4J8VC

X-ray structure of ncp145 with bound chlorido(eta-6-p-cymene)(n-phenyl-2-pyridinecarbothioamide)ruthenium(ii)
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
106
structure length
106
Chain Sequence
AKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords Histone H3.2
publication title Novel metal(II) arene 2-pyridinecarbothioamides: a rationale to orally active organometallic anticancer agents
doi rcsb
source organism Xenopus laevis
total genus 33
structure length 106
sequence length 106
chains with identical sequence G
ec nomenclature
pdb deposition date 2013-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4j8vC00
1P3IC 1P3PC 5B32B 5B33D 5BNXA 4YM6D 3W96A 4JJNA 1H3OA 5AVCB 4KUDC 1U35C 3LZ1C 2NZDC 4YS3B 3V9RA 1EQZA 4JJND 5FUGA 5AV8A 3W96D 5E5AD 5B2IA 1M18A 5DNMA 3B6FC 1TAFB 4J8VB 5AV8D 3AZEB 3MGRA 5DNMD 1M18D 4H9OB 3UTBB 3LZ0D 3AZGA 1KX3D 5B24C 3C1BA 3MGRD 4Z66A 5B33C 5DNNA 3AZKB 1P3MC 5AV9A 1JFIB 4G92B 3AZGD 5CPKA 3C1BD 2PYOA 3W98B 5AV5B 5AV9D 3WAAC 4JJNC 3WA9D 5CPKD 3VH6A 4NE3A 5JRGC 5E5AC 5C3IB 1S32A 2PYOD 3AV2A 3VH5T 4ZUXC 5AY8B 3X1UB 3AV2D 4J8XD 3REHB 4XZQC 4QLCC 3AZFB 4M6BA 3W97A 3MVDB 3LZ0C 3R45B 3MGQD 1KX3C 3W97D 3RELA 3AZMB 5CPJB 1M19C 1ZLAA 1P3FA 1P34D 5AV9C 3REJA 3AZHA 3WA9C 3RELD 5CPKC 3MGSD 3KXBD 1P3FD 2PYOC 3X1VB 3O62D 3X1TD 3AZLD 3AZHD 4R8PC 3REKD 5B1MD 4CSRA 5AVBB 3A6ND 1JFIA 4J8XC 5JA4B 3W98A 5CHLB 5AV5A 3AYWB 3MGQC 1F66A 4J8UA 2F8NB 3AZJA 2IO5B 3W97C 1HQ3B 4CAYA 4J8UD 5B31D 3AZJD 1P34C 1P3LC 3AZID 3X1SB 3MGSC 5GXQA 4KGCC 3KXBC 1P3BB 3R45A 3REIA 3O62C 3X1TC 3AZLC 5GXQD 3REKC 5B1MC 3AZNB 3A6NC 5F99B 5B0YC 3AV1A 3NQJB 5GT0A 3AN2D 2RVQD 4H9PA 3KUYB 3AV1D 5GT0D 5B40B 3C1CC 1P3IB 5B2JA 3LELC 3MGPC 5B0ZD 3NQUB 5B31C 1P3AA 3AZIC 3WKJC 4KUDB 1U35B 1N1JB 5B2JD 1ID3B 3LZ1B 1P3AD 2CV5A 3UT9A 3W99A 1TZYC 3KWQC 2CV5D 5KDMA 3AN2C 3W99D 1P3KD 5GT0C 4NFTA 5B24B 5B0ZC 5B33B 1P3MB 4Z5TD 3MNNA 2HIOD 2FJ7D 2BYMB 3NQJA 5GSUD 3MNND 3WAAB 5JRGB 5CP6A 3AFAC 1KX5C 2HUEC 4H9QB 3TU4D 4EO5B 4KHAA 4UUZB 4ZUXB 1B6WA 2F8NH 4WU9A 4XZQB 1KU5A 4QLCB 1P3KC 1ID3A 5AV6C 1P3OB 1AOIB 3LZ0B 5GT3D 1KX3B 3LJAA 4Z5TC 2HIOC 1M19B 5GSUC 4NE5A 4J8WB 2FJ7C 3B6GC 1BH9B 3WA9B 1EQZD 3B0DB 5B2ID 2NQBC 4LD9A 3TU4C 4WNNA 4WU8C 5BS7C 4R8PB 5G49A 4J8XB 4WZSB 5GT3C 3WTPA 3MGQB 2F8NG 4YM6C 4X23B 4Z66D 4G91C 5DNND 1KX4B 3WTPD 3W96C 2AROA 1P34B 1P3LB 1M1AB 5B32A 1EQZC 4KGCB 1P3OA 5AV8C 2AROD 3KXBB 1AOIA 5B2IC 3O62B 1S32D 5AVCA 5DNMC 1M18C 5B32D 4YS3A 5B1MB 5B0YB 5AVCD 3MGRC 4YS3D 1TAFA 3AZGC 4J8VA 1P3GB 3C1BC 4Z66C 5DNNC 3C1CB 3WTPC 2YFVB 3LELB 3AZEA 5CPIB 3MGPB 5B31B 1ZLAD 4H9OA 4J8VD 3UTBA 5BO0B 3AZIB 3WKJB 4WV4B 3AZED 3REJD 3AZKA 3UTBD 1S32C 4X23A 3AV2C 5B1LB 5B32C 3VH6T 3AZKD 4XUJB 1TZYB 2YFWB 3KWQB 3W98D 1M1AA 5AV5D 1F66D 5AY8A 3UTAB 3X1UA 3REHA 5B0ZB 3AZFA 3RELC 1ZLAC 3MVDA 1P3FC 3AZEC 5BT1D 3REJC 3REHD 3AZHC 4H9SA 3MVDD 3AZMA 5CPJA 3REID 1P3GA 4H9RB 3AFAB 1KX5B 5CPIA 2HUEB 5CPJD 5BO0A 3W98C 3X1VA 5AV5C 1P3PB 1F66C 4ZBJC 5AV6B 4J8UC 3AZJC 5C3IC 5AVBA 5B1LA 3X1VD 5JA4A 2NZDB 3AYWA 4XUJA 4Z5TB 2HIOB 2F8NA 5BT1C 3B6GB 5GXQC 3MVDC 4NE6A 3AYWD 3B6FB 3REIC 1HQ3A 2F8ND 3UTAA 3UT9D 3X1SA 2NQBB 2RVQC 3TU4B 4WU8B 1HQ3D 3AV1C 3B0BA 1P3BA 2LY8A 5GT3B 3AZNA 5F99A 1P3BD 4YM6B 5B2JC 4H9RA 4HGAC 5BNXB 3AZND 1P3AC 4JJNB 3W96B 3KUYA 1H3OB 3KSYA 5E5AB 5B40A 1P3IA 1P3PA 3V9RB 4E45A 3NQUA 5FUGB 5AV8B 3KUYD 2CV5C 3W99C 5CP6D 5B40D 3UT9C 1M18B 5DNMB 4KUDA 1U35A 1N1JA 1BFMA 3LZ1A 2NZDA 3MGRB 4WU9D 1U35D 1ID3D 3LZ1D 1P3BC 3B6FA 3AZGB 3C1BB 2JSSA 4Z66B 3LJAD 5AV9B 3MNNC 5B31G 4H9NB 4Z2MH 5CPKB 2PYOB 5B24A 5B33A 1P3MA 5CP6C 3B0CT 1S32B 3AV2B 2BYMA 5B24D 4LD9D 1P3MD 3WAAA 2CWEA 5JRGA 3VH5A 5E5AA 4WU9C 1ID3C 3W97B 4H9QA 3VH5W 4UUZA 3WAAD 4ZUXA 5JRGD 3LJAC 4XZQA 4QLCA 3RELB 3MGSB 1ZLAB 4ZUXD 1P3FB 3LZ0A 1KX3A 3X1TB 3AZHB 3REJB 4AWLC 4Z2MG 3AZLB 2BYKB 4QLCD 4XZQD 3REKB 1P3OD 3A6NB 1AOID 1M19A 4J8WA 4LD9C 2F8NK 4CSRB 1BH9A 3WA9A 1M19D 4H9NA 4J8WD 1BH8B 1F66B 4ZBJB 4J8UB 4R8PA 3AZJB 4J8XA 1HTAA 3VH6W 4EO5C 2AROC 4CAYB 4R8PD 3MGQA 1WWSA 5GXQB 1P3OC 1KX4A 1AOIC 3REIB 4X23D 5AVCC 5BNVB 1P34A 3AN2B 1P3LA 4YS3C 1KX4D 3MGSA 4J8WC 4KGCA 3AV1B 5GT0B 3KXBA 3O62A 3X1TA 3AZLA 1P3LD 1M1AD 2BYKA 4H9PB 4KGCD 4J8VC 5B1MA 3REKA 5AY8D 3B0DC 3A6NA 3X1UD 5B0YA 5B2JB 1B67A 4HGAB 3AZFD 3UTBC 1P3AB 5B0YD 3AZKC 3C1CA 2YFVA 1BH8A 3LELA 3MGPA 4DRAA 4X23C 4G92C 5B31A 3AZMD 2CV5B 1P3GD 3UT9B 3W99B 3AZIA 1KX4C 3WKJA 3C1CD 5CPID 3LELD 1ULYA 3MGPD 1P3KB 5KDMB 1M1AC 3WKJD 4E44A 5AY8C 3X1UC 1TZYA 5AVBD 2FJ7B 5GSUB 2YFWA 3KWQA 5B1LD 3REHC 5BNVA 3AZFC 3AN2A 4XUJD 1A7WA 3MNNB 1TZYD 1F1EA 3KWQD 4H9SC 5B0ZA 3AZMC 5CPJC 1P3GC 5CP6B 3UTAD 5B32G 5CPIC 3X1SD 4KHAB 2L5AA 3X1VC 4WU9B 3AFAA 1KX5A 4G91B 1Q9CA 5AVBC 5F99D 5B1LC 3LJAB 3AFAD 1KX5D 3AYWC 4XUJC 1EQZB 1P3KA 5AV6A 5B2IB 2IO5C 4AWLB 1P3ID 1P3PD 1HQ3C 5AV6D 4Z5TA 3WTPE 3UTAC 2HIOA 2FJ7A 1R4VA 5GSUA 4DRBA 3X1SC 3B6GA 4LD9B 4KUDD 4WNNB 2NZDD 5G49B 3B6GD 5DNNB 3WTPB 3AZNC 3TU4A 5F99C 2NQBA 3B6FD 4WU8A 5BS7A 3B0CW 2NQBD 4WU8D 2AROB 3KUYC 5GT3A 5B40C 4YM6A 1WWIA
