4J8VC

X-ray structure of ncp145 with bound chlorido(eta-6-p-cymene)(n-phenyl-2-pyridinecarbothioamide)ruthenium(ii)
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
106
structure length
106
Chain Sequence
AKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.2
publication title Novel metal(II) arene 2-pyridinecarbothioamides: a rationale to orally active organometallic anticancer agents
doi rcsb
source organism Xenopus laevis
molecule tags Structural protein/dna
total genus 33
structure length 106
sequence length 106
chains with identical sequence G
ec nomenclature
pdb deposition date 2013-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4j8vC00
3AZJD 1KX3C 3WAAD 3REHB 3MGQD 5BNVB 4HGAC 4H9QB 3WA9B 3B6GB 5AVCA 4J8WD 2RVQD 4XUJC 3KUYB 1HQ3C 3C1CB 3TU4B 1ID3D 1KX5B 5B0YA 1M19A 1ZLAD 4WU8B 5GT3A 3AZKC 3KXBD 2PYOA 1P3GC 1P3LC 4KUDC 3WKJD 3UT9C 2YFWB 5B33A 1P3FA 2YFVA 5JA4B 4WNNB 4ZUXA 5GT0A 4X23C 4Z66B 3REIC 3X1TC 5B40D 1F66B 1TZYC 2AROD 3MVDB 4WU9D 5CPKB 4LD9A 5AV6A 4R8PB 3AZJC 3WAAC 4E45A 1N1JA 1P3BC 4YS3A 5B2ID 1P3MB 3C1BB 5JRGB 5CP6A 5CPJD 3X1UA 5GSUC 3WTPB 2NQBA 5C3IB 3AN2D 5B1LB 4WZSB 2RVQC 3MGPB 1TAFA 1ID3C 3AZFA 5DNNC 5AV9B 3AZGA 3KXBC 3WKJC 5AV5D 3NQUB 4KGCA 3AYWD 3LZ1C 1EQZD 3UTBB 3AZID 5AVCB 3X1VD 4E44A 2AROC 4CAYA 4G91C 4WU9C 5B0YB 4Z66D 1M19B 2HIOD 1F66D 5B1MA 5AV8A 3UTAA 3W97D 3AZLD 3A6ND 5B2IC 5B0ZD 1Q9CA 1P3FB 5CPJC 2YFVB 1U35A 1P3MD 3MGSD 3REHC 1P34A 3AN2C 4ZUXB 1P3PD 5B31D 5B2JD 3B6GC 3B0CW 4H9QA 3WA9A 3KUYC 4J8VA 3TU4C 1KX5C 5AY8D 5AV6B 3LZ0B 3B6FD 1N1JB 2CV5D 3LELA 3X1UB 5CP6B 5AV5C 3REJA 1AOIA 1P3IA 3AYWC 2NQBB 1KX3D 5CPIA 1BH8B 3X1VC 2F8NH 4Z66C 3MNNB 2HIOC 4Z5TA 1F66C 3REKA 5B0YD 3W97C 5CPKC 3A6NC 5B24B 5GT3D 4R8PC 3B0DB 2PYOD 3VH6W 2NZDD 1B6WA 3RELB 1P3MC 4KGCB 1P3GD 5B33D 3X1SB 3C1BC 4KUDD 4ZBJC 1BH9A 1P3PC 5B31C 5B2JC 5JRGA 5C3IC 3AZHA 2IO5C 4CAYB 5GT0D 4J8UA 3W96A 5AV8B 2LY8A 4UUZA 1P3OB 3B6FC 3R45B 4LD9D 4YS3D 2BYMA 1P34B 3X1UD 4G92C 1P3BD 3AV1D 3O62A 1M1AA 3NQUA 4AWLB 1P3AB 4H9RA 5GSUD 5GXQB 5BS7A 5AVCC 2FJ7A 4QLCA 4J8VB 3UTBA 3AZFD 5B0YC 1M19C 5GT3C 3AZGD 3LELB 2PYOC 4EO5B 2NZDC 5DNND 3REJB 1AOIB 3V9RA 5B33C 1P3IB 3AZMB 1P3FC 3AZNA 4CSRA 4J8XD 5CPIB 1S32B 3B0CT 4ZUXC 5GT0C 3MGRB 3LZ1D 4Z5TB 3REKB 4LD9C 3B0BA 5B1MD 5AV8D 3UTAD 4WV4B 5CHLB 3W98B 4YS3C 3LZ0A 3W99D 3X1UC 1HQ3A 5CP6C 1BH9B 3AV1C 1U35D 4YM6A 3AZHB 3REHD 4J8UB 3LJAA 3W96B 3UT9A 1BH8A 3AZFC 3WA9D 4NE6A 3B6GD 2HUEB 4UUZB 3AZGC 3MNNA 3C1CD 3KUYD 5F99A 3VH6T 3TU4D 4X23A 3AV2A 2F8NA 1KX5D 3REIA 2BYMB 3LELD 1P3KB 4WU8D 5B24A 4J8XC 4H9SC 3AZEA 5BNXB 3O62B 1M1AB 3RELA 4H9RB 2L5AA 3X1SA 1KX4A 2FJ7B 4QLCB 5E5AA 5B32A 3MGQA 5B1MC 3KWQB 5AV8C 3UTAC 5DNMA 3W99C 3MVDD 4Z2MH 4J8WA 2CWEA 3V9RB 1P3OA 3AZNB 1WWSA 3R45A 5CPKD 1U35C 4JJNB 4CSRB 4R8PD 1P34C 4DRAA 1ZLAA 5AVBA 3C1BD 5JRGD 3VH5W 2F8NK 3WA9C 3WTPD 1P3AA 5GXQA 4J8VC 3W96D 5B1LD 3MGPD 3C1CC 3LELC 5B40A 4XUJB 4WU8C 1HQ3B 5AV9D 3REJC 5BT1D 1AOIC 1P3IC 4YM6B 4NE3A 3AZKB 4Z2MG 3AZMA 1P3LB 3O62D 1M1AD 3LJAB 3UT9B 4NFTA 5CPJA 1S32A 4Z5TC 3UTBD 3MGRA 5AVCD 3AN2A 5F99B 2F8NB 3MVDC 4X23B 3AV2B 3REIB 3X1TB 1M19D 1TZYB 3AZEB 3W98A 3AZND 4XZQA 1M18A 5JRGC 1P3FD 1KX4B 3AZHC 3WTPC 5E5AB 5B32B 3MGQB 4J8UC 3W96C 5B1LC 4ZUXD 3MGPC 1EQZA 5DNMB 3WTPE 3AZIA 4J8WB 3X1VA 5AV9C 5BT1C 1ID3B 2F8NG 3VH6A 2HIOA 1WWIA 4H9NA 5AV6D 3LZ0D 1ZLAB 4H9OA 3AFAA 1P3KA 5AVBB 3AZLA 4YM6D 5CP6D 3WKJB 3O62C 1M1AC 5B0ZA 1BFMA 5BNXA 5BS7C 2NQBD 2FJ7C 4QLCC 5B32G 3MGSA 1F1EA 3UTBC 5B31A 3MNND 5B40B 3KWQA 5F99D 2AROB 2F8ND 4G91B 3AV2D 4WU9B 3AZNC 5B24D 5AY8A 3B6FA 3AZED 2CV5A 4JJNA 5B2IB 3VH5T 3RELD 4KHAB 4KGCD 3X1SD 5CPJB 1JFIA 4H9PA 1KX4D 5E5AD 5B32D 1KX3A 3AN2B 2JSSA 5DNMD 3LZ0C 5AV6C 2BYKA 1P3OD 4XZQB 1M18B 4XUJA 4YM6C 1H3OA 5AVBD 2NQBC 1P34D 2NZDA 5AV5B 3AZKA 3LJAC 1P3GA 1P3LA 3AYWB 4KUDA 1EQZB 1P3AD 5GXQD 3AZIB 3MNNC 3X1VB 5F99C 4J8VD 3AV2C 2HIOB 4H9NB 4H9OB 5B24C 3AFAB 3X1TA 3B0DC 5FUGA 3W97B 1TZYA 3AZEC 3AZLB 3A6NB 3REJD 1AOID 3RELC 4KGCC 5B0ZB 1P3ID 3X1SC 3AZMD 1KX4C 1ULYA 5E5AC 5B32C 3MGSB 3MGQC 3AZJA 5CPID 3WAAA 1S32D 4ZBJB 1P3BA 3AV1A 1P3PB 5B31B 5B2JB 3MGRD 5DNMC 5GSUA 4Z5TD 2IO5B 4J8WC 3REKD 1P3OC 5BO0A 5AY8B 3B6FB 1ZLAC 1ID3A 2CV5B 3W98D 3KSYA 5AVBC 4XZQD 5G49A 5DNNA 1M18D 3KXBA 1JFIB 4H9PB 3WKJA 1KX3B 4G92B 4AWLC 1P3AC 4J8XA 5GXQC 4H9SA 3AZHD 4J8UD 1R4VA 4HGAB 4DRBA 5B31G 3LZ1A 2BYKB 5B40C 1KU5A 4EO5C 2AROA 1H3OB 5GT3B 3AFAD 4WU9A 1P3KD 2PYOB 3AZMC 3NQJA 4NE5A 2NZDB 5KDMA 3W99A 1P3GB 5CPIC 5B33B 4KUDB 3VH5A 1S32C 5B2IA 4KHAA 3MGRC 2FJ7D 4QLCD 3REHA 5GT0B 3REKC 5BNVA 3KWQD 3B6GA 1A7WA 5FUGB 3W98C 4LD9B 4XZQC 1M18C 3C1CA 3KUYA 1HTAA 3TU4A 1KX5A 4JJND 4YS3B 3AZJB 3WAAB 4WU8A 1P3BB 3AV1B 5AV5A 1EQZC 5GSUB 2YFWA 3AYWA 3AZIC 2HUEC 1TAFB 5JA4A 4WNNA 5BO0B 3AZFB 3AFAC 3AZGB 4Z66A 1P3KC 1F66A 5G49B 5DNNB 4XUJD 3AZLC 1HQ3D 3KXBB 3MVDA 5B0ZC 3W97A 5CPKA 3A6NA 3AZKD 4J8XB 4M6BA 4R8PA 3MGSC 1P3LD 1P3MA 3LJAD 3UT9D 3C1BA 3LZ1B 1P3PA 3WTPA 5B2JA 3KWQC 5B1LA 5B1MB 1B67A 5AY8C 4X23D 3MGPA 3REID 3X1TD 3UTAB 3NQJB 1TZYD 2CV5C 5KDMB 4JJNC 3W99B 5AV9A 1U35B
