4J8VC

X-ray structure of ncp145 with bound chlorido(eta-6-p-cymene)(n-phenyl-2-pyridinecarbothioamide)ruthenium(ii)
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
106
structure length
106
Chain Sequence
AKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.2
publication title Novel metal(II) arene 2-pyridinecarbothioamides: a rationale to orally active organometallic anticancer agents
doi rcsb
source organism Xenopus laevis
molecule tags Structural protein/dna
total genus 33
structure length 106
sequence length 106
chains with identical sequence G
ec nomenclature
pdb deposition date 2013-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4j8vC00
5AVBC 4WU8D 5C3IB 5B0ZA 4DRAA 1P34C 3AV2B 1HQ3D 4NE5A 1P3GD 1P3LB 4QLCB 4J8XB 1KX5D 5CPKC 2AROB 4Z5TC 2BYKA 3AFAA 5B33A 5F99D 4NE6A 5JRGA 4WU8C 2CV5C 3VH6A 3RELB 4UUZA 3X1VC 5CPIA 1JFIA 3MGQC 5FUGA 5CP6B 3LJAD 4R8PA 5B31A 5DNNC 3B0DB 5B40C 4H9RA 3W98B 4YM6C 2HIOC 1ULYA 1M19A 4HGAC 1P3OC 5GSUB 2F8NB 4H9SC 5B0YA 4JJNC 1WWIA 3VH5T 2PYOA 1KX3B 5KDMA 4Z66B 4XZQC 4WNNA 4DRBA 3AZGA 5C3IC 5B1MA 5B24A 4X23A 3MGPD 3AN2B 2RVQD 3AV2C 3WKJA 1P3LC 4QLCC 4J8XC 3AZFD 2AROC 3NQJA 5B32G 3MGRA 3A6ND 5B33B 3AFAB 5GT0B 4KGCB 5AV9A 3RELC 4UUZB 1ZLAD 4CSRA 1M18A 1JFIB 3W99D 4J8WA 3LELD 3UTBD 5AY8B 3B0DC 2NQBA 3MNNB 3W98C 1M19B 3VH5W 5B0ZD 5GSUC 5AV5D 4ZUXB 3MGSA 3AZND 1P3FD 3B6GD 1P3AB 5B2JA 1WWSA 1KX3C 4Z66C 4KHAA 3X1TB 3KUYA 4G91B 3AZEA 1A7WA 4XUJA 5B1MB 5JRGD 4X23B 2FJ7D 4E45A 3AZJA 3WKJB 5CPID 4G92B 4R8PD 5B31D 4ZBJB 3C1BD 3MVDA 5AV8B 3AFAC 5B33C 3REID 1P3KA 5GT0C 2YFWB 5AV9B 1P3PA 4KGCC 3AZKD 1P3BA 1KX4B 5B0YD 1HQ3A 1BFMA 2IO5B 4J8WB 3V9RA 2PYOD 5AY8C 4J8UA 3UTAB 3TU4B 3MNNC 1H3OB 1M19C 4WU9B 3AZGD 5B24D 3LZ0B 3UT9A 5BNXB 1P3AC 5B1LB 4J8VD 3X1TC 3B6FD 5B32B 4G91C 3MGRD 3AZGC 5B24C 5B1MC 3KWQA 3W96D 2BYMA 4X23C 4LD9D 2CWEA 3REKB 3AZJB 4H9NB 1M18D 3WKJC 4G92C 3AZMA 4ZBJC 4WU8B 5AV8C 2NQBD 5AV9C 5BNVA 1KX4C 3MGSD 1HQ3B 1P3GB 2IO5C 4J8WC 3V9RB 5DNNB 5B2JD 3AZFA 1B6WA 1KX5B 3NQUA 5F99B 3UTAC 3KXBA 3TU4C 3KUYD 4WU9C 3AZED 4XUJD 1N1JA 3LZ0C 3W99A 3LJAB 1EQZA 1R4VA 5B31G 5B1LC 5CHLB 5B32C 3MVDD 3WA9A 4CAYA 5AV5A 1P3KD 3AZNA 1P3PD 1P3FA 3B6GA 1P3BD 3REKC 3AZJC 5BO0B 3AZID 3W97D 4J8UD 3MVDC 3REJD 1P3MA 2FJ7A 5BNVB 3MGPB 1HQ3C 3UT9D 1P3GC 3AZFB 3AZHD 1KX5C 3C1BA 4J8UC 3A6NB 5F99C 3REIA 3AZKA 1ZLAB 3KWQD 3X1SA 3W99B 1TZYD 3LZ1A 3LELB 3UTBB 3VH5A 3LJAC 3WTPD 2F8NH 5DNMD 3WAAA 1F66A 4WZSB 3AZMD 5E5AA 4CAYB 5B0ZB 5AV5B 5BT1D 1P3FB 3B6GB 4J8VA 4KUDD 1ID3A 3AZMC 3B6FA 2BYKB 5JRGB 3KXBD 3W96A 4LD9A 2FJ7B 3MGPC 2RVQC 5CPIB 3X1UA 5FUGB 4Z2MG 1EQZD 4R8PB 5B31B 3REHD 3AZFC 3C1BB 3WTPE 4H9RB 5CPJD 3A6NC 3REIB 3AZKB 1P3ID 3WA9D 5B0YB 1ZLAC 3W99C 2HUEB 4YS3D 3LELC 3UTBC 2PYOB 5KDMB 5GXQA 4WNNB 3AV1D 3AZGB 1P3MD 5B0ZC 5B24B 5AV5C 3AZNC 3O62A 1P3FC 3B6GC 1M1AA 5AVCD 4J8VB 4WV4B 4M6BA 3B6FB 3NQJB 3MGRB 5JRGC 3W96B 4LD9B 2F8NK 2FJ7C 4CSRB 3AZIA 1M18B 3X1SD 5CPIC 3W97A 3LZ1D 3B0CT 5JA4A 4R8PC 5B31C 3C1BC 3REJA 3WAAD 2NQBB 1F66D 3REIC 3C1CD 5E5AD 3AZKC 2JSSA 3MGSB 5B0YC 1S32D 5B2JB 3AZHA 2HUEC 2PYOC 4H9PA 2NZDA 4KHAB 4Z5TA 3KUYB 1ID3D 2CV5A 4NE3A 5E5AC 3AZEB 4XUJB 5GT3D 4H9QA 1TZYA 4ZUXD 3MGQA 3WTPA 4J8VC 5B40A 3X1UD 4H9OA 3AZLD 5DNMA 3B6FC 3MVDB 4YM6A 3MGRC 1P3KB 3W96C 4LD9C 1P3PB 4H9SA 3B0CW 1P3BB 1AOIA 3AZIB 1M18C 3W97B 5JA4B 4XZQA 4KUDA 4J8UB 3REJB 5GXQD 2NQBC 5AV6D 3MGSC 3O62D 3AYWD 3UT9B 3AZHB 1M1AD 5B2JC 3REHA 4H9PB 4QLCA 4J8XA 2AROA 5CPJA 3KUYC 1P3IA 4E44A 3AZEC 4XUJC 3RELA 3KWQB 2BYMB 3O62C 1TZYB 5B2ID 4YS3A 1U35D 3WTPB 5CP6A 4H9OB 5DNMB 3AZMB 3AV1A 5AVBD 1P3KC 1P3PC 2F8NA 1P3BC 1P34D 5AVCA 3KSYA 3AZIC 3W97C 1KX3A 4KUDB 4Z66A 2NZDD 4AWLB 5CPKD 3NQUB 3REJC 4Z5TD 3KXBB 2CV5D 1TAFA 1N1JB 3UT9C 3X1VD 1EQZB 3AN2A 3REHB 3AZHC 4EO5B 3MGQD 2NZDC 5B40D 5G49A 5DNND 5CPJB 1KU5A 3C1CA 4YM6D 1P3IB 2HIOD 5GT0A 3WA9B 4KGCA 3VH6T 3AZNB 3KWQC 1P3OD 1S32A 1TZYC 4YS3B 4JJND 1AOID 3WTPC 1Q9CA 5AY8A 5DNMC 4XZQD 3AV1B 3MNNA 1P3MB 1BH8A 5GT3A 5BT1C 4ZUXA 5AVCB 1AOIC 1P3AA 3AZLA 3AV2D 4KUDC 1P3LD 1BH9A 4QLCD 4J8XD 3X1TA 4AWLC 2AROD 3KXBC 1TAFB 3RELD 3X1SB 3LZ1B 1EQZC 3REHC 4EO5C 5BS7A 5G49B 3VH6W 5CP6D 3WAAB 5CPJC 1F66B 5AV8A 3C1CB 5AV6A 5E5AB 3W98D 1P3IC 3WA9C 2YFWA 3AYWA 5GSUD 1S32B 2F8ND 1KX4A 4YS3C 5CP6C 1KX3D 4Z66D 1ID3B 3UTAA 2L5AA 3TU4A 3AV1C 1P3MC 1BH8B 1H3OA 4WU9A 5GT3B 5B2IA 3LZ0A 1U35A 5AVCC 5BNXA 3X1UB 3AZLB 3AN2D 5B1LA 1BH9B 5AVBA 5B32A 3R45A 3AFAD 5B33D 5GT0D 1P34A 4KGCD 3REKA 3X1SC 4H9NA 3LZ1C 3AN2C 5CPKA 5GXQB 3WAAC 5AY8D 1F66C 4WU8A 5AV6B 3C1CC 2YFVA 3MNND 1M19D 1HTAA 3O62B 3AYWB 1S32C 3X1VA 1M1AB 1P3GA 1P3AD 1KX5A 5DNNA 3B0BA 1ID3C 5F99A 3X1TD 2HIOA 1P3OA 4Z2MH 5GT3C 5B1MD 5B2IB 4ZUXC 4X23D 4JJNA 1U35B 3LJAA 3X1UC 3AZLC 3WKJD 5AVBB 3R45B 5AV8D 2F8NG 1P34B 5AV9D 1KX4D 5BO0A 3AV2A 2NZDB 4J8WD 1B67A 5CPKB 1P3LA 5BS7C 4Z5TB 5GXQC 2CV5B 2YFVB 5AV6C 3UTAD 3TU4D 4WU9D 4H9QB 3AYWC 3X1VB 3MGPA 3LZ0D 1M1AC 3MGQB 5B40B 4NFTA 5B1LD 3A6NA 4YM6B 3W98A 2HIOB 2LY8A 4HGAB 5B32D 1P3OB 5GSUA 1ZLAA 5B2IC 4JJNB 1AOIB 1U35C 3REKD 3UTBA 3LELA 3AZJD 1F1EA 4XZQB