chains in the Genus database with same CATH superfamily
1P3IC 1P3PC 5B32B 5B33D 5BNXA 4YM6D 3W96A 4JJNA 3F6TA 1H3OA 5AVCB 4KUDC 1U35C 3LZ1C 2NZDC 4YS3B 3V9RA 1EQZA 2VQRA 4JJND 5FUGA 5AV8A 3W96D 5E5AD 5B2IA 1M18A 5DNMA 3B6FC 1TAFB 2F2AC 4J8VB 5AV8D 3AZEB 3MGRA 5DNMD 1M18D 4H9OB 3UTBB 2DQNC 3LZ0D 3AZGA 1KX3D 5B24C 3C1BA 3MGRD 4Z66A 5B33C 5DNNA 3AZKB 1P3MC 5AV9A 1JFIB 4G92B 3AZGD 5CPKA 3C1BD 2PYOA 3W98B 5AV5B 5AV9D 3WAAC 4JJNC 3WA9D 5CPKD 3VH6A 4NE3A 3A1KA 5E5AC 5JRGC 5C3IB 1S32A 2PYOD 3AV2A 3VH5T 4ZUXC 5AY8B 3X1UB 3AV2D 4J8XD 3REHB 4XZQC 4QLCC 3AZFB 4M6BA 3W97A 3MVDB 3LZ0C 3R45B 3MGQD 3H0RC 1KX3C 3W97D 3RELA 3AZMB 5CPJB 1M19C 3EG5B 1ZLAA 1P3FA 1P34D 5AV9C 3REJA 3AZHA 3WA9C 3RELD 5CPKC 3MGSD 3EPHA 3KXBD 1P3FD 2PYOC 3X1VB 3O62D 3X1TD 3AZLD 3AZHD 4R8PC 3REKD 5B1MD 4CSRA 5AVBB 3A6ND 1JFIA 4J8XC 5JA4B 3W98A 5CHLB 5AV5A 3AYWB 3MGQC 1F66A 4J8UA 2F8NB 3AZJA 2Y2MA 2IO5B 3W97C 1HQ3B 4CAYA 4J8UD 5B31D 3AZJD 1P34C 1P3LC 3AZID 3X1SB 3MGSC 5GXQA 4KGCC 3KXBC 1P3BB 3R45A 2ZY3A 3REIA 3O62C 3X1TC 3AZLC 5GXQD 3REKC 5B1MC 3AZNB 3A6NC 5F99B 5B0YC 3AV1A 3NQJB 5GT0A 3AN2D 4UPKA 2RVQD 4H9PA 3KUYB 3AV1D 5GT0D 5B40B 3C1CC 1P3IB 5B2JA 3LELC 3MGPC 5B0ZD 3NQUB 5B31C 1P3AA 3AZIC 3WKJC 4KUDB 1U35B 1N1JB 5B2JD 1ID3B 2G5IC 3LZ1B 1P3AD 2CV5A 3UT9A 3W99A 1TZYC 3KWQC 2CV5D 5KDMA 3AN2C 3W99D 1P3KD 5GT0C 4NFTA 5B24B 5B0ZC 5B33B 1P3MB 4Z5TD 3MNNA 2HIOD 2FJ7D 2BYMB 3NQJA 5GSUD 3MNND 3WAAB 5JRGB 5CP6A 3AFAC 1KX5C 2HUEC 4H9QB 3TU4D 4EO5B 4KHAA 4UUZB 4ZUXB 1B6WA 2F8NH 4WU9A 4XZQB 1KU5A 4QLCB 1P3KC 1ID3A 5AV6C 3EPJA 1P3OB 2Y2PA 1AOIB 3LZ0B 5GT3D 1KX3B 3LJAA 4Z5TC 2HIOC 1M19B 5GSUC 4NE5A 4J8WB 2FJ7C 3B6GC 2JE5A 1BH9B 3WA9B 1EQZD 3B0DB 2Y2HA 3FDDA 5B2ID 2NQBC 4LD9A 3TU4C 4WNNA 4WU8C 5BS7C 4R8PB 5G49A 4J8XB 4WZSB 5GT3C 3WTPA 3MGQB 2F8NG 4YM6C 4X23B 1W2EA 4Z66D 4G91C 5DNND 1KX4B 3WTPD 3W96C 2AROA 1P34B 1P3LB 1M1AB 5B32A 1EQZC 4KGCB 1P3OA 5AV8C 2AROD 3KXBB 1AOIA 5B2IC 3O62B 1S32D 3H0LC 5AVCA 5DNMC 1M18C 5B32D 4YS3A 5B1MB 2FFFB 5B0YB 5AVCD 3MGRC 4YS3D 1TAFA 3AZGC 4J8VA 1P3GB 3C1BC 4Z66C 5DNNC 2J8PA 3C1CB 3WTPC 2YFVB 3LELB 3AZEA 5CPIB 3MGPB 5B31B 1ZLAD 4H9OA 4J8VD 2Y2QA 3UTBA 5BO0B 3AZIB 3WKJB 4WV4B 3AZED 3REJD 3AZKA 3UTBD 1S32C 4X23A 3AV2C 5B1LB 5B32C 3VH6T 3AZKD 4XUJB 1TZYB 2YFWB 3KWQB 3W98D 1M1AA 5AV5D 1F66D 3H0MC 5AY8A 3UTAB 3X1UA 3REHA 5B0ZB 3AZFA 3RELC 1ZLAC 3MVDA 1P3FC 3AZEC 5BT1D 3REJC 3REHD 3AZHC 4H9SA 3MVDD 3AZMA 5CPJA 3REID 1P3GA 2G5HC 4H9RB 3AFAB 1KX5B 5CPIA 2HUEB 5CPJD 5BO0A 3W98C 3X1VA 5AV5C 1P3PB 2DF4C 1F66C 4ZBJC 5AV6B 4J8UC 3AZJC 5C3IC 5AVBA 5B1LA 3X1VD 2W8SA 5JA4A 2NZDB 3AYWA 4XUJA 4Z5TB 2HIOB 2F8NA 5BT1C 3B6GB 2ZY5A 5GXQC 3KFUG 3MVDC 4NE6A 3AYWD 3B6FB 3REIC 1HQ3A 2F8ND 2UWXA 3UTAA 2Y2KA 3UT9D 3X1SA 2NQBB 2RVQC 3TU4B 2Y2NA 4WU8B 1HQ3D 3AV1C 1T3UA 3B0BA 2ZM5A 1P3BA 2LY8A 5GT3B 3AZNA 2Y2JA 5F99A 4YM6B 1P3BD 5B2JC 4H9RA 4HGAC 5BNXB 3AZND 1P3AC 4JJNB 3W96B 3KUYA 1H3OB 3KSYA 5E5AB 3EPKA 5B40A 1P3IA 1P3PA 3V9RB 4E45A 3NQUA 2Y2LA 5FUGB 5AV8B 3KUYD 2CV5C 3W99C 5CP6D 5B40D 3UT9C 1M18B 5DNMB 4KUDA 1U35A 1N1JA 1BFMA 3LZ1A 2NZDA 3MGRB 4WJ3C 4WU9D 1U35D 3EPLA 1ID3D 3LZ1D 1P3BC 3B6FA 3AZGB 3C1BB 2JSSA 4Z66B 3LJAD 5AV9B 3MNNC 5B31G 4H9NB 4Z2MH 5CPKB 2XD5A 2PYOB 5B24A 5B33A 2BG1A 1P3MA 5CP6C 3B0CT 1PZRA 1S32B 3AV2B 2BYMA 5B24D 4LD9D 1P3MD 3WAAA 2CWEA 3VH5A 5JRGA 5E5AA 4WU9C 1ID3C 3IP4C 3W97B 4H9QA 3VH5W 4UUZA 3WAAD 4ZUXA 5JRGD 3LJAC 4XZQA 4QLCA 2Y2GA 1Z2CB 3MGSB 3RELB 1ZLAB 4ZUXD 1P3FB 3LZ0A 1KX3A 3X1TB 3AZHB 3REJB 4AWLC 4Z2MG 3AZLB 2BYKB 2Y2OA 4QLCD 4XZQD 3AL0C 3REKB 1P3OD 3A6NB 1AOID 1M19A 4J8WA 4LD9C 2F8NK 4CSRB 1BH9A 3WA9A 1M19D 4H9NA 4J8WD 1BH8B 1F66B 4ZBJB 4J8UB 4R8PA 3AZJB 4J8XA 1HTAA 3VH6W 4EO5C 2AROC 4CAYB 4R8PD 3MGQA 1WWSA 5GXQB 1P3OC 1KX4A 3A1IA 1AOIC 3REIB 4X23D 5AVCC 5BNVB 1P34A 3AN2B 1P3LA 4YS3C 1KX4D 3MGSA 4J8WC 4KGCA 3AV1B 