A;  1M1A B;  4ZUX D;  3AZE B;  4XUJ A;  4J8U A;  5B0Y A;  3WAA B;  2NZD A;  5B1M C;  5AV6 B;  2ZY5 A;  3KXB C;  3H0L C;  5GT0 D;  3MGP A;  3C1B A;  5E5A D;  3AZN C;  5GSU A;  3H0R C;  5AV5 A;  4KUD C;  3AN2 B;  2PYO C;  4KGC C;  3REH A;  3UTB B;  3UTA B;  3LZ0 A;  2NQB B;  3AZK C;  1KX5 A;  5JRG B;  1BH8 A;  2ZY3 A;  3MGR A;  2Y2I A;  2BYM A;  3X1V D;  3B6F A;  4H9S C;  3AZF B;  1B6W A;  3H0M C;  2F2A C;  4NE3 A;  4J8X D;  5CPI C;  3WTP C;  1TAF B;  1P34 B;  2FJ7 B;  3UT9 A;  5F99 B;  1P3F D;  5CPK D;  5B2I C;  4JJN C;  1PZR A;  2J8P A;  1KU5 A;  1HQ3 B;  4LD9 D;  3REI B;  3REL D;  4Z66 B;  5AV8 A;  5B40 A;  1KX3 D;  4H9O B;  1P3A B;  2ARO C;  1AOI B;  5FUG B;  5B0Z A;  4XUJ D;  5GT3 B;  4J8U D;  2Y2Q A;  4H9R B;  1P3M D;  3AYW A;  5B0Y D;  1P3B D;  3KUY D;  2NZD D;  3AZL B;  5CPJ C;  1M18 A;  3C1B D;  3MGS A;  2Y2M A;  3C1C A;  1T3U A;  3W96 C;  5GSU D;  3X1T B;  3AFA C;  1ZLA B;  5AV5 D;  5B31 C;  3VH6 T;  4M6B A;  3UTA A;  3REH D;  3AZM B;  3KUY C;  4QLC C;  4KHA A;  4R8P A;  4J8V C;  1EQZ C;  3F6T A;  2L5A A;  5GXQ B;  2HIO C;  4XZQ D;  3LEL A;  3NQU B;  5AVC A;  1ID3 D;  1P34 A;  3MVD A;  4DRB A;  3C1B B;  4KUD B;  4DRA A;  5F99 A;  2PYO B;  5BNX B;  4AWL C;  4KGC B;  1P3L B;  5G49 B;  4YM6 D;  3REI A;  3W97 C;  3AZK B;  1P3A A;  1AOI A;  1M1A D;  5FUG A;  3AZE D;  2Y2H A;  5B40 D;  5AV8 D;  1P3P A;  1M19 A;  5B0Z D;  5CPI B;  1B67 A;  5AV6 D;  3AYW D;  3WTP B;  1M1A C;  2Y2G A;  2Y2P A;  2CV5 A;  1M18 D;  3C1C D;  3WAA C;  3AZM A;  3REK B;  5BT1 D;  5AVB C;  1P3I C;  3UTA D;  5B1L C;  2ARO B;  4X23 A;  5CP6 B;  4Z5T C;  4G91 B;  4R8P D;  3AV1 C;  4H9N B;  3X1U A;  1KX4 C;  5B1M A;  3AN2 C;  3B6G C;  3KXB A;  3AV2 C;  3AZN A;  3B0C T;  3LEL D;  3UTB C;  5BT1 C;  3AZH C;  5CPJ B;  1S32 C;  2NQB C;  4NE6 A;  4KUD A;  5JRG C;  2PYO A;  3AFA B;  1P34 D;  5G49 A;  5B31 B;  5F99 D;  5DNM B;  3AZF C;  5GT0 A;  3AZK A;  3VH6 W;  3MGQ B;  4QLC B;  4J8V B;  1EQZ B;  3REI D;  1P3A D;  4H9S A;  2FJ7 C;  3B0B A;  4UPK A;  1AOI D;  3AZI B;  5GT3 D;  4HGA C;  1P3O B;  1P3P D;  5CPI A;  3LJA B;  1HQ3 C;  1HTA A;  5BNV A;  3WTP A;  3V9R B;  4Z66 C;  3AZL D;  1P3G C;  3W99 C;  5B2I A;  4AWL B;  3X1T D;  5JA4 B;  4J8X A;  2CV5 D;  3W97 B;  5B33 C;  3AZM D;  2ARO A;  3AZG B;  3NQJ B;  1BH9 B;  4NFT A;  4H9N A;  3X1T C;  