1TZYD

Crystal structure of the core-histone octamer to 1.90 angstrom resolution
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
83
structure length
83
Chain Sequence
b'KVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H2A-IV
publication title High-resolution structure of the native histone octamer.
pubmed doi rcsb
molecule tags Dna binding protein
total genus 23
structure length 83
sequence length 83
chains with identical sequence H
ec nomenclature
pdb deposition date 2004-07-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1tzyD00
5DNMC 4H9NB 3MGRC 2HIOD 3MGSD 3X1SA 3AV1A 1M1AC 1P3FC 2L5AA 4WU9D 1P34A 1AOIB 5CP6A 4H9QA 5B2JA 4J8XC 2YFWA 1P3GD 1P3PD 3X1TD 3X1VD 4J8WB 1ID3A 5GSUA 4Z5TA 3AYWB 1P3KA 5BNXB 3AZLC 5B32D 1P3MA 5DNNA 3AZFD 3LZ1D 2NQBD 2PYOC 5B0YC 3VH5A 1F66D 3LELA 3NQUB 3W99C 4WU9C 1AOID 5B0ZA 1EQZC 2CV5C 1P3GC 4YS3D 5AV5C 2F8NB 3AYWD 5GT3A 3REHB 3W98A 3C1CB 3AZJA 4KUDD 3VH6A 4H9PB 3B0DB 3X1UA 5B2JD 1M18C 3RELB 3AZNA 5AV6B 5B2IB 3UTBA 5CPKD 4J8UA 2LY8A 5B40B 1AOIC 5JRGA 4J8VA 1BH8B 4CSRA 3REIB 3MNNA 3AZMB 4ZBJC 4J8WC 1P3LB 3AYWC 3C1CD 4X23C 3O62B 3C1BA 3R45A 2NZDB 1KX4A 4XZQB 5B2ID 2BYKA 3W98D 1KX3B 4Z2MH 3REID 1JFIA 5C3IB 3B0CT 3X1UD 1P3LD 5AV8B 1ZLAB 1TZYD 3REHC 2JSSA 3UTBD 5AVCB 3B0DC 4J8VD 4H9OB 2AROA 3RELC 3KWQB 4JJNA 5AV6C 3MNND 3AN2A 5F99B 5B2IC 5CPJA 5CPIB 5B40C 5GT0B 3UTAB 3AZHD 3B6GB 3WKJB 3REIC 1KX4D 3UT9D 3AZMC 1ZLAD 1P3LC 4LD9B 3O62C 1M19B 1S32B 4G91B 3MGQD 2NZDC 3KWQD 4XZQC 3MVDB 4ZUXB 5GT0D 3WTPE 1KX3C 3B6GD 2F8NG 3WKJD 5B1LA 1P3IC 5B33B 5C3IC 5AVBA 5AV8C 2AROD 3AFAA 4LD9D 4JJND 5AVCC 1P3BA 3MGRA 3W97B 5JA4B 3AZIB 4KGCA 3KWQC 1P3OD 3KXBB 3TU4B 3AV2B 5F99C 5KDMB 4QLCB 1P3AB 3A6ND 4CAYA 1M1AA 5CPIC 3UTAC 3REKB 3B6GC 3WKJC 4HGAB 1R4VA 2HIOB 5G49A 2RVQC 4UUZA 3MGSB 3AZGA 1M19C 1S32C 4G91C 4NE3A 2BYMB 3VH5T 5B31A 5AY8D 5BNVB 1P3PB 3X1TB 1KX5C 5B24A 5B0YA 5AVBD 3X1VB 4WU8D 3MVDC 4ZUXC 3AFAD 4R8PD 5B32B 3REKD 3LJAD 3AZKA 3AZFB 5B33C 3LZ1B 2NQBB 1BH9A 4KGCD 2CV5A 5FUGB 5AV5A 1F66B 1H3OA 3KSYA 3LZ0A 1U35D 3W97C 3REJA 4EO5B 3AZIC 3KXBC 3TU4C 3AV2C 4YS3B 4QLCC 1M18A 1P3AC 3X1SB 3AV1B 3WTPD 3REKC 1P34B 4KUDB 4HGAC 2HIOC 4H9QB 5B2JB 2YFWB 3MGSC 5B24D 3MGPD 4G92B 5CPKB 1ID3B 5BNXA 4X23A 3KUYA 3AZKD 1P3PC 3X1TC 3X1VC 2YFVB 3X1SD 3AV1D 5B32C 3LELB 1P34D 1N1JB 5GXQA 3NQJA 5CP6D 5B0ZB 3AZFC 3REJD 4DRBA 3LZ1C 2NQBC 1F66C 1ID3D 5GSUD 3REHA 4Z5TD 1P3KD 3W98B 4EO5C 1P3MD 5DNND 4H9PA 1B6WA 4YS3C 3X1UB 2HUEB 3RELA 1TZYB 5AV6A 3LELD 3AZNB 3AV1C 1WWIA 3UTBB 4J8UB 2F8NK 5B40A 5B0ZD 1P34C 4KUDC 5JRGB 1BH8A 5B2JC 1ULYA 3KUYD 5AV9A 4CSRB 4J8VB 3WA9A 3MNNB 3W96A 5B1MA 5GT3D 5CPKC 1ID3C 5BO0B 3B6FA 1HQ3A 5CHLB 3AZJD 4YM6A 3R45B 3AZHB 1F1EA 5GXQD 1KX4B 5B32G 3UT9B 4XZQA 3AZND 3C1CC 3LELC 4J8UD 3MGQB 3WAAA 5JRGD 4Z66A 1P3IA 2F8NH 3W98C 3C1BD 5AVCA 4H9OA 3X1UC 2HUEC 2AROB 1TZYC 5AV9D 4JJNB 3AZNC 1TAFA 3AN2B 3WA9D 5B1MD 3W96D 3UTBC 4WNNA 4J8UC 3AZEA 3B6FD 1HQ3D 4AWLB 2FJ7A 4YM6D 4J8VC 1BFMA 3V9RA 1P3OB 3MNNC 3A6NB 3AZHC 3WAAD 1KX4C 4H9SA 3UT9C 4Z66D 5BS7A 1ZLAC 4XUJA 1KX5A 3AN2D 5E5AA 3MVDA 4ZUXA 5DNMA 5CPJD 4Z2MG 3MGQC 5AY8B 5AVBB 4WU8B 3B0CW 3AFAB 4H9RA 4NFTA 4R8PB 5GT0C 1P3FA 1P3BB 3LJAB 3W97A 3MGRB 4J8XA 5JA4A 3AZIA 2FJ7D 4KGCB 2AROC 4LD9C 3TU4A 1B67A 4JJNC 3AN2C 3AZLA 4CAYB 1U35B 1M1AB 5B1LD 4AWLC 2PYOA 1P3OC 2HIOA 5G49B 4KHAB 4XUJD 3A6NC 3MGSA 5E5AD 3AZGB 3W99A 1P3BD 4WU9A 3WTPB 5DNMD 4WV4B 3MGRD 1EQZA 5B31B 1P3GA 5B24B 3X1VA 3MGPB 3VH6T 4H9NA 1M1AD 1P3FD 3AZKB 5AY8C 2CWEA 3LZ1A 4J8XD 5AVBC 4WU8C 1BH9B 3AFAC 4R8PC 3AZGD 1H3OB 3AZLD 1P3BC 1AOIA 3LZ0B 3LJAC 5CP6B 3REJB 5B31D 4KGCC 2PYOD 5B0YD 4YS3A 4J8WA 3AYWA 5GSUB 1M18B 4Z5TB 1P3KB 1U35C 3W99D 1P3MB 5DNNB 4KUDA 1EQZD 2CV5D 5AV5D 4ZBJB 3AZGC 5CPKA 3NQUA 3WTPC 3LZ0D 4X23B 3KUYB 5B31C 3VH5W 2F8NA 5B24C 1Q9CA 3MGPC 5GT3B 2YFVA 1M18D 1WWSA 2IO5B 3C1CA 3AZJB 1N1JA 5GXQB 3AZKC 3NQJB 4DRAA 3B0BA 3X1SC 5B2IA 4J8WD 4X23D 3VH6W 3LZ0C 5CP6C 3REJC 3REIA 3AZMA 