5GT0B 3KXBA 3O62A 3X1TA 3AZLA 1P3LD 1M1AD 2BYKA 4H9PB 4KGCD 4J8VC 5B1MA 3REKA 5AY8D 3B0DC 3A6NA 3X1UD 5B0YA 5B2JB 1B67A 4HGAB 3AZFD 3UTBC 1P3AB 5B0YD 3AZKC 3C1CA 2YFVA 1BH8A 3LELA 3MGPA 4DRAA 4X23C 4G92C 5B31A 3AZMD 2CV5B 1P3GD 3UT9B 3W99B 3AZIA 1KX4C 3WKJA 3C1CD 5CPID 3LELD 1ULYA 3MGPD 1P3KB 5KDMB 1M1AC 3WKJD 4E44A 5AY8C 3X1UC 1TZYA 5AVBD 2FJ7B 5GSUB 2YFWA 3KWQA 5B1LD 3REHC 5BNVA 3AZFC 3AN2A 4XUJD 1A7WA 3MNNB 1TZYD 1F1EA 3KWQD 4H9SC 5B0ZA 2ZY2A 3AZMC 5CPJC 1P3GC 5CP6B 3UTAD 5B32G 5CPIC 3X1SD 3P5JB 4KHAB 2L5AA 2ZY4A 3X1VC 4WU9B 2Y2IA 3AFAA 1KX5A 4G91B 1Q9CA 5AVBC 5F99D 5B1LC 3LJAB 4DQYB 3AFAD 1KX5D 3AYWC 4XUJC 1EQZB 1P3KA 5AV6A 5B2IB 2IO5C 4AWLB 1P3ID 1P3PD 1HQ3C 2JCHA 5AV6D 4Z5TA 3WTPE 3UTAC 2HIOA 2FJ7A 1R4VA 5GSUA 4DRBA 3X1SC 3B6GA 4LD9B 4KUDD 4WNNB 2NZDD 5G49B 3B6GD 5DNNB 3WTPB 3AZNC 3TU4A 5F99C 2NQBA 3B6FD 4WU8A 5BS7A 2RIQA 3B0CW 2XD1A 2NQBD 4WU8D 2AROB 3KUYC 5GT3A 5B40C 4YM6A 1WWIA
chains in the Genus database with same CATH topology
1P3IC 1P3PC 5B32B 5B33D 5BNXA 4YM6D 3W96A 4JJNA 3F6TA 1H3OA 5AVCB 4KUDC 1U35C 3LZ1C 2NZDC 4YS3B 3V9RA 1EQZA 2VQRA 4JJND 5FUGA 5AV8A 3W96D 5E5AD 5B2IA 1M18A 5DNMA 3B6FC 1TAFB 2F2AC 4J8VB 5AV8D 3AZEB 3MGRA 5DNMD 1M18D 4H9OB 3UTBB 2DQNC 3LZ0D 3AZGA 1KX3D 5B24C 3C1BA 3MGRD 4Z66A 5B33C 5DNNA 3AZKB 1P3MC 5AV9A 1JFIB 4G92B 3AZGD 5CPKA 3C1BD 2PYOA 3W98B 5AV5B 5AV9D 3WAAC 4JJNC 3WA9D 5CPKD 3VH6A 4NE3A 3A1KA 5E5AC 5JRGC 5C3IB 1S32A 2PYOD 3AV2A 3VH5T 4ZUXC 5AY8B 3X1UB 3AV2D 4J8XD 3REHB 4XZQC 4QLCC 3AZFB 4M6BA 3W97A 3MVDB 3LZ0C 3R45B 3MGQD 3H0RC 1KX3C 3W97D 3RELA 3AZMB 5CPJB 1M19C 3EG5B 1ZLAA 1P3FA 1P34D 5AV9C 3REJA 3AZHA 3WA9C 3RELD 5CPKC 3MGSD 3EPHA 3KXBD 1P3FD 2PYOC 3X1VB 3O62D 3X1TD 3AZLD 3AZHD 4R8PC 3REKD 5B1MD 4CSRA 5AVBB 3A6ND 1JFIA 4J8XC 5JA4B 3W98A 5CHLB 5AV5A 3AYWB 3MGQC 1F66A 4J8UA 2F8NB 3AZJA 2Y2MA 2IO5B 3W97C 1HQ3B 4CAYA 4J8UD 5B31D 3AZJD 1P34C 1P3LC 3AZID 3X1SB 3MGSC 5GXQA 4KGCC 3KXBC 1P3BB 3R45A 2ZY3A 3REIA 3O62C 3X1TC 3AZLC 5GXQD 3REKC 5B1MC 3AZNB 3A6NC 5F99B 5B0YC 3AV1A 3NQJB 5GT0A 3AN2D 4UPKA 2RVQD 4H9PA 3KUYB 3AV1D 5GT0D 5B40B 3C1CC 1P3IB 5B2JA 3LELC 3MGPC 5B0ZD 3NQUB 5B31C 1P3AA 3AZIC 3WKJC 4KUDB 1U35B 1N1JB 5B2JD 1ID3B 2G5IC 3LZ1B 1P3AD 2CV5A 3UT9A 3W99A 1TZYC 3KWQC 2CV5D 5KDMA 3AN2C 3W99D 1P3KD 5GT0C 4NFTA 5B24B 5B0ZC 5B33B 1P3MB 4Z5TD 3MNNA 2HIOD 2FJ7D 2BYMB 3NQJA 5GSUD 3MNND 3WAAB 5JRGB 5CP6A 3AFAC 1KX5C 2HUEC 4H9QB 3TU4D 4EO5B 4KHAA 4UUZB 4ZUXB 1B6WA 2F8NH 4WU9A 4XZQB 1KU5A 4QLCB 1P3KC 1ID3A 5AV6C 3EPJA 1P3OB 2Y2PA 1AOIB 3LZ0B 5GT3D 1KX3B 3LJAA 4Z5TC 2HIOC 1M19B 5GSUC 4NE5A 4J8WB 2FJ7C 3B6GC 2JE5A 1BH9B 3WA9B 1EQZD 3B0DB 2Y2HA 3FDDA 5B2ID 2NQBC 4LD9A 3TU4C 4WNNA 4WU8C 5BS7C 4R8PB 5G49A 4J8XB 4WZSB 5GT3C 3WTPA 3MGQB 2F8NG 4YM6C 4X23B 1W2EA 4Z66D 4G91C 5DNND 1KX4B 3WTPD 3W96C 2AROA 1P34B 1P3LB 1M1AB 5B32A 1EQZC 4KGCB 1P3OA 5AV8C 2AROD 3KXBB 1AOIA 5B2IC 3O62B 1S32D 3H0LC 5AVCA 5DNMC 1M18C 5B32D 4YS3A 5B1MB 2FFFB 5B0YB 5AVCD 3MGRC 4YS3D 1TAFA 3AZGC 4J8VA 1P3GB 3C1BC 4Z66C 5DNNC 2J8PA 3C1CB 3WTPC 2YFVB 3LELB 3AZEA 5CPIB 3MGPB 5B31B 1ZLAD 4H9OA 4J8VD 2Y2QA 3UTBA 5BO0B 3AZIB 3WKJB 4WV4B 3AZED 3REJD 3AZKA 3UTBD 1S32C 4X23A 3AV2C 5B1LB 5B32C 3VH6T 3AZKD 4XUJB 1TZYB 2YFWB 3KWQB 3W98D 1M1AA 5AV5D 1F66D 3H0MC 5AY8A 3UTAB 3X1UA 3REHA 5B0ZB 3AZFA 3RELC 1ZLAC 3MVDA 1P3FC 3AZEC 5BT1D 3REJC 3REHD 3AZHC 4H9SA 3MVDD 3AZMA 5CPJA 3REID 1P3GA 2G5HC 4H9RB 3AFAB 1KX5B 5CPIA 2HUEB 5CPJD 5BO0A 3W98C 3X1VA 5AV5C 1P3PB 2DF4C 1F66C 4ZBJC 5AV6B 4J8UC 3AZJC 5C3IC 5AVBA 5B1LA 3X1VD 2W8SA 5JA4A 2NZDB 3AYWA 4XUJA 4Z5TB 2HIOB 2F8NA 5BT1C 3B6GB 2ZY5A 5GXQC 3KFUG 3MVDC 4NE6A 3AYWD 3B6FB 3REIC 1HQ3A 2F8ND 2UWXA 3UTAA 2Y2KA 3UT9D 3X1SA 2NQBB 2RVQC 3TU4B 2Y2NA 4WU8B 1HQ3D 3AV1C 1T3UA 3B0BA 2ZM5A 1P3BA 2LY8A 5GT3B 3AZNA 2Y2JA 5F99A 4YM6B 1P3BD 5B2JC 4H9RA 4HGAC 5BNXB 3AZND 1P3AC 4JJNB 3W96B 3KUYA 1H3OB 3KSYA 5E5AB 3EPKA 5B40A 1P3IA 1P3PA 3V9RB 4E45A 3NQUA 2Y2LA 5FUGB 5AV8B 3KUYD 2CV5C 3W99C 5CP6D 5B40D 3UT9C 1M18B 5DNMB 4KUDA 1U35A 1N1JA 1BFMA 3LZ1A 2NZDA 3MGRB 4WJ3C 4WU9D 1U35D 3EPLA 1ID3D 3LZ1D 1P3BC 3B6FA 3AZGB 3C1BB 2JSSA 4Z66B 3LJAD 5AV9B 3MNNC 5B31G 4H9NB 4Z2MH 5CPKB 2XD5A 2PYOB 5B24A 5B33A 2BG1A 1P3MA 5CP6C 3B0CT 1PZRA 1S32B 3AV2B 2BYMA 5B24D 4LD9D 1P3MD 3WAAA 2CWEA 3VH5A 5JRGA 5E5AA 4WU9C 1ID3C 3IP4C 3W97B 4H9QA 3VH5W 4UUZA 3WAAD 4ZUXA 5JRGD 3LJAC 4XZQA 4QLCA 2Y2GA 1Z2CB 3MGSB 3RELB 1ZLAB 4ZUXD 1P3FB 3LZ0A 1KX3A 3X1TB 3AZHB 3REJB 4AWLC 4Z2MG 3AZLB 