4J8VC

X-ray structure of ncp145 with bound chlorido(eta-6-p-cymene)(n-phenyl-2-pyridinecarbothioamide)ruthenium(ii)
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
106
structure length
106
Chain Sequence
b'AKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPKK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.2
publication title Novel metal(II) arene 2-pyridinecarbothioamides: a rationale to orally active organometallic anticancer agents
doi rcsb
source organism Xenopus laevis
molecule tags Structural protein/dna
total genus 33
structure length 106
sequence length 106
chains with identical sequence G
ec nomenclature
pdb deposition date 2013-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4j8vC00
2CV5C 4NE5A 5F99B 4H9RA 3LZ0B 3W96C 3MGRA 1F66A 4R8PC 3AZKA 1KX5A 3WKJC 4J8WB 4YM6D 4WU8D 5B24D 3REJB 3X1VC 5B40A 1P3PD 1KX4B 3A6NB 3MGPB 4Z66D 3W97D 5DNMA 5B1LA 3C1BB 4E44A 3X1UC 1JFIB 3LJAD 2BYKA 1P3GB 5JRGD 3AZED 3AZJC 5DNND 3AV1D 5B0YC 1M1AA 4WU8A 4YM6A 1P3KC 5B24A 5CPKB 4EO5B 5E5AC 3AZHC 3AZLB 2HIOD 4Z66A 4QLCC 1P3OD 3AZFB 4KHAA 2PYOD 3AZGA 3B6GC 3WA9A 5C3IB 3KSYA 5G49A 5F99C 5JRGA 3KUYD 1P3LA 3AV1A 5CP6A 4YM6B 4NE3A 1P3PB 1U35C 3X1SC 3REKC 2HIOA 4J8XA 2NZDA 3AV2D 1A7WA 3UTBD 3W97B 3VH5T 1P3OA 2FJ7C 2PYOA 2IO5C 4H9QA 5BO0B 2CV5D 3REJC 3LJAB 3W96D 1KX4C 3KUYA 3A6NC 3AZEB 4WU9C 4HGAB 5DNNB 3AV1B 1AOIB 1N1JA 3B0DB 3C1BC 4R8PD 4UUZB 3AV2A 3UTBA 1P3OB 3WKJD 4H9PB 3B6FC 5GT0C 1ID3C 2CV5A 2PYOB 3LELA 3X1VD 2NQBB 4EO5C 5B32A 3AZMC 3B0BA 3AZLC 3KUYB 1B67A 2L5AA 1P3AC 3X1UD 3AZFC 5C3IC 3AZJD 3AFAC 3UTBB 1S32B 5B0YD 3WKJA 4J8VA 1P3KD 3TU4C 4KGCC 2CV5B 3X1VA 5E5AD 5CPIB 3AZHD 2F8NB 3W96B 3MNNA 4QLCD 1P3IC 3B6GD 3V9RA 4R8PB 4LD9B 3AZNB 5F99D 4X23B 3AZJA 3WKJB 4HGAC 1P3KA 2YFVA 1H3OB 5B2IA 1AOIC 5E5AA 3REIC 3X1VB 5BNVA 3X1SD 3MGQA 1U35D 3REKD 1KX3C 4E45A 1B6WA 1BFMA 4CAYA 3NQUB 2FJ7D 3X1UB 3B6GA 1TAFA 2NQBC 3REJD 5B31B 1KX4D 5F99A 3LZ0A 3A6ND 4WU9D 1P3FD 3MVDC 5B32G 5B0YB 3VH6T 3O62B 1P3KB 2YFVB 3C1BD 3AZHB 3NQJB 4CAYB 5BS7A 4QLCB 3B6FD 5GT0D 5KDMB 1S32C 1ID3D 3VH6A 4J8WA 3B6GB 4J8UC 3REJA 3AZMD 5CPIC 4H9OA 3WTPC 1KX4A 3AZLD 3A6NA 3MGPA 1KU5A 1P3AD 3AZFD 4CSRB 3C1BA 3KXBC 1U35B 3X1SB 1JFIA 3REKB 4LD9C 3AFAD 4M6BA 3AZNC 1P3GA 3B6FA 4X23C 5GT0A 1ID3A 2FJ7B 3TU4D 4KGCD 2IO5B 5CPKA 3AZMA 4H9OB 3AZLA 1P3FB 4WU9B 4KUDC 3UT9C 3AZFA 1P3ID 2RVQC 4ZBJC 5B31C 5BNXB 3AFAA 4H9NB 3B6FB 3WAAC 5CPJB 5GT0B 1ID3B 3TU4A 1AOID 4KGCA 3C1CC 3REID 3O62C 1KX3D 3AZMB 1P3PA 3W97A 1EQZC 1P3AB 5BO0A 2NQBD 4H9SC 3LJAA 3MVDD 3AFAB 1WWSA 3AZEA 5DNNA 1AOIA 3TU4B 4KGCB 1KX3A 4UUZA 5AVBC 3UTAC 1S32D 4H9PA 1P3IB 3B0CW 4J8UD 2NQBA 3REHC 5CPID 3WTPD 3AN2C 2F8ND 4Z2MH 3MVDA 3RELC 4Z5TB 1P34D 1P3FC 3VH6W 2AROC 4Z2MG 3KXBD 5AV5C 3REIB 4WNNA 4XZQB 1KX3B 5AY8B 4LD9D 3AZND 4X23D 1S32A 5AVCC 1ULYA 3W98C 2HUEB 5CPJC 4J8UA 5CPIA 2F8NA 4KUDD 3W96A 3UT9D 3MVDB 5GXQB 2RVQD 3KXBA 4WNNB 4R8PA 5B31D 4LD9A 3AZNA 3MGRC 4X23A 3WAAD 5AV9B 3C1CD 3O62D 1H3OA 1F66C 4J8UB 4JJNB 3R45B 3WTPB 1BH9B 1WWIA 3AZKC 3AYWC 1KX5C 3W99C 3NQUA 1EQZD 1P34B 5JA4B 4ZUXC 3KXBB 3X1UA 3LZ1B 5B33C 5B40C 5B2JC 5B31A 5DNMC 3WAAA 5B0YA 5B1LC 4Z5TC 3C1CA 3O62A 1HQ3C 5CHLB 3AZHA 5AVBD 4XZQC 3X1TC 5AY8C 4KUDB 3NQJA 3UT9B 5B0ZB 3UTAD 1EQZA 4QLCA 5B1MD 1M1AC 5KDMA 3REHD 2HUEC 4ZBJB 3B0CT 4H9SA 1BH8B 2F8NH 3AN2D 3RELD 3WAAB 2F8NG 4NE6A 2AROD 3C1CB 5GSUB 4CSRA 5AV5D 3AZGC 5GXQC 3WA9C 1U35A 3X1SA 3REKA 1P3BC 5AVCD 1P3LC 1EQZB 3W98D 5CPJD 5CP6C 5AV9C 3MGSB 2FJ7A 3REHA 3WTPE 1M19B 4JJNC 4AWLB 2BYMB 2NZDC 4G92C 1P3FA 4WU9A 2JSSA 4YS3B 2AROA 3AZID 1P34C 5FUGB 2CWEA 3LZ1C 5AVBB 3MGRD 5BNXA 3UTAB 4H9NA 5B31G 5AVCA 3W98A 5B1MB 5CPJA 4G91C 1F66D 3REHB 1M18C 1ZLAC 1F1EA 2YFWB 3AZKD 3AN2B 3AYWD 3RELB 1KX5D 3W99D 5GT3B 1TZYB 5AV8C 5B0ZC 4ZUXD 2AROB 1P3AA 1P3MB 5AV5B 5B33D 3LELC 5B40D 5B2JD 5B32C 5DNMD 5AVCB 5B1LD 4Z5TD 3W98B 1R4VA 1HQ3D 4DRBA 5GSUC 3X1TD 4XZQD 5AY8D 3AYWA 3W99A 1M1AD 4J8VC 4ZUXA 3AZIB 5B33A 1P3IA 5BT1C 4WZSB 3MGSC 5B2JA 5AV6C 4H9RB 1M19C 3MGRB 4XUJC 3MNNC 4AWLC 4Z5TA 4YS3C 5GXQD 1HQ3A 3AZGD 1F66B 3WA9D 3REIA 3X1TA 4XZQA 5AY8A 3AZKB 3AYWB 1P3BD 1KX5B 3W99B 1P3LD 5CP6D 5AV9D 3KWQC 4ZUXB 1HTAA 5B1MC 5B2IC 5B33B 5B40B 5B2JB 4JJND 3MGQC 4J8XD 2NZDD 5DNMB 4NFTA 5B1LB 5GT3C 1TZYC 5GXQA 1P3MC 1HQ3B 4DRAA 3LZ1D 3X1TB 2BYKB 3LZ0C 1P3BA 1M1AB 5AV9A 4WU8B 5B24B 1M18D 1ZLAD 4JJNA 3R45A 3WTPA 1BH9A 4Z66B 5BS7C 5AV8D 5B0ZD 1P34A 4KHAB 5JA4A 3LELD 4J8WC 3AZGB 3AZIC 