4G92C 1P3LA 1A7WA 1TZYA 4Z5TC 5GSUC 1P3KC 3O62A 3C1BB 2NZDA 1P3MC 5DNNC 5AV9B 3WA9B 2F8ND 4NE6A 5B1MB 3REHD 3W96B 2BYKB 5BO0A 5B31G 3B6FB 1KX3A 1HQ3B 5B0ZC 3AZHA 4YM6B 1JFIB 3KUYC 3UT9A 5AV8A 4WZSB 1ZLAA 3RELD 5GT3C 2IO5C 5AV6D 3AZJC 3MGQA 5B40D 5GXQC 3WAAB 4Z66B 3KWQA 1P3IB 5F99A 3AZMD 1HTAA 5CPIA 3O62D 5GT0A 3UTAA 5CPJB 5JRGC 3B6GA 2NZDD 3WKJA 4LD9A 4XZQD 1M19A 3C1BC 1TAFB 1S32A 4WNNB 3AZEB 1KX3D 2FJ7B 1P3ID 3V9RB 5AV9C 1P3OA 3WA9C 5AV8D 3W96C 5B1MC 3A6NA 3B6FC 1HQ3C 5AVCD 4NE5A 5B1LB 4YM6C 5B33A 1KU5A 4XUJB 1KX5B 5F99D 5E5AB 3AZED 5DNMB 5CPID 3UTAD 3WAAC 4Z66C 5AY8A 3KXBA 3AV2A 4QLCA 5KDMA 2RVQD 4WU8A 4M6BA 1P3AA 4R8PA 5CPJC 4H9RB 4E44A 1M19D 1S32D 1P3FB 3REKA 5BT1D 3LJAA 4J8XB 1KX5D 4UUZB 4E45A 3MVDD 4ZUXD 3AZLB 3AZEC 1U35A 2BYMA 2FJ7C 5BNVA 1P3PA 3X1TA 5B33D 2PYOB 5B0YB 4KHAA 5B32A 3WTPA 3W99B 5B1LC 4WU9B 5BT1C 3AZFA 3W97D 2NQBA 1EQZB 3AZID 4H9SC 5FUGA 5BS7C 2CV5B 3KXBD 4XUJC 3TU4D 3AV2D 5AV5B 4QLCD 1P3GB 3MGPA 5E5AC 1P3AD 1F66A
chains in the Genus database with same CATH superfamily
5DNMC 4H9NB 3MGRC 2HIOD 3MGSD 3X1SA 3AV1A 1M1AC 1P3FC 2L5AA 4WU9D 1P34A 1AOIB 5CP6A 2Y2GA 4H9QA 5B2JA 4J8XC 2YFWA 1P3GD 1P3PD 3X1TD 3X1VD 4J8WB 1ID3A 5GSUA 4Z5TA 3AYWB 1P3KA 5BNXB 3AZLC 5B32D 1P3MA 5DNNA 3AZFD 3LZ1D 2NQBD 2PYOC 5B0YC 3VH5A 1F66D 3LELA 3NQUB 3W99C 4WU9C 1AOID 5B0ZA 1EQZC 2CV5C 1P3GC 4YS3D 5AV5C 2F8NB 3AYWD 5GT3A 3REHB 3W98A 3C1CB 3AZJA 4KUDD 3VH6A 4H9PB 3B0DB 3X1UA 5B2JD 1M18C 3RELB 3AZNA 5AV6B 5B2IB 3UTBA 5CPKD 4J8UA 2LY8A 5B40B 1AOIC 5JRGA 4J8VA 1BH8B 4CSRA 3REIB 3MNNA 3AZMB 4ZBJC 4J8WC 1P3LB 2F2AC 3AYWC 3C1CD 4X23C 3O62B 3C1BA 3R45A 2NZDB 1KX4A 4XZQB 5B2ID 2BYKA 3W98D 1KX3B 4Z2MH 3REID 1JFIA 5C3IB 3B0CT 3X1UD 1P3LD 5AV8B 1ZLAB 1TZYD 3REHC 2JSSA 3UTBD 5AVCB 3H0MC 2JE5A 2Y2MA 3B0DC 4J8VD 4H9OB 2AROA 3RELC 3KWQB 4JJNA 5AV6C 3MNND 3AN2A 5F99B 5B2IC 5CPJA 5CPIB 5B40C 5GT0B 3UTAB 3AZHD 3B6GB 2ZY2A 3REIC 3WKJB 1KX4D 3UT9D 3AZMC 1ZLAD 1P3LC 4LD9B 3O62C 1M19B 1KX5C 1S32B 4G91B 3MGQD 2NZDC 3KWQD 4XZQC 3MVDB 4ZUXB 4DQYB 3EPKA 5GT0D 3A1IA 3WTPE 1KX3C 3B6GD 2F8NG 3WKJD 5B1LA 2XD5A 5B33B 5C3IC 1P3IC 5AVBA 5AV8C 2AROD 3AFAA 4LD9D 4JJND 5AVCC 1P3BA 3MGRA 3W97B 2DF4C 5JA4B 3AZIB 4KGCA 3KWQC 1P3OD 3KXBB 3TU4B 3AV2B 5F99C 5KDMB 4QLCB 1P3AB 3A6ND 4CAYA 1M1AA 5CPIC 3UTAC 3REKB 3B6GC 3WKJC 4HGAB 1R4VA 2HIOB 5G49A 2RVQC 4UUZA 3MGSB 3AZGA 1M19C 1S32C 4G91C 4NE3A 2BYMB 3VH5T 5B31A 1W2EA 5AY8D 5BNVB 3X1TB 1P3PB 5B24A 2Y2QA 2ZY4A 5AVBD 5B0YA 3X1VB 3MVDC 4ZUXC 4WU8D 3AFAD 4R8PD 5B32B 3REKD 3LJAD 3AZKA 3AZFB 5B33C 3LZ1B 2NQBB 1BH9A 4KGCD 2CV5A 5FUGB 5AV5A 1F66B 1H3OA 3KSYA 3LZ0A 1U35D 3W97C 3REJA 4EO5B 3AZIC 3KXBC 3TU4C 3AV2C 4YS3B 4QLCC 1M18A 1P3AC 3X1SB 3AV1B 2Y2PA 3WTPD 3REKC 1P34B 4KUDB 4HGAC 2HIOC 4H9QB 5B2JB 2YFWB 3EPJA 3MGSC 5B24D 3MGPD 4G92B 5CPKB 1ID3B 5BNXA 4X23A 3KUYA 3AZKD 1P3PC 3X1TC 3X1VC 2YFVB 3X1SD 3AV1D 5B32C 3LELB 1P34D 1N1JB 5GXQA 2Y2KA 3NQJA 5CP6D 5B0ZB 3REJD 2JCHA 4DRBA 3LZ1C 3AZFC 2NQBC 2RIQA 1F66C 1ID3D 5GSUD 3REHA 4Z5TD 1P3KD 3W98B 4EO5C 1P3MD 5DNND 4H9PA 1B6WA 4YS3C 4WJ3C 3X1UB 2HUEB 2W8SA 1TZYB 3RELA 2Y2LA 5AV6A 3LELD 3AZNB 3AV1C 1WWIA 3UTBB 4J8UB 2ZY3A 2F8NK 5B40A 5B0ZD 1P34C 4KUDC 5JRGB 1BH8A 5B2JC 1ULYA 3KUYD 5AV9A 4CSRB 4J8VB 3WA9A 3MNNB 2FFFB 3W96A 5B1MA 5GT3D 5CPKC 1ID3C 5BO0B 3B6FA 1HQ3A 5CHLB 3AZJD 3EG5B 3R45B 4YM6A 3AZHB 1F1EA 5GXQD 1KX4B 5B32G 3UT9B 4XZQA 3AZND 3C1CC 3LELC 4J8UD 3MGQB 3WAAA 5JRGD 4Z66A 1P3IA 2F8NH 3W98C 3C1BD 5AVCA 3FDDA 4H9OA 3X1UC 2HUEC 2AROB 1TZYC 5AV9D 4JJNB 3AZNC 1TAFA 3AN2B 3WA9D 5B1MD 3W96D 3UTBC 4WNNA 4J8UC 3AZEA 3B6FD 2G5IC 1HQ3D 4AWLB 2FJ7A 4YM6D 4J8VC 1BFMA 3V9RA 1P3OB 3MNNC 3A6NB 2DQNC 3AZHC 3WAAD 1KX4C 4H9SA 3UT9C 4Z66D 5BS7A 1ZLAC 4XUJA 1KX5A 3AN2D 5E5AA 3KFUG 3MVDA 4ZUXA 5DNMA 5CPJD 4Z2MG 3MGQC 2UWXA 2BG1A 5AY8B 5AVBB 4WU8B 3B0CW 3IP4C 2J8PA 2VQRA 3AFAB 4H9RA 4NFTA 4R8PB 5GT0C 1P3FA 1P3BB 3LJAB 3W97A 3MGRB 4J8XA 5JA4A 3AZIA 2FJ7D 4KGCB 2AROC 4LD9C 3TU4A 1B67A 4JJNC 