2BYKB 2Y2OA 4QLCD 4XZQD 3AL0C 3REKB 1P3OD 3A6NB 1AOID 1M19A 4J8WA 4LD9C 2F8NK 4CSRB 1BH9A 3WA9A 1M19D 4H9NA 4J8WD 1BH8B 1F66B 4ZBJB 4J8UB 4R8PA 3AZJB 4J8XA 1HTAA 3VH6W 4EO5C 2AROC 4CAYB 4R8PD 3MGQA 1WWSA 5GXQB 1P3OC 1KX4A 3A1IA 1AOIC 3REIB 4X23D 5AVCC 5BNVB 1P34A 3AN2B 1P3LA 4YS3C 1KX4D 3MGSA 4J8WC 4KGCA 3AV1B 5GT0B 3KXBA 3O62A 3X1TA 3AZLA 1P3LD 1M1AD 2BYKA 4H9PB 4KGCD 4J8VC 5B1MA 3REKA 5AY8D 3B0DC 3A6NA 3X1UD 5B0YA 5B2JB 1B67A 4HGAB 3AZFD 3UTBC 1P3AB 5B0YD 3AZKC 3C1CA 2YFVA 1BH8A 3LELA 3MGPA 4DRAA 4X23C 4G92C 5B31A 3AZMD 2CV5B 1P3GD 3UT9B 3W99B 3AZIA 1KX4C 3WKJA 3C1CD 5CPID 3LELD 1ULYA 3MGPD 1P3KB 5KDMB 1M1AC 3WKJD 4E44A 5AY8C 3X1UC 1TZYA 5AVBD 2FJ7B 5GSUB 2YFWA 3KWQA 5B1LD 3REHC 5BNVA 3AZFC 3AN2A 4XUJD 1A7WA 3MNNB 1TZYD 1F1EA 3KWQD 4H9SC 5B0ZA 2ZY2A 3AZMC 5CPJC 1P3GC 5CP6B 3UTAD 5B32G 5CPIC 3X1SD 3P5JB 4KHAB 2L5AA 2ZY4A 3X1VC 4WU9B 2Y2IA 3AFAA 1KX5A 4G91B 1Q9CA 5AVBC 5F99D 5B1LC 3LJAB 4DQYB 3AFAD 1KX5D 3AYWC 4XUJC 1EQZB 1P3KA 5AV6A 5B2IB 2IO5C 4AWLB 1P3ID 1P3PD 1HQ3C 2JCHA 5AV6D 4Z5TA 3WTPE 3UTAC 2HIOA 2FJ7A 1R4VA 5GSUA 4DRBA 3X1SC 3B6GA 4LD9B 4KUDD 4WNNB 2NZDD 5G49B 3B6GD 5DNNB 3WTPB 3AZNC 3TU4A 5F99C 2NQBA 3B6FD 4WU8A 5BS7A 2RIQA 3B0CW 2XD1A 2NQBD 4WU8D 2AROB 3KUYC 5GT3A 5B40C 4YM6A 1WWIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1P3I C;  1P3P C;  5B32 B;  5B33 D;  5BNX A;  4YM6 D;  3W96 A;  4JJN A;  1H3O A;  5AVC B;  4KUD C;  1U35 C;  3LZ1 C;  2NZD C;  4YS3 B;  3V9R A;  1EQZ A;  4JJN D;  5FUG A;  5AV8 A;  3W96 D;  5E5A D;  5B2I A;  1M18 A;  5DNM A;  3B6F C;  1TAF B;  4J8V B;  5AV8 D;  3AZE B;  3MGR A;  5DNM D;  1M18 D;  4H9O B;  3UTB B;  3LZ0 D;  3AZG A;  1KX3 D;  5B24 C;  3C1B A;  3MGR D;  4Z66 A;  5B33 C;  5DNN A;  3AZK B;  1P3M C;  5AV9 A;  1JFI B;  4G92 B;  3AZG D;  5CPK A;  3C1B D;  2PYO A;  3W98 B;  5AV5 B;  5AV9 D;  3WAA C;  4JJN C;  3WA9 D;  5CPK D;  3VH6 A;  4NE3 A;  5JRG C;  5E5A C;  5C3I B;  1S32 A;  2PYO D;  3AV2 A;  3VH5 T;  4ZUX C;  5AY8 B;  3X1U B;  3AV2 D;  4J8X D;  3REH B;  4XZQ C;  4QLC C;  3AZF B;  4M6B A;  3W97 A;  3MVD B;  3LZ0 C;  3R45 B;  3MGQ D;  1KX3 C;  3W97 D;  3REL A;  3AZM B;  5CPJ B;  1M19 C;  1ZLA A;  1P3F A;  1P34 D;  5AV9 C;  3REJ A;  3AZH A;  3WA9 C;  3REL D;  5CPK C;  3MGS D;  3KXB D;  1P3F D;  2PYO C;  3X1V B;  3O62 D;  3X1T D;  3AZL D;  3AZH D;  4R8P C;  3REK D;  5B1M D;  4CSR A;  5AVB B;  3A6N D;  1JFI A;  4J8X C;  5JA4 B;  3W98 A;  5CHL B;  5AV5 A;  3AYW B;  3MGQ C;  1F66 A;  4J8U A;  2F8N B;  3AZJ A;  2IO5 B;  3W97 C;  1HQ3 B;  4CAY A;  4J8U D;  5B31 D;  3AZJ D;  1P34 C;  1P3L C;  3AZI D;  3X1S B;  3MGS C;  5GXQ A;  4KGC C;  3KXB C;  1P3B B;  3R45 A;  3REI A;  3O62 C;  3X1T C;  3AZL C;  5GXQ D;  3REK C;  5B1M C;  3AZN B;  3A6N C;  5F99 B;  5B0Y C;  3AV1 A;  3NQJ B;  5GT0 A;  3AN2 D;  2RVQ D;  4H9P A;  3KUY B;  3AV1 D;  5GT0 D;  5B40 B;  3C1C C;  1P3I B;  5B2J A;  3LEL C;  3MGP C;  5B0Z D;  3NQU B;  5B31 C;  1P3A A;  3AZI C;  3WKJ C;  4KUD B;  1U35 B;  1N1J B;  5B2J D;  1ID3 B;  3LZ1 B;  1P3A D;  2CV5 A;  3UT9 A;  3W99 A;  1TZY C;  3KWQ C;  2CV5 D;  5KDM A;  3AN2 C;  3W99 D;  1P3K D;  5GT0 C;  4NFT A;  5B24 B;  5B0Z C;  5B33 B;  1P3M B;  4Z5T D;  3MNN A;  2HIO D;  2FJ7 D;  2BYM B;  3NQJ A;  5GSU D;  3MNN D;  3WAA B;  5JRG B;  5CP6 A;  3AFA C;  1KX5 C;  2HUE C;  4H9Q B;  3TU4 D;  4EO5 B;  4KHA A;  4UUZ B;  4ZUX B;  1B6W A;  2F8N H;  4WU9 A;  4XZQ B;  1KU5 A;  4QLC B;  1P3K C;  1ID3 A;  5AV6 C;  1P3O B;  1AOI B;  3LZ0 B;  5GT3 D;  1KX3 B;  3LJA A;  4Z5T C;  2HIO C;  1M19 B;  5GSU C;  4NE5 A;  4J8W B;  2FJ7 C;  3B6G C;  1BH9 B;  3WA9 B;  1EQZ D;  3B0D B;  5B2I D;  2NQB C;  4LD9 A;  3TU4 C;  4WNN A;  4WU8 C;  5BS7 C;  4R8P B;  5G49 A;  4J8X B;  4WZS B;  5GT3 C;  3WTP A;  3MGQ B;  2F8N G;  4YM6 C;  4X23 B;  4Z66 D;  4G91 C;  5DNN D;  1KX4 B;  3WTP D;  3W96 C;  2ARO A;  1P34 B;  1P3L B;  1M1A B;  5B32 A;  1EQZ C;  4KGC B;  1P3O A;  5AV8 C;  2ARO D;  3KXB B;  1AOI A;  5B2I C;  3O62 B;  1S32 D;  5AVC A;  5DNM C;  1M18 C;  5B32 D;  4YS3 A;  5B1M B;  5B0Y B;  5AVC D;  3MGR C;  4YS3 D;  1TAF A;  3AZG C;  4J8V A;  1P3G B;  3C1B C;  4Z66 C;  5DNN C;  3C1C B;  3WTP C;  2YFV B;  3LEL B;  3AZE A;  5CPI B;  3MGP B;  5B31 B;  1ZLA D;  4H9O A;  4J8V D;  3UTB A;  5BO0 B;  3AZI B;  3WKJ B;  4WV4 B;  3AZE D;  3REJ D;  3AZK A;  3UTB D;  1S32 C;  4X23 A;  3AV2 C;  5B1L B;  5B32 C;  3VH6 T;  3AZK D;  4XUJ B;  1TZY B;  2YFW B;  