3WA9B 3LZ1A 5B32D 5G49B 3MGPC 5JRGB 1P3BB 1P3LB 3VH5A 5CP6B 5GSUD 1M18A 1ZLAA 2HIOB 4J8XB 2NZDB 4G92B 4KUDA 1P3GC 5AV8A 5B0ZA 4J8VD 3UT9A 2F8NK 4H9QB 5BT1D 3MGSD 5CPKC 5AV6D 1BH8A 1M19D 4XUJD 3MNND 4WV4B 4G91B 1N1JB 4YS3D 5GSUA 1M18B 1ZLAB 3AV2B 5AV8B 3KWQD 5B2ID 3MGSA 3LELB 4YM6C 4WU8C 3MGQD 5B24C 5AV6A 5B32B 1P3PC 1M19A 4XUJA 2BYMA 4Z66C 3W97C 5GT3D 1TZYD 4YS3A 1P3MD 3LZ0D 5FUGA 3LJAC 5AVBA 5JRGC 3KWQA 4J8VB 3UTAA 5DNNC 3AZEC 5B1MA 3AV1C 3B0DC 5AV6B 2YFWA 3AN2A 4XUJB 3MNNB 3RELA 2HIOC 4J8XC 5GT3A 1TZYA 1P3OC 4J8WD 1P3MA 5AV5A 3V9RB 2PYOC 3MGPD 3AZJB 3KUYC 3KWQB 2LY8A 5B2IB 1Q9CA 5E5AB 5BNVB 3MGQB 1P3GD 3VH5W 3AV2C 3UTBC 3AZIA 1TAFB 5CPKD
chains in the Genus database with same CATH superfamily
2CV5C 4NE5A 5F99B 4H9RA 3LZ0B 3W96C 3MGRA 2JCHA 4DQYB 3P5JB 1F66A 4R8PC 3AZKA 1KX5A 3WKJC 4J8WB 4YM6D 4WU8D 5B24D 3REJB 3X1VC 5B40A 1P3PD 1KX4B 3A6NB 3MGPB 4Z66D 3W97D 5DNMA 5B1LA 3C1BB 4E44A 3X1UC 2DF4C 1JFIB 3AL0C 3LJAD 2BYKA 1P3GB 5JRGD 3AZED 3AZJC 5DNND 3AV1D 5B0YC 1M1AA 4WU8A 4YM6A 1P3KC 5B24A 5CPKB 4EO5B 5E5AC 3AZHC 3AZLB 2HIOD 4Z66A 4QLCC 1P3OD 3AZFB 4KHAA 2PYOD 2UWXA 3AZGA 3B6GC 3WA9A 5C3IB 2Y2NA 3KSYA 5G49A 5F99C 5JRGA 3KUYD 1P3LA 3AV1A 5CP6A 4YM6B 4NE3A 1P3PB 1U35C 3X1SC 3REKC 2HIOA 4J8XA 2NZDA 3AV2D 2Y2GA 1A7WA 4UPKA 3UTBD 3W97B 3VH5T 1P3OA 2FJ7C 2PYOA 2IO5C 4H9QA 5BO0B 2CV5D 2Y2PA 2F2AC 3REJC 3LJAB 3W96D 1KX4C 1Z2CB 3KUYA 3A6NC 3AZEB 4WU9C 4HGAB 5DNNB 3AV1B 1AOIB 1N1JA 3B0DB 3C1BC 4R8PD 4UUZB 3AV2A 3UTBA 1P3OB 3WKJD 4H9PB 3B6FC 5GT0C 1ID3C 2CV5A 2PYOB 3LELA 3X1VD 2NQBB 4EO5C 3H0RC 5B32A 3AZMC 3B0BA 3AZLC 3KUYB 1B67A 2L5AA 1P3AC 3X1UD 3AZFC 2ZY3A 5C3IC 3AZJD 3AFAC 3UTBB 1S32B 5B0YD 3WKJA 4J8VA 1P3KD 3TU4C 4KGCC 2CV5B 3X1VA 5E5AD 5CPIB 3AZHD 2F8NB 3W96B 3MNNA 4QLCD 3IP4C 1P3IC 3B6GD 3V9RA 4R8PB 4LD9B 3AZNB 5F99D 4X23B 3AZJA 3WKJB 4HGAC 1P3KA 2YFVA 1H3OB 5B2IA 1AOIC 5E5AA 3REIC 3X1VB 5BNVA 3X1SD 3MGQA 1U35D 3REKD 1KX3C 2ZY2A 4E45A 1B6WA 1BFMA 4CAYA 3NQUB 2FJ7D 3X1UB 3B6GA 1TAFA 2NQBC 3REJD 5B31B 1KX4D 3F6TA 5F99A 3LZ0A 3A6ND 4WU9D 1P3FD 3MVDC 5B32G 5B0YB 3VH6T 3O62B 1P3KB 2YFVB 2Y2LA 3C1BD 3AZHB 3NQJB 4CAYB 5BS7A 4QLCB 3B6FD 5GT0D 5KDMB 1S32C 1ID3D 3VH6A 4J8WA 3B6GB 4J8UC 3REJA 3AZMD 5CPIC 4H9OA 3WTPC 1KX4A 3AZLD 3A6NA 3MGPA 1KU5A 1P3AD 3AZFD 4CSRB 3C1BA 3KXBC 1U35B 3X1SB 1JFIA 3REKB 4LD9C 3AFAD 4M6BA 3AZNC 1P3GA 3B6FA 4X23C 5GT0A 1ID3A 2FJ7B 3TU4D 4KGCD 2IO5B 5CPKA 3AZMA 4H9OB 3AZLA 1P3FB 4WU9B 4KUDC 3UT9C 3AZFA 1P3ID 2RVQC 3A1KA 4ZBJC 5B31C 5BNXB 3AFAA 4H9NB 3B6FB 3WAAC 5CPJB 5GT0B 1ID3B 3TU4A 1AOID 4KGCA 3C1CC 3REID 3EG5B 3O62C 4WJ3C 1KX3D 3AZMB 1P3PA 3W97A 1EQZC 1P3AB 5BO0A 2NQBD 4H9SC 3LJAA 3MVDD 3AFAB 1WWSA 3AZEA 5DNNA 1AOIA 3TU4B 4KGCB 1KX3A 4UUZA 5AVBC 3UTAC 1S32D 4H9PA 1P3IB 3B0CW 4J8UD 2NQBA 3REHC 5CPID 3WTPD 3AN2C 2F8ND 2VQRA 4Z2MH 3MVDA 3RELC 4Z5TB 1P34D 1P3FC 3VH6W 2AROC 4Z2MG 3KXBD 5AV5C 3REIB 4WNNA 4XZQB 1KX3B 5AY8B 4LD9D 3AZND 4X23D 1S32A 5AVCC 1ULYA 3W98C 2HUEB 5CPJC 4J8UA 5CPIA 2F8NA 4KUDD 3W96A 3UT9D 3MVDB 5GXQB 2RVQD 3KXBA 4WNNB 4R8PA 5B31D 4LD9A 3AZNA 3MGRC 4X23A 3WAAD 5AV9B 3C1CD 3O62D 1H3OA 1F66C 4J8UB 4JJNB 3R45B 2Y2QA 1T3UA 3WTPB 1BH9B 1WWIA 3AZKC 2JE5A 3AYWC 1KX5C 3W99C 3NQUA 1EQZD 1P34B 5JA4B 4ZUXC 2BG1A 3KXBB 3X1UA 3LZ1B 5B33C 5B40C 5B2JC 5B31A 5DNMC 3WAAA 5B0YA 5B1LC 4Z5TC 3C1CA 3O62A 1HQ3C 2XD1A 5CHLB 3AZHA 5AVBD 4XZQC 3X1TC 5AY8C 4KUDB 3NQJA 3UT9B 5B0ZB 3UTAD 1EQZA 4QLCA 5B1MD 1M1AC 5KDMA 3REHD 2HUEC 4ZBJB 3B0CT 3FDDA 4H9SA 1BH8B 2F8NH 3AN2D 3RELD 2FFFB 3WAAB 2F8NG 4NE6A 2AROD 3C1CB 5GSUB 4CSRA 5AV5D 3AZGC 5GXQC 3WA9C 1U35A 3X1SA 2Y2KA 3REKA 1P3BC 5AVCD 1P3LC 1EQZB 3W98D 5CPJD 5CP6C 5AV9C 3MGSB 2FJ7A 3REHA 3H0LC 3WTPE 1M19B 4JJNC 4AWLB 2BYMB 2NZDC 4G92C 1P3FA 4WU9A 2JSSA 4YS3B 2AROA 3AZID 1P34C 5FUGB 2CWEA 3LZ1C 5AVBB 3MGRD 5BNXA 3UTAB 4H9NA 5B31G 5AVCA 3W98A 5B1MB 5CPJA 4G91C 3A1IA 2ZY5A 1F66D 3EPKA 3REHB 1M18C 1ZLAC 1F1EA 2YFWB 3AZKD 3AN2B 3AYWD 3RELB 1KX5D 3W99D 5GT3B 1TZYB 5AV8C 5B0ZC 4ZUXD 2AROB 1P3AA 1P3MB 5AV5B 5B33D 3LELC 5B40D 5B2JD 5B32C 5DNMD 2DQNC 5AVCB 5B1LD 4Z5TD 3W98B 1R4VA 1HQ3D 4DRBA 5GSUC 3X1TD 4XZQD 5AY8D 3AYWA 3W99A 1M1AD 4J8VC 4ZUXA 3AZIB 5B33A 1P3IA 5BT1C 4WZSB 3MGSC 5B2JA 2Y2JA 5AV6C 4H9RB 1M19C 3MGRB 4XUJC 3MNNC 4AWLC 4Z5TA 2Y2HA 4YS3C 5GXQD 1HQ3A 3AZGD 1F66B 3WA9D 3REIA 3X1TA 4XZQA 5AY8A 3AZKB 3AYWB 1P3BD 1KX5B 3W99B 1P3LD 3EPHA 5CP6D 5AV9D 3KWQC 4ZUXB 1HTAA 2ZY4A 5B1MC 5B2IC 2ZM5A 5B33B 5B40B 5B2JB 4JJND 3MGQC 