3AN2C 2G5HC 3AZLA 4CAYB 1U35B 1M1AB 5B1LD 4AWLC 2PYOA 1P3OC 2HIOA 5G49B 4KHAB 4XUJD 3A6NC 3MGSA 5E5AD 3AZGB 3W99A 1P3BD 4WU9A 3A1KA 3WTPB 5DNMD 4WV4B 3MGRD 1EQZA 5B31B 1P3GA 5B24B 3X1VA 3MGPB 3VH6T 4H9NA 1M1AD 1P3FD 3AZKB 5AY8C 2CWEA 3LZ1A 4J8XD 5AVBC 2Y2IA 4WU8C 1BH9B 3AFAC 3F6TA 4R8PC 3AZGD 1H3OB 3AZLD 1P3BC 1AOIA 3LZ0B 3H0RC 5CP6B 3LJAC 3REJB 5B31D 4KGCC 2PYOD 5B0YD 4YS3A 4J8WA 3AL0C 3AYWA 5GSUB 1M18B 4Z5TB 1P3KB 1U35C 3W99D 1P3MB 5DNNB 4KUDA 1EQZD 2Y2JA 2CV5D 5AV5D 4ZBJB 3AZGC 5CPKA 3NQUA 3WTPC 3LZ0D 4X23B 2Y2OA 3KUYB 5B31C 3VH5W 2F8NA 5B24C 1Q9CA 3MGPC 5GT3B 2YFVA 1M18D 1WWSA 2IO5B 3C1CA 3AZJB 1N1JA 5GXQB 3AZKC 3NQJB 4DRAA 3B0BA 3X1SC 5B2IA 4J8WD 3P5JB 4X23D 3VH6W 3LZ0C 5CP6C 3REJC 3REIA 3AZMA 4G92C 1P3LA 1A7WA 1TZYA 4Z5TC 5GSUC 1P3KC 3O62A 4UPKA 3C1BB 2NZDA 1P3MC 5DNNC 2Y2NA 5AV9B 3WA9B 2F8ND 4NE6A 5B1MB 3REHD 3W96B 2BYKB 5BO0A 5B31G 3B6FB 1KX3A 1HQ3B 5B0ZC 2XD1A 3AZHA 4YM6B 1JFIB 3KUYC 3UT9A 5AV8A 4WZSB 1ZLAA 3RELD 5GT3C 2IO5C 5AV6D 2ZM5A 2ZY5A 3AZJC 3MGQA 5B40D 5GXQC 3WAAB 4Z66B 3KWQA 1P3IB 5F99A 3AZMD 1HTAA 5CPIA 3O62D 5GT0A 3UTAA 5CPJB 5JRGC 3EPLA 3B6GA 2NZDD 3WKJA 4LD9A 4XZQD 1M19A 3C1BC 1TAFB 1S32A 3EPHA 4WNNB 3AZEB 1KX3D 2FJ7B 1P3ID 3V9RB 5AV9C 1P3OA 3WA9C 5AV8D 3W96C 5B1MC 3A6NA 3B6FC 1HQ3C 5AVCD 4NE5A 2Y2HA 5B1LB 4YM6C 5B33A 1KU5A 4XUJB 1KX5B 5F99D 5E5AB 3AZED 5DNMB 5CPID 3UTAD 3WAAC 4Z66C 5AY8A 3KXBA 3AV2A 4QLCA 5KDMA 2RVQD 4WU8A 4M6BA 1P3AA 4R8PA 5CPJC 4H9RB 4E44A 1M19D 1S32D 1P3FB 3REKA 5BT1D 3LJAA 4J8XB 1KX5D 4UUZB 4E45A 3MVDD 4ZUXD 3AZLB 3AZEC 1U35A 2BYMA 2FJ7C 5BNVA 1P3PA 3X1TA 1PZRA 5B33D 2PYOB 5B0YB 4KHAA 3H0LC 5B32A 1Z2CB 3WTPA 3W99B 5B1LC 4WU9B 5BT1C 3AZFA 1T3UA 3W97D 2NQBA 1EQZB 3AZID 4H9SC 5FUGA 5BS7C 2CV5B 3KXBD 4XUJC 3TU4D 3AV2D 5AV5B 4QLCD 1P3GB 3MGPA 5E5AC 1P3AD 1F66A
chains in the Genus database with same CATH topology
5DNMC 4H9NB 3MGRC 2HIOD 3MGSD 3X1SA 3AV1A 1M1AC 1P3FC 2L5AA 4WU9D 1P34A 1AOIB 5CP6A 2Y2GA 4H9QA 5B2JA 4J8XC 2YFWA 1P3GD 1P3PD 3X1TD 3X1VD 4J8WB 1ID3A 5GSUA 4Z5TA 3AYWB 1P3KA 5BNXB 3AZLC 5B32D 1P3MA 5DNNA 3AZFD 3LZ1D 2NQBD 2PYOC 5B0YC 3VH5A 1F66D 3LELA 3NQUB 3W99C 4WU9C 1AOID 5B0ZA 1EQZC 2CV5C 1P3GC 4YS3D 5AV5C 2F8NB 3AYWD 5GT3A 3REHB 3W98A 3C1CB 3AZJA 4KUDD 3VH6A 4H9PB 3B0DB 3X1UA 5B2JD 1M18C 3RELB 3AZNA 5AV6B 5B2IB 3UTBA 5CPKD 4J8UA 2LY8A 5B40B 1AOIC 5JRGA 4J8VA 1BH8B 4CSRA 3REIB 3MNNA 3AZMB 4ZBJC 4J8WC 1P3LB 2F2AC 3AYWC 3C1CD 4X23C 3O62B 3C1BA 3R45A 2NZDB 1KX4A 4XZQB 5B2ID 2BYKA 3W98D 1KX3B 4Z2MH 3REID 1JFIA 5C3IB 3B0CT 3X1UD 1P3LD 5AV8B 1ZLAB 1TZYD 3REHC 2JSSA 3UTBD 5AVCB 3H0MC 2JE5A 2Y2MA 3B0DC 4J8VD 4H9OB 2AROA 3RELC 3KWQB 4JJNA 5AV6C 3MNND 3AN2A 5F99B 5B2IC 5CPJA 5CPIB 5B40C 5GT0B 3UTAB 3AZHD 3B6GB 2ZY2A 3REIC 3WKJB 1KX4D 3UT9D 3AZMC 1ZLAD 1P3LC 4LD9B 3O62C 1M19B 1KX5C 1S32B 4G91B 3MGQD 2NZDC 3KWQD 4XZQC 3MVDB 4ZUXB 4DQYB 3EPKA 5GT0D 3A1IA 3WTPE 1KX3C 3B6GD 2F8NG 3WKJD 5B1LA 2XD5A 5B33B 5C3IC 1P3IC 5AVBA 5AV8C 2AROD 3AFAA 4LD9D 4JJND 5AVCC 1P3BA 3MGRA 3W97B 2DF4C 5JA4B 3AZIB 4KGCA 3KWQC 1P3OD 3KXBB 3TU4B 3AV2B 5F99C 5KDMB 4QLCB 1P3AB 3A6ND 4CAYA 1M1AA 5CPIC 3UTAC 3REKB 3B6GC 3WKJC 4HGAB 1R4VA 2HIOB 5G49A 2RVQC 4UUZA 3MGSB 3AZGA 1M19C 1S32C 4G91C 4NE3A 2BYMB 3VH5T 5B31A 1W2EA 5AY8D 5BNVB 3X1TB 1P3PB 5B24A 2Y2QA 2ZY4A 5AVBD 5B0YA 3X1VB 3MVDC 4ZUXC 4WU8D 3AFAD 4R8PD 5B32B 3REKD 3LJAD 3AZKA 3AZFB 5B33C 3LZ1B 2NQBB 1BH9A 4KGCD 2CV5A 5FUGB 5AV5A 1F66B 1H3OA 3KSYA 3LZ0A 1U35D 3W97C 3REJA 4EO5B 3AZIC 3KXBC 3TU4C 3AV2C 4YS3B 4QLCC 1M18A 1P3AC 3X1SB 3AV1B 2Y2PA 3WTPD 3REKC 1P34B 4KUDB 4HGAC 2HIOC 4H9QB 5B2JB 2YFWB 3EPJA 3MGSC 5B24D 3MGPD 4G92B 5CPKB 1ID3B 5BNXA 4X23A 3KUYA 3AZKD 1P3PC 3X1TC 3X1VC 2YFVB 3X1SD 3AV1D 5B32C 3LELB 1P34D 1N1JB 5GXQA 2Y2KA 3NQJA 5CP6D 5B0ZB 3REJD 2JCHA 4DRBA 3LZ1C 3AZFC 2NQBC 2RIQA 1F66C 1ID3D 5GSUD 3REHA 4Z5TD 1P3KD 3W98B 4EO5C 1P3MD 5DNND 4H9PA 1B6WA 4YS3C 4WJ3C 3X1UB 2HUEB 2W8SA 1TZYB 3RELA 2Y2LA 5AV6A 3LELD 3AZNB 3AV1C 1WWIA 3UTBB 