3KWQ B;  3W98 D;  1M1A A;  5AV5 D;  1F66 D;  5AY8 A;  3UTA B;  3X1U A;  3REH A;  5B0Z B;  3AZF A;  3REL C;  1ZLA C;  3MVD A;  1P3F C;  3AZE C;  5BT1 D;  3REJ C;  3REH D;  3AZH C;  4H9S A;  3MVD D;  3AZM A;  5CPJ A;  3REI D;  1P3G A;  4H9R B;  3AFA B;  1KX5 B;  5CPI A;  2HUE B;  5CPJ D;  5BO0 A;  3W98 C;  3X1V A;  5AV5 C;  1P3P B;  1F66 C;  4ZBJ C;  5AV6 B;  4J8U C;  3AZJ C;  5C3I C;  5AVB A;  5B1L A;  3X1V D;  5JA4 A;  2NZD B;  3AYW A;  4XUJ A;  4Z5T B;  2HIO B;  2F8N A;  5BT1 C;  3B6G B;  5GXQ C;  3MVD C;  4NE6 A;  3AYW D;  3B6F B;  3REI C;  1HQ3 A;  2F8N D;  3UTA A;  3UT9 D;  3X1S A;  2NQB B;  2RVQ C;  3TU4 B;  4WU8 B;  1HQ3 D;  3AV1 C;  3B0B A;  1P3B A;  2LY8 A;  5GT3 B;  3AZN A;  5F99 A;  1P3B D;  4YM6 B;  5B2J C;  4H9R A;  4HGA C;  5BNX B;  3AZN D;  1P3A C;  4JJN B;  3W96 B;  3KUY A;  1H3O B;  3KSY A;  5E5A B;  5B40 A;  1P3I A;  1P3P A;  3V9R B;  4E45 A;  3NQU A;  5FUG B;  5AV8 B;  3KUY D;  2CV5 C;  3W99 C;  5CP6 D;  5B40 D;  3UT9 C;  1M18 B;  5DNM B;  4KUD A;  1U35 A;  1N1J A;  1BFM A;  3LZ1 A;  2NZD A;  3MGR B;  4WU9 D;  1U35 D;  1ID3 D;  3LZ1 D;  1P3B C;  3B6F A;  3AZG B;  3C1B B;  2JSS A;  4Z66 B;  3LJA D;  5AV9 B;  3MNN C;  5B31 G;  4H9N B;  4Z2M H;  5CPK B;  2PYO B;  5B24 A;  5B33 A;  1P3M A;  5CP6 C;  3B0C T;  1S32 B;  3AV2 B;  2BYM A;  5B24 D;  4LD9 D;  1P3M D;  3WAA A;  2CWE A;  5JRG A;  3VH5 A;  5E5A A;  4WU9 C;  1ID3 C;  3W97 B;  4H9Q A;  3VH5 W;  4UUZ A;  3WAA D;  4ZUX A;  5JRG D;  3LJA C;  4XZQ A;  4QLC A;  3REL B;  3MGS B;  1ZLA B;  4ZUX D;  1P3F B;  3LZ0 A;  1KX3 A;  3X1T B;  3AZH B;  3REJ B;  4AWL C;  4Z2M G;  3AZL B;  2BYK B;  4QLC D;  4XZQ D;  3REK B;  1P3O D;  3A6N B;  1AOI D;  1M19 A;  4J8W A;  4LD9 C;  2F8N K;  4CSR B;  1BH9 A;  3WA9 A;  1M19 D;  4H9N A;  4J8W D;  1BH8 B;  1F66 B;  4ZBJ B;  4J8U B;  4R8P A;  3AZJ B;  4J8X A;  1HTA A;  3VH6 W;  4EO5 C;  2ARO C;  4CAY B;  4R8P D;  3MGQ A;  1WWS A;  5GXQ B;  1P3O C;  1KX4 A;  1AOI C;  3REI B;  4X23 D;  5AVC C;  5BNV B;  1P34 A;  3AN2 B;  1P3L A;  4YS3 C;  1KX4 D;  3MGS A;  4J8W C;  4KGC A;  3AV1 B;  5GT0 B;  3KXB A;  3O62 A;  3X1T A;  3AZL A;  1P3L D;  1M1A D;  2BYK A;  4H9P B;  4KGC D;  4J8V C;  5B1M A;  3REK A;  5AY8 D;  3B0D C;  3A6N A;  3X1U D;  5B0Y A;  5B2J B;  1B67 A;  4HGA B;  3AZF D;  3UTB C;  1P3A B;  5B0Y D;  3AZK C;  3C1C A;  2YFV A;  1BH8 A;  3LEL A;  3MGP A;  4DRA A;  4X23 C;  4G92 C;  5B31 A;  3AZM D;  2CV5 B;  1P3G D;  3UT9 B;  3W99 B;  3AZI A;  1KX4 C;  3WKJ A;  3C1C D;  5CPI D;  3LEL D;  1ULY A;  3MGP D;  1P3K B;  5KDM B;  1M1A C;  3WKJ D;  4E44 A;  5AY8 C;  3X1U C;  1TZY A;  5AVB D;  2FJ7 B;  5GSU B;  2YFW A;  3KWQ A;  5B1L D;  3REH C;  5BNV A;  3AZF C;  3AN2 A;  4XUJ D;  1A7W A;  3MNN B;  1TZY D;  1F1E A;  3KWQ D;  4H9S C;  5B0Z A;  3AZM C;  5CPJ C;  1P3G C;  5CP6 B;  3UTA D;  5B32 G;  5CPI C;  3X1S D;  4KHA B;  2L5A A;  3X1V C;  4WU9 B;  3AFA A;  1KX5 A;  4G91 B;  1Q9C A;  5AVB C;  5F99 D;  5B1L C;  3LJA B;  3AFA D;  1KX5 D;  3AYW C;  4XUJ C;  1EQZ B;  1P3K A;  5AV6 A;  5B2I B;  2IO5 C;  4AWL B;  1P3I D;  1P3P D;  1HQ3 C;  5AV6 D;  4Z5T A;  3WTP E;  3UTA C;  2HIO A;  2FJ7 A;  1R4V A;  5GSU A;  4DRB A;  3X1S C;  3B6G A;  4LD9 B;  4KUD D;  4WNN B;  2NZD D;  5G49 B;  3B6G D;  5DNN B;  3WTP B;  3AZN C;  3TU4 A;  5F99 C;  2NQB A;  3B6F D;  4WU8 A;  5BS7 A;  3B0C W;  2NQB D;  4WU8 D;  2ARO B;  3KUY C;  5GT3 A;  5B40 C;  4YM6 A;  1WWI A; 
#chains in the Genus database with same CATH topology
 1P3I C;  1P3P C;  5B32 B;  5B33 D;  5BNX A;  4YM6 D;  3W96 A;  4JJN A;  3F6T A;  1H3O A;  5AVC B;  4KUD C;  1U35 C;  3LZ1 C;  2NZD C;  4YS3 B;  3V9R A;  1EQZ A;  2VQR A;  4JJN D;  5FUG A;  5AV8 A;  3W96 D;  5E5A D;  5B2I A;  1M18 A;  5DNM A;  3B6F C;  1TAF B;  2F2A C;  4J8V B;  5AV8 D;  3AZE B;  3MGR A;  5DNM D;  1M18 D;  4H9O B;  3UTB B;  2DQN C;  3LZ0 D;  3AZG A;  1KX3 D;  5B24 C;  3C1B A;  3MGR D;  4Z66 A;  5B33 C;  5DNN A;  3AZK B;  1P3M C;  5AV9 A;  1JFI B;  4G92 B;  3AZG D;  5CPK A;  3C1B D;  2PYO A;  3W98 B;  5AV5 B;  5AV9 D;  3WAA C;  4JJN C;  3WA9 D;  5CPK D;  3VH6 A;  4NE3 A;  3A1K A;  5E5A C;  5JRG C;  5C3I B;  1S32 A;  2PYO D;  3AV2 A;  3VH5 T;  4ZUX C;  5AY8 B;  3X1U B;  3AV2 D;  4J8X D;  3REH B;  4XZQ C;  4QLC C;  3AZF B;  4M6B A;  3W97 A;  3MVD B;  3LZ0 C;  3R45 B;  3MGQ D;  3H0R C;  1KX3 C;  3W97 D;  3REL A;  3AZM B;  5CPJ B;  1M19 C;  3EG5 B;  1ZLA A;  1P3F A;  1P34 