4J8XD 2NZDD 5DNMB 4NFTA 5B1LB 5GT3C 1TZYC 5GXQA 1P3MC 1HQ3B 4DRAA 2G5HC 3LZ1D 1PZRA 3X1TB 2BYKB 3LZ0C 1P3BA 3EPJA 1M1AB 5AV9A 4WU8B 5B24B 1M18D 1ZLAD 4JJNA 3R45A 3WTPA 1BH9A 4Z66B 5BS7C 5AV8D 5B0ZD 1P34A 4KHAB 5JA4A 3LELD 4J8WC 2RIQA 3AZIC 3AZGB 3WA9B 3LZ1A 5B32D 2Y2IA 5G49B 3MGPC 5JRGB 1P3BB 1P3LB 3VH5A 1W2EA 5CP6B 5GSUD 1M18A 1ZLAA 2HIOB 4J8XB 2NZDB 4G92B 4KUDA 1P3GC 5AV8A 5B0ZA 4J8VD 3UT9A 2F8NK 4H9QB 5BT1D 3MGSD 5CPKC 5AV6D 1BH8A 1M19D 4XUJD 3MNND 4WV4B 4G91B 1N1JB 4YS3D 2G5IC 2Y2MA 5GSUA 1M18B 1ZLAB 3AV2B 5AV8B 2J8PA 3KWQD 5B2ID 3MGSA 3LELB 4YM6C 4WU8C 3MGQD 5B24C 5AV6A 5B32B 1P3PC 1M19A 4XUJA 2BYMA 4Z66C 3W97C 3H0MC 5GT3D 1TZYD 4YS3A 1P3MD 3KFUG 3LZ0D 5FUGA 3LJAC 5AVBA 5JRGC 3KWQA 4J8VB 3UTAA 5DNNC 3AZEC 5B1MA 3AV1C 3B0DC 2Y2OA 5AV6B 2YFWA 3AN2A 4XUJB 3MNNB 3RELA 2HIOC 4J8XC 5GT3A 1TZYA 1P3OC 4J8WD 1P3MA 5AV5A 3V9RB 2PYOC 2W8SA 3MGPD 3AZJB 3KUYC 3KWQB 2LY8A 5B2IB 1Q9CA 5E5AB 5BNVB 3MGQB 2XD5A 3EPLA 1P3GD 3VH5W 3AV2C 3UTBC 3AZIA 1TAFB 5CPKD
chains in the Genus database with same CATH topology
2CV5C 4NE5A 5F99B 4H9RA 3LZ0B 3W96C 3MGRA 2JCHA 4DQYB 3P5JB 1F66A 4R8PC 3AZKA 1KX5A 3WKJC 4J8WB 4YM6D 4WU8D 5B24D 3REJB 3X1VC 5B40A 1P3PD 1KX4B 3A6NB 3MGPB 4Z66D 3W97D 5DNMA 5B1LA 3C1BB 4E44A 3X1UC 2DF4C 1JFIB 3AL0C 3LJAD 2BYKA 1P3GB 5JRGD 3AZED 3AZJC 5DNND 3AV1D 5B0YC 1M1AA 4WU8A 4YM6A 1P3KC 5B24A 5CPKB 4EO5B 5E5AC 3AZHC 3AZLB 2HIOD 4Z66A 4QLCC 1P3OD 3AZFB 4KHAA 2PYOD 2UWXA 3AZGA 3B6GC 3WA9A 5C3IB 2Y2NA 3KSYA 5G49A 5F99C 5JRGA 3KUYD 1P3LA 3AV1A 5CP6A 4YM6B 4NE3A 1P3PB 1U35C 3X1SC 3REKC 2HIOA 4J8XA 2NZDA 3AV2D 2Y2GA 1A7WA 4UPKA 3UTBD 3W97B 3VH5T 1P3OA 2FJ7C 2PYOA 2IO5C 4H9QA 5BO0B 2CV5D 2Y2PA 2F2AC 3REJC 3LJAB 3W96D 1KX4C 1Z2CB 3KUYA 3A6NC 3AZEB 4WU9C 4HGAB 5DNNB 3AV1B 1AOIB 1N1JA 3B0DB 3C1BC 4R8PD 4UUZB 3AV2A 3UTBA 1P3OB 3WKJD 4H9PB 3B6FC 5GT0C 1ID3C 2CV5A 2PYOB 3LELA 3X1VD 2NQBB 4EO5C 3H0RC 5B32A 3AZMC 3B0BA 3AZLC 3KUYB 1B67A 2L5AA 1P3AC 3X1UD 3AZFC 2ZY3A 5C3IC 3AZJD 3AFAC 3UTBB 1S32B 5B0YD 3WKJA 4J8VA 1P3KD 3TU4C 4KGCC 2CV5B 3X1VA 5E5AD 5CPIB 3AZHD 2F8NB 3W96B 3MNNA 4QLCD 3IP4C 1P3IC 3B6GD 3V9RA 4R8PB 4LD9B 3AZNB 5F99D 4X23B 3AZJA 3WKJB 4HGAC 1P3KA 2YFVA 1H3OB 5B2IA 1AOIC 5E5AA 3REIC 3X1VB 5BNVA 3X1SD 3MGQA 1U35D 3REKD 1KX3C 2ZY2A 4E45A 1B6WA 1BFMA 4CAYA 3NQUB 2FJ7D 3X1UB 3B6GA 1TAFA 2NQBC 3REJD 5B31B 1KX4D 3F6TA 5F99A 3LZ0A 3A6ND 4WU9D 1P3FD 3MVDC 5B32G 5B0YB 3VH6T 3O62B 1P3KB 2YFVB 2Y2LA 3C1BD 3AZHB 3NQJB 4CAYB 5BS7A 4QLCB 3B6FD 5GT0D 5KDMB 1S32C 1ID3D 3VH6A 4J8WA 3B6GB 4J8UC 3REJA 3AZMD 5CPIC 4H9OA 3WTPC 1KX4A 3AZLD 3A6NA 3MGPA 1KU5A 1P3AD 3AZFD 4CSRB 3C1BA 3KXBC 1U35B 3X1SB 1JFIA 3REKB 4LD9C 3AFAD 4M6BA 3AZNC 1P3GA 3B6FA 4X23C 5GT0A 1ID3A 2FJ7B 3TU4D 4KGCD 2IO5B 5CPKA 3AZMA 4H9OB 3AZLA 1P3FB 4WU9B 4KUDC 3UT9C 3AZFA 1P3ID 2RVQC 3A1KA 4ZBJC 5B31C 5BNXB 3AFAA 4H9NB 3B6FB 3WAAC 5CPJB 5GT0B 1ID3B 3TU4A 1AOID 4KGCA 3C1CC 3REID 3EG5B 3O62C 4WJ3C 1KX3D 3AZMB 1P3PA 3W97A 1EQZC 1P3AB 5BO0A 2NQBD 4H9SC 3LJAA 3MVDD 3AFAB 1WWSA 3AZEA 5DNNA 1AOIA 3TU4B 4KGCB 1KX3A 4UUZA 5AVBC 3UTAC 1S32D 4H9PA 1P3IB 3B0CW 4J8UD 2NQBA 3REHC 5CPID 3WTPD 3AN2C 2F8ND 2VQRA 4Z2MH 3MVDA 3RELC 4Z5TB 1P34D 1P3FC 3VH6W 2AROC 4Z2MG 3KXBD 5AV5C 3REIB 4WNNA 4XZQB 1KX3B 5AY8B 4LD9D 3AZND 4X23D 1S32A 5AVCC 1ULYA 3W98C 2HUEB 5CPJC 4J8UA 5CPIA 2F8NA 4KUDD 3W96A 3UT9D 3MVDB 5GXQB 2RVQD 3KXBA 4WNNB 4R8PA 5B31D 4LD9A 3AZNA 3MGRC 4X23A 3WAAD 5AV9B 3C1CD 3O62D 1H3OA 1F66C 4J8UB 4JJNB 3R45B 2Y2QA 1T3UA 3WTPB 1BH9B 1WWIA 3AZKC 2JE5A 3AYWC 1KX5C 3W99C 3NQUA 1EQZD 1P34B 5JA4B 4ZUXC 2BG1A 3KXBB 3X1UA 3LZ1B 5B33C 5B40C 5B2JC 5B31A 5DNMC 3WAAA 5B0YA 5B1LC 4Z5TC 3C1CA 3O62A 1HQ3C 2XD1A 5CHLB 3AZHA 5AVBD 4XZQC 3X1TC 5AY8C 4KUDB 3NQJA 3UT9B 5B0ZB 3UTAD 1EQZA 4QLCA 5B1MD 1M1AC 5KDMA 3REHD 2HUEC 4ZBJB 3B0CT 3FDDA 4H9SA 1BH8B 2F8NH 3AN2D 3RELD 2FFFB 3WAAB 2F8NG 4NE6A 2AROD 3C1CB 5GSUB 4CSRA 5AV5D 3AZGC 5GXQC 3WA9C 1U35A 3X1SA 2Y2KA 3REKA 1P3BC 5AVCD 1P3LC 1EQZB 3W98D 5CPJD 5CP6C 5AV9C 3MGSB 2FJ7A 3REHA 3H0LC 3WTPE 1M19B 4JJNC 4AWLB 2BYMB 2NZDC 4G92C 1P3FA 4WU9A 2JSSA 4YS3B 2AROA 3AZID 1P34C 5FUGB 2CWEA 3LZ1C 5AVBB 3MGRD 5BNXA 3UTAB 4H9NA 5B31G 5AVCA 3W98A 5B1MB 5CPJA 4G91C 3A1IA 2ZY5A 1F66D 3EPKA 3REHB 1M18C 1ZLAC 1F1EA 2YFWB 3AZKD 3AN2B 3AYWD 3RELB 1KX5D 3W99D 5GT3B 1TZYB 5AV8C 5B0ZC 4ZUXD 2AROB 1P3AA 1P3MB 5AV5B 5B33D 3LELC 5B40D 5B2JD 5B32C 5DNMD 2DQNC 5AVCB 5B1LD 4Z5TD 3W98B 1R4VA 1HQ3D 4DRBA 5GSUC 3X1TD 4XZQD 5AY8D 3AYWA 3W99A 