chains in the Genus database with same CATH superfamily
3AZJD 1KX3C 3WAAD 2BG1A 3REHB 3MGQD 5BNVB 4HGAC 4H9QB 3WA9B 3B6GB 2FFFB 5AVCA 4J8WD 2RVQD 4XUJC 3KUYB 1HQ3C 3C1CB 3TU4B 1ID3D 1KX5B 5B0YA 1M19A 1ZLAD 4WU8B 5GT3A 3AZKC 3KXBD 2PYOA 1P3GC 1P3LC 4KUDC 3WKJD 3UT9C 2YFWB 5B33A 1P3FA 2YFVA 5JA4B 4WNNB 4ZUXA 5GT0A 4X23C 4Z66B 4UPKA 3REIC 3X1TC 5B40D 1F66B 1TZYC 2AROD 3MVDB 4WU9D 2Y2GA 5CPKB 4LD9A 5AV6A 4R8PB 3AZJC 3WAAC 4E45A 1N1JA 1P3BC 4YS3A 5B2ID 1P3MB 3C1BB 5JRGB 5CP6A 5CPJD 3X1UA 5GSUC 3WTPB 2NQBA 4DQYB 5C3IB 3AN2D 5B1LB 4WZSB 2RVQC 3MGPB 1TAFA 1ID3C 3AZFA 5DNNC 5AV9B 3AZGA 3KXBC 3WKJC 5AV5D 3NQUB 4KGCA 3AYWD 3LZ1C 1EQZD 3UTBB 2J8PA 3AZID 5AVCB 3X1VD 4E44A 2AROC 4CAYA 4G91C 4WU9C 5B0YB 4Z66D 1M19B 2HIOD 1F66D 5B1MA 5AV8A 3UTAA 3W97D 4WJ3C 3AZLD 3A6ND 5B2IC 5B0ZD 1Q9CA 1P3FB 5CPJC 2YFVB 1U35A 1P3MD 3MGSD 3REHC 1P34A 3AN2C 4ZUXB 1P3PD 3H0LC 5B31D 5B2JD 3B6GC 3B0CW 4H9QA 3WA9A 3KUYC 4J8VA 3TU4C 1KX5C 5AY8D 5AV6B 3LZ0B 3B6FD 1N1JB 2CV5D 3LELA 2JCHA 3X1UB 5CP6B 5AV5C 3REJA 1AOIA 1P3IA 3AYWC 2NQBB 1KX3D 5CPIA 1BH8B 3X1VC 2F8NH 4Z66C 3MNNB 2HIOC 4Z5TA 1F66C 3REKA 5B0YD 3W97C 5CPKC 3A6NC 5B24B 5GT3D 4R8PC 3B0DB 2PYOD 3VH6W 2NZDD 1B6WA 3RELB 1P3MC 4KGCB 1P3GD 2DF4C 5B33D 3X1SB 3C1BC 4KUDD 4ZBJC 1BH9A 2F2AC 1P3PC 5B31C 5B2JC 5JRGA 5C3IC 3AZHA 2IO5C 4CAYB 5GT0D 4J8UA 3W96A 5AV8B 2LY8A 4UUZA 1P3OB 3B6FC 3R45B 4LD9D 4YS3D 2BYMA 1P34B 3X1UD 4G92C 1P3BD 3AV1D 3O62A 1M1AA 3NQUA 4AWLB 1P3AB 4H9RA 5GSUD 5GXQB 5BS7A 5AVCC 2FJ7A 4QLCA 4J8VB 3UTBA 3AZFD 3F6TA 5B0YC 1M19C 5GT3C 3AZGD 3LELB 2PYOC 4EO5B 2NZDC 5DNND 3REJB 1AOIB 3V9RA 5B33C 1P3IB 3AZMB 1P3FC 3AZNA 4CSRA 4J8XD 5CPIB 1S32B 3B0CT 4ZUXC 5GT0C 3MGRB 3LZ1D 4Z5TB 3REKB 4LD9C 3B0BA 5B1MD 5AV8D 3UTAD 4WV4B 5CHLB 2Y2IA 3W98B 4YS3C 3LZ0A 3W99D 3X1UC 1HQ3A 5CP6C 1BH9B 3AV1C 1U35D 2Y2PA 4YM6A 3AZHB 2Y2KA 3REHD 4J8UB 3LJAA 3W96B 3UT9A 1BH8A 3AZFC 3WA9D 4NE6A 3EPJA 3B6GD 2HUEB 4UUZB 3AZGC 3MNNA 3C1CD 3KUYD 5F99A 3VH6T 3TU4D 4X23A 3AV2A 2F8NA 1KX5D 3REIA 2BYMB 3LELD 1P3KB 4WU8D 5B24A 4J8XC 4H9SC 3AZEA 5BNXB 3O62B 1M1AB 3RELA 4H9RB 2L5AA 3X1SA 1KX4A 2FJ7B 4QLCB 5E5AA 5B32A 3MGQA 2ZM5A 5B1MC 3KWQB 5AV8C 3UTAC 5DNMA 3W99C 3MVDD 4Z2MH 4J8WA 2CWEA 3V9RB 1P3OA 3AZNB 1WWSA 3R45A 5CPKD 1U35C 4JJNB 4CSRB 4R8PD 1P34C 4DRAA 1ZLAA 3EPLA 3IP4C 5AVBA 3KFUG 3C1BD 5JRGD 3VH5W 2F8NK 2RIQA 3WA9C 3WTPD 1P3AA 2W8SA 5GXQA 4J8VC 5B1LD 3W96D 3EG5B 3MGPD 3C1CC 3LELC 5B40A 4XUJB 4WU8C 1HQ3B 5AV9D 3REJC 5BT1D 1AOIC 1P3IC 3H0RC 4YM6B 4NE3A 3AZKB 4Z2MG 3AZMA 1P3LB 2Y2MA 3O62D 1M1AD 3LJAB 3UT9B 4NFTA 5CPJA 1S32A 4Z5TC 3A1KA 3UTBD 3MGRA 5AVCD 3AN2A 5F99B 2F8NB 3MVDC 4X23B 3AV2B 3REIB 3X1TB 1M19D 1TZYB 2ZY4A 2Y2QA 3AZEB 3W98A 3AZND 4XZQA 1M18A 5JRGC 1P3FD 1KX4B 3AZHC 3WTPC 5E5AB 5B32B 3MGQB 4J8UC 3W96C 5B1LC 4ZUXD 3MGPC 1EQZA 5DNMB 3WTPE 3AZIA 4J8WB 3X1VA 5AV9C 5BT1C 1ID3B 2F8NG 3VH6A 2HIOA 1WWIA 4H9NA 5AV6D 3LZ0D 3P5JB 1ZLAB 4H9OA 3AFAA 1P3KA 5AVBB 3AZLA 4YM6D 5CP6D 3WKJB 3O62C 1M1AC 5B0ZA 1BFMA 5BNXA 5BS7C 2NQBD 2FJ7C 3A1IA 4QLCC 5B32G 1F1EA 3MGSA 3UTBC 5B31A 1PZRA 3MNND 5B40B 1T3UA 3KWQA 2ZY5A 2Y2HA 2AROB 5F99D 4G91B 3AV2D 4WU9B 2F8ND 3AL0C 3AZNC 2G5HC 5B24D 5AY8A 3B6FA 2VQRA 3AZED 2CV5A 4JJNA 5B2IB 3VH5T 3RELD 4KHAB 4KGCD 3EPHA 3X1SD 5CPJB 1JFIA 4H9PA 1KX4D 2Y2JA 5E5AD 5B32D 1KX3A 3AN2B 2JSSA 5DNMD 3LZ0C 5AV6C 2BYKA 1P3OD 4XZQB 1M18B 4XUJA 4YM6C 1H3OA 5AVBD 2NQBC 1P34D 2NZDA 5AV5B 3AZKA 3LJAC 1P3GA 1P3LA 3AYWB 4KUDA 1EQZB 3EPKA 1P3AD 5GXQD 3AZIB 3MNNC 2XD1A 3X1VB 5F99C 4J8VD 3AV2C 3FDDA 2HIOB 4H9NB 4H9OB 5B24C 2UWXA 3AFAB 3X1TA 3B0DC 5FUGA 2JE5A 1TZYA 3AZEC 3AZLB 3A6NB 3REJD 1AOID 3W97B 3RELC 4KGCC 5B0ZB 1P3ID 3X1SC 3AZMD 3H0MC 1KX4C 1ULYA 5E5AC 5B32C 3MGSB 3MGQC 3AZJA 5CPID 3WAAA 1S32D 4ZBJB 1P3BA 3AV1A 1P3PB 5B31B 5B2JB 3MGRD 2ZY3A 5DNMC 5GSUA 4Z5TD 2IO5B 4J8WC 3REKD 1P3OC 