D;  5AV9 C;  3REJ A;  3AZH A;  3WA9 C;  3REL D;  5CPK C;  3MGS D;  3EPH A;  3KXB D;  1P3F D;  2PYO C;  3X1V B;  3O62 D;  3X1T D;  3AZL D;  3AZH D;  4R8P C;  3REK D;  5B1M D;  4CSR A;  5AVB B;  3A6N D;  1JFI A;  4J8X C;  5JA4 B;  3W98 A;  5CHL B;  5AV5 A;  3AYW B;  3MGQ C;  1F66 A;  4J8U A;  2F8N B;  3AZJ A;  2Y2M A;  2IO5 B;  3W97 C;  1HQ3 B;  4CAY A;  4J8U D;  5B31 D;  3AZJ D;  1P34 C;  1P3L C;  3AZI D;  3X1S B;  3MGS C;  5GXQ A;  4KGC C;  3KXB C;  1P3B B;  3R45 A;  2ZY3 A;  3REI A;  3O62 C;  3X1T C;  3AZL C;  5GXQ D;  3REK C;  5B1M C;  3AZN B;  3A6N C;  5F99 B;  5B0Y C;  3AV1 A;  3NQJ B;  5GT0 A;  3AN2 D;  4UPK A;  2RVQ D;  4H9P A;  3KUY B;  3AV1 D;  5GT0 D;  5B40 B;  3C1C C;  1P3I B;  5B2J A;  3LEL C;  3MGP C;  5B0Z D;  3NQU B;  5B31 C;  1P3A A;  3AZI C;  3WKJ C;  4KUD B;  1U35 B;  1N1J B;  5B2J D;  1ID3 B;  2G5I C;  3LZ1 B;  1P3A D;  2CV5 A;  3UT9 A;  3W99 A;  1TZY C;  3KWQ C;  2CV5 D;  5KDM A;  3AN2 C;  3W99 D;  1P3K D;  5GT0 C;  4NFT A;  5B24 B;  5B0Z C;  5B33 B;  1P3M B;  4Z5T D;  3MNN A;  2HIO D;  2FJ7 D;  2BYM B;  3NQJ A;  5GSU D;  3MNN D;  3WAA B;  5JRG B;  5CP6 A;  3AFA C;  1KX5 C;  2HUE C;  4H9Q B;  3TU4 D;  4EO5 B;  4KHA A;  4UUZ B;  4ZUX B;  1B6W A;  2F8N H;  4WU9 A;  4XZQ B;  1KU5 A;  4QLC B;  1P3K C;  1ID3 A;  5AV6 C;  3EPJ A;  1P3O B;  2Y2P A;  1AOI B;  3LZ0 B;  5GT3 D;  1KX3 B;  3LJA A;  4Z5T C;  2HIO C;  1M19 B;  5GSU C;  4NE5 A;  4J8W B;  2FJ7 C;  3B6G C;  2JE5 A;  1BH9 B;  3WA9 B;  1EQZ D;  3B0D B;  2Y2H A;  3FDD A;  5B2I D;  2NQB C;  4LD9 A;  3TU4 C;  4WNN A;  4WU8 C;  5BS7 C;  4R8P B;  5G49 A;  4J8X B;  4WZS B;  5GT3 C;  3WTP A;  3MGQ B;  2F8N G;  4YM6 C;  4X23 B;  1W2E A;  4Z66 D;  4G91 C;  5DNN D;  1KX4 B;  3WTP D;  3W96 C;  2ARO A;  1P34 B;  1P3L B;  1M1A B;  5B32 A;  1EQZ C;  4KGC B;  1P3O A;  5AV8 C;  2ARO D;  3KXB B;  1AOI A;  5B2I C;  3O62 B;  1S32 D;  3H0L C;  5AVC A;  5DNM C;  1M18 C;  5B32 D;  4YS3 A;  5B1M B;  2FFF B;  5B0Y B;  5AVC D;  3MGR C;  4YS3 D;  1TAF A;  3AZG C;  4J8V A;  1P3G B;  3C1B C;  4Z66 C;  5DNN C;  2J8P A;  3C1C B;  3WTP C;  2YFV B;  3LEL B;  3AZE A;  5CPI B;  3MGP B;  5B31 B;  1ZLA D;  4H9O A;  4J8V D;  2Y2Q A;  3UTB A;  5BO0 B;  3AZI B;  3WKJ B;  4WV4 B;  3AZE D;  3REJ D;  3AZK A;  3UTB D;  1S32 C;  4X23 A;  3AV2 C;  5B1L B;  5B32 C;  3VH6 T;  3AZK D;  4XUJ B;  1TZY B;  2YFW B;  3KWQ B;  3W98 D;  1M1A A;  5AV5 D;  1F66 D;  3H0M C;  5AY8 A;  3UTA B;  3X1U A;  3REH A;  5B0Z B;  3AZF A;  3REL C;  1ZLA C;  3MVD A;  1P3F C;  3AZE C;  5BT1 D;  3REJ C;  3REH D;  3AZH C;  4H9S A;  3MVD D;  3AZM A;  5CPJ A;  3REI D;  1P3G A;  2G5H C;  4H9R B;  3AFA B;  1KX5 B;  5CPI A;  2HUE B;  5CPJ D;  5BO0 A;  3W98 C;  3X1V A;  5AV5 C;  1P3P B;  2DF4 C;  1F66 C;  4ZBJ C;  5AV6 B;  4J8U C;  3AZJ C;  5C3I C;  5AVB A;  5B1L A;  3X1V D;  2W8S A;  5JA4 A;  2NZD B;  3AYW A;  4XUJ A;  4Z5T B;  2HIO B;  2F8N A;  5BT1 C;  3B6G B;  2ZY5 A;  5GXQ C;  3KFU G;  3MVD C;  4NE6 A;  3AYW D;  3B6F B;  3REI C;  1HQ3 A;  2F8N D;  2UWX A;  3UTA A;  2Y2K A;  3UT9 D;  3X1S A;  2NQB B;  2RVQ C;  3TU4 B;  2Y2N A;  4WU8 B;  1HQ3 D;  3AV1 C;  1T3U A;  3B0B A;  2ZM5 A;  1P3B A;  2LY8 A;  5GT3 B;  3AZN A;  2Y2J A;  5F99 A;  4YM6 B;  1P3B D;  5B2J C;  4H9R A;  4HGA C;  5BNX B;  3AZN D;  1P3A C;  4JJN B;  3W96 B;  3KUY A;  1H3O B;  3KSY A;  5E5A B;  3EPK A;  5B40 A;  1P3I A;  1P3P A;  3V9R B;  4E45 A;  3NQU A;  2Y2L A;  5FUG B;  5AV8 B;  3KUY D;  2CV5 C;  3W99 C;  5CP6 D;  5B40 D;  3UT9 C;  1M18 B;  5DNM B;  4KUD A;  1U35 A;  1N1J A;  1BFM A;  3LZ1 A;  2NZD A;  3MGR B;  4WJ3 C;  4WU9 D;  1U35 D;  3EPL A;  1ID3 D;  3LZ1 D;  1P3B C;  3B6F A;  3AZG B;  3C1B B;  2JSS A;  4Z66 B;  3LJA D;  5AV9 B;  3MNN C;  5B31 G;  4H9N B;  4Z2M H;  5CPK B;  2XD5 A;  2PYO B;  5B24 A;  5B33 A;  2BG1 A;  1P3M A;  5CP6 C;  3B0C T;  1PZR A;  1S32 B;  3AV2 B;  2BYM A;  5B24 D;  4LD9 D;  1P3M D;  3WAA A;  2CWE A;  3VH5 A;  5JRG A;  5E5A A;  4WU9 C;  1ID3 C;  3IP4 C;  3W97 B;  4H9Q A;  3VH5 W;  4UUZ A;  3WAA D;  4ZUX A;  5JRG D;  3LJA C;  4XZQ A;  4QLC A;  2Y2G A;  1Z2C B;  3MGS B;  3REL B;  1ZLA B;  4ZUX D;  1P3F B;  3LZ0 A;  1KX3 A;  3X1T B;  3AZH B;  3REJ B;  4AWL C;  4Z2M G;  3AZL B;  2BYK B;  2Y2O A;  4QLC D;  4XZQ D;  3AL0 C;  3REK B;  1P3O D;  3A6N B;  1AOI D;  1M19 A;  4J8W A;  4LD9 C;  2F8N K;  4CSR B;  1BH9 A;  3WA9 A;  1M19 D;  4H9N A;  4J8W D;  1BH8 B;  1F66 B;  4ZBJ B;  4J8U