chains in the Genus database with same CATH superfamily
3EPLA 2F2AC 5AVBC 4WU8D 5C3IB 5B0ZA 2J8PA 4DRAA 3EG5B 1P34C 3AV2B 1HQ3D 4NE5A 1P3GD 1P3LB 4QLCB 4J8XB 1KX5D 5CPKC 2AROB 4Z5TC 2BYKA 3AFAA 5B33A 5F99D 4NE6A 5JRGA 4WU8C 2CV5C 3VH6A 3RELB 4UUZA 3X1VC 5CPIA 1JFIA 3MGQC 5FUGA 5CP6B 3LJAD 4R8PA 5B31A 5DNNC 3B0DB 5B40C 4H9RA 3W98B 2ZM5A 4YM6C 2HIOC 1ULYA 1M19A 4HGAC 2JE5A 5GSUB 1P3OC 2F8NB 4H9SC 1Z2CB 5B0YA 4JJNC 1WWIA 3VH5T 2PYOA 1KX3B 5KDMA 4Z66B 4XZQC 3EPJA 4UPKA 4WNNA 4DRBA 3AZGA 5C3IC 5B1MA 5B24A 4X23A 3MGPD 3AN2B 2RVQD 3AV2C 3WKJA 1P3LC 4QLCC 4J8XC 3AZFD 2AROC 3NQJA 5B32G 3MGRA 1W2EA 5B33B 3A6ND 3AFAB 5GT0B 4KGCB 5AV9A 3RELC 4UUZB 2Y2KA 1ZLAD 4CSRA 1M18A 1JFIB 3W99D 4J8WA 3LELD 3UTBD 5AY8B 3B0DC 2NQBA 2G5HC 3MNNB 3EPKA 3W98C 1M19B 3VH5W 5B0ZD 5GSUC 5AV5D 4ZUXB 3MGSA 3AZND 1P3FD 3B6GD 1P3AB 5B2JA 1WWSA 3A1IA 1KX3C 4Z66C 4KHAA 3X1TB 2ZY4A 3KUYA 4G91B 2RIQA 3AZEA 1A7WA 4XUJA 5B1MB 5JRGD 4X23B 2FJ7D 4E45A 3AZJA 3WKJB 5CPID 4G92B 4R8PD 5B31D 4ZBJB 3C1BD 3MVDA 5AV8B 3AFAC 5B33C 3REID 1P3KA 5GT0C 2YFWB 5AV9B 1P3PA 4KGCC 3AZKD 1P3BA 1KX4B 5B0YD 1HQ3A 1BFMA 2IO5B 4J8WB 3V9RA 2PYOD 5AY8C 4J8UA 3UTAB 3TU4B 3MNNC 1H3OB 1M19C 4WU9B 3AZGD 5B24D 3LZ0B 3UT9A 5BNXB 1P3AC 5B1LB 4J8VD 3X1TC 3B6FD 5B32B 4G91C 3MGRD 3AZGC 5B24C 5B1MC 3KWQA 3W96D 2BYMA 4X23C 4LD9D 2CWEA 3REKB 3AZJB 4H9NB 1M18D 2Y2GA 3WKJC 3H0MC 4G92C 3AZMA 4ZBJC 4WU8B 5AV8C 2NQBD 5AV9C 5BNVA 1KX4C 3MGSD 2Y2LA 1HQ3B 1P3GB 2IO5C 4J8WC 3V9RB 5DNNB 5B2JD 3AZFA 1B6WA 1KX5B 3A1KA 3NQUA 5F99B 3UTAC 3KXBA 3TU4C 3KUYD 4WU9C 3AZED 4XUJD 1N1JA 3LZ0C 3W99A 3LJAB 1EQZA 1R4VA 5B31G 5B1LC 3F6TA 5CHLB 5B32C 2BG1A 3MVDD 3WA9A 4CAYA 5AV5A 1P3KD 3AZNA 1P3PD 1P3FA 3B6GA 1P3BD 3REKC 3AZJC 5BO0B 3AZID 3W97D 4J8UD 3MVDC 3REJD 1P3MA 2FJ7A 5BNVB 3MGPB 1HQ3C 3UT9D 1P3GC 3AZFB 3AZHD 1KX5C 2DQNC 3C1BA 4J8UC 3A6NB 5F99C 3REIA 3AZKA 2Y2NA 1ZLAB 3KWQD 2Y2MA 3X1SA 3W99B 1TZYD 3LZ1A 3LELB 3UTBB 3VH5A 3LJAC 3WTPD 2F8NH 5DNMD 2DF4C 3WAAA 1F66A 4WZSB 3AZMD 2Y2JA 5E5AA 4CAYB 5B0ZB 5AV5B 5BT1D 1P3FB 3B6GB 4J8VA 4KUDD 1ID3A 3AZMC 3B6FA 2BYKB 5JRGB 3KXBD 3W96A 4LD9A 2FJ7B 2Y2IA 3MGPC 2RVQC 5CPIB 3X1UA 5FUGB 4Z2MG 1EQZD 4R8PB 5B31B 3REHD 3AZFC 3C1BB 3WTPE 4H9RB 5CPJD 3A6NC 3REIB 3AZKB 1P3ID 3WA9D 5B0YB 1ZLAC 3W99C 2HUEB 4YS3D 3LELC 3UTBC 2PYOB 5KDMB 5GXQA 3KFUG 4WNNB 1T3UA 3AZGB 3AV1D 5B0ZC 5B24B 5AV5C 1P3MD 3AZNC 3O62A 1P3FC 3B6GC 1M1AA 5AVCD 4J8VB 4WV4B 4M6BA 3B6FB 3NQJB 3MGRB 5JRGC 3W96B 4LD9B 2F8NK 2FJ7C 4CSRB 3AZIA 1M18B 3X1SD 5CPIC 3W97A 3LZ1D 4DQYB 3B0CT 5JA4A 4R8PC 5B31C 3C1BC 3REJA 3WAAD 2NQBB 1F66D 3REIC 3C1CD 5E5AD 3AZKC 2JSSA 3H0RC 3MGSB 5B0YC 1S32D 5B2JB 3AZHA 2HUEC 2PYOC 4H9PA 2NZDA 4KHAB 4Z5TA 3KUYB 1ID3D 2CV5A 4NE3A 5E5AC 3AZEB 4XUJB 2XD5A 5GT3D 4H9QA 1TZYA 4ZUXD 3MGQA 3WTPA 4J8VC 5B40A 3X1UD 4H9OA 3AZLD 5DNMA 2Y2QA 3B6FC 3MVDB 4YM6A 3MGRC 2XD1A 1P3KB 3W96C 4LD9C 1P3PB 4H9SA 3B0CW 1P3BB 1AOIA 3AZIB 1M18C 3W97B 5JA4B 4XZQA 4KUDA 3AL0C 4J8UB 2JCHA 3REJB 5GXQD 2NQBC 5AV6D 3MGSC 3O62D 3AYWD 3UT9B 2FFFB 3AZHB 1M1AD 5B2JC 3REHA 4H9PB 4QLCA 4J8XA 2AROA 5CPJA 3KUYC 1P3IA 4E44A 3AZEC 4XUJC 3RELA 3KWQB 2BYMB 3O62C 1TZYB 5B2ID 4YS3A 1U35D 3WTPB 5CP6A 4H9OB 5DNMB 3AZMB 3P5JB 3AV1A 5AVBD 1P3KC 1P3PC 2F8NA 1P3BC 1P34D 5AVCA 3KSYA 3AZIC 3W97C 1KX3A 4KUDB 4Z66A 2NZDD 4AWLB 5CPKD 3NQUB 3REJC 4Z5TD 3KXBB 2CV5D 1TAFA 1N1JB 3UT9C 3X1VD 1EQZB 3AN2A 3REHB 3AZHC 4EO5B 3MGQD 2NZDC 5B40D 5G49A 5DNND 5CPJB 1KU5A 3C1CA 4YM6D 1P3IB 2HIOD 5GT0A 3WA9B 2ZY2A 4KGCA 3VH6T 3AZNB 3KWQC 1P3OD 1S32A 1TZYC 4YS3B 4JJND 1AOID 3H0LC 3WTPC 1Q9CA 5AY8A 5DNMC 4XZQD 3AV1B 3MNNA 1P3MB 1BH8A 5GT3A 5BT1C 4ZUXA 5AVCB 1AOIC 1P3AA 3AZLA 3AV2D 4KUDC 1P3LD 1BH9A 4QLCD 4J8XD 3X1TA 4AWLC 2AROD 2Y2HA 3FDDA 3KXBC 1TAFB 2W8SA 3RELD 3X1SB 3LZ1B 1EQZC 3REHC 4EO5C 5BS7A 5G49B 3VH6W 5CP6D 3WAAB 5CPJC 1F66B 5AV8A 