1ZLA C;  4LD9 A;  3O62 C;  4E44 A;  1KX3 A;  1Z2C B;  3KXB D;  3KWQ C;  3AZN D;  3W96 A;  3AFA A;  5B31 A;  1P3M A;  3VH5 A;  4KUD D;  5GXQ C;  5AV9 B;  2PYO D;  4KGC D;  1P3B A;  2YFV B;  3KUY A;  4QLC A;  5AVB B;  4H9P B;  1U35 C;  3X1S C;  1P3I B;  5B1L B;  3AZK D;  4Z5T B;  3AV1 B;  3WKJ C;  2HIO A;  3W98 C;  1KX4 B;  3B6G B;  3AV2 B;  1P3L C;  5CHL B;  4H9Q B;  2BYK B;  3AZH B;  1S32 B;  5CPI D;  3FDD A;  3B0C W;  3WTP D;  4XZQ A;  3R45 B;  1ULY A;  5B2I D;  3B0D C;  3W97 A;  1ID3 A;  4ZBJ C;  3VH5 W;  3A1I A;  2ARO D;  5CP6 D;  3EPJ A;  4HGA B;  4YM6 A;  2F8N G;  4Z2M G;  3REK C;  1M1A A;  4EO5 C;  3AZE A;  2F8N B;  3A6N B;  5CPJ D;  1P3G B;  3W99 B;  2Y2K A;  5CP6 C;  2XD5 A;  1JFI B;  4G91 C;  5B32 G;  3W96 D;  2F8N K;  2JSS A;  3AFA D;  2YFV A;  3WAA A;  5B31 D;  1BFM A;  5AV6 A;  1P3I A;  5B33 B;  5B1L A;  5B32 B;  3MGQ D;  4QLC D;  4Z5T A;  3AV1 A;  4J8V D;  1EQZ D;  1KX4 A;  3AN2 A;  3B6G A;  3AV2 A;  2HIO D;  3O62 B;  3UTB A;  3AZI D;  3A1K A;  3AZH A;  5DNM C;  2NQB A;  3KWQ B;  3MGQ C;  5JRG A;  2G5H C;  5KDM B;  3MNN C;  3R45 A;  1P3K C;  3AZF A;  2RVQ C;  3AZI C;  1P3O C;  1U35 B;  3LJA C;  3X1S B;  3W97 D;  4G92 B;  1TAF A;  4J8W B;  3LZ1 C;  2FJ7 A;  3WKJ B;  3AZG D;  3W98 B;  1F66 B;  5B24 C;  1HQ3 A;  4UUZ B;  3REJ C;  4Z66 A;  1P3G A;  4H9O A;  3W99 A;  3AZG C;  5GT3 A;  4H9R A;  3B0D B;  5B33 A;  1A7W A;  3WAA D;  4ZBJ B;  2Y2O A;  3TU4 B;  5AY8 C;  3AZL A;  5AVB D;  1P3I D;  5B1L D;  4WV4 B;  3X1T A;  4Z5T D;  5DNN B;  3AV1 D;  1ZLA A;  4CAY B;  3O62 A;  2BG1 A;  4ZUX B;  1KX4 D;  5AV9 C;  3AN2 D;  3B6G D;  3LZ0 C;  3KWQ A;  3AV2 D;  4DQY B;  3IP4 C;  4EO5 B;  3UTB D;  3AZH D;  5C3I C;  1S32 D;  2NQB D;  2W8S A;  5JRG D;  5GXQ A;  3NQU A;  2IO5 B;  4WZS B;  1U35 A;  3X1S A;  3AZF D;  1TZY B;  1WWS A;  3UT9 C;  5BNX A;  4KGC A;  1P3L A;  2FJ7 D;  4YS3 B;  1HQ3 D;  3VH5 T;  3MNN B;  3AZJ C;  3EPK A;  4Z66 D;  1P3K B;  1P3G D;  3W99 D;  3EPH A;  1P3F B;  5B33 D;  3EG5 B;  3LZ1 B;  3MGS C;  3A6N C;  3WTP E;  1R4V A;  1N1J B;  5B24 B;  4CSR B;  3EPL A;  3REJ B;  3REK A;  3O62 D;  1ZLA D;  4XUJ B;  3KWQ D;  2VQR A;  5B32 C;  5CP6 A;  2NZD B;  5AVC C;  4WU9 C;  5GXQ D;  3MGP B; 
#chains in the Genus database with same CATH homology