4J8UB 2ZY3A 2F8NK 5B40A 5B0ZD 1P34C 4KUDC 5JRGB 1BH8A 5B2JC 1ULYA 3KUYD 5AV9A 4CSRB 4J8VB 3WA9A 3MNNB 2FFFB 3W96A 5B1MA 5GT3D 5CPKC 1ID3C 5BO0B 3B6FA 1HQ3A 5CHLB 3AZJD 3EG5B 3R45B 4YM6A 3AZHB 1F1EA 5GXQD 1KX4B 5B32G 3UT9B 4XZQA 3AZND 3C1CC 3LELC 4J8UD 3MGQB 3WAAA 5JRGD 4Z66A 1P3IA 2F8NH 3W98C 3C1BD 5AVCA 3FDDA 4H9OA 3X1UC 2HUEC 2AROB 1TZYC 5AV9D 4JJNB 3AZNC 1TAFA 3AN2B 3WA9D 5B1MD 3W96D 3UTBC 4WNNA 4J8UC 3AZEA 3B6FD 2G5IC 1HQ3D 4AWLB 2FJ7A 4YM6D 4J8VC 1BFMA 3V9RA 1P3OB 3MNNC 3A6NB 2DQNC 3AZHC 3WAAD 1KX4C 4H9SA 3UT9C 4Z66D 5BS7A 1ZLAC 4XUJA 1KX5A 3AN2D 5E5AA 3KFUG 3MVDA 4ZUXA 5DNMA 5CPJD 4Z2MG 3MGQC 2UWXA 2BG1A 5AY8B 5AVBB 4WU8B 3B0CW 3IP4C 2J8PA 2VQRA 3AFAB 4H9RA 4NFTA 4R8PB 5GT0C 1P3FA 1P3BB 3LJAB 3W97A 3MGRB 4J8XA 5JA4A 3AZIA 2FJ7D 4KGCB 2AROC 4LD9C 3TU4A 1B67A 4JJNC 3AN2C 2G5HC 3AZLA 4CAYB 1U35B 1M1AB 5B1LD 4AWLC 2PYOA 1P3OC 2HIOA 5G49B 4KHAB 4XUJD 3A6NC 3MGSA 5E5AD 3AZGB 3W99A 1P3BD 4WU9A 3A1KA 3WTPB 5DNMD 4WV4B 3MGRD 1EQZA 5B31B 1P3GA 5B24B 3X1VA 3MGPB 3VH6T 4H9NA 1M1AD 1P3FD 3AZKB 5AY8C 2CWEA 3LZ1A 4J8XD 5AVBC 2Y2IA 4WU8C 1BH9B 3AFAC 3F6TA 4R8PC 3AZGD 1H3OB 3AZLD 1P3BC 1AOIA 3LZ0B 3H0RC 5CP6B 3LJAC 3REJB 5B31D 4KGCC 2PYOD 5B0YD 4YS3A 4J8WA 3AL0C 3AYWA 5GSUB 1M18B 4Z5TB 1P3KB 1U35C 3W99D 1P3MB 5DNNB 4KUDA 1EQZD 2Y2JA 2CV5D 5AV5D 4ZBJB 3AZGC 5CPKA 3NQUA 3WTPC 3LZ0D 4X23B 2Y2OA 3KUYB 5B31C 3VH5W 2F8NA 5B24C 1Q9CA 3MGPC 5GT3B 2YFVA 1M18D 1WWSA 2IO5B 3C1CA 3AZJB 1N1JA 5GXQB 3AZKC 3NQJB 4DRAA 3B0BA 3X1SC 5B2IA 4J8WD 3P5JB 4X23D 3VH6W 3LZ0C 5CP6C 3REJC 3REIA 3AZMA 4G92C 1P3LA 1A7WA 1TZYA 4Z5TC 5GSUC 1P3KC 3O62A 4UPKA 3C1BB 2NZDA 1P3MC 5DNNC 2Y2NA 5AV9B 3WA9B 2F8ND 4NE6A 5B1MB 3REHD 3W96B 2BYKB 5BO0A 5B31G 3B6FB 1KX3A 1HQ3B 5B0ZC 2XD1A 3AZHA 4YM6B 1JFIB 3KUYC 3UT9A 5AV8A 4WZSB 1ZLAA 3RELD 5GT3C 2IO5C 5AV6D 2ZM5A 2ZY5A 3AZJC 3MGQA 5B40D 5GXQC 3WAAB 4Z66B 3KWQA 1P3IB 5F99A 3AZMD 1HTAA 5CPIA 3O62D 5GT0A 3UTAA 5CPJB 5JRGC 3EPLA 3B6GA 2NZDD 3WKJA 4LD9A 4XZQD 1M19A 3C1BC 1TAFB 1S32A 3EPHA 4WNNB 3AZEB 1KX3D 2FJ7B 1P3ID 3V9RB 5AV9C 1P3OA 3WA9C 5AV8D 3W96C 5B1MC 3A6NA 3B6FC 1HQ3C 5AVCD 4NE5A 2Y2HA 5B1LB 4YM6C 5B33A 1KU5A 4XUJB 1KX5B 5F99D 5E5AB 3AZED 5DNMB 5CPID 3UTAD 3WAAC 4Z66C 5AY8A 3KXBA 3AV2A 4QLCA 5KDMA 2RVQD 4WU8A 4M6BA 1P3AA 4R8PA 5CPJC 4H9RB 4E44A 1M19D 1S32D 1P3FB 3REKA 5BT1D 3LJAA 4J8XB 1KX5D 4UUZB 4E45A 3MVDD 4ZUXD 3AZLB 3AZEC 1U35A 2BYMA 2FJ7C 5BNVA 1P3PA 3X1TA 1PZRA 5B33D 2PYOB 5B0YB 4KHAA 3H0LC 5B32A 1Z2CB 3WTPA 3W99B 5B1LC 4WU9B 5BT1C 3AZFA 1T3UA 3W97D 2NQBA 1EQZB 3AZID 4H9SC 5FUGA 5BS7C 2CV5B 3KXBD 4XUJC 3TU4D 3AV2D 5AV5B 4QLCD 1P3GB 3MGPA 5E5AC 1P3AD 1F66A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DNM C;  4H9N B;  3MGR C;  2HIO D;  3MGS D;  3X1S A;  3AV1 A;  1M1A C;  1P3F C;  2L5A A;  4WU9 D;  1P34 A;  1AOI B;  5CP6 A;  4H9Q A;  5B2J A;  4J8X C;  2YFW A;  1P3G D;  1P3P D;  3X1T D;  3X1V D;  4J8W B;  1ID3 A;  5GSU A;  4Z5T A;  3AYW B;  1P3K A;  5BNX B;  3AZL C;  5B32 D;  1P3M A;  5DNN A;  3AZF D;  3LZ1 D;  2NQB D;  2PYO C;  5B0Y C;  3VH5 A;  1F66 D;  3LEL A;  3NQU B;  3W99 C;  4WU9 C;  1AOI D;  5B0Z A;  1EQZ C;  2CV5 C;  1P3G C;  4YS3 D;  5AV5 C;  2F8N B;  3AYW D;  5GT3 A;  3REH B;  3W98 A;  3C1C B;  3AZJ A;  4KUD D;  3VH6 A;  4H9P B;  3B0D B;  3X1U A;  5B2J D;  1M18 C;  3REL B;  3AZN A;  5AV6 B;  5B2I B;  3UTB A;  5CPK D;  4J8U A;  2LY8 A;  5B40 B;  1AOI C;  5JRG A;  4J8V A;  1BH8 B;  4CSR A;  3REI B;  3MNN A;  3AZM B;  4ZBJ C;  4J8W C;  1P3L B;  3AYW C;  3C1C D;  4X23 C;  3O62 B;  3C1B A;  3R45 A;  2NZD B;  1KX4 A;  4XZQ B;  5B2I D;  2BYK A;  3W98 D;  1KX3 B;  4Z2M H;  3REI D;  1JFI A;  5C3I B;  3B0C T;  3X1U D;  1P3L D;  5AV8 B;  1ZLA B;  1TZY D;  3REH C;  2JSS A;  3UTB D;  5AVC B;  3B0D C;  4J8V D;  4H9O B;  2ARO A;  3REL C;  3KWQ B;  4JJN A;  5AV6 C;  3MNN D;  3AN2 A;  5F99 B;  5B2I C;  5CPJ A;  5CPI B;  5B40 C;  5GT0 B;  3UTA B;  3AZH D;  3B6G B;  3WKJ B;  3REI C;  1KX4 D;  3UT9 D;  