1M1AD 4J8VC 4ZUXA 3AZIB 5B33A 1P3IA 5BT1C 4WZSB 3MGSC 5B2JA 2Y2JA 5AV6C 4H9RB 1M19C 3MGRB 4XUJC 3MNNC 4AWLC 4Z5TA 2Y2HA 4YS3C 5GXQD 1HQ3A 3AZGD 1F66B 3WA9D 3REIA 3X1TA 4XZQA 5AY8A 3AZKB 3AYWB 1P3BD 1KX5B 3W99B 1P3LD 3EPHA 5CP6D 5AV9D 3KWQC 4ZUXB 1HTAA 2ZY4A 5B1MC 5B2IC 2ZM5A 5B33B 5B40B 5B2JB 4JJND 3MGQC 4J8XD 2NZDD 5DNMB 4NFTA 5B1LB 5GT3C 1TZYC 5GXQA 1P3MC 1HQ3B 4DRAA 2G5HC 3LZ1D 1PZRA 3X1TB 2BYKB 3LZ0C 1P3BA 3EPJA 1M1AB 5AV9A 4WU8B 5B24B 1M18D 1ZLAD 4JJNA 3R45A 3WTPA 1BH9A 4Z66B 5BS7C 5AV8D 5B0ZD 1P34A 4KHAB 5JA4A 3LELD 4J8WC 2RIQA 3AZIC 3AZGB 3WA9B 3LZ1A 5B32D 2Y2IA 5G49B 3MGPC 5JRGB 1P3BB 1P3LB 3VH5A 1W2EA 5CP6B 5GSUD 1M18A 1ZLAA 2HIOB 4J8XB 2NZDB 4G92B 4KUDA 1P3GC 5AV8A 5B0ZA 4J8VD 3UT9A 2F8NK 4H9QB 5BT1D 3MGSD 5CPKC 5AV6D 1BH8A 1M19D 4XUJD 3MNND 4WV4B 4G91B 1N1JB 4YS3D 2G5IC 2Y2MA 5GSUA 1M18B 1ZLAB 3AV2B 5AV8B 2J8PA 3KWQD 5B2ID 3MGSA 3LELB 4YM6C 4WU8C 3MGQD 5B24C 5AV6A 5B32B 1P3PC 1M19A 4XUJA 2BYMA 4Z66C 3W97C 3H0MC 5GT3D 1TZYD 4YS3A 1P3MD 3KFUG 3LZ0D 5FUGA 3LJAC 5AVBA 5JRGC 3KWQA 4J8VB 3UTAA 5DNNC 3AZEC 5B1MA 3AV1C 3B0DC 2Y2OA 5AV6B 2YFWA 3AN2A 4XUJB 3MNNB 3RELA 2HIOC 4J8XC 5GT3A 1TZYA 1P3OC 4J8WD 1P3MA 5AV5A 3V9RB 2PYOC 2W8SA 3MGPD 3AZJB 3KUYC 3KWQB 2LY8A 5B2IB 1Q9CA 5E5AB 5BNVB 3MGQB 2XD5A 3EPLA 1P3GD 3VH5W 3AV2C 3UTBC 3AZIA 1TAFB 5CPKD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CV5 C;  4NE5 A;  5F99 B;  4H9R A;  3LZ0 B;  3W96 C;  3MGR A;  1F66 A;  4R8P C;  3AZK A;  1KX5 A;  3WKJ C;  4J8W B;  4YM6 D;  4WU8 D;  5B24 D;  3REJ B;  3X1V C;  5B40 A;  1P3P D;  1KX4 B;  3A6N B;  3MGP B;  4Z66 D;  3W97 D;  5DNM A;  5B1L A;  3C1B B;  4E44 A;  3X1U C;  1JFI B;  3LJA D;  2BYK A;  1P3G B;  5JRG D;  3AZE D;  3AZJ C;  5DNN D;  3AV1 D;  5B0Y C;  1M1A A;  4WU8 A;  4YM6 A;  1P3K C;  5B24 A;  5CPK B;  4EO5 B;  5E5A C;  3AZH C;  3AZL B;  2HIO D;  4Z66 A;  4QLC C;  1P3O D;  3AZF B;  4KHA A;  2PYO D;  3AZG A;  3B6G C;  3WA9 A;  5C3I B;  3KSY A;  5G49 A;  5F99 C;  5JRG A;  3KUY D;  1P3L A;  3AV1 A;  5CP6 A;  4YM6 B;  4NE3 A;  1P3P B;  1U35 C;  3X1S C;  3REK C;  2HIO A;  4J8X A;  2NZD A;  3AV2 D;  1A7W A;  3UTB D;  3W97 B;  3VH5 T;  1P3O A;  2FJ7 C;  2PYO A;  2IO5 C;  4H9Q A;  5BO0 B;  2CV5 D;  3REJ C;  3LJA B;  3W96 D;  1KX4 C;  3KUY A;  3A6N C;  3AZE B;  4WU9 C;  4HGA B;  5DNN B;  3AV1 B;  1AOI B;  1N1J A;  3B0D B;  3C1B C;  4R8P D;  4UUZ B;  3AV2 A;  3UTB A;  1P3O B;  3WKJ D;  4H9P B;  3B6F C;  5GT0 C;  1ID3 C;  2CV5 A;  2PYO B;  3LEL A;  3X1V D;  2NQB B;  4EO5 C;  5B32 A;  3AZM C;  3B0B A;  3AZL C;  3KUY B;  1B67 A;  2L5A A;  1P3A C;  3X1U D;  3AZF C;  5C3I C;  3AZJ D;  3AFA C;  3UTB B;  1S32 B;  5B0Y D;  3WKJ A;  4J8V A;  1P3K D;  3TU4 C;  4KGC C;  2CV5 B;  3X1V A;  5E5A D;  5CPI B;  3AZH D;  2F8N B;  3W96 B;  3MNN A;  4QLC D;  1P3I C;  3B6G D;  3V9R A;  4R8P B;  4LD9 B;  3AZN B;  5F99 D;  4X23 B;  3AZJ A;  3WKJ B;  4HGA C;  1P3K A;  2YFV A;  1H3O B;  5B2I A;  1AOI C;  5E5A A;  3REI C;  3X1V B;  5BNV A;  3X1S D;  3MGQ A;  1U35 D;  3REK D;  1KX3 C;  4E45 A;  1B6W A;  1BFM A;  4CAY A;  3NQU B;  2FJ7 D;  3X1U B;  3B6G A;  1TAF A;  2NQB C;  3REJ D;  5B31 B;  1KX4 D;  5F99 A;  3LZ0 A;  3A6N D;  4WU9 D;  1P3F D;  3MVD C;  5B32 G;  5B0Y B;  3VH6 T;  3O62 B;  1P3K B;  2YFV B;  3C1B D;  3AZH B;  3NQJ B;  4CAY B;  5BS7 A;  4QLC B;  3B6F D;  5GT0 D;  5KDM B;  1S32 C;  1ID3 D;  3VH6 A;  4J8W A;  3B6G B;  4J8U C;  3REJ A;  3AZM D;  5CPI C;  4H9O A;  3WTP C;  1KX4 A;  3AZL D;  3A6N A;  3MGP A;  1KU5 A;  1P3A D;  3AZF D;  4CSR B;  3C1B A;  3KXB C;  1U35 B;  3X1S B;  1JFI A;  3REK B;  4LD9 C;  3AFA D;  4M6B A;  3AZN C;  1P3G A;  3B6F A;  4X23 C;  5GT0 A;  1ID3 A;  2FJ7 B;  3TU4 D;  4KGC D;  2IO5 B;  5CPK A;  3AZM A;  4H9O B;  3AZL A;  1P3F B;  4WU9 B;  4KUD C;  3UT9 C;  3AZF A;  1P3I D;  2RVQ C;  4ZBJ C;  5B31 C;  5BNX B;  3AFA A;  4H9N B;  3B6F B;  3WAA C;  5CPJ B;  5GT0 B;  1ID3 B;  3TU4 A;  1AOI D;  4KGC A;  3C1C C;  3REI D;  3O62 C;  1KX3 D;  3AZM B;  1P3P A;  3W97 A;  1EQZ C;  1P3A B;  5BO0 A;  2NQB D;  4H9S C;  3LJA A;  3MVD D;  3AFA B;  1WWS A;  3AZE A;  5DNN A;  1AOI A;  3TU4 B;  4KGC B;  1KX3 A;  4UUZ A;  5AVB C;  3UTA C;  1S32 D;  4H9P A;  1P3I B;  3B0C W;  4J8U D;  2NQB A;  3REH C;  5CPI D;  3WTP D;  3AN2 C;  2F8N D;  4Z2M H;  3MVD A;  3REL C;  4Z5T B;  1P34 D;  1P3F C;  3VH6 W;  2ARO C;  4Z2M G;  3KXB D;  5AV5 C;  3REI B;  4WNN A;  4XZQ B;  1KX3 B;  5AY8 B;  4LD9 D;  3AZN