2ZY5A 5AV6A 5E5AB 3C1CB 3W98D 1P3IC 3WA9C 2UWXA 2YFWA 3AYWA 5GSUD 1S32B 2F8ND 1KX4A 4YS3C 5CP6C 1KX3D 4Z66D 1ID3B 3UTAA 2L5AA 3TU4A 3AV1C 1P3MC 1BH8B 1H3OA 4WU9A 5GT3B 5B2IA 3LZ0A 1U35A 5AVCC 5BNXA 3X1UB 3AZLB 3AN2D 5B1LA 1BH9B 5AVBA 5B32A 3R45A 2ZY3A 3AFAD 5B33D 5GT0D 1P34A 4KGCD 3REKA 3X1SC 4H9NA 3LZ1C 4WJ3C 3AN2C 5CPKA 5GXQB 3WAAC 5AY8D 2G5IC 1F66C 4WU8A 5AV6B 3C1CC 2YFVA 3MNND 1M19D 1HTAA 2VQRA 3O62B 3AYWB 1S32C 3X1VA 1M1AB 1P3GA 1P3AD 1KX5A 5DNNA 3B0BA 1ID3C 5F99A 3X1TD 2HIOA 3EPHA 1P3OA 4Z2MH 5GT3C 5B1MD 5B2IB 4ZUXC 4X23D 4JJNA 1U35B 3LJAA 3X1UC 3AZLC 3IP4C 3WKJD 5AVBB 3R45B 5AV8D 2F8NG 1P34B 5AV9D 1KX4D 5BO0A 3AV2A 2NZDB 4J8WD 1B67A 5CPKB 1P3LA 5BS7C 4Z5TB 5GXQC 1PZRA 2CV5B 2YFVB 5AV6C 3UTAD 3TU4D 4WU9D 4H9QB 3AYWC 3X1VB 3MGPA 3LZ0D 1M1AC 3MGQB 2Y2OA 5B40B 4NFTA 5B1LD 3A6NA 4YM6B 3W98A 2HIOB 2LY8A 4HGAB 5B32D 1P3OB 5GSUA 1ZLAA 5B2IC 4JJNB 1AOIB 1U35C 2Y2PA 3REKD 3UTBA 3LELA 3AZJD 1F1EA 4XZQB
chains in the Genus database with same CATH topology
3EPLA 2F2AC 5AVBC 4WU8D 5C3IB 5B0ZA 2J8PA 4DRAA 3EG5B 1P34C 3AV2B 1HQ3D 4NE5A 1P3GD 1P3LB 4QLCB 4J8XB 1KX5D 5CPKC 2AROB 4Z5TC 2BYKA 3AFAA 5B33A 5F99D 4NE6A 5JRGA 4WU8C 2CV5C 3VH6A 3RELB 4UUZA 3X1VC 5CPIA 1JFIA 3MGQC 5FUGA 5CP6B 3LJAD 4R8PA 5B31A 5DNNC 3B0DB 5B40C 4H9RA 3W98B 2ZM5A 4YM6C 2HIOC 1ULYA 1M19A 4HGAC 2JE5A 5GSUB 1P3OC 2F8NB 4H9SC 1Z2CB 5B0YA 4JJNC 1WWIA 3VH5T 2PYOA 1KX3B 5KDMA 4Z66B 4XZQC 3EPJA 4UPKA 4WNNA 4DRBA 3AZGA 5C3IC 5B1MA 5B24A 4X23A 3MGPD 3AN2B 2RVQD 3AV2C 3WKJA 1P3LC 4QLCC 4J8XC 3AZFD 2AROC 3NQJA 5B32G 3MGRA 1W2EA 5B33B 3A6ND 3AFAB 5GT0B 4KGCB 5AV9A 3RELC 4UUZB 2Y2KA 1ZLAD 4CSRA 1M18A 1JFIB 3W99D 4J8WA 3LELD 3UTBD 5AY8B 3B0DC 2NQBA 2G5HC 3MNNB 3EPKA 3W98C 1M19B 3VH5W 5B0ZD 5GSUC 5AV5D 4ZUXB 3MGSA 3AZND 1P3FD 3B6GD 1P3AB 5B2JA 1WWSA 3A1IA 1KX3C 4Z66C 4KHAA 3X1TB 2ZY4A 3KUYA 4G91B 2RIQA 3AZEA 1A7WA 4XUJA 5B1MB 5JRGD 4X23B 2FJ7D 4E45A 3AZJA 3WKJB 5CPID 4G92B 4R8PD 5B31D 4ZBJB 3C1BD 3MVDA 5AV8B 3AFAC 5B33C 3REID 1P3KA 5GT0C 2YFWB 5AV9B 1P3PA 4KGCC 3AZKD 1P3BA 1KX4B 5B0YD 1HQ3A 1BFMA 2IO5B 4J8WB 3V9RA 2PYOD 5AY8C 4J8UA 3UTAB 3TU4B 3MNNC 1H3OB 1M19C 4WU9B 3AZGD 5B24D 3LZ0B 3UT9A 5BNXB 1P3AC 5B1LB 4J8VD 3X1TC 3B6FD 5B32B 4G91C 3MGRD 3AZGC 5B24C 5B1MC 3KWQA 3W96D 2BYMA 4X23C 4LD9D 2CWEA 3REKB 3AZJB 4H9NB 1M18D 2Y2GA 3WKJC 3H0MC 4G92C 3AZMA 4ZBJC 4WU8B 5AV8C 2NQBD 5AV9C 5BNVA 1KX4C 3MGSD 2Y2LA 1HQ3B 1P3GB 2IO5C 4J8WC 3V9RB 5DNNB 5B2JD 3AZFA 1B6WA 1KX5B 3A1KA 3NQUA 5F99B 3UTAC 3KXBA 3TU4C 3KUYD 4WU9C 3AZED 4XUJD 1N1JA 3LZ0C 3W99A 3LJAB 1EQZA 1R4VA 5B31G 5B1LC 3F6TA 5CHLB 5B32C 2BG1A 3MVDD 3WA9A 4CAYA 5AV5A 1P3KD 3AZNA 1P3PD 1P3FA 3B6GA 1P3BD 3REKC 3AZJC 5BO0B 3AZID 3W97D 4J8UD 3MVDC 3REJD 1P3MA 2FJ7A 5BNVB 3MGPB 1HQ3C 3UT9D 1P3GC 3AZFB 3AZHD 1KX5C 2DQNC 3C1BA 4J8UC 3A6NB 5F99C 3REIA 3AZKA 2Y2NA 1ZLAB 3KWQD 2Y2MA 3X1SA 3W99B 1TZYD 3LZ1A 3LELB 3UTBB 3VH5A 3LJAC 3WTPD 2F8NH 5DNMD 2DF4C 3WAAA 1F66A 4WZSB 3AZMD 2Y2JA 5E5AA 4CAYB 5B0ZB 5AV5B 5BT1D 1P3FB 3B6GB 4J8VA 4KUDD 1ID3A 3AZMC 3B6FA 2BYKB 5JRGB 3KXBD 3W96A 4LD9A 2FJ7B 2Y2IA 3MGPC 2RVQC 5CPIB 3X1UA 5FUGB 4Z2MG 1EQZD 4R8PB 5B31B 3REHD 3AZFC 3C1BB 3WTPE 4H9RB 5CPJD 3A6NC 3REIB 3AZKB 1P3ID 3WA9D 5B0YB 1ZLAC 3W99C 2HUEB 4YS3D 3LELC 3UTBC 2PYOB 5KDMB 5GXQA 3KFUG 4WNNB 1T3UA 3AZGB 3AV1D 5B0ZC 5B24B 5AV5C 1P3MD 3AZNC 3O62A 1P3FC 3B6GC 1M1AA 5AVCD 4J8VB 4WV4B 4M6BA 3B6FB 3NQJB 3MGRB 5JRGC 3W96B 4LD9B 2F8NK 2FJ7C 4CSRB 3AZIA 1M18B 3X1SD 5CPIC 3W97A 3LZ1D 4DQYB 3B0CT 5JA4A 4R8PC 5B31C 3C1BC 3REJA 3WAAD 2NQBB 1F66D 3REIC 3C1CD 5E5AD 3AZKC 2JSSA 3H0RC 3MGSB 5B0YC 1S32D 5B2JB 3AZHA 2HUEC 2PYOC 4H9PA 2NZDA 4KHAB 4Z5TA 3KUYB 1ID3D 2CV5A 4NE3A 5E5AC 3AZEB 4XUJB 2XD5A 5GT3D 4H9QA 1TZYA 4ZUXD 3MGQA 3WTPA 4J8VC 5B40A 3X1UD 4H9OA 3AZLD 5DNMA 2Y2QA 3B6FC 3MVDB 4YM6A 3MGRC 2XD1A 1P3KB 3W96C 4LD9C 1P3PB 4H9SA 3B0CW 1P3BB 1AOIA 3AZIB 1M18C 3W97B 5JA4B 4XZQA 4KUDA 3AL0C 4J8UB 2JCHA 3REJB 5GXQD 2NQBC 5AV6D 3MGSC 3O62D 3AYWD 3UT9B 2FFFB 3AZHB 1M1AD 5B2JC 3REHA 4H9PB 4QLCA 4J8XA 2AROA 5CPJA 3KUYC 1P3IA 4E44A 3AZEC 4XUJC 3RELA 3KWQB 2BYMB 3O62C 1TZYB 5B2ID 4YS3A 1U35D 3WTPB 5CP6A 4H9OB 5DNMB 3AZMB 3P5JB 3AV1A 5AVBD 1P3KC 1P3PC 2F8NA 1P3BC 1P34D 5AVCA 3KSYA 3AZIC 3W97C 1KX3A 4KUDB 4Z66A 2NZDD 4AWLB 5CPKD 3NQUB 3REJC 4Z5TD 3KXBB 2CV5D 1TAFA 1N1JB 3UT9C 3X1VD 1EQZB 3AN2A 3REHB 3AZHC 4EO5B 3MGQD 2NZDC 5B40D 5G49A 5DNND 5CPJB 1KU5A 3C1CA 4YM6D 1P3IB 2HIOD 5GT0A 3WA9B 2ZY2A 4KGCA 3VH6T 