3AZM C;  1ZLA D;  1P3L C;  4LD9 B;  3O62 C;  1M19 B;  1S32 B;  4G91 B;  3MGQ D;  2NZD C;  3KWQ D;  4XZQ C;  3MVD B;  4ZUX B;  5GT0 D;  3WTP E;  1KX3 C;  3B6G D;  2F8N G;  3WKJ D;  5B1L A;  1P3I C;  5B33 B;  5C3I C;  5AVB A;  5AV8 C;  2ARO D;  3AFA A;  4LD9 D;  4JJN D;  5AVC C;  1P3B A;  3MGR A;  3W97 B;  5JA4 B;  3AZI B;  4KGC A;  3KWQ C;  1P3O D;  3KXB B;  3TU4 B;  3AV2 B;  5F99 C;  5KDM B;  4QLC B;  1P3A B;  3A6N D;  4CAY A;  1M1A A;  5CPI C;  3UTA C;  3REK B;  3B6G C;  3WKJ C;  4HGA B;  1R4V A;  2HIO B;  5G49 A;  2RVQ C;  4UUZ A;  3MGS B;  3AZG A;  1M19 C;  1S32 C;  4G91 C;  4NE3 A;  2BYM B;  3VH5 T;  5B31 A;  5AY8 D;  5BNV B;  1P3P B;  3X1T B;  1KX5 C;  5B24 A;  5B0Y A;  5AVB D;  3X1V B;  4WU8 D;  3MVD C;  4ZUX C;  3AFA D;  4R8P D;  5B32 B;  3REK D;  3LJA D;  3AZK A;  3AZF B;  5B33 C;  3LZ1 B;  2NQB B;  1BH9 A;  4KGC D;  2CV5 A;  5FUG B;  5AV5 A;  1F66 B;  1H3O A;  3KSY A;  3LZ0 A;  1U35 D;  3W97 C;  3REJ A;  4EO5 B;  3AZI C;  3KXB C;  3TU4 C;  3AV2 C;  4YS3 B;  4QLC C;  1M18 A;  1P3A C;  3X1S B;  3AV1 B;  3WTP D;  3REK C;  1P34 B;  4KUD B;  4HGA C;  2HIO C;  4H9Q B;  5B2J B;  2YFW B;  3MGS C;  5B24 D;  3MGP D;  4G92 B;  5CPK B;  1ID3 B;  5BNX A;  4X23 A;  3KUY A;  3AZK D;  1P3P C;  3X1T C;  3X1V C;  2YFV B;  3X1S D;  3AV1 D;  5B32 C;  3LEL B;  1P34 D;  1N1J B;  5GXQ A;  3NQJ A;  5CP6 D;  5B0Z B;  3AZF C;  3REJ D;  4DRB A;  3LZ1 C;  2NQB C;  1F66 C;  1ID3 D;  5GSU D;  3REH A;  4Z5T D;  1P3K D;  3W98 B;  4EO5 C;  1P3M D;  5DNN D;  4H9P A;  1B6W A;  4YS3 C;  3X1U B;  2HUE B;  3REL A;  1TZY B;  5AV6 A;  3LEL D;  3AZN B;  3AV1 C;  1WWI A;  3UTB B;  4J8U B;  2F8N K;  5B40 A;  5B0Z D;  1P34 C;  4KUD C;  5JRG B;  1BH8 A;  5B2J C;  1ULY A;  3KUY D;  5AV9 A;  4CSR B;  4J8V B;  3WA9 A;  3MNN B;  3W96 A;  5B1M A;  5GT3 D;  5CPK C;  1ID3 C;  5BO0 B;  3B6F A;  1HQ3 A;  5CHL B;  3AZJ D;  4YM6 A;  3R45 B;  3AZH B;  1F1E A;  5GXQ D;  1KX4 B;  5B32 G;  3UT9 B;  4XZQ A;  3AZN D;  3C1C C;  3LEL C;  4J8U D;  3MGQ B;  3WAA A;  5JRG D;  4Z66 A;  1P3I A;  2F8N H;  3W98 C;  3C1B D;  5AVC A;  4H9O A;  3X1U C;  2HUE C;  2ARO B;  1TZY C;  5AV9 D;  4JJN B;  3AZN C;  1TAF A;  3AN2 B;  3WA9 D;  5B1M D;  3W96 D;  3UTB C;  4WNN A;  4J8U C;  3AZE A;  3B6F D;  1HQ3 D;  4AWL B;  2FJ7 A;  4YM6 D;  4J8V C;  1BFM A;  3V9R A;  1P3O B;  3MNN C;  3A6N B;  3AZH C;  3WAA D;  1KX4 C;  4H9S A;  3UT9 C;  4Z66 D;  5BS7 A;  1ZLA C;  4XUJ A;  1KX5 A;  3AN2 D;  5E5A A;  3MVD A;  4ZUX A;  5DNM A;  5CPJ D;  4Z2M G;  3MGQ C;  5AY8 B;  5AVB B;  4WU8 B;  3B0C W;  3AFA B;  4H9R A;  4NFT A;  4R8P B;  5GT0 C;  1P3F A;  1P3B B;  3LJA B;  3W97 A;  3MGR B;  4J8X A;  5JA4 A;  3AZI A;  2FJ7 D;  4KGC B;  2ARO C;  4LD9 C;  3TU4 A;  1B67 A;  4JJN C;  3AN2 C;  3AZL A;  4CAY B;  1U35 B;  1M1A B;  5B1L D;  4AWL C;  2PYO A;  1P3O C;  2HIO A;  5G49 B;  4KHA B;  4XUJ D;  3A6N C;  3MGS A;  5E5A D;  3AZG B;  3W99 A;  1P3B D;  4WU9 A;  3WTP B;  5DNM D;  4WV4 B;  3MGR D;  1EQZ A;  5B31 B;  1P3G A;  5B24 B;  3X1V A;  3MGP B;  3VH6 T;  4H9N A;  1M1A D;  1P3F D;  3AZK B;  5AY8 C;  2CWE A;  3LZ1 A;  4J8X D;  5AVB C;  4WU8 C;  1BH9 B;  3AFA C;  4R8P C;  3AZG D;  1H3O B;  3AZL D;  1P3B C;  1AOI A;  3LZ0 B;  3LJA C;  5CP6 B;  3REJ B;  5B31 D;  4KGC C;  2PYO D;  5B0Y D;  4YS3 A;  4J8W A;  3AYW A;  5GSU B;  1M18 B;  4Z5T B;  1P3K B;  1U35 C;  3W99 D;  1P3M B;  5DNN B;  4KUD A;  1EQZ D;  2CV5 D;  5AV5 D;  4ZBJ B;  3AZG C;  5CPK A;  3NQU A;  3WTP C;  3LZ0 D;  4X23 B;  3KUY B;  5B31 C;  3VH5 W;  2F8N A;  5B24 C;  1Q9C A;  3MGP C;  5GT3 B;  2YFV A;  1M18 D;  1WWS A;  2IO5 B;  3C1C A;  3AZJ B;  1N1J A;  5GXQ B;  3AZK C;  3NQJ B;  4DRA A;  3B0B A;  3X1S C;  5B2I A;  4J8W D;  4X23 D;  3VH6 W;  3LZ0 C;  5CP6 C;  3REJ C;  3REI A;  3AZM A;  4G92 C;  1P3L A;  1A7W A;  1TZY A;  4Z5T C;  5GSU C;  1P3K C;  3O62 A;  3C1B B;  2NZD A;  1P3M C;  5DNN C;  5AV9 B;  3WA9 B;  2F8N D;  4NE6 A;  5B1M B;  3REH