B;  4R8P A;  3AZJ B;  4J8X A;  1HTA A;  3VH6 W;  4EO5 C;  2ARO C;  4CAY B;  4R8P D;  3MGQ A;  1WWS A;  5GXQ B;  1P3O C;  1KX4 A;  3A1I A;  1AOI C;  3REI B;  4X23 D;  5AVC C;  5BNV B;  1P34 A;  3AN2 B;  1P3L A;  4YS3 C;  1KX4 D;  3MGS A;  4J8W C;  4KGC A;  3AV1 B;  5GT0 B;  3KXB A;  3O62 A;  3X1T A;  3AZL A;  1P3L D;  1M1A D;  2BYK A;  4H9P B;  4KGC D;  4J8V C;  5B1M A;  3REK A;  5AY8 D;  3B0D C;  3A6N A;  3X1U D;  5B0Y A;  5B2J B;  1B67 A;  4HGA B;  3AZF D;  3UTB C;  1P3A B;  5B0Y D;  3AZK C;  3C1C A;  2YFV A;  1BH8 A;  3LEL A;  3MGP A;  4DRA A;  4X23 C;  4G92 C;  5B31 A;  3AZM D;  2CV5 B;  1P3G D;  3UT9 B;  3W99 B;  3AZI A;  1KX4 C;  3WKJ A;  3C1C D;  5CPI D;  3LEL D;  1ULY A;  3MGP D;  1P3K B;  5KDM B;  1M1A C;  3WKJ D;  4E44 A;  5AY8 C;  3X1U C;  1TZY A;  5AVB D;  2FJ7 B;  5GSU B;  2YFW A;  3KWQ A;  5B1L D;  3REH C;  5BNV A;  3AZF C;  3AN2 A;  4XUJ D;  1A7W A;  3MNN B;  1TZY D;  1F1E A;  3KWQ D;  4H9S C;  5B0Z A;  2ZY2 A;  3AZM C;  5CPJ C;  1P3G C;  5CP6 B;  3UTA D;  5B32 G;  5CPI C;  3X1S D;  3P5J B;  4KHA B;  2L5A A;  2ZY4 A;  3X1V C;  4WU9 B;  2Y2I A;  3AFA A;  1KX5 A;  4G91 B;  1Q9C A;  5AVB C;  5F99 D;  5B1L C;  3LJA B;  4DQY B;  3AFA D;  1KX5 D;  3AYW C;  4XUJ C;  1EQZ B;  1P3K A;  5AV6 A;  5B2I B;  2IO5 C;  4AWL B;  1P3I D;  1P3P D;  1HQ3 C;  2JCH A;  5AV6 D;  4Z5T A;  3WTP E;  3UTA C;  2HIO A;  2FJ7 A;  1R4V A;  5GSU A;  4DRB A;  3X1S C;  3B6G A;  4LD9 B;  4KUD D;  4WNN B;  2NZD D;  5G49 B;  3B6G D;  5DNN B;  3WTP B;  3AZN C;  3TU4 A;  5F99 C;  2NQB A;  3B6F D;  4WU8 A;  5BS7 A;  2RIQ A;  3B0C W;  2XD1 A;  2NQB D;  4WU8 D;  2ARO B;  3KUY C;  5GT3 A;  5B40 C;  4YM6 A;  1WWI A; 
#chains in the Genus database with same CATH homology
 1P3I C;  1P3P C;  5B32 B;  5B33 D;  5BNX A;  4YM6 D;  3W96 A;  4JJN A;  3F6T A;  1H3O A;  5AVC B;  4KUD C;  1U35 C;  3LZ1 C;  2NZD C;  4YS3 B;  3V9R A;  1EQZ A;  2VQR A;  4JJN D;  5FUG A;  5AV8 A;  3W96 D;  5E5A D;  5B2I A;  1M18 A;  5DNM A;  3B6F C;  1TAF B;  2F2A C;  4J8V B;  5AV8 D;  3AZE B;  3MGR A;  5DNM D;  1M18 D;  4H9O B;  3UTB B;  2DQN C;  3LZ0 D;  3AZG A;  1KX3 D;  5B24 C;  3C1B A;  3MGR D;  4Z66 A;  5B33 C;  5DNN A;  3AZK B;  1P3M C;  5AV9 A;  1JFI B;  4G92 B;  3AZG D;  5CPK A;  3C1B D;  2PYO A;  3W98 B;  5AV5 B;  5AV9 D;  3WAA C;  4JJN C;  3WA9 D;  5CPK D;  3VH6 A;  4NE3 A;  3A1K A;  5E5A C;  5JRG C;  5C3I B;  1S32 A;  2PYO D;  3AV2 A;  3VH5 T;  4ZUX C;  5AY8 B;  3X1U B;  3AV2 D;  4J8X D;  3REH B;  4XZQ C;  4QLC C;  3AZF B;  4M6B A;  3W97 A;  3MVD B;  3LZ0 C;  3R45 B;  3MGQ D;  3H0R C;  1KX3 C;  3W97 D;  3REL A;  3AZM B;  5CPJ B;  1M19 C;  3EG5 B;  1ZLA A;  1P3F A;  1P34 D;  5AV9 C;  3REJ A;  3AZH A;  3WA9 C;  3REL D;  5CPK C;  3MGS D;  3EPH A;  3KXB D;  1P3F D;  2PYO C;  3X1V B;  3O62 D;  3X1T D;  3AZL D;  3AZH D;  4R8P C;  3REK D;  5B1M D;  4CSR A;  5AVB B;  3A6N D;  1JFI A;  4J8X C;  5JA4 B;  3W98 A;  5CHL B;  5AV5 A;  3AYW B;  3MGQ C;  1F66 A;  4J8U A;  2F8N B;  3AZJ A;  2Y2M A;  2IO5 B;  3W97 C;  1HQ3 B;  4CAY A;  4J8U D;  5B31 D;  3AZJ D;  1P34 C;  1P3L C;  3AZI D;  3X1S B;  3MGS C;  5GXQ A;  4KGC C;  3KXB C;  1P3B B;  3R45 A;  2ZY3 A;  3REI A;  3O62 C;  3X1T C;  3AZL C;  5GXQ D;  3REK C;  5B1M C;  3AZN B;  3A6N C;  5F99 B;  5B0Y C;  3AV1 A;  3NQJ B;  5GT0 A;  3AN2 D;  4UPK A;  2RVQ D;  4H9P A;  3KUY B;  3AV1 D;  5GT0 D;  5B40 B;  3C1C C;  1P3I B;  5B2J A;  3LEL C;  3MGP C;  5B0Z D;  3NQU B;  5B31 C;  1P3A A;  3AZI C;  3WKJ C;  4KUD B;  1U35 B;  1N1J B;  5B2J D;  1ID3 B;  2G5I C;  3LZ1 B;  1P3A D;  2CV5 A;  3UT9 A;  3W99 A;  1TZY C;  3KWQ C;  2CV5 D;  5KDM A;  3AN2 C;  3W99 D;  1P3K D;  5GT0 C;  4NFT A;  5B24 B;  5B0Z C;  5B33 B;  1P3M B;  4Z5T D;  3MNN A;  2HIO D;  2FJ7 D;  2BYM B;  3NQJ A;  5GSU D;  3MNN D;  3WAA B;  5JRG B;  5CP6 A;  3AFA C;  1KX5 C;  2HUE C;  4H9Q B;  3TU4 D;  4EO5 B;  4KHA A;  4UUZ B;  4ZUX B;  1B6W A;  2F8N H;  4WU9 A;  4XZQ B;  1KU5 A;  4QLC B;  1P3K C;  1ID3 A;  5AV6 C;  3EPJ A;  1P3O B;  2Y2P A;  1AOI B;  3LZ0 B;  5GT3 D;  1KX3 B;  3LJA A;  4Z5T C;  2HIO C;  1M19 B;  5GSU C;  4NE5 A;  4J8W B;  2FJ7 C;  3B6G C;  2JE5 A;  1BH9 B;  3WA9 B;  1EQZ D;  3B0D B;  2Y2H A;  3FDD A;  5B2I D;  2NQB C;  4LD9 A;  3TU4 C;  4WNN A;  4WU8 C;  5BS7 C;  4R8P B;  5G49 A;  4J8X B;  4WZS B;  5GT3 C;  3WTP A;  3MGQ B;  2F8N G;  4YM6 C;  4X23 B;  1W2E A;  4Z66 D;  4G91 C;  5DNN D;  1KX4 B;  3WTP D;  