3AZNB 3KWQC 1P3OD 1S32A 1TZYC 4YS3B 4JJND 1AOID 3H0LC 3WTPC 1Q9CA 5AY8A 5DNMC 4XZQD 3AV1B 3MNNA 1P3MB 1BH8A 5GT3A 5BT1C 4ZUXA 5AVCB 1AOIC 1P3AA 3AZLA 3AV2D 4KUDC 1P3LD 1BH9A 4QLCD 4J8XD 3X1TA 4AWLC 2AROD 2Y2HA 3FDDA 3KXBC 1TAFB 2W8SA 3RELD 3X1SB 3LZ1B 1EQZC 3REHC 4EO5C 5BS7A 5G49B 3VH6W 5CP6D 3WAAB 5CPJC 1F66B 5AV8A 2ZY5A 5AV6A 5E5AB 3C1CB 3W98D 1P3IC 3WA9C 2UWXA 2YFWA 3AYWA 5GSUD 1S32B 2F8ND 1KX4A 4YS3C 5CP6C 1KX3D 4Z66D 1ID3B 3UTAA 2L5AA 3TU4A 3AV1C 1P3MC 1BH8B 1H3OA 4WU9A 5GT3B 5B2IA 3LZ0A 1U35A 5AVCC 5BNXA 3X1UB 3AZLB 3AN2D 5B1LA 1BH9B 5AVBA 5B32A 3R45A 2ZY3A 3AFAD 5B33D 5GT0D 1P34A 4KGCD 3REKA 3X1SC 4H9NA 3LZ1C 4WJ3C 3AN2C 5CPKA 5GXQB 3WAAC 5AY8D 2G5IC 1F66C 4WU8A 5AV6B 3C1CC 2YFVA 3MNND 1M19D 1HTAA 2VQRA 3O62B 3AYWB 1S32C 3X1VA 1M1AB 1P3GA 1P3AD 1KX5A 5DNNA 3B0BA 1ID3C 5F99A 3X1TD 2HIOA 3EPHA 1P3OA 4Z2MH 5GT3C 5B1MD 5B2IB 4ZUXC 4X23D 4JJNA 1U35B 3LJAA 3X1UC 3AZLC 3IP4C 3WKJD 5AVBB 3R45B 5AV8D 2F8NG 1P34B 5AV9D 1KX4D 5BO0A 3AV2A 2NZDB 4J8WD 1B67A 5CPKB 1P3LA 5BS7C 4Z5TB 5GXQC 1PZRA 2CV5B 2YFVB 5AV6C 3UTAD 3TU4D 4WU9D 4H9QB 3AYWC 3X1VB 3MGPA 3LZ0D 1M1AC 3MGQB 2Y2OA 5B40B 4NFTA 5B1LD 3A6NA 4YM6B 3W98A 2HIOB 2LY8A 4HGAB 5B32D 1P3OB 5GSUA 1ZLAA 5B2IC 4JJNB 1AOIB 1U35C 2Y2PA 3REKD 3UTBA 3LELA 3AZJD 1F1EA 4XZQB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AVB C;  4WU8 D;  5C3I B;  5B0Z A;  4DRA A;  1P34 C;  3AV2 B;  1HQ3 D;  4NE5 A;  1P3G D;  1P3L B;  4QLC B;  4J8X B;  1KX5 D;  5CPK C;  2ARO B;  4Z5T C;  2BYK A;  3AFA A;  5B33 A;  5F99 D;  4NE6 A;  5JRG A;  4WU8 C;  2CV5 C;  3VH6 A;  3REL B;  4UUZ A;  3X1V C;  5CPI A;  1JFI A;  3MGQ C;  5FUG A;  5CP6 B;  3LJA D;  4R8P A;  5B31 A;  5DNN C;  3B0D B;  5B40 C;  4H9R A;  3W98 B;  4YM6 C;  2HIO C;  1ULY A;  1M19 A;  4HGA C;  1P3O C;  5GSU B;  2F8N B;  4H9S C;  5B0Y A;  4JJN C;  1WWI A;  3VH5 T;  2PYO A;  1KX3 B;  5KDM A;  4Z66 B;  4XZQ C;  4WNN A;  4DRB A;  3AZG A;  5C3I C;  5B1M A;  5B24 A;  4X23 A;  3MGP D;  3AN2 B;  2RVQ D;  3AV2 C;  3WKJ A;  1P3L C;  4QLC C;  4J8X C;  3AZF D;  2ARO C;  3NQJ A;  5B32 G;  3MGR A;  3A6N D;  5B33 B;  3AFA B;  5GT0 B;  4KGC B;  5AV9 A;  3REL C;  4UUZ B;  1ZLA D;  4CSR A;  1M18 A;  1JFI B;  3W99 D;  4J8W A;  3LEL D;  3UTB D;  5AY8 B;  3B0D C;  2NQB A;  3MNN B;  3W98 C;  1M19 B;  3VH5 W;  5B0Z D;  5GSU C;  5AV5 D;  4ZUX B;  3MGS A;  3AZN D;  1P3F D;  3B6G D;  1P3A B;  5B2J A;  1WWS A;  1KX3 C;  4Z66 C;  4KHA A;  3X1T B;  3KUY A;  4G91 B;  3AZE A;  1A7W A;  4XUJ A;  5B1M B;  5JRG D;  4X23 B;  2FJ7 D;  4E45 A;  3AZJ A;  3WKJ B;  5CPI D;  4G92 B;  4R8P D;  5B31 D;  4ZBJ B;  3C1B D;  3MVD A;  5AV8 B;  3AFA C;  5B33 C;  3REI D;  1P3K A;  5GT0 C;  2YFW B;  5AV9 B;  1P3P A;  4KGC C;  3AZK D;  1P3B A;  1KX4 B;  5B0Y D;  1HQ3 A;  1BFM A;  2IO5 B;  4J8W B;  3V9R A;  2PYO D;  5AY8 C;  4J8U A;  3UTA B;  3TU4 B;  3MNN C;  1H3O B;  1M19 C;  4WU9 B;  3AZG D;  5B24 D;  3LZ0 B;  3UT9 A;  5BNX B;  1P3A C;  5B1L B;  4J8V D;  3X1T C;  3B6F D;  5B32 B;  4G91 C;  3MGR D;  3AZG C;  5B24 C;  5B1M C;  3KWQ A;  3W96 D;  2BYM A;  4X23 C;  4LD9 D;  2CWE A;  3REK B;  3AZJ B;  4H9N B;  1M18 D;  3WKJ C;  4G92 C;  3AZM A;  4ZBJ C;  4WU8 B;  5AV8 C;  2NQB D;  5AV9 C;  5BNV A;  1KX4 C;  3MGS D;  1HQ3 B;  1P3G B;  2IO5 C;  4J8W C;  3V9R B;  5DNN B;  5B2J D;  3AZF A;  1B6W A;  1KX5 B;  3NQU A;  5F99 B;  3UTA C;  3KXB A;  3TU4 C;  3KUY D;  4WU9 C;  3AZE D;  4XUJ D;  1N1J A;  3LZ0 C;  3W99 A;  3LJA B;  1EQZ A;  1R4V A;  5B31 G;  5B1L C;  5CHL B;  5B32 C;  3MVD D;  3WA9 A;  4CAY A;  5AV5 A;  1P3K D;  3AZN A;  1P3P D;  1P3F A;  3B6G A;  1P3B D;  3REK C;  3AZJ C;  5BO0 B;  3AZI D;  3W97 D;  4J8U D;  3MVD C;  3REJ D;  1P3M A;  2FJ7 A;  5BNV B;  3MGP B;  1HQ3 C;  3UT9 D;  1P3G C;  3AZF B;  3AZH D;  1KX5 C;  3C1B A;  4J8U C;  3A6N B;  5F99 C;  3REI A;  3AZK A;  1ZLA B;  3KWQ D;  3X1S A;  3W99 B;  1TZY D;  3LZ1 A;  3LEL B;  3UTB B;  3VH5 A;  3LJA C;  3WTP D;  2F8N H;  5DNM D;  3WAA A;  1F66 A;  4WZS B;  3AZM D;  5E5A A;  4CAY B;  5B0Z B;  5AV5 B;  5BT1 D;  1P3F B;  3B6G B;  4J8V A;  4KUD D;  1ID3 A;  3AZM C;  3B6F A;  2BYK B;  5JRG B;  3KXB D;  3W96 A;  4LD9 A;  2FJ7 B;  3MGP C;  2RVQ C;  5CPI B;  3X1U A;  5FUG B;  4Z2M G;  1EQZ D;  4R8P B;  5B31 B;  3REH D;  3AZF C;  3C1B B;  3WTP E;  4H9R B;  5CPJ D;  3A6N C;  3REI B;  3AZK B;  1P3I D;  3WA9 D;  5B0Y B;  1ZLA C;  3W99 C;  2HUE B;  4YS3 D;  3LEL C;  3UTB C;  2PYO B;  5KDM B;  