D;  4X23 D;  1S32 A;  5AVC C;  1ULY A;  3W98 C;  2HUE B;  5CPJ C;  4J8U A;  5CPI A;  2F8N A;  4KUD D;  3W96 A;  3UT9 D;  3MVD B;  5GXQ B;  2RVQ D;  3KXB A;  4WNN B;  4R8P A;  5B31 D;  4LD9 A;  3AZN A;  3MGR C;  4X23 A;  3WAA D;  5AV9 B;  3C1C D;  3O62 D;  1H3O A;  1F66 C;  4J8U B;  4JJN B;  3R45 B;  3WTP B;  1BH9 B;  1WWI A;  3AZK C;  3AYW C;  1KX5 C;  3W99 C;  3NQU A;  1EQZ D;  1P34 B;  5JA4 B;  4ZUX C;  3KXB B;  3X1U A;  3LZ1 B;  5B33 C;  5B40 C;  5B2J C;  5B31 A;  5DNM C;  3WAA A;  5B0Y A;  5B1L C;  4Z5T C;  3C1C A;  3O62 A;  1HQ3 C;  5CHL B;  3AZH A;  5AVB D;  4XZQ C;  3X1T C;  5AY8 C;  4KUD B;  3NQJ A;  3UT9 B;  5B0Z B;  3UTA D;  1EQZ A;  4QLC A;  5B1M D;  1M1A C;  5KDM A;  3REH D;  2HUE C;  4ZBJ B;  3B0C T;  4H9S A;  1BH8 B;  2F8N H;  3AN2 D;  3REL D;  3WAA B;  2F8N G;  4NE6 A;  2ARO D;  3C1C B;  5GSU B;  4CSR A;  5AV5 D;  3AZG C;  5GXQ C;  3WA9 C;  1U35 A;  3X1S A;  3REK A;  1P3B C;  5AVC D;  1P3L C;  1EQZ B;  3W98 D;  5CPJ D;  5CP6 C;  5AV9 C;  3MGS B;  2FJ7 A;  3REH A;  3WTP E;  1M19 B;  4JJN C;  4AWL B;  2BYM B;  2NZD C;  4G92 C;  1P3F A;  4WU9 A;  2JSS A;  4YS3 B;  2ARO A;  3AZI D;  1P34 C;  5FUG B;  2CWE A;  3LZ1 C;  5AVB B;  3MGR D;  5BNX A;  3UTA B;  4H9N A;  5B31 G;  5AVC A;  3W98 A;  5B1M B;  5CPJ A;  4G91 C;  1F66 D;  3REH B;  1M18 C;  1ZLA C;  1F1E A;  2YFW B;  3AZK D;  3AN2 B;  3AYW D;  3REL B;  1KX5 D;  3W99 D;  5GT3 B;  1TZY B;  5AV8 C;  5B0Z C;  4ZUX D;  2ARO B;  1P3A A;  1P3M B;  5AV5 B;  5B33 D;  3LEL C;  5B40 D;  5B2J D;  5B32 C;  5DNM D;  5AVC B;  5B1L D;  4Z5T D;  3W98 B;  1R4V A;  1HQ3 D;  4DRB A;  5GSU C;  3X1T D;  4XZQ D;  5AY8 D;  3AYW A;  3W99 A;  1M1A D;  4J8V C;  4ZUX A;  3AZI B;  5B33 A;  1P3I A;  5BT1 C;  4WZS B;  3MGS C;  5B2J A;  5AV6 C;  4H9R B;  1M19 C;  3MGR B;  4XUJ C;  3MNN C;  4AWL C;  4Z5T A;  4YS3 C;  5GXQ D;  1HQ3 A;  3AZG D;  1F66 B;  3WA9 D;  3REI A;  3X1T A;  4XZQ A;  5AY8 A;  3AZK B;  3AYW B;  1P3B D;  1KX5 B;  3W99 B;  1P3L D;  5CP6 D;  5AV9 D;  3KWQ C;  4ZUX B;  1HTA A;  5B1M C;  5B2I C;  5B33 B;  5B40 B;  5B2J B;  4JJN D;  3MGQ C;  4J8X D;  2NZD D;  5DNM B;  4NFT A;  5B1L B;  5GT3 C;  1TZY C;  5GXQ A;  1P3M C;  1HQ3 B;  4DRA A;  3LZ1 D;  3X1T B;  2BYK B;  3LZ0 C;  1P3B A;  1M1A B;  5AV9 A;  4WU8 B;  5B24 B;  1M18 D;  1ZLA D;  4JJN A;  3R45 A;  3WTP A;  1BH9 A;  4Z66 B;  5BS7 C;  5AV8 D;  5B0Z D;  1P34 A;  4KHA B;  5JA4 A;  3LEL D;  4J8W C;  3AZG B;  3AZI C;  3WA9 B;  3LZ1 A;  5B32 D;  5G49 B;  3MGP C;  5JRG B;  1P3B B;  1P3L B;  3VH5 A;  5CP6 B;  5GSU D;  1M18 A;  1ZLA A;  2HIO B;  4J8X B;  2NZD B;  4G92 B;  4KUD A;  1P3G C;  5AV8 A;  5B0Z A;  4J8V D;  3UT9 A;  2F8N K;  4H9Q B;  5BT1 D;  3MGS D;  5CPK C;  5AV6 D;  1BH8 A;  1M19 D;  4XUJ D;  3MNN D;  4WV4 B;  4G91 B;  1N1J B;  4YS3 D;  5GSU A;  1M18 B;  1ZLA B;  3AV2 B;  5AV8 B;  3KWQ D;  5B2I D;  3MGS A;  3LEL B;  4YM6 C;  4WU8 C;  3MGQ D;  5B24 C;  5AV6 A;  5B32 B;  1P3P C;  1M19 A;  4XUJ A;  2BYM A;  4Z66 C;  3W97 C;  5GT3 D;  1TZY D;  4YS3 A;  1P3M D;  3LZ0 D;  5FUG A;  3LJA C;  5AVB A;  5JRG C;  3KWQ A;  4J8V B;  3UTA A;  5DNN C;  3AZE C;  5B1M A;  3AV1 C;  3B0D C;  5AV6 B;  2YFW A;  3AN2 A;  4XUJ B;  3MNN B;  3REL A;  2HIO C;  4J8X C;  5GT3 A;  1TZY A;  1P3O C;  4J8W D;  1P3M A;  5AV5 A;  3V9R B;  2PYO C;  3MGP D;  3AZJ B;  3KUY C;  3KWQ B;  2LY8 A;  5B2I B;  1Q9C A;  5E5A B;  5BNV B;  3MGQ B;  1P3G D;  3VH5 W;  3AV2 C;  3UTB C;  3AZI A;  1TAF B;  5CPK D; 
#chains in the Genus database with same CATH topology
 2CV5 C;  4NE5 A;  5F99 B;  4H9R A;  3LZ0 B;  3W96 C;  3MGR A;  2JCH A;  4DQY B;  3P5J B;  1F66 A;  4R8P C;  3AZK A;  1KX5 A;  3WKJ C;  4J8W B;  4YM6 D;  4WU8 D;  5B24 D;  3REJ B;  3X1V C;  5B40 A;  1P3P D;  1KX4 B;  3A6N B;  3MGP B;  4Z66 D;  3W97 D;  5DNM A;  5B1L A;  3C1B B;  4E44 A;  3X1U C;  2DF4 C;  1JFI B;  3AL0 C;  3LJA D;  2BYK A;  1P3G B;  5JRG D;  3AZE D;  3AZJ C;  5DNN D;  3AV1 D;  5B0Y C;  1M1A A;  4WU8 A;  4YM6 A;  1P3K C;  5B24 A;  5CPK B;  4EO5 B;  5E5A C;  3AZH C;  3AZL B;  2HIO D;  4Z66 A;  4QLC C;  1P3O D;  3AZF B;  4KHA A;  2PYO D;  2UWX A;  3AZG A;  3B6G C;  3WA9 A;  5C3I B;  2Y2N A;  3KSY A;  5G49 A;  5F99 C;  5JRG A;  3KUY D;  1P3L A;  3AV1 A;  5CP6 A;  4YM6 B;  4NE3 A;  1P3P B;  1U35 C;  3X1S C;  3REK C;  2HIO A;  4J8X A;  2NZD A;  3AV2 D;  2Y2G A;  1A7W A;  4UPK A;  3UTB D;  3W97 B;  3VH5 T;  1P3O A;  2FJ7 C;  2PYO A;  2IO5 C;  4H9Q