3W96 C;  2ARO A;  1P34 B;  1P3L B;  1M1A B;  5B32 A;  1EQZ C;  4KGC B;  1P3O A;  5AV8 C;  2ARO D;  3KXB B;  1AOI A;  5B2I C;  3O62 B;  1S32 D;  3H0L C;  5AVC A;  5DNM C;  1M18 C;  5B32 D;  4YS3 A;  5B1M B;  2FFF B;  5B0Y B;  5AVC D;  3MGR C;  4YS3 D;  1TAF A;  3AZG C;  4J8V A;  1P3G B;  3C1B C;  4Z66 C;  5DNN C;  2J8P A;  3C1C B;  3WTP C;  2YFV B;  3LEL B;  3AZE A;  5CPI B;  3MGP B;  5B31 B;  1ZLA D;  4H9O A;  4J8V D;  2Y2Q A;  3UTB A;  5BO0 B;  3AZI B;  3WKJ B;  4WV4 B;  3AZE D;  3REJ D;  3AZK A;  3UTB D;  1S32 C;  4X23 A;  3AV2 C;  5B1L B;  5B32 C;  3VH6 T;  3AZK D;  4XUJ B;  1TZY B;  2YFW B;  3KWQ B;  3W98 D;  1M1A A;  5AV5 D;  1F66 D;  3H0M C;  5AY8 A;  3UTA B;  3X1U A;  3REH A;  5B0Z B;  3AZF A;  3REL C;  1ZLA C;  3MVD A;  1P3F C;  3AZE C;  5BT1 D;  3REJ C;  3REH D;  3AZH C;  4H9S A;  3MVD D;  3AZM A;  5CPJ A;  3REI D;  1P3G A;  2G5H C;  4H9R B;  3AFA B;  1KX5 B;  5CPI A;  2HUE B;  5CPJ D;  5BO0 A;  3W98 C;  3X1V A;  5AV5 C;  1P3P B;  2DF4 C;  1F66 C;  4ZBJ C;  5AV6 B;  4J8U C;  3AZJ C;  5C3I C;  5AVB A;  5B1L A;  3X1V D;  2W8S A;  5JA4 A;  2NZD B;  3AYW A;  4XUJ A;  4Z5T B;  2HIO B;  2F8N A;  5BT1 C;  3B6G B;  2ZY5 A;  5GXQ C;  3KFU G;  3MVD C;  4NE6 A;  3AYW D;  3B6F B;  3REI C;  1HQ3 A;  2F8N D;  2UWX A;  3UTA A;  2Y2K A;  3UT9 D;  3X1S A;  2NQB B;  2RVQ C;  3TU4 B;  2Y2N A;  4WU8 B;  1HQ3 D;  3AV1 C;  1T3U A;  3B0B A;  2ZM5 A;  1P3B A;  2LY8 A;  5GT3 B;  3AZN A;  2Y2J A;  5F99 A;  4YM6 B;  1P3B D;  5B2J C;  4H9R A;  4HGA C;  5BNX B;  3AZN D;  1P3A C;  4JJN B;  3W96 B;  3KUY A;  1H3O B;  3KSY A;  5E5A B;  3EPK A;  5B40 A;  1P3I A;  1P3P A;  3V9R B;  4E45 A;  3NQU A;  2Y2L A;  5FUG B;  5AV8 B;  3KUY D;  2CV5 C;  3W99 C;  5CP6 D;  5B40 D;  3UT9 C;  1M18 B;  5DNM B;  4KUD A;  1U35 A;  1N1J A;  1BFM A;  3LZ1 A;  2NZD A;  3MGR B;  4WJ3 C;  4WU9 D;  1U35 D;  3EPL A;  1ID3 D;  3LZ1 D;  1P3B C;  3B6F A;  3AZG B;  3C1B B;  2JSS A;  4Z66 B;  3LJA D;  5AV9 B;  3MNN C;  5B31 G;  4H9N B;  4Z2M H;  5CPK B;  2XD5 A;  2PYO B;  5B24 A;  5B33 A;  2BG1 A;  1P3M A;  5CP6 C;  3B0C T;  1PZR A;  1S32 B;  3AV2 B;  2BYM A;  5B24 D;  4LD9 D;  1P3M D;  3WAA A;  2CWE A;  3VH5 A;  5JRG A;  5E5A A;  4WU9 C;  1ID3 C;  3IP4 C;  3W97 B;  4H9Q A;  3VH5 W;  4UUZ A;  3WAA D;  4ZUX A;  5JRG D;  3LJA C;  4XZQ A;  4QLC A;  2Y2G A;  1Z2C B;  3MGS B;  3REL B;  1ZLA B;  4ZUX D;  1P3F B;  3LZ0 A;  1KX3 A;  3X1T B;  3AZH B;  3REJ B;  4AWL C;  4Z2M G;  3AZL B;  2BYK B;  2Y2O A;  4QLC D;  4XZQ D;  3AL0 C;  3REK B;  1P3O D;  3A6N B;  1AOI D;  1M19 A;  4J8W A;  4LD9 C;  2F8N K;  4CSR B;  1BH9 A;  3WA9 A;  1M19 D;  4H9N A;  4J8W D;  1BH8 B;  1F66 B;  4ZBJ B;  4J8U B;  4R8P A;  3AZJ B;  4J8X A;  1HTA A;  3VH6 W;  4EO5 C;  2ARO C;  4CAY B;  4R8P D;  3MGQ A;  1WWS A;  5GXQ B;  1P3O C;  1KX4 A;  3A1I A;  1AOI C;  3REI B;  4X23 D;  5AVC C;  5BNV B;  1P34 A;  3AN2 B;  1P3L A;  4YS3 C;  1KX4 D;  3MGS A;  4J8W C;  4KGC A;  3AV1 B;  5GT0 B;  3KXB A;  3O62 A;  3X1T A;  3AZL A;  1P3L D;  1M1A D;  2BYK A;  4H9P B;  4KGC D;  4J8V C;  5B1M A;  3REK A;  5AY8 D;  3B0D C;  3A6N A;  3X1U D;  5B0Y A;  5B2J B;  1B67 A;  4HGA B;  3AZF D;  3UTB C;  1P3A B;  5B0Y D;  3AZK C;  3C1C A;  2YFV A;  1BH8 A;  3LEL A;  3MGP A;  4DRA A;  4X23 C;  4G92 C;  5B31 A;  3AZM D;  2CV5 B;  1P3G D;  3UT9 B;  3W99 B;  3AZI A;  1KX4 C;  3WKJ A;  3C1C D;  5CPI D;  3LEL D;  1ULY A;  3MGP D;  1P3K B;  5KDM B;  1M1A C;  3WKJ D;  4E44 A;  5AY8 C;  3X1U C;  1TZY A;  5AVB D;  2FJ7 B;  5GSU B;  2YFW A;  3KWQ A;  5B1L D;  3REH C;  5BNV A;  3AZF C;  3AN2 A;  4XUJ D;  1A7W A;  3MNN B;  1TZY D;  1F1E A;  3KWQ D;  4H9S C;  5B0Z A;  2ZY2 A;  3AZM C;  5CPJ C;  1P3G C;  5CP6 B;  3UTA D;  5B32 G;  5CPI C;  3X1S D;  3P5J B;  4KHA B;  2L5A A;  2ZY4 A;  3X1V C;  4WU9 B;  2Y2I A;  3AFA A;  1KX5 A;  4G91 B;  1Q9C A;  5AVB C;  5F99 D;  5B1L C;  3LJA B;  4DQY B;  3AFA D;  1KX5 D;  3AYW C;  4XUJ C;  1EQZ B;  1P3K A;  5AV6 A;  5B2I B;  2IO5 C;  4AWL B;  1P3I D;  1P3P D;  1HQ3 C;  2JCH A;  5AV6 D;  4Z5T A;  3WTP E;  3UTA C;  2HIO A;  2FJ7 A;  1R4V A;  5GSU A;  4DRB A;  3X1S C;  3B6G A;  4LD9 B;  4KUD D;  4WNN B;  2NZD D;  5G49 B;  3B6G D;  5DNN B;  3WTP B;  3AZN C;  3TU4 A;  5F99 C;  2NQB A;  3B6F D;  4WU8 A;  5BS7 A;  2RIQ A;  3B0C W;  2XD1 A;  2NQB D;  4WU8 D;  2ARO B;  3KUY C;  5GT3 A;  5B40 C;  4YM6 A;  1WWI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...