5BO0A 5AY8B 3B6FB 1ZLAC 1ID3A 2CV5B 3W98D 3KSYA 5AVBC 4XZQD 5G49A 5DNNA 1M18D 3KXBA 1JFIB 4H9PB 1Z2CB 1KX3B 3WKJA 4G92B 4AWLC 1P3AC 4J8XA 5GXQC 4H9SA 3AZHD 4J8UD 1R4VA 4HGAB 4DRBA 5B31G 3LZ1A 2BYKB 2G5IC 5B40C 1KU5A 4EO5C 2AROA 1H3OB 5GT3B 3AFAD 4WU9A 1P3KD 2PYOB 3AZMC 3NQJA 4NE5A 2NZDB 2ZY2A 5KDMA 3W99A 2XD5A 1P3GB 5CPIC 5B33B 4KUDB 3VH5A 1S32C 5B2IA 4KHAA 2DQNC 3MGRC 2FJ7D 4QLCD 3REHA 5GT0B 3REKC 5BNVA 3KWQD 3B6GA 1A7WA 5FUGB 3W98C 4LD9B 4XZQC 1M18C 3C1CA 3KUYA 1HTAA 3TU4A 1KX5A 4JJND 4YS3B 3AZJB 3WAAB 4WU8A 1P3BB 3AV1B 5AV5A 1EQZC 5GSUB 2YFWA 3AYWA 3AZIC 2HUEC 1TAFB 5JA4A 4WNNA 5BO0B 3AZFB 2Y2NA 3AFAC 3AZGB 4Z66A 1P3KC 1F66A 5G49B 5DNNB 4XUJD 3AZLC 1HQ3D 3KXBB 3MVDA 5B0ZC 3W97A 5CPKA 3A6NA 3AZKD 4J8XB 4M6BA 4R8PA 3MGSC 1P3LD 1P3MA 3LJAD 3UT9D 3C1BA 2Y2LA 3LZ1B 1W2EA 1P3PA 3WTPA 5B2JA 3KWQC 5B1LA 5B1MB 1B67A 5AY8C 4X23D 3MGPA 3REID 3X1TD 3UTAB 3NQJB 1TZYD 2CV5C 5KDMB 4JJNC 3W99B 2Y2OA 5AV9A 1U35B
chains in the Genus database with same CATH topology
3AZJD 1KX3C 3WAAD 2BG1A 3REHB 3MGQD 5BNVB 4HGAC 4H9QB 3WA9B 3B6GB 2FFFB 5AVCA 4J8WD 2RVQD 4XUJC 3KUYB 1HQ3C 3C1CB 3TU4B 1ID3D 1KX5B 5B0YA 1M19A 1ZLAD 4WU8B 5GT3A 3AZKC 3KXBD 2PYOA 1P3GC 1P3LC 4KUDC 3WKJD 3UT9C 2YFWB 5B33A 1P3FA 2YFVA 5JA4B 4WNNB 4ZUXA 5GT0A 4X23C 4Z66B 4UPKA 3REIC 3X1TC 5B40D 1F66B 1TZYC 2AROD 3MVDB 4WU9D 2Y2GA 5CPKB 4LD9A 5AV6A 4R8PB 3AZJC 3WAAC 4E45A 1N1JA 1P3BC 4YS3A 5B2ID 1P3MB 3C1BB 5JRGB 5CP6A 5CPJD 3X1UA 5GSUC 3WTPB 2NQBA 4DQYB 5C3IB 3AN2D 5B1LB 4WZSB 2RVQC 3MGPB 1TAFA 1ID3C 3AZFA 5DNNC 5AV9B 3AZGA 3KXBC 3WKJC 5AV5D 3NQUB 4KGCA 3AYWD 3LZ1C 1EQZD 3UTBB 2J8PA 3AZID 5AVCB 3X1VD 4E44A 2AROC 4CAYA 4G91C 4WU9C 5B0YB 4Z66D 1M19B 2HIOD 1F66D 5B1MA 5AV8A 3UTAA 3W97D 4WJ3C 3AZLD 3A6ND 5B2IC 5B0ZD 1Q9CA 1P3FB 5CPJC 2YFVB 1U35A 1P3MD 3MGSD 3REHC 1P34A 3AN2C 4ZUXB 1P3PD 3H0LC 5B31D 5B2JD 3B6GC 3B0CW 4H9QA 3WA9A 3KUYC 4J8VA 3TU4C 1KX5C 5AY8D 5AV6B 3LZ0B 3B6FD 1N1JB 2CV5D 3LELA 2JCHA 3X1UB 5CP6B 5AV5C 3REJA 1AOIA 1P3IA 3AYWC 2NQBB 1KX3D 5CPIA 1BH8B 3X1VC 2F8NH 4Z66C 3MNNB 2HIOC 4Z5TA 1F66C 3REKA 5B0YD 3W97C 5CPKC 3A6NC 5B24B 5GT3D 4R8PC 3B0DB 2PYOD 3VH6W 2NZDD 1B6WA 3RELB 1P3MC 4KGCB 1P3GD 2DF4C 5B33D 3X1SB 3C1BC 4KUDD 4ZBJC 1BH9A 2F2AC 1P3PC 5B31C 5B2JC 5JRGA 5C3IC 3AZHA 2IO5C 4CAYB 5GT0D 4J8UA 3W96A 5AV8B 2LY8A 4UUZA 1P3OB 3B6FC 3R45B 4LD9D 4YS3D 2BYMA 1P34B 3X1UD 4G92C 1P3BD 3AV1D 3O62A 1M1AA 3NQUA 4AWLB 1P3AB 4H9RA 5GSUD 5GXQB 5BS7A 5AVCC 2FJ7A 4QLCA 4J8VB 3UTBA 3AZFD 3F6TA 5B0YC 1M19C 5GT3C 3AZGD 3LELB 2PYOC 4EO5B 2NZDC 5DNND 3REJB 1AOIB 3V9RA 5B33C 1P3IB 3AZMB 1P3FC 3AZNA 4CSRA 4J8XD 5CPIB 1S32B 3B0CT 4ZUXC 5GT0C 3MGRB 3LZ1D 4Z5TB 3REKB 4LD9C 3B0BA 5B1MD 5AV8D 3UTAD 4WV4B 5CHLB 2Y2IA 3W98B 4YS3C 3LZ0A 3W99D 3X1UC 1HQ3A 5CP6C 1BH9B 3AV1C 1U35D 2Y2PA 4YM6A 3AZHB 2Y2KA 3REHD 4J8UB 3LJAA 3W96B 3UT9A 1BH8A 3AZFC 3WA9D 4NE6A 3EPJA 3B6GD 2HUEB 4UUZB 3AZGC 3MNNA 3C1CD 3KUYD 5F99A 3VH6T 3TU4D 4X23A 3AV2A 2F8NA 1KX5D 3REIA 2BYMB 3LELD 1P3KB 4WU8D 5B24A 4J8XC 4H9SC 3AZEA 5BNXB 3O62B 1M1AB 3RELA 4H9RB 2L5AA 3X1SA 1KX4A 2FJ7B 4QLCB 5E5AA 5B32A 3MGQA 2ZM5A 5B1MC 3KWQB 5AV8C 3UTAC 5DNMA 3W99C 3MVDD 4Z2MH 4J8WA 2CWEA 3V9RB 1P3OA 3AZNB 1WWSA 3R45A 5CPKD 1U35C 4JJNB 4CSRB 4R8PD 1P34C 4DRAA 1ZLAA 3EPLA 3IP4C 5AVBA 3KFUG 3C1BD 5JRGD 3VH5W 2F8NK 2RIQA 3WA9C 3WTPD 1P3AA 2W8SA 5GXQA 4J8VC 5B1LD 3W96D 3EG5B 3MGPD 3C1CC 3LELC 5B40A 4XUJB 4WU8C 1HQ3B 5AV9D 3REJC 5BT1D 1AOIC 1P3IC 3H0RC 4YM6B 4NE3A 3AZKB 4Z2MG 3AZMA 1P3LB 2Y2MA 3O62D 1M1AD 3LJAB 3UT9B 4NFTA 5CPJA 1S32A 4Z5TC 3A1KA 3UTBD 3MGRA 5AVCD 3AN2A 5F99B 2F8NB 3MVDC 4X23B 3AV2B 3REIB 3X1TB 1M19D 1TZYB 2ZY4A 2Y2QA 3AZEB 3W98A 3AZND 4XZQA 1M18A 5JRGC 1P3FD 1KX4B 3AZHC 3WTPC 5E5AB 5B32B 3MGQB 4J8UC 3W96C 5B1LC 4ZUXD 3MGPC 1EQZA 5DNMB 3WTPE 3AZIA 4J8WB 3X1VA 5AV9C 5BT1C 1ID3B 2F8NG 3VH6A 2HIOA 1WWIA 4H9NA 5AV6D 3LZ0D 3P5JB 1ZLAB 4H9OA 3AFAA 1P3KA 5AVBB 3AZLA 4YM6D 5CP6D 3WKJB 3O62C 1M1AC 5B0ZA 1BFMA 5BNXA 5BS7C 2NQBD 2FJ7C 3A1IA 4QLCC 5B32G 1F1EA 3MGSA 3UTBC 5B31A 1PZRA 3MNND 5B40B 1T3UA 3KWQA 2ZY5A 2Y2HA 2AROB 5F99D 4G91B 3AV2D 4WU9B 2F8ND 3AL0C 3AZNC 2G5HC 5B24D 5AY8A 3B6FA 2VQRA 3AZED 2CV5A 4JJNA 5B2IB 3VH5T 3RELD 4KHAB 4KGCD 3EPHA 3X1SD 5CPJB 1JFIA 4H9PA 1KX4D 2Y2JA 5E5AD 5B32D 1KX3A 3AN2B 2JSSA 5DNMD 3LZ0C 5AV6C 2BYKA 1P3OD 4XZQB 1M18B 4XUJA 4YM6C 1H3OA 5AVBD 2NQBC 1P34D 2NZDA 5AV5B 3AZKA 3LJAC 1P3GA 1P3LA 3AYWB 4KUDA 1EQZB 3EPKA 1P3AD 5GXQD 3AZIB 3MNNC 2XD1A 3X1VB 