5GXQ A;  4WNN B;  3AV1 D;  3AZG B;  1P3M D;  5B0Z C;  5B24 B;  5AV5 C;  3AZN C;  3O62 A;  1P3F C;  3B6G C;  1M1A A;  5AVC D;  4J8V B;  4WV4 B;  4M6B A;  3B6F B;  3NQJ B;  3MGR B;  5JRG C;  3W96 B;  4LD9 B;  2F8N K;  2FJ7 C;  4CSR B;  3AZI A;  1M18 B;  3X1S D;  5CPI C;  3W97 A;  3LZ1 D;  3B0C T;  5JA4 A;  4R8P C;  5B31 C;  3C1B C;  3REJ A;  3WAA D;  2NQB B;  1F66 D;  3REI C;  3C1C D;  5E5A D;  3AZK C;  2JSS A;  3MGS B;  5B0Y C;  1S32 D;  5B2J B;  3AZH A;  2HUE C;  2PYO C;  4H9P A;  2NZD A;  4KHA B;  4Z5T A;  3KUY B;  1ID3 D;  2CV5 A;  4NE3 A;  5E5A C;  3AZE B;  4XUJ B;  5GT3 D;  4H9Q A;  1TZY A;  4ZUX D;  3MGQ A;  3WTP A;  4J8V C;  5B40 A;  3X1U D;  4H9O A;  3AZL D;  5DNM A;  3B6F C;  3MVD B;  4YM6 A;  3MGR C;  1P3K B;  3W96 C;  4LD9 C;  1P3P B;  4H9S A;  3B0C W;  1P3B B;  1AOI A;  3AZI B;  1M18 C;  3W97 B;  5JA4 B;  4XZQ A;  4KUD A;  4J8U B;  3REJ B;  5GXQ D;  2NQB C;  5AV6 D;  3MGS C;  3O62 D;  3AYW D;  3UT9 B;  3AZH B;  1M1A D;  5B2J C;  3REH A;  4H9P B;  4QLC A;  4J8X A;  2ARO A;  5CPJ A;  3KUY C;  1P3I A;  4E44 A;  3AZE C;  4XUJ C;  3REL A;  3KWQ B;  2BYM B;  3O62 C;  1TZY B;  5B2I D;  4YS3 A;  1U35 D;  3WTP B;  5CP6 A;  4H9O B;  5DNM B;  3AZM B;  3AV1 A;  5AVB D;  1P3K C;  1P3P C;  2F8N A;  1P3B C;  1P34 D;  5AVC A;  3KSY A;  3AZI C;  3W97 C;  1KX3 A;  4KUD B;  4Z66 A;  2NZD D;  4AWL B;  5CPK D;  3NQU B;  3REJ C;  4Z5T D;  3KXB B;  2CV5 D;  1TAF A;  1N1J B;  3UT9 C;  3X1V D;  1EQZ B;  3AN2 A;  3REH B;  3AZH C;  4EO5 B;  3MGQ D;  2NZD C;  5B40 D;  5G49 A;  5DNN D;  5CPJ B;  1KU5 A;  3C1C A;  4YM6 D;  1P3I B;  2HIO D;  5GT0 A;  3WA9 B;  4KGC A;  3VH6 T;  3AZN B;  3KWQ C;  1P3O D;  1S32 A;  1TZY C;  4YS3 B;  4JJN D;  1AOI D;  3WTP C;  1Q9C A;  5AY8 A;  5DNM C;  4XZQ D;  3AV1 B;  3MNN A;  1P3M B;  1BH8 A;  5GT3 A;  5BT1 C;  4ZUX A;  5AVC B;  1AOI C;  1P3A A;  3AZL A;  3AV2 D;  4KUD C;  1P3L D;  1BH9 A;  4QLC D;  4J8X D;  3X1T A;  4AWL C;  2ARO D;  3KXB C;  1TAF B;  3REL D;  3X1S B;  3LZ1 B;  1EQZ C;  3REH C;  4EO5 C;  5BS7 A;  5G49 B;  3VH6 W;  5CP6 D;  3WAA B;  5CPJ C;  1F66 B;  5AV8 A;  3C1C B;  5AV6 A;  5E5A B;  3W98 D;  1P3I C;  3WA9 C;  2YFW A;  3AYW A;  5GSU D;  1S32 B;  2F8N D;  1KX4 A;  4YS3 C;  5CP6 C;  1KX3 D;  4Z66 D;  1ID3 B;  3UTA A;  2L5A A;  3TU4 A;  3AV1 C;  1P3M C;  1BH8 B;  1H3O A;  4WU9 A;  5GT3 B;  5B2I A;  3LZ0 A;  1U35 A;  5AVC C;  5BNX A;  3X1U B;  3AZL B;  3AN2 D;  5B1L A;  1BH9 B;  5AVB A;  5B32 A;  3R45 A;  3AFA D;  5B33 D;  5GT0 D;  1P34 A;  4KGC D;  3REK A;  3X1S C;  4H9N A;  3LZ1 C;  3AN2 C;  5CPK A;  5GXQ B;  3WAA C;  5AY8 D;  1F66 C;  4WU8 A;  5AV6 B;  3C1C C;  2YFV A;  3MNN D;  1M19 D;  1HTA A;  3O62 B;  3AYW B;  1S32 C;  3X1V A;  1M1A B;  1P3G A;  1P3A D;  1KX5 A;  5DNN A;  3B0B A;  1ID3 C;  5F99 A;  3X1T D;  2HIO A;  1P3O A;  4Z2M H;  5GT3 C;  5B1M D;  5B2I B;  4ZUX C;  4X23 D;  4JJN A;  1U35 B;  3LJA A;  3X1U C;  3AZL C;  3WKJ D;  5AVB B;  3R45 B;  5AV8 D;  2F8N G;  1P34 B;  5AV9 D;  1KX4 D;  5BO0 A;  3AV2 A;  2NZD B;  4J8W D;  1B67 A;  5CPK B;  1P3L A;  5BS7 C;  4Z5T B;  5GXQ C;  2CV5 B;  2YFV B;  5AV6 C;  3UTA D;  3TU4 D;  4WU9 D;  4H9Q B;  3AYW C;  3X1V B;  3MGP A;  3LZ0 D;  1M1A C;  3MGQ B;  5B40 B;  4NFT A;  5B1L D;  3A6N A;  4YM6 B;  3W98 A;  2HIO B;  2LY8 A;  4HGA B;  5B32 D;  1P3O B;  5GSU A;  1ZLA A;  5B2I C;  4JJN B;  1AOI B;  1U35 C;  3REK D;  3UTB A;  3LEL A;  3AZJ D;  1F1E A;  4XZQ B; 
#chains in the Genus database with same CATH topology
 3EPL A;  2F2A C;  5AVB C;  4WU8 D;  5C3I B;  5B0Z A;  2J8P A;  4DRA A;  3EG5 B;  1P34 C;  3AV2 B;  1HQ3 D;  4NE5 A;  1P3G D;  1P3L B;  4QLC B;  4J8X B;  1KX5 D;  5CPK C;  2ARO B;  4Z5T C;  2BYK A;  3AFA A;  5B33 A;  5F99 D;  4NE6 A;  5JRG A;  4WU8 C;  2CV5 C;  3VH6 A;  3REL B;  4UUZ A;  3X1V C;  5CPI A;  1JFI A;  3MGQ C;  5FUG A;  5CP6 B;  3LJA D;  4R8P A;  5B31 A;  5DNN C;  3B0D B;  5B40 C;  4H9R A;  3W98 B;  2ZM5 A;  4YM6 C;  2HIO C;  1ULY A;  1M19 A;  4HGA C;  2JE5 A;  5GSU B;  1P3O C;  2F8N B;  4H9S C;  1Z2C B;  5B0Y A;  4JJN C;  1WWI A;  3VH5 T;  2PYO A;  1KX3 B;  5KDM A;  4Z66 B;  4XZQ C;  3EPJ A;  4UPK A;  4WNN A;  4DRB A;  3AZG A;  5C3I C;  5B1M A;  5B24 A;  4X23 A;  3MGP D;  3AN2 B;  2RVQ D;  3AV2 C;  3WKJ A;  1P3L C;  4QLC C;  4J8X C;  3AZF D;  2ARO C;  3NQJ A;  5B32 G;  3MGR A;  1W2E A;  5B33 B;  3A6N D;  3AFA B;  5GT0 B;  4KGC B;  5AV9 A;  3REL C;  4UUZ B;  2Y2K