 5GSU B;  5AY8 B;  5CPJ A;  1U35 D;  3MVD C;  3X1S D;  3REH B;  3WKJ D;  3W98 D;  4WU8 C;  2DQN C;  5DNM A;  3LZ0 B;  1P3L D;  3MGQ A;  1KX5 B;  1BH8 B;  3MGR B;  3MNN A;  2BYM B;  4J8V A;  5C3I B;  1EQZ A;  3B6F B;  4G92 C;  4J8W C;  1M19 C;  3AZI A;  1F66 C;  1P3O A;  2JCH A;  3LJA A;  5BS7 C;  3LZ1 A;  3V9R A;  2ZY4 A;  3UT9 B;  1H3O B;  5B24 A;  5JA4 A;  5B2J C;  3WA9 C;  5AV8 B;  5B40 B;  4X23 C;  3REK D;  3AZG A;  3NQJ A;  3TU4 C;  5B0Z B;  1BH9 A;  3AZJ B;  3X1U C;  5DNN C;  3AYW B;  4ZUX C;  2Y2L A;  5AY8 A;  1M18 B;  3MGS B;  3C1C B;  1TZY D;  5AV9 A;  4E45 A;  5GT0 C;  5E5A C;  2IO5 C;  4KHA B;  4R8P B;  5AVB A;  4H9P A;  4YS3 D;  5DNM D;  1TZY C;  2UWX A;  3MNN D;  3LEL B;  5AVC B;  4WU9 B;  1P3K D;  4JJN B;  1F1E A;  2RVQ D;  2BYK A;  4H9Q A;  1P3O D;  3X1V C;  4YS3 C;  1S32 A;  3MVD B;  3LJA D;  1H3O A;  3LZ1 D;  3P5J B;  2XD1 A;  4WU8 B;  4J8X C;  5B24 D;  3REJ D;  2ZY2 A;  3AZJ A;  1P3F C;  1P3P B;  5CPK C;  1M19 B;  4LD9 C;  2YFW B;  3REL C;  1KX3 C;  3MGP D;  2F8N A;  4XUJ C;  3A6N A;  5AY8 D;  4J8U C;  2CV5 B;  1P3M C;  1JFI A;  1Q9C A;  5B2J B;  5B0Y C;  1P3B C;  2NZD C;  3WA9 B;  2CWE A;  5AV9 D;  3LZ0 D;  5B32 A;  3MGP C;  3C1B C;  4X23 B;  5GSU C;  1KX5 D;  2G5I C;  5AV5 C;  3MGR D;  3B6F D;  3X1U B;  4WU9 A;  5B1M B;  2Y2J A;  4JJN A;  3KXB B;  3REH C;  3AZN B;  2F8N H;  2Y2N A;  4Z2M H;  3AL0 C;  1KX5 C;  3MGR C;  5KDM A;  4XZQ C;  3B6F C;  4WU8 A;  3UT9 D;  3KSY A;  5GT0 B;  1ID3 C;  5E5A B;  1WWI A;  4J8W A;  3WKJ A;  3W98 A;  3AZJ D;  1F66 A;  2YFW A;  4YM6 C;  2HUE C;  5BS7 A;  4UUZ A;  3VH6 A;  5BNV B;  3X1V B;  4WNN B;  3AZE C;  2ZM5 A;  5AV8 C;  5B40 C;  5B2I B;  4WJ3 C;  3MGS D;  5B2J A;  5B0Z C;  3A6N D;  2F8N D;  4NE5 A;  4J8X B;  3WA9 A;  5AV6 C;  3AYW C;  3TU4 A;  1M18 C;  5CPK B;  2LY8 A;  2RIQ A;  5B32 D;  3C1C C;  5DNN A;  4LD9 B;  4CAY A;  4ZUX A;  5BO0 B;  3REL B;  5AVC D;  5B31 G;  4WU9 D;  3UTA C;  4JJN D;  1KX3 B;  4R8P C;  3W96 B;  4J8U B;  3MVD D;  1P3M B;  2DF4 C;  5E5A A;  5B0Y B;  3LEL C;  3KUY B;  1P3B B;  4WU8 D;  1TZY A;  1P34 C;  5AV5 B;  2HIO B;  5F99 C;  4J8W D;  1M19 D;  1F66 D;  3X1V A;  4WNN A;  4YS3 A;  3REI C;  3KFU G;  1P3A C;  1AOI C;  2JE5 A;  1W2E A;  4XZQ B;  5GT3 C;  2FFF B;  1P3K A;  1P3P C;  1ID3 B;  5B2J D;  3AZL C;  3WA9 D;  1P3F A;  5CPK A;  4X23 D;  3TU4 D;  2CV5 C;  4YM6 B;  5BO0 A;  1N1J A;  3X1U