5F99C 4J8VD 3AV2C 3FDDA 2HIOB 4H9NB 4H9OB 5B24C 2UWXA 3AFAB 3X1TA 3B0DC 5FUGA 2JE5A 1TZYA 3AZEC 3AZLB 3A6NB 3REJD 1AOID 3W97B 3RELC 4KGCC 5B0ZB 1P3ID 3X1SC 3AZMD 3H0MC 1KX4C 1ULYA 5E5AC 5B32C 3MGSB 3MGQC 3AZJA 5CPID 3WAAA 1S32D 4ZBJB 1P3BA 3AV1A 1P3PB 5B31B 5B2JB 3MGRD 2ZY3A 5DNMC 5GSUA 4Z5TD 2IO5B 4J8WC 3REKD 1P3OC 5BO0A 5AY8B 3B6FB 1ZLAC 1ID3A 2CV5B 3W98D 3KSYA 5AVBC 4XZQD 5G49A 5DNNA 1M18D 3KXBA 1JFIB 4H9PB 1Z2CB 1KX3B 3WKJA 4G92B 4AWLC 1P3AC 4J8XA 5GXQC 4H9SA 3AZHD 4J8UD 1R4VA 4HGAB 4DRBA 5B31G 3LZ1A 2BYKB 2G5IC 5B40C 1KU5A 4EO5C 2AROA 1H3OB 5GT3B 3AFAD 4WU9A 1P3KD 2PYOB 3AZMC 3NQJA 4NE5A 2NZDB 2ZY2A 5KDMA 3W99A 2XD5A 1P3GB 5CPIC 5B33B 4KUDB 3VH5A 1S32C 5B2IA 4KHAA 2DQNC 3MGRC 2FJ7D 4QLCD 3REHA 5GT0B 3REKC 5BNVA 3KWQD 3B6GA 1A7WA 5FUGB 3W98C 4LD9B 4XZQC 1M18C 3C1CA 3KUYA 1HTAA 3TU4A 1KX5A 4JJND 4YS3B 3AZJB 3WAAB 4WU8A 1P3BB 3AV1B 5AV5A 1EQZC 5GSUB 2YFWA 3AYWA 3AZIC 2HUEC 1TAFB 5JA4A 4WNNA 5BO0B 3AZFB 2Y2NA 3AFAC 3AZGB 4Z66A 1P3KC 1F66A 5G49B 5DNNB 4XUJD 3AZLC 1HQ3D 3KXBB 3MVDA 5B0ZC 3W97A 5CPKA 3A6NA 3AZKD 4J8XB 4M6BA 4R8PA 3MGSC 1P3LD 1P3MA 3LJAD 3UT9D 3C1BA 2Y2LA 3LZ1B 1W2EA 1P3PA 3WTPA 5B2JA 3KWQC 5B1LA 5B1MB 1B67A 5AY8C 4X23D 3MGPA 3REID 3X1TD 3UTAB 3NQJB 1TZYD 2CV5C 5KDMB 4JJNC 3W99B 2Y2OA 5AV9A 1U35B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AZJ D;  1KX3 C;  3WAA D;  3REH B;  3MGQ D;  5BNV B;  4HGA C;  4H9Q B;  3WA9 B;  3B6G B;  5AVC A;  4J8W D;  2RVQ D;  4XUJ C;  3KUY B;  1HQ3 C;  3C1C B;  3TU4 B;  1ID3 D;  1KX5 B;  5B0Y A;  1M19 A;  1ZLA D;  4WU8 B;  5GT3 A;  3AZK C;  3KXB D;  2PYO A;  1P3G C;  1P3L C;  4KUD C;  3WKJ D;  3UT9 C;  2YFW B;  5B33 A;  1P3F A;  2YFV A;  5JA4 B;  4WNN B;  4ZUX A;  5GT0 A;  4X23 C;  4Z66 B;  3REI C;  3X1T C;  5B40 D;  1F66 B;  1TZY C;  2ARO D;  3MVD B;  4WU9 D;  5CPK B;  4LD9 A;  5AV6 A;  4R8P B;  3AZJ C;  3WAA C;  4E45 A;  1N1J A;  1P3B C;  4YS3 A;  5B2I D;  1P3M B;  3C1B B;  5JRG B;  5CP6 A;  5CPJ D;  3X1U A;  5GSU C;  3WTP B;  2NQB A;  5C3I B;  3AN2 D;  5B1L B;  4WZS B;  2RVQ C;  3MGP B;  1TAF A;  1ID3 C;  3AZF A;  5DNN C;  5AV9 B;  3AZG A;  3KXB C;  3WKJ C;  5AV5 D;  3NQU B;  4KGC A;  3AYW D;  3LZ1 C;  1EQZ D;  3UTB B;  3AZI D;  5AVC B;  3X1V D;  4E44 A;  2ARO C;  4CAY A;  4G91 C;  4WU9 C;  5B0Y B;  4Z66 D;  1M19 B;  2HIO D;  1F66 D;  5B1M A;  5AV8 A;  3UTA A;  3W97 D;  3AZL D;  3A6N D;  5B2I C;  5B0Z D;  1Q9C A;  1P3F B;  5CPJ C;  2YFV B;  1U35 A;  1P3M D;  3MGS D;  3REH C;  1P34 A;  3AN2 C;  4ZUX B;  1P3P D;  5B31 D;  5B2J D;  3B6G C;  3B0C W;  4H9Q A;  3WA9 A;  3KUY C;  4J8V A;  3TU4 C;  1KX5 C;  5AY8 D;  5AV6 B;  3LZ0 B;  3B6F D;  1N1J B;  2CV5 D;  3LEL A;  3X1U B;  5CP6 B;  5AV5 C;  3REJ A;  1AOI A;  1P3I A;  3AYW C;  2NQB B;  1KX3 D;  5CPI A;  1BH8 B;  3X1V C;  2F8N H;  4Z66 C;  3MNN B;  2HIO C;  4Z5T A;  1F66 C;  3REK A;  5B0Y D;  3W97 C;  5CPK C;  3A6N C;  5B24 B;  5GT3 D;  4R8P C;  3B0D B;  2PYO D;  3VH6 W;  2NZD D;  1B6W A;  3REL B;  1P3M C;  4KGC B;  1P3G D;  5B33 D;  3X1S B;  3C1B C;  4KUD D;  4ZBJ C;  1BH9 A;  1P3P C;  5B31 C;  5B2J C;  5JRG A;  5C3I C;  3AZH A;  2IO5 C;  4CAY B;  5GT0 D;  4J8U A;  3W96 A;  5AV8 B;  2LY8 A;  4UUZ A;  1P3O B;  3B6F C;  3R45 B;  4LD9 D;  4YS3 D;  2BYM A;  1P34 B;  3X1U D;  4G92 C;  1P3B D;  3AV1 D;  3O62 A;  1M1A A;  3NQU A;  4AWL B;  1P3A B;  4H9R A;  5GSU D;  5GXQ B;  5BS7 A;  5AVC C;  2FJ7 A;  4QLC A;  4J8V B;  3UTB A;  3AZF D;  5B0Y C;  1M19 C;  5GT3 C;  3AZG D;  3LEL B;  2PYO C;  4EO5 B;  2NZD C;  5DNN D;  3REJ B;  1AOI B;  3V9R A;  5B33 C;  1P3I B;  3AZM B;  1P3F C;  3AZN A;  4CSR A;  4J8X D;  5CPI B;  1S32 B;  3B0C T;  4ZUX C;  5GT0 C;  3MGR B;  3LZ1 D;  4Z5T B;  3REK B;  4LD9 C;  3B0B A;  5B1M D;  5AV8 D;  3UTA D;  4WV4 B;  5CHL B;  3W98 B;  4YS3 C;  3LZ0 A;  3W99 D;  3X1U C;  1HQ3 A;  5CP6 C;  1BH9 B;  3AV1 C;  1U35 D;  4YM6 A;  3AZH B;  3REH D;  4J8U B;  3LJA A;  3W96 B;  3UT9 A;  1BH8 A;  3AZF C;  3WA9 D;  4NE6 A;  3B6G D;  2HUE B;  4UUZ B;  3AZG C;  3MNN A;  3C1C D;  3KUY D;  5F99 A;  3VH6 T;  3TU4 D;  4X23 A;  3AV2 A;  2F8N A;  1KX5 D;  3REI A;  2BYM B;  3LEL D;  1P3K B;  4WU8 D;  5B24 A;  4J8X C;  4H9S C;  3AZE A;  5BNX B;  3O62 B;  1M1A B;  3REL A;  4H9R B;  2L5A A;  3X1S A;  1KX4 A;  2FJ7 B;  4QLC B;  5E5A A;  5B32 A;  3MGQ A;  5B1M C;  3KWQ B;  5AV8 C;  3UTA C;  5DNM A;  3W99 C;  3MVD D;  4Z2M H;  4J8W A;  2CWE A;  3V9R B;  1P3O A;  3AZN B;  1WWS A;  