A;  1ZLA D;  4CSR A;  1M18 A;  1JFI B;  3W99 D;  4J8W A;  3LEL D;  3UTB D;  5AY8 B;  3B0D C;  2NQB A;  2G5H C;  3MNN B;  3EPK A;  3W98 C;  1M19 B;  3VH5 W;  5B0Z D;  5GSU C;  5AV5 D;  4ZUX B;  3MGS A;  3AZN D;  1P3F D;  3B6G D;  1P3A B;  5B2J A;  1WWS A;  3A1I A;  1KX3 C;  4Z66 C;  4KHA A;  3X1T B;  2ZY4 A;  3KUY A;  4G91 B;  2RIQ A;  3AZE A;  1A7W A;  4XUJ A;  5B1M B;  5JRG D;  4X23 B;  2FJ7 D;  4E45 A;  3AZJ A;  3WKJ B;  5CPI D;  4G92 B;  4R8P D;  5B31 D;  4ZBJ B;  3C1B D;  3MVD A;  5AV8 B;  3AFA C;  5B33 C;  3REI D;  1P3K A;  5GT0 C;  2YFW B;  5AV9 B;  1P3P A;  4KGC C;  3AZK D;  1P3B A;  1KX4 B;  5B0Y D;  1HQ3 A;  1BFM A;  2IO5 B;  4J8W B;  3V9R A;  2PYO D;  5AY8 C;  4J8U A;  3UTA B;  3TU4 B;  3MNN C;  1H3O B;  1M19 C;  4WU9 B;  3AZG D;  5B24 D;  3LZ0 B;  3UT9 A;  5BNX B;  1P3A C;  5B1L B;  4J8V D;  3X1T C;  3B6F D;  5B32 B;  4G91 C;  3MGR D;  3AZG C;  5B24 C;  5B1M C;  3KWQ A;  3W96 D;  2BYM A;  4X23 C;  4LD9 D;  2CWE A;  3REK B;  3AZJ B;  4H9N B;  1M18 D;  2Y2G A;  3WKJ C;  3H0M C;  4G92 C;  3AZM A;  4ZBJ C;  4WU8 B;  5AV8 C;  2NQB D;  5AV9 C;  5BNV A;  1KX4 C;  3MGS D;  2Y2L A;  1HQ3 B;  1P3G B;  2IO5 C;  4J8W C;  3V9R B;  5DNN B;  5B2J D;  3AZF A;  1B6W A;  1KX5 B;  3A1K A;  3NQU A;  5F99 B;  3UTA C;  3KXB A;  3TU4 C;  3KUY D;  4WU9 C;  3AZE D;  4XUJ D;  1N1J A;  3LZ0 C;  3W99 A;  3LJA B;  1EQZ A;  1R4V A;  5B31 G;  5B1L C;  3F6T A;  5CHL B;  5B32 C;  2BG1 A;  3MVD D;  3WA9 A;  4CAY A;  5AV5 A;  1P3K D;  3AZN A;  1P3P D;  1P3F A;  3B6G A;  1P3B D;  3REK C;  3AZJ C;  5BO0 B;  3AZI D;  3W97 D;  4J8U D;  3MVD C;  3REJ D;  1P3M A;  2FJ7 A;  5BNV B;  3MGP B;  1HQ3 C;  3UT9 D;  1P3G C;  3AZF B;  3AZH D;  1KX5 C;  2DQN C;  3C1B A;  4J8U C;  3A6N B;  5F99 C;  3REI A;  3AZK A;  2Y2N A;  1ZLA B;  3KWQ D;  2Y2M A;  3X1S A;  3W99 B;  1TZY D;  3LZ1 A;  3LEL B;  3UTB B;  3VH5 A;  3LJA C;  3WTP D;  2F8N H;  5DNM D;  2DF4 C;  3WAA A;  1F66 A;  4WZS B;  3AZM D;  2Y2J A;  5E5A A;  4CAY B;  5B0Z B;  5AV5 B;  5BT1 D;  1P3F B;  3B6G B;  4J8V A;  4KUD D;  1ID3 A;  3AZM C;  3B6F A;  2BYK B;  5JRG B;  3KXB D;  3W96 A;  4LD9 A;  2FJ7 B;  2Y2I A;  3MGP C;  2RVQ C;  5CPI B;  3X1U A;  5FUG B;  4Z2M G;  1EQZ D;  4R8P B;  5B31 B;  3REH D;  3AZF C;  3C1B B;  3WTP E;  4H9R B;  5CPJ D;  3A6N C;  3REI B;  3AZK B;  1P3I D;  3WA9 D;  5B0Y B;  1ZLA C;  3W99 C;  2HUE B;  4YS3 D;  3LEL C;  3UTB C;  2PYO B;  5KDM B;  5GXQ A;  3KFU G;  4WNN B;  1T3U A;  3AZG B;  3AV1 D;  5B0Z C;  5B24 B;  5AV5 C;  1P3M D;  3AZN C;  3O62 A;  1P3F C;  3B6G C;  1M1A A;  5AVC D;  4J8V B;  4WV4 B;  4M6B A;  3B6F B;  3NQJ B;  3MGR B;  5JRG C;  3W96 B;  4LD9 B;  2F8N K;  2FJ7 C;  4CSR B;  3AZI A;  1M18 B;  3X1S D;  5CPI C;  3W97 A;  3LZ1 D;  4DQY B;  3B0C T;  5JA4 A;  4R8P C;  5B31 C;  3C1B C;  3REJ A;  3WAA D;  2NQB B;  1F66 D;  3REI C;  3C1C D;  5E5A D;  3AZK C;  2JSS A;  3H0R C;  3MGS B;  5B0Y C;  1S32 D;  5B2J B;  3AZH A;  2HUE C;  2PYO C;  4H9P A;  2NZD A;  4KHA B;  4Z5T A;  3KUY B;  1ID3 D;  2CV5 A;  4NE3 A;  5E5A C;  3AZE B;  4XUJ B;  2XD5 A;  5GT3 D;  4H9Q A;  1TZY A;  4ZUX D;  3MGQ A;  3WTP A;  4J8V C;  5B40 A;  3X1U D;  4H9O A;  3AZL D;  5DNM A;  2Y2Q A;  3B6F C;  3MVD B;  4YM6 A;  3MGR C;  2XD1 A;  1P3K B;  3W96 C;  4LD9 C;  1P3P B;  4H9S A;  3B0C W;  1P3B B;  1AOI A;  3AZI B;  1M18 C;  3W97 B;  5JA4 B;  4XZQ A;  4KUD A;  3AL0 C;  4J8U B;  2JCH A;  3REJ B;  5GXQ D;  2NQB C;  5AV6 D;  3MGS C;  3O62 D;  3AYW D;  3UT9 B;  2FFF B;  3AZH B;  1M1A D;  5B2J C;  3REH A;  4H9P B;  4QLC A;  4J8X A;  2ARO A;  5CPJ A;  3KUY C;  1P3I A;  4E44 A;  3AZE C;  4XUJ C;  3REL A;  3KWQ B;  2BYM B;  3O62 C;  1TZY B;  5B2I D;  4YS3 A;  1U35 D;  3WTP B;  5CP6 A;  4H9O B;  5DNM B;  3AZM B;  3P5J B;  3AV1 A;  5AVB D;  1P3K C;  1P3P C;  2F8N A;  1P3B C;  1P34 D;  5AVC A;  3KSY A;  3AZI C;  3W97 C;  1KX3 A;  4KUD B;  4Z66 A;  2NZD D;  4AWL B;  5CPK D;  3NQU B;  3REJ C;  4Z5T D;  3KXB B;  2CV5 D;  1TAF A;  1N1J B;  3UT9 C;  3X1V D;  1EQZ B;  3AN2 A;  3REH B;  3AZH C;  4EO5 B;  3MGQ D;  2NZD C;  5B40 D;  5G49 A;  5DNN D;  5CPJ B;  1KU5 A;  3C1C A;  4YM6 D;  1P3I B;  2HIO D;  5GT0 A;  3WA9 B;  2ZY2 A;  4KGC A;  3VH6 T;  3AZN B;  3KWQ C;  1P3O D;  1S32 A;  1TZY C;  4YS3 B;  4JJN D;  1AOI D;  3H0L C;  3WTP C;  1Q9C A;  5AY8 A;  5DNM C;  4XZQ D;  3AV1 B;  3MNN A;  1P3M B;  1BH8 A;  5GT3 A;  5BT1 C;  4ZUX A;  5AVC B;  1AOI C;  1P3A A;  3AZL