A;  5BO0 B;  2CV5 D;  2Y2P A;  2F2A C;  3REJ C;  3LJA B;  3W96 D;  1KX4 C;  1Z2C B;  3KUY A;  3A6N C;  3AZE B;  4WU9 C;  4HGA B;  5DNN B;  3AV1 B;  1AOI B;  1N1J A;  3B0D B;  3C1B C;  4R8P D;  4UUZ B;  3AV2 A;  3UTB A;  1P3O B;  3WKJ D;  4H9P B;  3B6F C;  5GT0 C;  1ID3 C;  2CV5 A;  2PYO B;  3LEL A;  3X1V D;  2NQB B;  4EO5 C;  3H0R C;  5B32 A;  3AZM C;  3B0B A;  3AZL C;  3KUY B;  1B67 A;  2L5A A;  1P3A C;  3X1U D;  3AZF C;  2ZY3 A;  5C3I C;  3AZJ D;  3AFA C;  3UTB B;  1S32 B;  5B0Y D;  3WKJ A;  4J8V A;  1P3K D;  3TU4 C;  4KGC C;  2CV5 B;  3X1V A;  5E5A D;  5CPI B;  3AZH D;  2F8N B;  3W96 B;  3MNN A;  4QLC D;  3IP4 C;  1P3I C;  3B6G D;  3V9R A;  4R8P B;  4LD9 B;  3AZN B;  5F99 D;  4X23 B;  3AZJ A;  3WKJ B;  4HGA C;  1P3K A;  2YFV A;  1H3O B;  5B2I A;  1AOI C;  5E5A A;  3REI C;  3X1V B;  5BNV A;  3X1S D;  3MGQ A;  1U35 D;  3REK D;  1KX3 C;  2ZY2 A;  4E45 A;  1B6W A;  1BFM A;  4CAY A;  3NQU B;  2FJ7 D;  3X1U B;  3B6G A;  1TAF A;  2NQB C;  3REJ D;  5B31 B;  1KX4 D;  3F6T A;  5F99 A;  3LZ0 A;  3A6N D;  4WU9 D;  1P3F D;  3MVD C;  5B32 G;  5B0Y B;  3VH6 T;  3O62 B;  1P3K B;  2YFV B;  2Y2L A;  3C1B D;  3AZH B;  3NQJ B;  4CAY B;  5BS7 A;  4QLC B;  3B6F D;  5GT0 D;  5KDM B;  1S32 C;  1ID3 D;  3VH6 A;  4J8W A;  3B6G B;  4J8U C;  3REJ A;  3AZM D;  5CPI C;  4H9O A;  3WTP C;  1KX4 A;  3AZL D;  3A6N A;  3MGP A;  1KU5 A;  1P3A D;  3AZF D;  4CSR B;  3C1B A;  3KXB C;  1U35 B;  3X1S B;  1JFI A;  3REK B;  4LD9 C;  3AFA D;  4M6B A;  3AZN C;  1P3G A;  3B6F A;  4X23 C;  5GT0 A;  1ID3 A;  2FJ7 B;  3TU4 D;  4KGC D;  2IO5 B;  5CPK A;  3AZM A;  4H9O B;  3AZL A;  1P3F B;  4WU9 B;  4KUD C;  3UT9 C;  3AZF A;  1P3I D;  2RVQ C;  3A1K A;  4ZBJ C;  5B31 C;  5BNX B;  3AFA A;  4H9N B;  3B6F B;  3WAA C;  5CPJ B;  5GT0 B;  1ID3 B;  3TU4 A;  1AOI D;  4KGC A;  3C1C C;  3REI D;  3EG5 B;  3O62 C;  4WJ3 C;  1KX3 D;  3AZM B;  1P3P A;  3W97 A;  1EQZ C;  1P3A B;  5BO0 A;  2NQB D;  4H9S C;  3LJA A;  3MVD D;  3AFA B;  1WWS A;  3AZE A;  5DNN A;  1AOI A;  3TU4 B;  4KGC B;  1KX3 A;  4UUZ A;  5AVB C;  3UTA C;  1S32 D;  4H9P A;  1P3I B;  3B0C W;  4J8U D;  2NQB A;  3REH C;  5CPI D;  3WTP D;  3AN2 C;  2F8N D;  2VQR A;  4Z2M H;  3MVD A;  3REL C;  4Z5T B;  1P34 D;  1P3F C;  3VH6 W;  2ARO C;  4Z2M G;  3KXB D;  5AV5 C;  3REI B;  4WNN A;  4XZQ B;  1KX3 B;  5AY8 B;  4LD9 D;  3AZN D;  4X23 D;  1S32 A;  5AVC C;  1ULY A;  3W98 C;  2HUE B;  5CPJ C;  4J8U A;  5CPI A;  2F8N A;  4KUD D;  3W96 A;  3UT9 D;  3MVD B;  5GXQ B;  2RVQ D;  3KXB A;  4WNN B;  4R8P A;  5B31 D;  4LD9 A;  3AZN A;  3MGR C;  4X23 A;  3WAA D;  5AV9 B;  3C1C D;  3O62 D;  1H3O A;  1F66 C;  4J8U B;  4JJN B;  3R45 B;  2Y2Q A;  1T3U A;  3WTP B;  1BH9 B;  1WWI A;  3AZK C;  2JE5 A;  3AYW C;  1KX5 C;  3W99 C;  3NQU A;  1EQZ D;  1P34 B;  5JA4 B;  4ZUX C;  2BG1 A;  3KXB B;  3X1U A;  3LZ1 B;  5B33 C;  5B40 C;  5B2J C;  5B31 A;  5DNM C;  3WAA A;  5B0Y A;  5B1L C;  4Z5T C;  3C1C A;  3O62 A;  1HQ3 C;  2XD1 A;  5CHL B;  3AZH A;  5AVB D;  4XZQ C;  3X1T C;  5AY8 C;  4KUD B;  3NQJ A;  3UT9 B;  5B0Z B;  3UTA D;  1EQZ A;  4QLC A;  5B1M D;  1M1A C;  5KDM A;  3REH D;  2HUE C;  4ZBJ B;  3B0C T;  3FDD A;  4H9S A;  1BH8 B;  2F8N H;  3AN2 D;  3REL D;  2FFF B;  3WAA B;  2F8N G;  4NE6 A;  2ARO D;  3C1C B;  5GSU B;  4CSR A;  5AV5 D;  3AZG C;  5GXQ C;  3WA9 C;  1U35 A;  3X1S A;  2Y2K A;  3REK A;  1P3B C;  5AVC D;  1P3L C;  1EQZ B;  3W98 D;  5CPJ D;  5CP6 C;  5AV9 C;  3MGS B;  2FJ7 A;  3REH A;  3H0L C;  3WTP E;  1M19 B;  4JJN C;  4AWL B;  2BYM B;  2NZD C;  4G92 C;  1P3F A;  4WU9 A;  2JSS A;  4YS3 B;  2ARO A;  3AZI D;  1P34 C;  5FUG B;  2CWE A;  3LZ1 C;  5AVB B;  3MGR D;  5BNX A;  3UTA B;  4H9N A;  5B31 G;  5AVC A;  3W98 A;  5B1M B;  5CPJ A;  4G91 C;  3A1I A;  2ZY5 A;  1F66 D;  3EPK A;  3REH B;  1M18 C;  1ZLA C;  1F1E A;  2YFW B;  3AZK D;  3AN2 B;  3AYW D;  3REL B;  1KX5 D;  3W99 D;  5GT3 B;  1TZY B;  5AV8 C;  5B0Z C;  4ZUX D;  2ARO B;  1P3A A;  1P3M B;  5AV5 B;  5B33 D;  3LEL C;  5B40 D;  5B2J D;  5B32 C;  5DNM D;  2DQN C;  5AVC B;  5B1L D;  4Z5T D;  3W98 B;  1R4V A;  1HQ3 D;  4DRB A;  5GSU C;  3X1T D;  4XZQ D;  5AY8 D;  3AYW A;  3W99 A;  1M1A D;  4J8V C;  4ZUX A;  3AZI B;  5B33 A;  1P3I A;  5BT1 C;  4WZS B;  3MGS C;  5B2J A;  2Y2J A;  5AV6 C;  4H9R B;  1M19 C;  3MGR B;  4XUJ C;  3MNN C;  4AWL C;  4Z5T A;  2Y2H A;  4YS3 C;  5GXQ D;  1HQ3 A;  3AZG D;  1F66 B;  3WA9 D;  3REI A;  3X1T A;  4XZQ A;  5AY8 