3R45 A;  5CPK D;  1U35 C;  4JJN B;  4CSR B;  4R8P D;  1P34 C;  4DRA A;  1ZLA A;  5AVB A;  3C1B D;  5JRG D;  3VH5 W;  2F8N K;  3WA9 C;  3WTP D;  1P3A A;  5GXQ A;  4J8V C;  3W96 D;  5B1L D;  3MGP D;  3C1C C;  3LEL C;  5B40 A;  4XUJ B;  4WU8 C;  1HQ3 B;  5AV9 D;  3REJ C;  5BT1 D;  1AOI C;  1P3I C;  4YM6 B;  4NE3 A;  3AZK B;  4Z2M G;  3AZM A;  1P3L B;  3O62 D;  1M1A D;  3LJA B;  3UT9 B;  4NFT A;  5CPJ A;  1S32 A;  4Z5T C;  3UTB D;  3MGR A;  5AVC D;  3AN2 A;  5F99 B;  2F8N B;  3MVD C;  4X23 B;  3AV2 B;  3REI B;  3X1T B;  1M19 D;  1TZY B;  3AZE B;  3W98 A;  3AZN D;  4XZQ A;  1M18 A;  5JRG C;  1P3F D;  1KX4 B;  3AZH C;  3WTP C;  5E5A B;  5B32 B;  3MGQ B;  4J8U C;  3W96 C;  5B1L C;  4ZUX D;  3MGP C;  1EQZ A;  5DNM B;  3WTP E;  3AZI A;  4J8W B;  3X1V A;  5AV9 C;  5BT1 C;  1ID3 B;  2F8N G;  3VH6 A;  2HIO A;  1WWI A;  4H9N A;  5AV6 D;  3LZ0 D;  1ZLA B;  4H9O A;  3AFA A;  1P3K A;  5AVB B;  3AZL A;  4YM6 D;  5CP6 D;  3WKJ B;  3O62 C;  1M1A C;  5B0Z A;  1BFM A;  5BNX A;  5BS7 C;  2NQB D;  2FJ7 C;  4QLC C;  5B32 G;  3MGS A;  1F1E A;  3UTB C;  5B31 A;  3MNN D;  5B40 B;  3KWQ A;  5F99 D;  2ARO B;  2F8N D;  4G91 B;  3AV2 D;  4WU9 B;  3AZN C;  5B24 D;  5AY8 A;  3B6F A;  3AZE D;  2CV5 A;  4JJN A;  5B2I B;  3VH5 T;  3REL D;  4KHA B;  4KGC D;  3X1S D;  5CPJ B;  1JFI A;  4H9P A;  1KX4 D;  5E5A D;  5B32 D;  1KX3 A;  3AN2 B;  2JSS A;  5DNM D;  3LZ0 C;  5AV6 C;  2BYK A;  1P3O D;  4XZQ B;  1M18 B;  4XUJ A;  4YM6 C;  1H3O A;  5AVB D;  2NQB C;  1P34 D;  2NZD A;  5AV5 B;  3AZK A;  3LJA C;  1P3G A;  1P3L A;  3AYW B;  4KUD A;  1EQZ B;  1P3A D;  5GXQ D;  3AZI B;  3MNN C;  3X1V B;  5F99 C;  4J8V D;  3AV2 C;  2HIO B;  4H9N B;  4H9O B;  5B24 C;  3AFA B;  3X1T A;  3B0D C;  5FUG A;  3W97 B;  1TZY A;  3AZE C;  3AZL B;  3A6N B;  3REJ D;  1AOI D;  3REL C;  4KGC C;  5B0Z B;  1P3I D;  3X1S C;  3AZM D;  1KX4 C;  1ULY A;  5E5A C;  5B32 C;  3MGS B;  3MGQ C;  3AZJ A;  5CPI D;  3WAA A;  1S32 D;  4ZBJ B;  1P3B A;  3AV1 A;  1P3P B;  5B31 B;  5B2J B;  3MGR D;  5DNM C;  5GSU A;  4Z5T D;  2IO5 B;  4J8W C;  3REK D;  1P3O C;  5BO0 A;  5AY8 B;  3B6F B;  1ZLA C;  1ID3 A;  2CV5 B;  3W98 D;  3KSY A;  5AVB C;  4XZQ D;  5G49 A;  5DNN A;  1M18 D;  3KXB A;  1JFI B;  4H9P B;  3WKJ A;  1KX3 B;  4G92 B;  4AWL C;  1P3A C;  4J8X A;  5GXQ C;  4H9S A;  3AZH D;  4J8U D;  1R4V A;  4HGA B;  4DRB A;  5B31 G;  3LZ1 A;  2BYK B;  5B40 C;  1KU5 A;  4EO5 C;  2ARO A;  1H3O B;  5GT3 B;  3AFA D;  4WU9 A;  1P3K D;  2PYO B;  3AZM C;  3NQJ A;  4NE5 A;  2NZD B;  5KDM A;  3W99 A;  1P3G B;  5CPI C;  5B33 B;  4KUD B;  3VH5 A;  1S32 C;  5B2I A;  4KHA A;  3MGR C;  2FJ7 D;  4QLC D;  3REH A;  5GT0 B;  3REK C;  5BNV A;  3KWQ D;  3B6G A;  1A7W A;  5FUG B;  3W98 C;  4LD9 B;  4XZQ C;  1M18 C;  3C1C A;  3KUY A;  1HTA A;  3TU4 A;  1KX5 A;  4JJN D;  4YS3 B;  3AZJ B;  3WAA B;  4WU8 A;  1P3B B;  3AV1 B;  5AV5 A;  1EQZ C;  5GSU B;  2YFW A;  3AYW A;  3AZI C;  2HUE C;  1TAF B;  5JA4 A;  4WNN A;  5BO0 B;  3AZF B;  3AFA C;  3AZG B;  4Z66 A;  1P3K C;  1F66 A;  5G49 B;  5DNN B;  4XUJ D;  3AZL C;  1HQ3 D;  3KXB B;  3MVD A;  5B0Z C;  3W97 A;  5CPK A;  3A6N A;  3AZK D;  4J8X B;  4M6B A;  4R8P A;  3MGS C;  1P3L D;  1P3M A;  3LJA D;  3UT9 D;  3C1B A;  3LZ1 B;  1P3P A;  3WTP A;  5B2J A;  3KWQ C;  5B1L A;  5B1M B;  1B67 A;  5AY8 C;  4X23 D;  3MGP A;  3REI D;  3X1T D;  3UTA B;  3NQJ B;  1TZY D;  2CV5 C;  5KDM B;  4JJN C;  3W99 B;  5AV9 A;  1U35 B; 
#chains in the Genus database with same CATH topology
 3AZJ D;  1KX3 C;  3WAA D;  2BG1 A;  3REH B;  3MGQ D;  5BNV B;  4HGA C;  4H9Q B;  3WA9 B;  3B6G B;  2FFF B;  5AVC A;  4J8W D;  2RVQ D;  4XUJ C;  3KUY B;  1HQ3 C;  3C1C B;  3TU4 B;  1ID3 D;  1KX5 B;  5B0Y A;  1M19 A;  1ZLA D;  4WU8 B;  5GT3 A;  3AZK C;  3KXB D;  2PYO A;  1P3G C;  1P3L C;  4KUD C;  3WKJ D;  3UT9 C;  2YFW B;  5B33 A;  1P3F A;  2YFV A;  5JA4 B;  4WNN B;  4ZUX A;  5GT0 A;  4X23 C;  4Z66 B;  4UPK A;  3REI C;  3X1T C;  5B40 D;  1F66 B;  1TZY C;  2ARO D;  3MVD B;  4WU9 D;  2Y2G A;  5CPK B;  4LD9 A;  5AV6 A;  4R8P B;  3AZJ C;  3WAA C;  4E45 A;  1N1J A;  1P3B C;  4YS3 A;  5B2I D;  1P3M B;  3C1B B;  5JRG B;  5CP6 A;  5CPJ D;  3X1U A;  5GSU C;  3WTP B;  2NQB A;  4DQY B;  5C3I B;  3AN2 D;  5B1L B;  4WZS B;  2RVQ C;  3MGP B;  1TAF A;  1ID3 C;  3AZF A;  5DNN C;  5AV9 B;  3AZG A;  3KXB C;  3WKJ C;  5AV5 D;  3NQU B;  4KGC A;  3AYW D;  3LZ1 C;  1EQZ D;  3UTB B;  2J8P A;  3AZI D;  