A;  3AV2 D;  4KUD C;  1P3L D;  1BH9 A;  4QLC D;  4J8X D;  3X1T A;  4AWL C;  2ARO D;  2Y2H A;  3FDD A;  3KXB C;  1TAF B;  2W8S A;  3REL D;  3X1S B;  3LZ1 B;  1EQZ C;  3REH C;  4EO5 C;  5BS7 A;  5G49 B;  3VH6 W;  5CP6 D;  3WAA B;  5CPJ C;  1F66 B;  5AV8 A;  2ZY5 A;  5AV6 A;  5E5A B;  3C1C B;  3W98 D;  1P3I C;  3WA9 C;  2UWX A;  2YFW A;  3AYW A;  5GSU D;  1S32 B;  2F8N D;  1KX4 A;  4YS3 C;  5CP6 C;  1KX3 D;  4Z66 D;  1ID3 B;  3UTA A;  2L5A A;  3TU4 A;  3AV1 C;  1P3M C;  1BH8 B;  1H3O A;  4WU9 A;  5GT3 B;  5B2I A;  3LZ0 A;  1U35 A;  5AVC C;  5BNX A;  3X1U B;  3AZL B;  3AN2 D;  5B1L A;  1BH9 B;  5AVB A;  5B32 A;  3R45 A;  2ZY3 A;  3AFA D;  5B33 D;  5GT0 D;  1P34 A;  4KGC D;  3REK A;  3X1S C;  4H9N A;  3LZ1 C;  4WJ3 C;  3AN2 C;  5CPK A;  5GXQ B;  3WAA C;  5AY8 D;  2G5I C;  1F66 C;  4WU8 A;  5AV6 B;  3C1C C;  2YFV A;  3MNN D;  1M19 D;  1HTA A;  2VQR A;  3O62 B;  3AYW B;  1S32 C;  3X1V A;  1M1A B;  1P3G A;  1P3A D;  1KX5 A;  5DNN A;  3B0B A;  1ID3 C;  5F99 A;  3X1T D;  2HIO A;  3EPH A;  1P3O A;  4Z2M H;  5GT3 C;  5B1M D;  5B2I B;  4ZUX C;  4X23 D;  4JJN A;  1U35 B;  3LJA A;  3X1U C;  3AZL C;  3IP4 C;  3WKJ D;  5AVB B;  3R45 B;  5AV8 D;  2F8N G;  1P34 B;  5AV9 D;  1KX4 D;  5BO0 A;  3AV2 A;  2NZD B;  4J8W D;  1B67 A;  5CPK B;  1P3L A;  5BS7 C;  4Z5T B;  5GXQ C;  1PZR A;  2CV5 B;  2YFV B;  5AV6 C;  3UTA D;  3TU4 D;  4WU9 D;  4H9Q B;  3AYW C;  3X1V B;  3MGP A;  3LZ0 D;  1M1A C;  3MGQ B;  2Y2O A;  5B40 B;  4NFT A;  5B1L D;  3A6N A;  4YM6 B;  3W98 A;  2HIO B;  2LY8 A;  4HGA B;  5B32 D;  1P3O B;  5GSU A;  1ZLA A;  5B2I C;  4JJN B;  1AOI B;  1U35 C;  2Y2P A;  3REK D;  3UTB A;  3LEL A;  3AZJ D;  1F1E A;  4XZQ B; 
#chains in the Genus database with same CATH homology
 3EPL A;  2F2A C;  5AVB C;  4WU8 D;  5C3I B;  5B0Z A;  2J8P A;  4DRA A;  3EG5 B;  1P34 C;  3AV2 B;  1HQ3 D;  4NE5 A;  1P3G D;  1P3L B;  4QLC B;  4J8X B;  1KX5 D;  5CPK C;  2ARO B;  4Z5T C;  2BYK A;  3AFA A;  5B33 A;  5F99 D;  4NE6 A;  5JRG A;  4WU8 C;  2CV5 C;  3VH6 A;  3REL B;  4UUZ A;  3X1V C;  5CPI A;  1JFI A;  3MGQ C;  5FUG A;  5CP6 B;  3LJA D;  4R8P A;  5B31 A;  5DNN C;  3B0D B;  5B40 C;  4H9R A;  3W98 B;  2ZM5 A;  4YM6 C;  2HIO C;  1ULY A;  1M19 A;  4HGA C;  2JE5 A;  5GSU B;  1P3O C;  2F8N B;  4H9S C;  1Z2C B;  5B0Y A;  4JJN C;  1WWI A;  3VH5 T;  2PYO A;  1KX3 B;  5KDM A;  4Z66 B;  4XZQ C;  3EPJ A;  4UPK A;  4WNN A;  4DRB A;  3AZG A;  5C3I C;  5B1M A;  5B24 A;  4X23 A;  3MGP D;  3AN2 B;  2RVQ D;  3AV2 C;  3WKJ A;  1P3L C;  4QLC C;  4J8X C;  3AZF D;  2ARO C;  3NQJ A;  5B32 G;  3MGR A;  1W2E A;  5B33 B;  3A6N D;  3AFA B;  5GT0 B;  4KGC B;  5AV9 A;  3REL C;  4UUZ B;  2Y2K A;  1ZLA D;  4CSR A;  1M18 A;  1JFI B;  3W99 D;  4J8W A;  3LEL D;  3UTB D;  5AY8 B;  3B0D C;  2NQB A;  2G5H C;  3MNN B;  3EPK A;  3W98 C;  1M19 B;  3VH5 W;  5B0Z D;  5GSU C;  5AV5 D;  4ZUX B;  3MGS A;  3AZN D;  1P3F D;  3B6G D;  1P3A B;  5B2J A;  1WWS A;  3A1I A;  1KX3 C;  4Z66 C;  4KHA A;  3X1T B;  2ZY4 A;  3KUY A;  4G91 B;  2RIQ A;  3AZE A;  1A7W A;  4XUJ A;  5B1M B;  5JRG D;  4X23 B;  2FJ7 D;  4E45 A;  3AZJ A;  3WKJ B;  5CPI D;  4G92 B;  4R8P D;  5B31 D;  4ZBJ B;  3C1B D;  3MVD A;  5AV8 B;  3AFA C;  5B33 C;  3REI D;  1P3K A;  5GT0 C;  2YFW B;  5AV9 B;  1P3P A;  4KGC C;  3AZK D;  1P3B A;  1KX4 B;  5B0Y D;  1HQ3 A;  1BFM A;  2IO5 B;  4J8W B;  3V9R A;  2PYO D;  5AY8 C;  4J8U A;  3UTA B;  3TU4 B;  3MNN C;  1H3O B;  1M19 C;  4WU9 B;  3AZG D;  5B24 D;  3LZ0 B;  3UT9 A;  5BNX B;  1P3A C;  5B1L B;  4J8V D;  3X1T C;  3B6F D;  5B32 B;  4G91 C;  3MGR D;  3AZG C;  5B24 C;  5B1M C;  3KWQ A;  3W96 D;  2BYM A;  4X23 C;  4LD9 D;  2CWE A;  3REK B;  3AZJ B;  4H9N B;  1M18 D;  2Y2G A;  3WKJ C;  3H0M C;  4G92 C;  3AZM A;  4ZBJ C;  4WU8 B;  5AV8 C;  2NQB D;  5AV9 C;  5BNV A;  1KX4 C;  3MGS D;  2Y2L A;  1HQ3 B;  1P3G B;  2IO5 C;  4J8W C;  3V9R B;  5DNN B;  5B2J D;  3AZF A;  1B6W A;  1KX5 B;  3A1K A;  3NQU A;  5F99 B;  3UTA C;  3KXB A;  3TU4 C;  3KUY D;  4WU9 C;  3AZE D;  4XUJ D;  1N1J A;  3LZ0 C;  3W99 A;  3LJA B;  1EQZ A;  1R4V A;  5B31 G;  5B1L C;  3F6T A;  5CHL B;  5B32 C;  2BG1 A;  3MVD D;  3WA9 A;  4CAY A;  5AV5 A;  1P3K D;  3AZN A;  1P3P D;  1P3F A;  3B6G A;  1P3B D;  3REK C;  3AZJ C;  5BO0 B;  3AZI D;  3W97 D;  4J8U D;  3MVD C;  3REJ D;  1P3M A;  2FJ7 A;  5BNV B;  3MGP B;  1HQ3 C;  3UT9 D;  1P3G C;  3AZF B;  3AZH D;  1KX5 C;  2DQN C;  3C1B A;  4J8U C;  3A6N