A;  3AZK B;  3AYW B;  1P3B D;  1KX5 B;  3W99 B;  1P3L D;  3EPH A;  5CP6 D;  5AV9 D;  3KWQ C;  4ZUX B;  1HTA A;  2ZY4 A;  5B1M C;  5B2I C;  2ZM5 A;  5B33 B;  5B40 B;  5B2J B;  4JJN D;  3MGQ C;  4J8X D;  2NZD D;  5DNM B;  4NFT A;  5B1L B;  5GT3 C;  1TZY C;  5GXQ A;  1P3M C;  1HQ3 B;  4DRA A;  2G5H C;  3LZ1 D;  1PZR A;  3X1T B;  2BYK B;  3LZ0 C;  1P3B A;  3EPJ A;  1M1A B;  5AV9 A;  4WU8 B;  5B24 B;  1M18 D;  1ZLA D;  4JJN A;  3R45 A;  3WTP A;  1BH9 A;  4Z66 B;  5BS7 C;  5AV8 D;  5B0Z D;  1P34 A;  4KHA B;  5JA4 A;  3LEL D;  4J8W C;  2RIQ A;  3AZI C;  3AZG B;  3WA9 B;  3LZ1 A;  5B32 D;  2Y2I A;  5G49 B;  3MGP C;  5JRG B;  1P3B B;  1P3L B;  3VH5 A;  1W2E A;  5CP6 B;  5GSU D;  1M18 A;  1ZLA A;  2HIO B;  4J8X B;  2NZD B;  4G92 B;  4KUD A;  1P3G C;  5AV8 A;  5B0Z A;  4J8V D;  3UT9 A;  2F8N K;  4H9Q B;  5BT1 D;  3MGS D;  5CPK C;  5AV6 D;  1BH8 A;  1M19 D;  4XUJ D;  3MNN D;  4WV4 B;  4G91 B;  1N1J B;  4YS3 D;  2G5I C;  2Y2M A;  5GSU A;  1M18 B;  1ZLA B;  3AV2 B;  5AV8 B;  2J8P A;  3KWQ D;  5B2I D;  3MGS A;  3LEL B;  4YM6 C;  4WU8 C;  3MGQ D;  5B24 C;  5AV6 A;  5B32 B;  1P3P C;  1M19 A;  4XUJ A;  2BYM A;  4Z66 C;  3W97 C;  3H0M C;  5GT3 D;  1TZY D;  4YS3 A;  1P3M D;  3KFU G;  3LZ0 D;  5FUG A;  3LJA C;  5AVB A;  5JRG C;  3KWQ A;  4J8V B;  3UTA A;  5DNN C;  3AZE C;  5B1M A;  3AV1 C;  3B0D C;  2Y2O A;  5AV6 B;  2YFW A;  3AN2 A;  4XUJ B;  3MNN B;  3REL A;  2HIO C;  4J8X C;  5GT3 A;  1TZY A;  1P3O C;  4J8W D;  1P3M A;  5AV5 A;  3V9R B;  2PYO C;  2W8S A;  3MGP D;  3AZJ B;  3KUY C;  3KWQ B;  2LY8 A;  5B2I B;  1Q9C A;  5E5A B;  5BNV B;  3MGQ B;  2XD5 A;  3EPL A;  1P3G D;  3VH5 W;  3AV2 C;  3UTB C;  3AZI A;  1TAF B;  5CPK D; 
#chains in the Genus database with same CATH homology
 2CV5 C;  4NE5 A;  5F99 B;  4H9R A;  3LZ0 B;  3W96 C;  3MGR A;  2JCH A;  4DQY B;  3P5J B;  1F66 A;  4R8P C;  3AZK A;  1KX5 A;  3WKJ C;  4J8W B;  4YM6 D;  4WU8 D;  5B24 D;  3REJ B;  3X1V C;  5B40 A;  1P3P D;  1KX4 B;  3A6N B;  3MGP B;  4Z66 D;  3W97 D;  5DNM A;  5B1L A;  3C1B B;  4E44 A;  3X1U C;  2DF4 C;  1JFI B;  3AL0 C;  3LJA D;  2BYK A;  1P3G B;  5JRG D;  3AZE D;  3AZJ C;  5DNN D;  3AV1 D;  5B0Y C;  1M1A A;  4WU8 A;  4YM6 A;  1P3K C;  5B24 A;  5CPK B;  4EO5 B;  5E5A C;  3AZH C;  3AZL B;  2HIO D;  4Z66 A;  4QLC C;  1P3O D;  3AZF B;  4KHA A;  2PYO D;  2UWX A;  3AZG A;  3B6G C;  3WA9 A;  5C3I B;  2Y2N A;  3KSY A;  5G49 A;  5F99 C;  5JRG A;  3KUY D;  1P3L A;  3AV1 A;  5CP6 A;  4YM6 B;  4NE3 A;  1P3P B;  1U35 C;  3X1S C;  3REK C;  2HIO A;  4J8X A;  2NZD A;  3AV2 D;  2Y2G A;  1A7W A;  4UPK A;  3UTB D;  3W97 B;  3VH5 T;  1P3O A;  2FJ7 C;  2PYO A;  2IO5 C;  4H9Q A;  5BO0 B;  2CV5 D;  2Y2P A;  2F2A C;  3REJ C;  3LJA B;  3W96 D;  1KX4 C;  1Z2C B;  3KUY A;  3A6N C;  3AZE B;  4WU9 C;  4HGA B;  5DNN B;  3AV1 B;  1AOI B;  1N1J A;  3B0D B;  3C1B C;  4R8P D;  4UUZ B;  3AV2 A;  3UTB A;  1P3O B;  3WKJ D;  4H9P B;  3B6F C;  5GT0 C;  1ID3 C;  2CV5 A;  2PYO B;  3LEL A;  3X1V D;  2NQB B;  4EO5 C;  3H0R C;  5B32 A;  3AZM C;  3B0B A;  3AZL C;  3KUY B;  1B67 A;  2L5A A;  1P3A C;  3X1U D;  3AZF C;  2ZY3 A;  5C3I C;  3AZJ D;  3AFA C;  3UTB B;  1S32 B;  5B0Y D;  3WKJ A;  4J8V A;  1P3K D;  3TU4 C;  4KGC C;  2CV5 B;  3X1V A;  5E5A D;  5CPI B;  3AZH D;  2F8N B;  3W96 B;  3MNN A;  4QLC D;  3IP4 C;  1P3I C;  3B6G D;  3V9R A;  4R8P B;  4LD9 B;  3AZN B;  5F99 D;  4X23 B;  3AZJ A;  3WKJ B;  4HGA C;  1P3K A;  2YFV A;  1H3O B;  5B2I A;  1AOI C;  5E5A A;  3REI C;  3X1V B;  5BNV A;  3X1S D;  3MGQ A;  1U35 D;  3REK D;  1KX3 C;  2ZY2 A;  4E45 A;  1B6W A;  1BFM A;  4CAY A;  3NQU B;  2FJ7 D;  3X1U B;  3B6G A;  1TAF A;  2NQB C;  3REJ D;  5B31 B;  1KX4 D;  3F6T A;  5F99 A;  3LZ0 A;  3A6N D;  4WU9 D;  1P3F D;  3MVD C;  5B32 G;  5B0Y B;  3VH6 T;  3O62 B;  1P3K B;  2YFV B;  2Y2L A;  3C1B D;  3AZH B;  3NQJ B;  4CAY B;  5BS7 A;  4QLC B;  3B6F D;  5GT0 D;  5KDM B;  1S32 C;  1ID3 D;  3VH6 A;  4J8W A;  3B6G B;  4J8U C;  3REJ A;  3AZM D;  5CPI C;  4H9O A;  3WTP C;  1KX4 A;  3AZL D;  3A6N A;  3MGP A;  1KU5 A;  1P3A D;  3AZF D;  4CSR B;  3C1B A;  3KXB C;  1U35 B;  3X1S B;  1JFI A;  3REK B;  4LD9 C;  3AFA D;  4M6B A;  3AZN C;  1P3G A;  3B6F A;  4X23 C;  5GT0 A;  1ID3 A;  2FJ7 B;  3TU4 D;  4KGC D;  2IO5 B;  5CPK A;  3AZM A;  4H9O B;  3AZL A;  1P3F B;  4WU9 B;  4KUD C;  3UT9 C;  3AZF A;  1P3I D;  2RVQ C;  3A1K A;  4ZBJ C;  5B31 C;  5BNX B;  3AFA A;  4H9N B;  3B6F B;  