5AVC B;  3X1V D;  4E44 A;  2ARO C;  4CAY A;  4G91 C;  4WU9 C;  5B0Y B;  4Z66 D;  1M19 B;  2HIO D;  1F66 D;  5B1M A;  5AV8 A;  3UTA A;  3W97 D;  4WJ3 C;  3AZL D;  3A6N D;  5B2I C;  5B0Z D;  1Q9C A;  1P3F B;  5CPJ C;  2YFV B;  1U35 A;  1P3M D;  3MGS D;  3REH C;  1P34 A;  3AN2 C;  4ZUX B;  1P3P D;  3H0L C;  5B31 D;  5B2J D;  3B6G C;  3B0C W;  4H9Q A;  3WA9 A;  3KUY C;  4J8V A;  3TU4 C;  1KX5 C;  5AY8 D;  5AV6 B;  3LZ0 B;  3B6F D;  1N1J B;  2CV5 D;  3LEL A;  2JCH A;  3X1U B;  5CP6 B;  5AV5 C;  3REJ A;  1AOI A;  1P3I A;  3AYW C;  2NQB B;  1KX3 D;  5CPI A;  1BH8 B;  3X1V C;  2F8N H;  4Z66 C;  3MNN B;  2HIO C;  4Z5T A;  1F66 C;  3REK A;  5B0Y D;  3W97 C;  5CPK C;  3A6N C;  5B24 B;  5GT3 D;  4R8P C;  3B0D B;  2PYO D;  3VH6 W;  2NZD D;  1B6W A;  3REL B;  1P3M C;  4KGC B;  1P3G D;  2DF4 C;  5B33 D;  3X1S B;  3C1B C;  4KUD D;  4ZBJ C;  1BH9 A;  2F2A C;  1P3P C;  5B31 C;  5B2J C;  5JRG A;  5C3I C;  3AZH A;  2IO5 C;  4CAY B;  5GT0 D;  4J8U A;  3W96 A;  5AV8 B;  2LY8 A;  4UUZ A;  1P3O B;  3B6F C;  3R45 B;  4LD9 D;  4YS3 D;  2BYM A;  1P34 B;  3X1U D;  4G92 C;  1P3B D;  3AV1 D;  3O62 A;  1M1A A;  3NQU A;  4AWL B;  1P3A B;  4H9R A;  5GSU D;  5GXQ B;  5BS7 A;  5AVC C;  2FJ7 A;  4QLC A;  4J8V B;  3UTB A;  3AZF D;  3F6T A;  5B0Y C;  1M19 C;  5GT3 C;  3AZG D;  3LEL B;  2PYO C;  4EO5 B;  2NZD C;  5DNN D;  3REJ B;  1AOI B;  3V9R A;  5B33 C;  1P3I B;  3AZM B;  1P3F C;  3AZN A;  4CSR A;  4J8X D;  5CPI B;  1S32 B;  3B0C T;  4ZUX C;  5GT0 C;  3MGR B;  3LZ1 D;  4Z5T B;  3REK B;  4LD9 C;  3B0B A;  5B1M D;  5AV8 D;  3UTA D;  4WV4 B;  5CHL B;  2Y2I A;  3W98 B;  4YS3 C;  3LZ0 A;  3W99 D;  3X1U C;  1HQ3 A;  5CP6 C;  1BH9 B;  3AV1 C;  1U35 D;  2Y2P A;  4YM6 A;  3AZH B;  2Y2K A;  3REH D;  4J8U B;  3LJA A;  3W96 B;  3UT9 A;  1BH8 A;  3AZF C;  3WA9 D;  4NE6 A;  3EPJ A;  3B6G D;  2HUE B;  4UUZ B;  3AZG C;  3MNN A;  3C1C D;  3KUY D;  5F99 A;  3VH6 T;  3TU4 D;  4X23 A;  3AV2 A;  2F8N A;  1KX5 D;  3REI A;  2BYM B;  3LEL D;  1P3K B;  4WU8 D;  5B24 A;  4J8X C;  4H9S C;  3AZE A;  5BNX B;  3O62 B;  1M1A B;  3REL A;  4H9R B;  2L5A A;  3X1S A;  1KX4 A;  2FJ7 B;  4QLC B;  5E5A A;  5B32 A;  3MGQ A;  2ZM5 A;  5B1M C;  3KWQ B;  5AV8 C;  3UTA C;  5DNM A;  3W99 C;  3MVD D;  4Z2M H;  4J8W A;  2CWE A;  3V9R B;  1P3O A;  3AZN B;  1WWS A;  3R45 A;  5CPK D;  1U35 C;  4JJN B;  4CSR B;  4R8P D;  1P34 C;  4DRA A;  1ZLA A;  3EPL A;  3IP4 C;  5AVB A;  3KFU G;  3C1B D;  5JRG D;  3VH5 W;  2F8N K;  2RIQ A;  3WA9 C;  3WTP D;  1P3A A;  2W8S A;  5GXQ A;  4J8V C;  5B1L D;  3W96 D;  3EG5 B;  3MGP D;  3C1C C;  3LEL C;  5B40 A;  4XUJ B;  4WU8 C;  1HQ3 B;  5AV9 D;  3REJ C;  5BT1 D;  1AOI C;  1P3I C;  3H0R C;  4YM6 B;  4NE3 A;  3AZK B;  4Z2M G;  3AZM A;  1P3L B;  2Y2M A;  3O62 D;  1M1A D;  3LJA B;  3UT9 B;  4NFT A;  5CPJ A;  1S32 A;  4Z5T C;  3A1K A;  3UTB D;  3MGR A;  5AVC D;  3AN2 A;  5F99 B;  2F8N B;  3MVD C;  4X23 B;  3AV2 B;  3REI B;  3X1T B;  1M19 D;  1TZY B;  2ZY4 A;  2Y2Q A;  3AZE B;  3W98 A;  3AZN D;  4XZQ A;  1M18 A;  5JRG C;  1P3F D;  1KX4 B;  3AZH C;  3WTP C;  5E5A B;  5B32 B;  3MGQ B;  4J8U C;  3W96 C;  5B1L C;  4ZUX D;  3MGP C;  1EQZ A;  5DNM B;  3WTP E;  3AZI A;  4J8W B;  3X1V A;  5AV9 C;  5BT1 C;  1ID3 B;  2F8N G;  3VH6 A;  2HIO A;  1WWI A;  4H9N A;  5AV6 D;  3LZ0 D;  3P5J B;  1ZLA B;  4H9O A;  3AFA A;  1P3K A;  5AVB B;  3AZL A;  4YM6 D;  5CP6 D;  3WKJ B;  3O62 C;  1M1A C;  5B0Z A;  1BFM A;  5BNX A;  5BS7 C;  2NQB D;  2FJ7 C;  3A1I A;  4QLC C;  5B32 G;  1F1E A;  3MGS A;  3UTB C;  5B31 A;  1PZR A;  3MNN D;  5B40 B;  1T3U A;  3KWQ A;  2ZY5 A;  2Y2H A;  2ARO B;  5F99 D;  4G91 B;  3AV2 D;  4WU9 B;  2F8N D;  3AL0 C;  3AZN C;  2G5H C;  5B24 D;  5AY8 A;  3B6F A;  2VQR A;  3AZE D;  2CV5 A;  4JJN A;  5B2I B;  3VH5 T;  3REL D;  4KHA B;  4KGC D;  3EPH A;  3X1S D;  5CPJ B;  1JFI A;  4H9P A;  1KX4 D;  2Y2J A;  5E5A D;  5B32 D;  1KX3 A;  3AN2 B;  2JSS A;  5DNM D;  3LZ0 C;  5AV6 C;  2BYK A;  1P3O D;  4XZQ B;  1M18 B;  4XUJ A;  4YM6 C;  1H3O A;  5AVB D;  2NQB C;  1P34 D;  2NZD A;  5AV5 B;  3AZK A;  3LJA C;  1P3G A;  1P3L A;  3AYW B;  4KUD A;  1EQZ B;  3EPK A;  1P3A D;  5GXQ D;  3AZI B;  3MNN C;  2XD1 A;  3X1V B;  5F99 C;  4J8V D;  3AV2 C;  3FDD A;  2HIO B;  4H9N B;  4H9O B;  5B24 C;  2UWX A;  3AFA B;  3X1T A;  3B0D C;  5FUG A;  2JE5 A;  1TZY A;  3AZE C;  3AZL B;  3A6N B;  3REJ D;  1AOI D;  3W97 B;  3REL C;  4KGC C;  5B0Z B;  1P3I D;  