D;  3W96 B;  2BYK B;  5BO0 A;  5B31 G;  3B6F B;  1KX3 A;  1HQ3 B;  5B0Z C;  3AZH A;  4YM6 B;  1JFI B;  3KUY C;  3UT9 A;  5AV8 A;  4WZS B;  1ZLA A;  3REL D;  5GT3 C;  2IO5 C;  5AV6 D;  3AZJ C;  3MGQ A;  5B40 D;  5GXQ C;  3WAA B;  4Z66 B;  3KWQ A;  1P3I B;  5F99 A;  3AZM D;  1HTA A;  5CPI A;  3O62 D;  5GT0 A;  3UTA A;  5CPJ B;  5JRG C;  3B6G A;  2NZD D;  3WKJ A;  4LD9 A;  4XZQ D;  1M19 A;  3C1B C;  1TAF B;  1S32 A;  4WNN B;  3AZE B;  1KX3 D;  2FJ7 B;  1P3I D;  3V9R B;  5AV9 C;  1P3O A;  3WA9 C;  5AV8 D;  3W96 C;  5B1M C;  3A6N A;  3B6F C;  1HQ3 C;  5AVC D;  4NE5 A;  5B1L B;  4YM6 C;  5B33 A;  1KU5 A;  4XUJ B;  1KX5 B;  5F99 D;  5E5A B;  3AZE D;  5DNM B;  5CPI D;  3UTA D;  3WAA C;  4Z66 C;  5AY8 A;  3KXB A;  3AV2 A;  4QLC A;  5KDM A;  2RVQ D;  4WU8 A;  4M6B A;  1P3A A;  4R8P A;  5CPJ C;  4H9R B;  4E44 A;  1M19 D;  1S32 D;  1P3F B;  3REK A;  5BT1 D;  3LJA A;  4J8X B;  1KX5 D;  4UUZ B;  4E45 A;  3MVD D;  4ZUX D;  3AZL B;  3AZE C;  1U35 A;  2BYM A;  2FJ7 C;  5BNV A;  1P3P A;  3X1T A;  5B33 D;  2PYO B;  5B0Y B;  4KHA A;  5B32 A;  3WTP A;  3W99 B;  5B1L C;  4WU9 B;  5BT1 C;  3AZF A;  3W97 D;  2NQB A;  1EQZ B;  3AZI D;  4H9S C;  5FUG A;  5BS7 C;  2CV5 B;  3KXB D;  4XUJ C;  3TU4 D;  3AV2 D;  5AV5 B;  4QLC D;  1P3G B;  3MGP A;  5E5A C;  1P3A D;  1F66 A; 
#chains in the Genus database with same CATH topology
 5DNM C;  4H9N B;  3MGR C;  2HIO D;  3MGS D;  3X1S A;  3AV1 A;  1M1A C;  1P3F C;  2L5A A;  4WU9 D;  1P34 A;  1AOI B;  5CP6 A;  2Y2G A;  4H9Q A;  5B2J A;  4J8X C;  2YFW A;  1P3G D;  1P3P D;  3X1T D;  3X1V D;  4J8W B;  1ID3 A;  5GSU A;  4Z5T A;  3AYW B;  1P3K A;  5BNX B;  3AZL C;  5B32 D;  1P3M A;  5DNN A;  3AZF D;  3LZ1 D;  2NQB D;  2PYO C;  5B0Y C;  3VH5 A;  1F66 D;  3LEL A;  3NQU B;  3W99 C;  4WU9 C;  1AOI D;  5B0Z A;  1EQZ C;  2CV5 C;  1P3G C;  4YS3 D;  5AV5 C;  2F8N B;  3AYW D;  5GT3 A;  3REH B;  3W98 A;  3C1C B;  3AZJ A;  4KUD D;  3VH6 A;  4H9P B;  3B0D B;  3X1U A;  5B2J D;  1M18 C;  3REL B;  3AZN A;  5AV6 B;  5B2I B;  3UTB A;  5CPK D;  4J8U A;  2LY8 A;  5B40 B;  1AOI C;  5JRG A;  4J8V A;  1BH8 B;  4CSR A;  3REI B;  3MNN A;  3AZM B;  4ZBJ C;  4J8W C;  1P3L B;  2F2A C;  3AYW C;  3C1C D;  4X23 C;  3O62 B;  3C1B A;  3R45 A;  2NZD B;  1KX4 A;  4XZQ B;  5B2I D;  2BYK A;  3W98 D;  1KX3 B;  4Z2M H;  3REI D;  1JFI A;  5C3I B;  3B0C T;  3X1U D;  1P3L D;  5AV8 B;  1ZLA B;  1TZY D;  3REH C;  2JSS A;  3UTB D;  5AVC B;  3H0M C;  2JE5 A;  2Y2M A;  3B0D C;  4J8V D;  4H9O B;  2ARO A;  3REL C;  3KWQ B;  4JJN A;  5AV6 C;  3MNN D;  3AN2 A;  5F99 B;  5B2I C;  5CPJ A;  5CPI B;  5B40 C;  5GT0 B;  3UTA B;  3AZH D;  3B6G B;  2ZY2 A;  3REI C;  3WKJ B;  1KX4 D;  3UT9 D;  3AZM C;  1ZLA D;  1P3L C;  4LD9 B;  3O62 C;  1M19 B;  1KX5 C;  1S32 B;  4G91 B;  3MGQ D;  2NZD C;  3KWQ D;  4XZQ C;  3MVD B;  4ZUX B;  4DQY B;  3EPK A;  5GT0 D;  3A1I A;  3WTP E;  1KX3 C;  3B6G D;  2F8N G;  3WKJ D;  5B1L A;  2XD5 A;  5B33 B;  5C3I C;  1P3I C;  5AVB A;  5AV8 C;  2ARO D;  3AFA A;  4LD9 D;  4JJN D;  5AVC C;  1P3B A;  3MGR A;  3W97 B;  2DF4 C;  5JA4 B;  3AZI B;  4KGC A;  3KWQ C;  1P3O D;  3KXB B;  3TU4 B;  3AV2 B;  5F99 C;  5KDM B;  4QLC B;  1P3A B;  3A6N D;  4CAY A;  1M1A A;  5CPI C;  3UTA C;  3REK B;  3B6G C;  3WKJ C;  4HGA B;  1R4V A;  2HIO B;  5G49 A;  2RVQ C;  4UUZ A;  3MGS B;  3AZG A;  1M19 C;  1S32 C;  4G91 C;  4NE3 A;  2BYM B;  3VH5 T;  5B31 A;  1W2E A;  5AY8 D;  5BNV B;  3X1T B;  1P3P B;  5B24 A;  2Y2Q A;  2ZY4 A;  5AVB D;  5B0Y A;  3X1V B;  3MVD C;  4ZUX C;  4WU8 D;  3AFA D;  4R8P D;  5B32 B;  3REK D;  3LJA D;  3AZK A;  3AZF B;  5B33 C;  3LZ1 B;  2NQB B;  1BH9 A;  4KGC D;  2CV5 A;  5FUG B;  5AV5 A;  1F66 B;  1H3O A;  3KSY A;  3LZ0 A;  1U35 D;  3W97 C;  3REJ A;  4EO5 B;  3AZI C;  3KXB C;  3TU4 C;  3AV2 C;  4YS3 B;  4QLC C;  1M18 A;  1P3A C;  3X1S B;  3AV1 B;  2Y2P A;  3WTP D;  3REK C;  1P34 B;  4KUD B;  4HGA C;  2HIO C;  4H9Q B;  5B2J B;  2YFW