B;  5F99 C;  3REI A;  3AZK A;  2Y2N A;  1ZLA B;  3KWQ D;  2Y2M A;  3X1S A;  3W99 B;  1TZY D;  3LZ1 A;  3LEL B;  3UTB B;  3VH5 A;  3LJA C;  3WTP D;  2F8N H;  5DNM D;  2DF4 C;  3WAA A;  1F66 A;  4WZS B;  3AZM D;  2Y2J A;  5E5A A;  4CAY B;  5B0Z B;  5AV5 B;  5BT1 D;  1P3F B;  3B6G B;  4J8V A;  4KUD D;  1ID3 A;  3AZM C;  3B6F A;  2BYK B;  5JRG B;  3KXB D;  3W96 A;  4LD9 A;  2FJ7 B;  2Y2I A;  3MGP C;  2RVQ C;  5CPI B;  3X1U A;  5FUG B;  4Z2M G;  1EQZ D;  4R8P B;  5B31 B;  3REH D;  3AZF C;  3C1B B;  3WTP E;  4H9R B;  5CPJ D;  3A6N C;  3REI B;  3AZK B;  1P3I D;  3WA9 D;  5B0Y B;  1ZLA C;  3W99 C;  2HUE B;  4YS3 D;  3LEL C;  3UTB C;  2PYO B;  5KDM B;  5GXQ A;  3KFU G;  4WNN B;  1T3U A;  3AZG B;  3AV1 D;  5B0Z C;  5B24 B;  5AV5 C;  1P3M D;  3AZN C;  3O62 A;  1P3F C;  3B6G C;  1M1A A;  5AVC D;  4J8V B;  4WV4 B;  4M6B A;  3B6F B;  3NQJ B;  3MGR B;  5JRG C;  3W96 B;  4LD9 B;  2F8N K;  2FJ7 C;  4CSR B;  3AZI A;  1M18 B;  3X1S D;  5CPI C;  3W97 A;  3LZ1 D;  4DQY B;  3B0C T;  5JA4 A;  4R8P C;  5B31 C;  3C1B C;  3REJ A;  3WAA D;  2NQB B;  1F66 D;  3REI C;  3C1C D;  5E5A D;  3AZK C;  2JSS A;  3H0R C;  3MGS B;  5B0Y C;  1S32 D;  5B2J B;  3AZH A;  2HUE C;  2PYO C;  4H9P A;  2NZD A;  4KHA B;  4Z5T A;  3KUY B;  1ID3 D;  2CV5 A;  4NE3 A;  5E5A C;  3AZE B;  4XUJ B;  2XD5 A;  5GT3 D;  4H9Q A;  1TZY A;  4ZUX D;  3MGQ A;  3WTP A;  4J8V C;  5B40 A;  3X1U D;  4H9O A;  3AZL D;  5DNM A;  2Y2Q A;  3B6F C;  3MVD B;  4YM6 A;  3MGR C;  2XD1 A;  1P3K B;  3W96 C;  4LD9 C;  1P3P B;  4H9S A;  3B0C W;  1P3B B;  1AOI A;  3AZI B;  1M18 C;  3W97 B;  5JA4 B;  4XZQ A;  4KUD A;  3AL0 C;  4J8U B;  2JCH A;  3REJ B;  5GXQ D;  2NQB C;  5AV6 D;  3MGS C;  3O62 D;  3AYW D;  3UT9 B;  2FFF B;  3AZH B;  1M1A D;  5B2J C;  3REH A;  4H9P B;  4QLC A;  4J8X A;  2ARO A;  5CPJ A;  3KUY C;  1P3I A;  4E44 A;  3AZE C;  4XUJ C;  3REL A;  3KWQ B;  2BYM B;  3O62 C;  1TZY B;  5B2I D;  4YS3 A;  1U35 D;  3WTP B;  5CP6 A;  4H9O B;  5DNM B;  3AZM B;  3P5J B;  3AV1 A;  5AVB D;  1P3K C;  1P3P C;  2F8N A;  1P3B C;  1P34 D;  5AVC A;  3KSY A;  3AZI C;  3W97 C;  1KX3 A;  4KUD B;  4Z66 A;  2NZD D;  4AWL B;  5CPK D;  3NQU B;  3REJ C;  4Z5T D;  3KXB B;  2CV5 D;  1TAF A;  1N1J B;  3UT9 C;  3X1V D;  1EQZ B;  3AN2 A;  3REH B;  3AZH C;  4EO5 B;  3MGQ D;  2NZD C;  5B40 D;  5G49 A;  5DNN D;  5CPJ B;  1KU5 A;  3C1C A;  4YM6 D;  1P3I B;  2HIO D;  5GT0 A;  3WA9 B;  2ZY2 A;  4KGC A;  3VH6 T;  3AZN B;  3KWQ C;  1P3O D;  1S32 A;  1TZY C;  4YS3 B;  4JJN D;  1AOI D;  3H0L C;  3WTP C;  1Q9C A;  5AY8 A;  5DNM C;  4XZQ D;  3AV1 B;  3MNN A;  1P3M B;  1BH8 A;  5GT3 A;  5BT1 C;  4ZUX A;  5AVC B;  1AOI C;  1P3A A;  3AZL A;  3AV2 D;  4KUD C;  1P3L D;  1BH9 A;  4QLC D;  4J8X D;  3X1T A;  4AWL C;  2ARO D;  2Y2H A;  3FDD A;  3KXB C;  1TAF B;  2W8S A;  3REL D;  3X1S B;  3LZ1 B;  1EQZ C;  3REH C;  4EO5 C;  5BS7 A;  5G49 B;  3VH6 W;  5CP6 D;  3WAA B;  5CPJ C;  1F66 B;  5AV8 A;  2ZY5 A;  5AV6 A;  5E5A B;  3C1C B;  3W98 D;  1P3I C;  3WA9 C;  2UWX A;  2YFW A;  3AYW A;  5GSU D;  1S32 B;  2F8N D;  1KX4 A;  4YS3 C;  5CP6 C;  1KX3 D;  4Z66 D;  1ID3 B;  3UTA A;  2L5A A;  3TU4 A;  3AV1 C;  1P3M C;  1BH8 B;  1H3O A;  4WU9 A;  5GT3 B;  5B2I A;  3LZ0 A;  1U35 A;  5AVC C;  5BNX A;  3X1U B;  3AZL B;  3AN2 D;  5B1L A;  1BH9 B;  5AVB A;  5B32 A;  3R45 A;  2ZY3 A;  3AFA D;  5B33 D;  5GT0 D;  1P34 A;  4KGC D;  3REK A;  3X1S C;  4H9N A;  3LZ1 C;  4WJ3 C;  3AN2 C;  5CPK A;  5GXQ B;  3WAA C;  5AY8 D;  2G5I C;  1F66 C;  4WU8 A;  5AV6 B;  3C1C C;  2YFV A;  3MNN D;  1M19 D;  1HTA A;  2VQR A;  3O62 B;  3AYW B;  1S32 C;  3X1V A;  1M1A B;  1P3G A;  1P3A D;  1KX5 A;  5DNN A;  3B0B A;  1ID3 C;  5F99 A;  3X1T D;  2HIO A;  3EPH A;  1P3O A;  4Z2M H;  5GT3 C;  5B1M D;  5B2I B;  4ZUX C;  4X23 D;  4JJN A;  1U35 B;  3LJA A;  3X1U C;  3AZL C;  3IP4 C;  3WKJ D;  5AVB B;  3R45 B;  5AV8 D;  2F8N G;  1P34 B;  5AV9 D;  1KX4 D;  5BO0 A;  3AV2 A;  2NZD B;  4J8W D;  1B67 A;  5CPK B;  1P3L A;  5BS7 C;  4Z5T B;  5GXQ C;  1PZR A;  2CV5 B;  2YFV B;  5AV6 C;  3UTA D;  3TU4 D;  4WU9 D;  4H9Q B;  3AYW C;  3X1V B;  3MGP A;  3LZ0 D;  1M1A C;  3MGQ B;  2Y2O A;  5B40 B;  4NFT A;  5B1L D;  3A6N A;  4YM6 B;  3W98 A;  2HIO B;  2LY8 A;  4HGA B;  5B32 D;  1P3O B;  5GSU A;  1ZLA A;  5B2I C;  4JJN B;  1AOI B;  1U35 C;  2Y2P A;  3REK D;  3UTB A;  3LEL A;  3AZJ D;  1F1E A;  4XZQ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...