D;  2HUE B;  3REL A;  5B1M D;  4CSR A;  5DNN D;  3AZM C;  3REJ A;  1M1A B;  4ZUX D;  3AZE B;  4XUJ A;  4J8U A;  5B0Y A;  3WAA B;  2NZD A;  5B1M C;  5AV6 B;  2ZY5 A;  3KXB C;  3H0L C;  5GT0 D;  3MGP A;  3C1B A;  5E5A D;  3AZN C;  5GSU A;  3H0R C;  5AV5 A;  4KUD C;  3AN2 B;  2PYO C;  4KGC C;  3REH A;  3UTB B;  3UTA B;  3LZ0 A;  2NQB B;  3AZK C;  1KX5 A;  5JRG B;  1BH8 A;  2ZY3 A;  3MGR A;  2Y2I A;  2BYM A;  3X1V D;  3B6F A;  4H9S C;  3AZF B;  1B6W A;  3H0M C;  2F2A C;  4NE3 A;  4J8X D;  5CPI C;  3WTP C;  1TAF B;  1P34 B;  2FJ7 B;  3UT9 A;  5F99 B;  1P3F D;  5CPK D;  5B2I C;  4JJN C;  1PZR A;  2J8P A;  1KU5 A;  1HQ3 B;  4LD9 D;  3REI B;  3REL D;  4Z66 B;  5AV8 A;  5B40 A;  1KX3 D;  4H9O B;  1P3A B;  2ARO C;  1AOI B;  5FUG B;  5B0Z A;  4XUJ D;  5GT3 B;  4J8U D;  2Y2Q A;  4H9R B;  1P3M D;  3AYW A;  5B0Y D;  1P3B D;  3KUY D;  2NZD D;  3AZL B;  5CPJ C;  1M18 A;  3C1B D;  3MGS A;  2Y2M A;  3C1C A;  1T3U A;  3W96 C;  5GSU D;  3X1T B;  3AFA C;  1ZLA B;  5AV5 D;  5B31 C;  3VH6 T;  4M6B A;  3UTA A;  3REH D;  3AZM B;  3KUY C;  4QLC C;  4KHA A;  4R8P A;  4J8V C;  1EQZ C;  3F6T A;  2L5A A;  5GXQ B;  2HIO C;  4XZQ D;  3LEL A;  3NQU B;  5AVC A;  1ID3 D;  1P34 A;  3MVD A;  4DRB A;  3C1B B;  4KUD B;  4DRA A;  5F99 A;  2PYO B;  5BNX B;  4AWL C;  4KGC B;  1P3L B;  5G49 B;  4YM6 D;  3REI A;  3W97 C;  3AZK B;  1P3A A;  1AOI A;  1M1A D;  5FUG A;  3AZE D;  2Y2H A;  5B40 D;  5AV8 D;  1P3P A;  1M19 A;  5B0Z D;  5CPI B;  1B67 A;  5AV6 D;  3AYW D;  3WTP B;  1M1A C;  2Y2G A;  2Y2P A;  2CV5 A;  1M18 D;  3C1C D;  3WAA C;  3AZM A;  3REK B;  5BT1 D;  5AVB C;  1P3I C;  3UTA D;  5B1L C;  2ARO B;  4X23 A;  5CP6 B;  4Z5T C;  4G91 B;  4R8P D;  3AV1 C;  4H9N B;  3X1U A;  1KX4 C;  5B1M A;  3AN2 C;  3B6G C;  3KXB A;  3AV2 C;  3AZN A;  3B0C T;  3LEL D;  3UTB C;  5BT1 C;  3AZH C;  5CPJ B;  1S32 C;  2NQB C;  4NE6 A;  4KUD A;  5JRG C;  2PYO A;  3AFA B;  1P34 D;  5G49 A;  5B31 B;  5F99 D;  5DNM B;  3AZF C;  5GT0 A;  3AZK A;  3VH6 W;  3MGQ B;  4QLC B;  4J8V B;  1EQZ B;  3REI D;  1P3A D;  4H9S A;  2FJ7 C;  3B0B A;  4UPK A;  1AOI D;  3AZI B;  5GT3 D;  4HGA C;  1P3O B;  1P3P D;  5CPI A;  3LJA B;  1HQ3 C;  1HTA A;  5BNV A;  3WTP A;  3V9R B;  4Z66 C;  3AZL D;  1P3G C;  3W99 C;  5B2I A;  4AWL B;  3X1T D;  5JA4 B;  4J8X A;  2CV5 D;  3W97 B;  5B33 C;  3AZM D;  