3WAA C;  5CPJ B;  5GT0 B;  1ID3 B;  3TU4 A;  1AOI D;  4KGC A;  3C1C C;  3REI D;  3EG5 B;  3O62 C;  4WJ3 C;  1KX3 D;  3AZM B;  1P3P A;  3W97 A;  1EQZ C;  1P3A B;  5BO0 A;  2NQB D;  4H9S C;  3LJA A;  3MVD D;  3AFA B;  1WWS A;  3AZE A;  5DNN A;  1AOI A;  3TU4 B;  4KGC B;  1KX3 A;  4UUZ A;  5AVB C;  3UTA C;  1S32 D;  4H9P A;  1P3I B;  3B0C W;  4J8U D;  2NQB A;  3REH C;  5CPI D;  3WTP D;  3AN2 C;  2F8N D;  2VQR A;  4Z2M H;  3MVD A;  3REL C;  4Z5T B;  1P34 D;  1P3F C;  3VH6 W;  2ARO C;  4Z2M G;  3KXB D;  5AV5 C;  3REI B;  4WNN A;  4XZQ B;  1KX3 B;  5AY8 B;  4LD9 D;  3AZN D;  4X23 D;  1S32 A;  5AVC C;  1ULY A;  3W98 C;  2HUE B;  5CPJ C;  4J8U A;  5CPI A;  2F8N A;  4KUD D;  3W96 A;  3UT9 D;  3MVD B;  5GXQ B;  2RVQ D;  3KXB A;  4WNN B;  4R8P A;  5B31 D;  4LD9 A;  3AZN A;  3MGR C;  4X23 A;  3WAA D;  5AV9 B;  3C1C D;  3O62 D;  1H3O A;  1F66 C;  4J8U B;  4JJN B;  3R45 B;  2Y2Q A;  1T3U A;  3WTP B;  1BH9 B;  1WWI A;  3AZK C;  2JE5 A;  3AYW C;  1KX5 C;  3W99 C;  3NQU A;  1EQZ D;  1P34 B;  5JA4 B;  4ZUX C;  2BG1 A;  3KXB B;  3X1U A;  3LZ1 B;  5B33 C;  5B40 C;  5B2J C;  5B31 A;  5DNM C;  3WAA A;  5B0Y A;  5B1L C;  4Z5T C;  3C1C A;  3O62 A;  1HQ3 C;  2XD1 A;  5CHL B;  3AZH A;  5AVB D;  4XZQ C;  3X1T C;  5AY8 C;  4KUD B;  3NQJ A;  3UT9 B;  5B0Z B;  3UTA D;  1EQZ A;  4QLC A;  5B1M D;  1M1A C;  5KDM A;  3REH D;  2HUE C;  4ZBJ B;  3B0C T;  3FDD A;  4H9S A;  1BH8 B;  2F8N H;  3AN2 D;  3REL D;  2FFF B;  3WAA B;  2F8N G;  4NE6 A;  2ARO D;  3C1C B;  5GSU B;  4CSR A;  5AV5 D;  3AZG C;  5GXQ C;  3WA9 C;  1U35 A;  3X1S A;  2Y2K A;  3REK A;  1P3B C;  5AVC D;  1P3L C;  1EQZ B;  3W98 D;  5CPJ D;  5CP6 C;  5AV9 C;  3MGS B;  2FJ7 A;  3REH A;  3H0L C;  3WTP E;  1M19 B;  4JJN C;  4AWL B;  2BYM B;  2NZD C;  4G92 C;  1P3F A;  4WU9 A;  2JSS A;  4YS3 B;  2ARO A;  3AZI D;  1P34 C;  5FUG B;  2CWE A;  3LZ1 C;  5AVB B;  3MGR D;  5BNX A;  3UTA B;  4H9N A;  5B31 G;  5AVC A;  3W98 A;  5B1M B;  5CPJ A;  4G91 C;  3A1I A;  2ZY5 A;  1F66 D;  3EPK A;  3REH B;  1M18 C;  1ZLA C;  1F1E A;  2YFW B;  3AZK D;  3AN2 B;  3AYW D;  3REL B;  1KX5 D;  3W99 D;  5GT3 B;  1TZY B;  5AV8 C;  5B0Z C;  4ZUX D;  2ARO B;  1P3A A;  1P3M B;  5AV5 B;  5B33 D;  3LEL C;  5B40 D;  5B2J D;  5B32 C;  5DNM D;  2DQN C;  5AVC B;  5B1L D;  4Z5T D;  3W98 B;  1R4V A;  1HQ3 D;  4DRB A;  5GSU C;  3X1T D;  4XZQ D;  5AY8 D;  3AYW A;  3W99 A;  1M1A D;  4J8V C;  4ZUX A;  3AZI B;  5B33 A;  1P3I A;  5BT1 C;  4WZS B;  3MGS C;  5B2J A;  2Y2J A;  5AV6 C;  4H9R B;  1M19 C;  3MGR B;  4XUJ C;  3MNN C;  4AWL C;  4Z5T A;  2Y2H A;  4YS3 C;  5GXQ D;  1HQ3 A;  3AZG D;  1F66 B;  3WA9 D;  3REI A;  3X1T A;  4XZQ A;  5AY8 A;  3AZK B;  3AYW B;  1P3B D;  1KX5 B;  3W99 B;  1P3L D;  3EPH A;  5CP6 D;  5AV9 D;  3KWQ C;  4ZUX B;  1HTA A;  2ZY4 A;  5B1M C;  5B2I C;  2ZM5 A;  5B33 B;  5B40 B;  5B2J B;  4JJN D;  3MGQ C;  4J8X D;  2NZD D;  5DNM B;  4NFT A;  5B1L B;  5GT3 C;  1TZY C;  5GXQ A;  1P3M C;  1HQ3 B;  4DRA A;  2G5H C;  3LZ1 D;  1PZR A;  3X1T B;  2BYK B;  3LZ0 C;  1P3B A;  3EPJ A;  1M1A B;  5AV9 A;  4WU8 B;  5B24 B;  1M18 D;  1ZLA D;  4JJN A;  3R45 A;  3WTP A;  1BH9 A;  4Z66 B;  5BS7 C;  5AV8 D;  5B0Z D;  1P34 A;  4KHA B;  5JA4 A;  3LEL D;  4J8W C;  2RIQ A;  3AZI C;  3AZG B;  3WA9 B;  3LZ1 A;  5B32 D;  2Y2I A;  5G49 B;  3MGP C;  5JRG B;  1P3B B;  1P3L B;  3VH5 A;  1W2E A;  5CP6 B;  5GSU D;  1M18 A;  1ZLA A;  2HIO B;  4J8X B;  2NZD B;  4G92 B;  4KUD A;  1P3G C;  5AV8 A;  5B0Z A;  4J8V D;  3UT9 A;  2F8N K;  4H9Q B;  5BT1 D;  3MGS D;  5CPK C;  5AV6 D;  1BH8 A;  1M19 D;  4XUJ D;  3MNN D;  4WV4 B;  4G91 B;  1N1J B;  4YS3 D;  2G5I C;  2Y2M A;  5GSU A;  1M18 B;  1ZLA B;  3AV2 B;  5AV8 B;  2J8P A;  3KWQ D;  5B2I D;  3MGS A;  3LEL B;  4YM6 C;  4WU8 C;  3MGQ D;  5B24 C;  5AV6 A;  5B32 B;  1P3P C;  1M19 A;  4XUJ A;  2BYM A;  4Z66 C;  3W97 C;  3H0M C;  5GT3 D;  1TZY D;  4YS3 A;  1P3M D;  3KFU G;  3LZ0 D;  5FUG A;  3LJA C;  5AVB A;  5JRG C;  3KWQ A;  4J8V B;  3UTA A;  5DNN C;  3AZE C;  5B1M A;  3AV1 C;  3B0D C;  2Y2O A;  5AV6 B;  2YFW A;  3AN2 A;  4XUJ B;  3MNN B;  3REL A;  2HIO C;  4J8X C;  5GT3 A;  1TZY A;  1P3O C;  4J8W D;  1P3M A;  5AV5 A;  3V9R B;  2PYO C;  2W8S A;  3MGP D;  3AZJ B;  3KUY C;  3KWQ B;  2LY8 A;  5B2I B;  1Q9C A;  5E5A B;  5BNV B;  3MGQ B;  2XD5 A;  3EPL A;  1P3G D;  3VH5 W;  3AV2 C;  3UTB C;  3AZI A;  1TAF B;  5CPK D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...