B;  3EPJ A;  3MGS C;  5B24 D;  3MGP D;  4G92 B;  5CPK B;  1ID3 B;  5BNX A;  4X23 A;  3KUY A;  3AZK D;  1P3P C;  3X1T C;  3X1V C;  2YFV B;  3X1S D;  3AV1 D;  5B32 C;  3LEL B;  1P34 D;  1N1J B;  5GXQ A;  2Y2K A;  3NQJ A;  5CP6 D;  5B0Z B;  3REJ D;  2JCH A;  4DRB A;  3LZ1 C;  3AZF C;  2NQB C;  2RIQ A;  1F66 C;  1ID3 D;  5GSU D;  3REH A;  4Z5T D;  1P3K D;  3W98 B;  4EO5 C;  1P3M D;  5DNN D;  4H9P A;  1B6W A;  4YS3 C;  4WJ3 C;  3X1U B;  2HUE B;  2W8S A;  1TZY B;  3REL A;  2Y2L A;  5AV6 A;  3LEL D;  3AZN B;  3AV1 C;  1WWI A;  3UTB B;  4J8U B;  2ZY3 A;  2F8N K;  5B40 A;  5B0Z D;  1P34 C;  4KUD C;  5JRG B;  1BH8 A;  5B2J C;  1ULY A;  3KUY D;  5AV9 A;  4CSR B;  4J8V B;  3WA9 A;  3MNN B;  2FFF B;  3W96 A;  5B1M A;  5GT3 D;  5CPK C;  1ID3 C;  5BO0 B;  3B6F A;  1HQ3 A;  5CHL B;  3AZJ D;  3EG5 B;  3R45 B;  4YM6 A;  3AZH B;  1F1E A;  5GXQ D;  1KX4 B;  5B32 G;  3UT9 B;  4XZQ A;  3AZN D;  3C1C C;  3LEL C;  4J8U D;  3MGQ B;  3WAA A;  5JRG D;  4Z66 A;  1P3I A;  2F8N H;  3W98 C;  3C1B D;  5AVC A;  3FDD A;  4H9O A;  3X1U C;  2HUE C;  2ARO B;  1TZY C;  5AV9 D;  4JJN B;  3AZN C;  1TAF A;  3AN2 B;  3WA9 D;  5B1M D;  3W96 D;  3UTB C;  4WNN A;  4J8U C;  3AZE A;  3B6F D;  2G5I C;  1HQ3 D;  4AWL B;  2FJ7 A;  4YM6 D;  4J8V C;  1BFM A;  3V9R A;  1P3O B;  3MNN C;  3A6N B;  2DQN C;  3AZH C;  3WAA D;  1KX4 C;  4H9S A;  3UT9 C;  4Z66 D;  5BS7 A;  1ZLA C;  4XUJ A;  1KX5 A;  3AN2 D;  5E5A A;  3KFU G;  3MVD A;  4ZUX A;  5DNM A;  5CPJ D;  4Z2M G;  3MGQ C;  2UWX A;  2BG1 A;  5AY8 B;  5AVB B;  4WU8 B;  3B0C W;  3IP4 C;  2J8P A;  2VQR A;  3AFA B;  4H9R A;  4NFT A;  4R8P B;  5GT0 C;  1P3F A;  1P3B B;  3LJA B;  3W97 A;  3MGR B;  4J8X A;  5JA4 A;  3AZI A;  2FJ7 D;  4KGC B;  2ARO C;  4LD9 C;  3TU4 A;  1B67 A;  4JJN C;  3AN2 C;  2G5H C;  3AZL A;  4CAY B;  1U35 B;  1M1A B;  5B1L D;  4AWL C;  2PYO A;  1P3O C;  2HIO A;  5G49 B;  4KHA B;  4XUJ D;  3A6N C;  3MGS A;  5E5A D;  3AZG B;  3W99 A;  1P3B D;  4WU9 A;  3A1K A;  3WTP B;  5DNM D;  4WV4 B;  3MGR D;  1EQZ A;  5B31 B;  1P3G A;  5B24 B;  3X1V A;  3MGP B;  3VH6 T;  4H9N A;  1M1A D;  1P3F D;  3AZK B;  5AY8 C;  2CWE A;  3LZ1 A;  4J8X D;  5AVB C;  2Y2I A;  4WU8 C;  1BH9 B;  3AFA C;  3F6T A;  4R8P C;  3AZG D;  1H3O B;  3AZL D;  1P3B C;  1AOI A;  3LZ0 B;  3H0R C;  5CP6 B;  3LJA C;  3REJ B;  5B31 D;  4KGC C;  2PYO D;  5B0Y D;  4YS3 A;  4J8W A;  3AL0 C;  3AYW A;  5GSU B;  1M18 B;  4Z5T B;  1P3K B;  1U35 C;  3W99 D;  1P3M B;  5DNN B;  4KUD A;  1EQZ D;  2Y2J A;  2CV5 D;  5AV5 D;  4ZBJ B;  3AZG C;  5CPK A;  3NQU A;  3WTP C;  3LZ0 D;  4X23 B;  2Y2O A;  3KUY B;  5B31 C;  3VH5 W;  2F8N A;  5B24 C;  1Q9C A;  3MGP C;  5GT3 B;  2YFV A;  1M18 D;  1WWS A;  2IO5 B;  3C1C A;  3AZJ B;  1N1J A;  5GXQ B;  3AZK C;  3NQJ B;  4DRA A;  3B0B A;  3X1S C;  5B2I A;  4J8W D;  3P5J B;  4X23 D;  3VH6 W;  3LZ0 C;  5CP6 C;  3REJ C;  3REI A;  3AZM A;  4G92 C;  1P3L A;  1A7W A;  1TZY A;  4Z5T C;  5GSU C;  1P3K C;  3O62 A;  4UPK A;  3C1B B;  2NZD A;  1P3M C;  5DNN C;  2Y2N A;  5AV9 B;  3WA9 B;  2F8N D;  4NE6 A;  5B1M B;  3REH D;  3W96 B;  2BYK B;  5BO0 A;  5B31 G;  3B6F B;  1KX3 A;  1HQ3 B;  5B0Z C;  2XD1 A;  3AZH A;  4YM6 B;  1JFI B;  3KUY C;  3UT9 A;  5AV8 A;  4WZS B;  1ZLA A;  3REL D;  5GT3 C;  2IO5 C;  5AV6 D;  2ZM5 A;  2ZY5 A;  3AZJ C;  3MGQ A;  5B40 D;  5GXQ C;  3WAA B;  4Z66 B;  3KWQ A;  1P3I B;  5F99 A;  3AZM D;  1HTA A;  5CPI A;  3O62 D;  5GT0 A;  3UTA A;  5CPJ B;  5JRG C;  3EPL A;  3B6G A;  2NZD D;  3WKJ A;  4LD9 A;  4XZQ D;  1M19 A;  3C1B C;  1TAF B;  1S32 A;  3EPH A;  4WNN B;  3AZE B;  1KX3 D;  2FJ7 B;  1P3I D;  3V9R B;  5AV9 C;  1P3O A;  3WA9 C;  5AV8 D;  3W96 C;  5B1M C;  3A6N A;  3B6F C;  1HQ3 C;  5AVC D;  4NE5 A;  2Y2H A;  5B1L B;  4YM6 C;  5B33 A;  1KU5 A;  4XUJ B;  1KX5 B;  5F99 D;  5E5A B;  3AZE D;  5DNM B;  5CPI D;  3UTA D;  3WAA C;  4Z66 C;  5AY8 A;  3KXB A;  3AV2 A;  4QLC A;  5KDM A;  2RVQ D;  4WU8 A;  4M6B A;  1P3A A;  4R8P A;  5CPJ C;  4H9R B;  4E44 A;  1M19 D;  1S32 D;  1P3F B;  3REK A;  5BT1 D;  3LJA A;  4J8X B;  1KX5 D;  4UUZ B;  4E45 A;  3MVD D;  4ZUX D;  3AZL B;  3AZE C;  1U35 A;  2BYM A;  2FJ7 C;  5BNV A;  1P3P A;  3X1T A;  1PZR A;  5B33 D;  2PYO B;  5B0Y B;  4KHA A;  3H0L C;  5B32 A;  1Z2C B;  3WTP A;  3W99 B;  5B1L C;  4WU9 B;  5BT1 C;  3AZF A;  1T3U A;  3W97 D;  2NQB A;  1EQZ B;  3AZI D;  4H9S C;  5FUG A;  5BS7 C;  2CV5 B;  3KXB D;  4XUJ C;  3TU4 D;  3AV2 D;  5AV5 B;  4QLC D;  1P3G B;  3MGP A;  5E5A C;  1P3A D;  1F66 A; 