3X1S C;  3AZM D;  3H0M C;  1KX4 C;  1ULY A;  5E5A C;  5B32 C;  3MGS B;  3MGQ C;  3AZJ A;  5CPI D;  3WAA A;  1S32 D;  4ZBJ B;  1P3B A;  3AV1 A;  1P3P B;  5B31 B;  5B2J B;  3MGR D;  2ZY3 A;  5DNM C;  5GSU A;  4Z5T D;  2IO5 B;  4J8W C;  3REK D;  1P3O C;  5BO0 A;  5AY8 B;  3B6F B;  1ZLA C;  1ID3 A;  2CV5 B;  3W98 D;  3KSY A;  5AVB C;  4XZQ D;  5G49 A;  5DNN A;  1M18 D;  3KXB A;  1JFI B;  4H9P B;  1Z2C B;  1KX3 B;  3WKJ A;  4G92 B;  4AWL C;  1P3A C;  4J8X A;  5GXQ C;  4H9S A;  3AZH D;  4J8U D;  1R4V A;  4HGA B;  4DRB A;  5B31 G;  3LZ1 A;  2BYK B;  2G5I C;  5B40 C;  1KU5 A;  4EO5 C;  2ARO A;  1H3O B;  5GT3 B;  3AFA D;  4WU9 A;  1P3K D;  2PYO B;  3AZM C;  3NQJ A;  4NE5 A;  2NZD B;  2ZY2 A;  5KDM A;  3W99 A;  2XD5 A;  1P3G B;  5CPI C;  5B33 B;  4KUD B;  3VH5 A;  1S32 C;  5B2I A;  4KHA A;  2DQN C;  3MGR C;  2FJ7 D;  4QLC D;  3REH A;  5GT0 B;  3REK C;  5BNV A;  3KWQ D;  3B6G A;  1A7W A;  5FUG B;  3W98 C;  4LD9 B;  4XZQ C;  1M18 C;  3C1C A;  3KUY A;  1HTA A;  3TU4 A;  1KX5 A;  4JJN D;  4YS3 B;  3AZJ B;  3WAA B;  4WU8 A;  1P3B B;  3AV1 B;  5AV5 A;  1EQZ C;  5GSU B;  2YFW A;  3AYW A;  3AZI C;  2HUE C;  1TAF B;  5JA4 A;  4WNN A;  5BO0 B;  3AZF B;  2Y2N A;  3AFA C;  3AZG B;  4Z66 A;  1P3K C;  1F66 A;  5G49 B;  5DNN B;  4XUJ D;  3AZL C;  1HQ3 D;  3KXB B;  3MVD A;  5B0Z C;  3W97 A;  5CPK A;  3A6N A;  3AZK D;  4J8X B;  4M6B A;  4R8P A;  3MGS C;  1P3L D;  1P3M A;  3LJA D;  3UT9 D;  3C1B A;  2Y2L A;  3LZ1 B;  1W2E A;  1P3P A;  3WTP A;  5B2J A;  3KWQ C;  5B1L A;  5B1M B;  1B67 A;  5AY8 C;  4X23 D;  3MGP A;  3REI D;  3X1T D;  3UTA B;  3NQJ B;  1TZY D;  2CV5 C;  5KDM B;  4JJN C;  3W99 B;  2Y2O A;  5AV9 A;  1U35 B; 
#chains in the Genus database with same CATH homology
 3AZJ D;  1KX3 C;  3WAA D;  2BG1 A;  3REH B;  3MGQ D;  5BNV B;  4HGA C;  4H9Q B;  3WA9 B;  3B6G B;  2FFF B;  5AVC A;  4J8W D;  2RVQ D;  4XUJ C;  3KUY B;  1HQ3 C;  3C1C B;  3TU4 B;  1ID3 D;  1KX5 B;  5B0Y A;  1M19 A;  1ZLA D;  4WU8 B;  5GT3 A;  3AZK C;  3KXB D;  2PYO A;  1P3G C;  1P3L C;  4KUD C;  3WKJ D;  3UT9 C;  2YFW B;  5B33 A;  1P3F A;  2YFV A;  5JA4 B;  4WNN B;  4ZUX A;  5GT0 A;  4X23 C;  4Z66 B;  4UPK A;  3REI C;  3X1T C;  5B40 D;  1F66 B;  1TZY C;  2ARO D;  3MVD B;  4WU9 D;  2Y2G A;  5CPK B;  4LD9 A;  5AV6 A;  4R8P B;  3AZJ C;  3WAA C;  4E45 A;  1N1J A;  1P3B C;  4YS3 A;  5B2I D;  1P3M B;  3C1B B;  5JRG B;  5CP6 A;  5CPJ D;  3X1U A;  5GSU C;  3WTP B;  2NQB A;  4DQY B;  5C3I B;  3AN2 D;  5B1L B;  4WZS B;  2RVQ C;  3MGP B;  1TAF A;  1ID3 C;  3AZF A;  5DNN C;  5AV9 B;  3AZG A;  3KXB C;  3WKJ C;  5AV5 D;  3NQU B;  4KGC A;  3AYW D;  3LZ1 C;  1EQZ D;  3UTB B;  2J8P A;  3AZI D;  5AVC B;  3X1V D;  4E44 A;  2ARO C;  4CAY A;  4G91 C;  4WU9 C;  5B0Y B;  4Z66 D;  1M19 B;  2HIO D;  1F66 D;  5B1M A;  5AV8 A;  3UTA A;  3W97 D;  4WJ3 C;  3AZL D;  3A6N D;  5B2I C;  5B0Z D;  1Q9C A;  1P3F B;  5CPJ C;  2YFV B;  1U35 A;  1P3M D;  3MGS D;  3REH C;  1P34 A;  3AN2 C;  4ZUX B;  1P3P D;  3H0L C;  5B31 D;  5B2J D;  3B6G C;  3B0C W;  4H9Q A;  3WA9 A;  3KUY C;  4J8V A;  3TU4 C;  1KX5 C;  5AY8 D;  5AV6 B;  3LZ0 B;  3B6F D;  1N1J B;  2CV5 D;  3LEL A;  2JCH A;  3X1U B;  5CP6 B;  5AV5 C;  3REJ A;  1AOI A;  1P3I A;  3AYW C;  2NQB B;  1KX3 D;  5CPI A;  1BH8 B;  3X1V C;  2F8N H;  4Z66 C;  3MNN B;  2HIO C;  4Z5T A;  1F66 C;  3REK A;  5B0Y D;  3W97 C;  5CPK C;  3A6N C;  5B24 B;  5GT3 D;  4R8P C;  3B0D B;  2PYO D;  3VH6 W;  2NZD D;  1B6W A;  3REL B;  1P3M C;  4KGC B;  1P3G D;  2DF4 C;  5B33 D;  3X1S B;  3C1B C;  4KUD D;  4ZBJ C;  1BH9 A;  2F2A C;  1P3P C;  5B31 C;  5B2J C;  5JRG A;  5C3I C;  3AZH A;  2IO5 C;  4CAY B;  5GT0 D;  4J8U A;  3W96 A;  5AV8 B;  2LY8 A;  4UUZ A;  1P3O B;  3B6F C;  3R45 B;  4LD9 D;  4YS3 D;  2BYM A;  1P34 B;  3X1U D;  4G92 C;  1P3B D;  3AV1 D;  3O62 A;  1M1A A;  3NQU A;  4AWL B;  1P3A B;  4H9R A;  5GSU D;  5GXQ B;  5BS7 A;  5AVC C;  2FJ7 A;  4QLC A;  4J8V B;  3UTB A;  3AZF D;  3F6T A;  5B0Y C;  1M19 C;  5GT3 C;  3AZG D;  3LEL B;  2PYO C;  4EO5 B;  2NZD C;  5DNN D;  3REJ B;  1AOI B;  3V9R A;  5B33 C;  1P3I B;  3AZM B;  1P3F C;  3AZN A;  4CSR A;  4J8X D;  5CPI B;  1S32 B;  3B0C T;  4ZUX C;  5GT0 C;  3MGR B;  3LZ1 D;  4Z5T B;  3REK B;  4LD9 C;  3B0B A;  5B1M D;  5AV8 D;  3UTA D;  4WV4 B;  5CHL B;  2Y2I A;  3W98 B;  4YS3 C;  3LZ0 A;  3W99 D;  3X1U C;  1HQ3 A;  5CP6 C;  1BH9 B;  3AV1 C;  1U35 D;  2Y2P A;  4YM6 A;  3AZH B;  2Y2K