2ARO A;  3AZG B;  3NQJ B;  1BH9 B;  4NFT A;  4H9N A;  3X1T C;  1ZLA C;  4LD9 A;  3O62 C;  4E44 A;  1KX3 A;  1Z2C B;  3KXB D;  3KWQ C;  3AZN D;  3W96 A;  3AFA A;  5B31 A;  1P3M A;  3VH5 A;  4KUD D;  5GXQ C;  5AV9 B;  2PYO D;  4KGC D;  1P3B A;  2YFV B;  3KUY A;  4QLC A;  5AVB B;  4H9P B;  1U35 C;  3X1S C;  1P3I B;  5B1L B;  3AZK D;  4Z5T B;  3AV1 B;  3WKJ C;  2HIO A;  3W98 C;  1KX4 B;  3B6G B;  3AV2 B;  1P3L C;  5CHL B;  4H9Q B;  2BYK B;  3AZH B;  1S32 B;  5CPI D;  3FDD A;  3B0C W;  3WTP D;  4XZQ A;  3R45 B;  1ULY A;  5B2I D;  3B0D C;  3W97 A;  1ID3 A;  4ZBJ C;  3VH5 W;  3A1I A;  2ARO D;  5CP6 D;  3EPJ A;  4HGA B;  4YM6 A;  2F8N G;  4Z2M G;  3REK C;  1M1A A;  4EO5 C;  3AZE A;  2F8N B;  3A6N B;  5CPJ D;  1P3G B;  3W99 B;  2Y2K A;  5CP6 C;  2XD5 A;  1JFI B;  4G91 C;  5B32 G;  3W96 D;  2F8N K;  2JSS A;  3AFA D;  2YFV A;  3WAA A;  5B31 D;  1BFM A;  5AV6 A;  1P3I A;  5B33 B;  5B1L A;  5B32 B;  3MGQ D;  4QLC D;  4Z5T A;  3AV1 A;  4J8V D;  1EQZ D;  1KX4 A;  3AN2 A;  3B6G A;  3AV2 A;  2HIO D;  3O62 B;  3UTB A;  3AZI D;  3A1K A;  3AZH A;  5DNM C;  2NQB A;  3KWQ B;  3MGQ C;  5JRG A;  2G5H C;  5KDM B;  3MNN C;  3R45 A;  1P3K C;  3AZF A;  2RVQ C;  3AZI C;  1P3O C;  1U35 B;  3LJA C;  3X1S B;  3W97 D;  4G92 B;  1TAF A;  4J8W B;  3LZ1 C;  2FJ7 A;  3WKJ B;  3AZG D;  3W98 B;  1F66 B;  5B24 C;  1HQ3 A;  4UUZ B;  3REJ C;  4Z66 A;  1P3G A;  4H9O A;  3W99 A;  3AZG C;  5GT3 A;  4H9R A;  3B0D B;  5B33 A;  1A7W A;  3WAA D;  4ZBJ B;  2Y2O A;  3TU4 B;  5AY8 C;  3AZL A;  5AVB D;  1P3I D;  5B1L D;  4WV4 B;  3X1T A;  4Z5T D;  5DNN B;  3AV1 D;  1ZLA A;  4CAY B;  3O62 A;  2BG1 A;  4ZUX B;  1KX4 D;  5AV9 C;  3AN2 D;  3B6G D;  3LZ0 C;  3KWQ A;  3AV2 D;  4DQY B;  3IP4 C;  4EO5 B;  3UTB D;  3AZH D;  5C3I C;  1S32 D;  2NQB D;  2W8S A;  5JRG D;  5GXQ A;  3NQU A;  2IO5 B;  4WZS B;  1U35 A;  3X1S A;  3AZF D;  1TZY B;  1WWS A;  3UT9 C;  5BNX A;  4KGC A;  1P3L A;  2FJ7 D;  4YS3 B;  1HQ3 D;  3VH5 T;  3MNN B;  3AZJ C;  3EPK A;  4Z66 D;  1P3K B;  1P3G D;  3W99 D;  3EPH A;  1P3F B;  5B33 D;  3EG5 B;  3LZ1 B;  3MGS C;  3A6N C;  3WTP E;  1R4V A;  1N1J B;  5B24 B;  4CSR B;  3EPL A;  3REJ B;  3REK A;  3O62 D;  1ZLA D;  4XUJ B;  3KWQ D;  2VQR A;  5B32 C;  5CP6 A;  2NZD B;  5AVC C;  4WU9 C;  5GXQ D;  3MGP B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...