A;  3REH D;  4J8U B;  3LJA A;  3W96 B;  3UT9 A;  1BH8 A;  3AZF C;  3WA9 D;  4NE6 A;  3EPJ A;  3B6G D;  2HUE B;  4UUZ B;  3AZG C;  3MNN A;  3C1C D;  3KUY D;  5F99 A;  3VH6 T;  3TU4 D;  4X23 A;  3AV2 A;  2F8N A;  1KX5 D;  3REI A;  2BYM B;  3LEL D;  1P3K B;  4WU8 D;  5B24 A;  4J8X C;  4H9S C;  3AZE A;  5BNX B;  3O62 B;  1M1A B;  3REL A;  4H9R B;  2L5A A;  3X1S A;  1KX4 A;  2FJ7 B;  4QLC B;  5E5A A;  5B32 A;  3MGQ A;  2ZM5 A;  5B1M C;  3KWQ B;  5AV8 C;  3UTA C;  5DNM A;  3W99 C;  3MVD D;  4Z2M H;  4J8W A;  2CWE A;  3V9R B;  1P3O A;  3AZN B;  1WWS A;  3R45 A;  5CPK D;  1U35 C;  4JJN B;  4CSR B;  4R8P D;  1P34 C;  4DRA A;  1ZLA A;  3EPL A;  3IP4 C;  5AVB A;  3KFU G;  3C1B D;  5JRG D;  3VH5 W;  2F8N K;  2RIQ A;  3WA9 C;  3WTP D;  1P3A A;  2W8S A;  5GXQ A;  4J8V C;  5B1L D;  3W96 D;  3EG5 B;  3MGP D;  3C1C C;  3LEL C;  5B40 A;  4XUJ B;  4WU8 C;  1HQ3 B;  5AV9 D;  3REJ C;  5BT1 D;  1AOI C;  1P3I C;  3H0R C;  4YM6 B;  4NE3 A;  3AZK B;  4Z2M G;  3AZM A;  1P3L B;  2Y2M A;  3O62 D;  1M1A D;  3LJA B;  3UT9 B;  4NFT A;  5CPJ A;  1S32 A;  4Z5T C;  3A1K A;  3UTB D;  3MGR A;  5AVC D;  3AN2 A;  5F99 B;  2F8N B;  3MVD C;  4X23 B;  3AV2 B;  3REI B;  3X1T B;  1M19 D;  1TZY B;  2ZY4 A;  2Y2Q A;  3AZE B;  3W98 A;  3AZN D;  4XZQ A;  1M18 A;  5JRG C;  1P3F D;  1KX4 B;  3AZH C;  3WTP C;  5E5A B;  5B32 B;  3MGQ B;  4J8U C;  3W96 C;  5B1L C;  4ZUX D;  3MGP C;  1EQZ A;  5DNM B;  3WTP E;  3AZI A;  4J8W B;  3X1V A;  5AV9 C;  5BT1 C;  1ID3 B;  2F8N G;  3VH6 A;  2HIO A;  1WWI A;  4H9N A;  5AV6 D;  3LZ0 D;  3P5J B;  1ZLA B;  4H9O A;  3AFA A;  1P3K A;  5AVB B;  3AZL A;  4YM6 D;  5CP6 D;  3WKJ B;  3O62 C;  1M1A C;  5B0Z A;  1BFM A;  5BNX A;  5BS7 C;  2NQB D;  2FJ7 C;  3A1I A;  4QLC C;  5B32 G;  1F1E A;  3MGS A;  3UTB C;  5B31 A;  1PZR A;  3MNN D;  5B40 B;  1T3U A;  3KWQ A;  2ZY5 A;  2Y2H A;  2ARO B;  5F99 D;  4G91 B;  3AV2 D;  4WU9 B;  2F8N D;  3AL0 C;  3AZN C;  2G5H C;  5B24 D;  5AY8 A;  3B6F A;  2VQR A;  3AZE D;  2CV5 A;  4JJN A;  5B2I B;  3VH5 T;  3REL D;  4KHA B;  4KGC D;  3EPH A;  3X1S D;  5CPJ B;  1JFI A;  4H9P A;  1KX4 D;  2Y2J A;  5E5A D;  5B32 D;  1KX3 A;  3AN2 B;  2JSS A;  5DNM D;  3LZ0 C;  5AV6 C;  2BYK A;  1P3O D;  4XZQ B;  1M18 B;  4XUJ A;  4YM6 C;  1H3O A;  5AVB D;  2NQB C;  1P34 D;  2NZD A;  5AV5 B;  3AZK A;  3LJA C;  1P3G A;  1P3L A;  3AYW B;  4KUD A;  1EQZ B;  3EPK A;  1P3A D;  5GXQ D;  3AZI B;  3MNN C;  2XD1 A;  3X1V B;  5F99 C;  4J8V D;  3AV2 C;  3FDD A;  2HIO B;  4H9N B;  4H9O B;  5B24 C;  2UWX A;  3AFA B;  3X1T A;  3B0D C;  5FUG A;  2JE5 A;  1TZY A;  3AZE C;  3AZL B;  3A6N B;  3REJ D;  1AOI D;  3W97 B;  3REL C;  4KGC C;  5B0Z B;  1P3I D;  3X1S C;  3AZM D;  3H0M C;  1KX4 C;  1ULY A;  5E5A C;  5B32 C;  3MGS B;  3MGQ C;  3AZJ A;  5CPI D;  3WAA A;  1S32 D;  4ZBJ B;  1P3B A;  3AV1 A;  1P3P B;  5B31 B;  5B2J B;  3MGR D;  2ZY3 A;  5DNM C;  5GSU A;  4Z5T D;  2IO5 B;  4J8W C;  3REK D;  1P3O C;  5BO0 A;  5AY8 B;  3B6F B;  1ZLA C;  1ID3 A;  2CV5 B;  3W98 D;  3KSY A;  5AVB C;  4XZQ D;  5G49 A;  5DNN A;  1M18 D;  3KXB A;  1JFI B;  4H9P B;  1Z2C B;  1KX3 B;  3WKJ A;  4G92 B;  4AWL C;  1P3A C;  4J8X A;  5GXQ C;  4H9S A;  3AZH D;  4J8U D;  1R4V A;  4HGA B;  4DRB A;  5B31 G;  3LZ1 A;  2BYK B;  2G5I C;  5B40 C;  1KU5 A;  4EO5 C;  2ARO A;  1H3O B;  5GT3 B;  3AFA D;  4WU9 A;  1P3K D;  2PYO B;  3AZM C;  3NQJ A;  4NE5 A;  2NZD B;  2ZY2 A;  5KDM A;  3W99 A;  2XD5 A;  1P3G B;  5CPI C;  5B33 B;  4KUD B;  3VH5 A;  1S32 C;  5B2I A;  4KHA A;  2DQN C;  3MGR C;  2FJ7 D;  4QLC D;  3REH A;  5GT0 B;  3REK C;  5BNV A;  3KWQ D;  3B6G A;  1A7W A;  5FUG B;  3W98 C;  4LD9 B;  4XZQ C;  1M18 C;  3C1C A;  3KUY A;  1HTA A;  3TU4 A;  1KX5 A;  4JJN D;  4YS3 B;  3AZJ B;  3WAA B;  4WU8 A;  1P3B B;  3AV1 B;  5AV5 A;  1EQZ C;  5GSU B;  2YFW A;  3AYW A;  3AZI C;  2HUE C;  1TAF B;  5JA4 A;  4WNN A;  5BO0 B;  3AZF B;  2Y2N A;  3AFA C;  3AZG B;  4Z66 A;  1P3K C;  1F66 A;  5G49 B;  5DNN B;  4XUJ D;  3AZL C;  1HQ3 D;  3KXB B;  3MVD A;  5B0Z C;  3W97 A;  5CPK A;  3A6N A;  3AZK D;  4J8X B;  4M6B A;  4R8P A;  3MGS C;  1P3L D;  1P3M A;  3LJA D;  3UT9 D;  3C1B A;  2Y2L A;  3LZ1 B;  1W2E A;  1P3P A;  3WTP A;  5B2J A;  3KWQ C;  5B1L A;  5B1M B;  1B67 A;  5AY8 C;  4X23 D;  3MGP A;  3REI D;  3X1T D;  3UTA B;  3NQJ B;  1TZY D;  2CV5 C;  5KDM B;  4JJN C;  3W99 B;  2Y2O A;  5AV9 A;  1U35 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...