#chains in the Genus database with same CATH homology
 5DNM C;  4H9N B;  3MGR C;  2HIO D;  3MGS D;  3X1S A;  3AV1 A;  1M1A C;  1P3F C;  2L5A A;  4WU9 D;  1P34 A;  1AOI B;  5CP6 A;  2Y2G A;  4H9Q A;  5B2J A;  4J8X C;  2YFW A;  1P3G D;  1P3P D;  3X1T D;  3X1V D;  4J8W B;  1ID3 A;  5GSU A;  4Z5T A;  3AYW B;  1P3K A;  5BNX B;  3AZL C;  5B32 D;  1P3M A;  5DNN A;  3AZF D;  3LZ1 D;  2NQB D;  2PYO C;  5B0Y C;  3VH5 A;  1F66 D;  3LEL A;  3NQU B;  3W99 C;  4WU9 C;  1AOI D;  5B0Z A;  1EQZ C;  2CV5 C;  1P3G C;  4YS3 D;  5AV5 C;  2F8N B;  3AYW D;  5GT3 A;  3REH B;  3W98 A;  3C1C B;  3AZJ A;  4KUD D;  3VH6 A;  4H9P B;  3B0D B;  3X1U A;  5B2J D;  1M18 C;  3REL B;  3AZN A;  5AV6 B;  5B2I B;  3UTB A;  5CPK D;  4J8U A;  2LY8 A;  5B40 B;  1AOI C;  5JRG A;  4J8V A;  1BH8 B;  4CSR A;  3REI B;  3MNN A;  3AZM B;  4ZBJ C;  4J8W C;  1P3L B;  2F2A C;  3AYW C;  3C1C D;  4X23 C;  3O62 B;  3C1B A;  3R45 A;  2NZD B;  1KX4 A;  4XZQ B;  5B2I D;  2BYK A;  3W98 D;  1KX3 B;  4Z2M H;  3REI D;  1JFI A;  5C3I B;  3B0C T;  3X1U D;  1P3L D;  5AV8 B;  1ZLA B;  1TZY D;  3REH C;  2JSS A;  3UTB D;  5AVC B;  3H0M C;  2JE5 A;  2Y2M A;  3B0D C;  4J8V D;  4H9O B;  2ARO A;  3REL C;  3KWQ B;  4JJN A;  5AV6 C;  3MNN D;  3AN2 A;  5F99 B;  5B2I C;  5CPJ A;  5CPI B;  5B40 C;  5GT0 B;  3UTA B;  3AZH D;  3B6G B;  2ZY2 A;  3REI C;  3WKJ B;  1KX4 D;  3UT9 D;  3AZM C;  1ZLA D;  1P3L C;  4LD9 B;  3O62 C;  1M19 B;  1KX5 C;  1S32 B;  4G91 B;  3MGQ D;  2NZD C;  3KWQ D;  4XZQ C;  3MVD B;  4ZUX B;  4DQY B;  3EPK A;  5GT0 D;  3A1I A;  3WTP E;  1KX3 C;  3B6G D;  2F8N G;  3WKJ D;  5B1L A;  2XD5 A;  5B33 B;  5C3I C;  1P3I C;  5AVB A;  5AV8 C;  2ARO D;  3AFA A;  4LD9 D;  4JJN D;  5AVC C;  1P3B A;  3MGR A;  3W97 B;  2DF4 C;  5JA4 B;  3AZI B;  4KGC A;  3KWQ C;  1P3O D;  3KXB B;  3TU4 B;  3AV2 B;  5F99 C;  5KDM B;  4QLC B;  1P3A B;  3A6N D;  4CAY A;  1M1A A;  5CPI C;  3UTA C;  3REK B;  3B6G C;  3WKJ C;  4HGA B;  1R4V A;  2HIO B;  5G49 A;  2RVQ C;  4UUZ A;  3MGS B;  3AZG A;  1M19 C;  1S32 C;  4G91 C;  4NE3 A;  2BYM B;  3VH5 T;  5B31 A;  1W2E A;  5AY8 D;  5BNV B;  3X1T B;  1P3P B;  5B24 A;  2Y2Q A;  2ZY4 A;  5AVB D;  5B0Y A;  3X1V B;  3MVD C;  4ZUX C;  4WU8 D;  3AFA D;  4R8P D;  5B32 B;  3REK D;  3LJA D;  3AZK A;  3AZF B;  5B33 C;  3LZ1 B;  2NQB B;  1BH9 A;  4KGC D;  2CV5 A;  5FUG B;  5AV5 A;  1F66 B;  1H3O A;  3KSY A;  3LZ0 A;  1U35 D;  3W97 C;  3REJ A;  4EO5 B;  3AZI C;  3KXB C;  3TU4 C;  3AV2 C;  4YS3 B;  4QLC C;  1M18 A;  1P3A C;  3X1S B;  3AV1 B;  2Y2P A;  3WTP D;  3REK C;  1P34 B;  4KUD B;  4HGA C;  2HIO C;  4H9Q B;  5B2J B;  2YFW B;  3EPJ A;  3MGS C;  5B24 D;  3MGP D;  4G92 B;  5CPK B;  1ID3 B;  5BNX A;  4X23 A;  3KUY A;  3AZK D;  1P3P C;  3X1T C;  3X1V C;  2YFV B;  3X1S D;  3AV1 D;  5B32 C;  3LEL B;  1P34 D;  1N1J B;  5GXQ A;  2Y2K A;  3NQJ A;  5CP6 D;  5B0Z B;  3REJ D;  2JCH A;  4DRB A;  3LZ1 C;  3AZF C;  2NQB C;  2RIQ A;  1F66 C;  1ID3 D;  5GSU D;  3REH A;  4Z5T D;  1P3K D;  3W98 B;  4EO5 C;  1P3M D;  5DNN D;  4H9P A;  1B6W A;  4YS3 C;  4WJ3 C;  3X1U B;  2HUE B;  2W8S A;  1TZY B;  3REL A;  2Y2L A;  5AV6 A;  3LEL D;  3AZN B;  3AV1 C;  1WWI A;  3UTB B;  4J8U B;  2ZY3 A;  2F8N K;  5B40 A;  5B0Z D;  1P34 C;  4KUD C;  5JRG B;  1BH8 A;  5B2J C;  1ULY A;  3KUY D;  5AV9 A;  4CSR B;  4J8V B;  3WA9 A;  3MNN B;  2FFF B;  3W96 A;  5B1M A;  5GT3 D;  5CPK C;  1ID3 C;  5BO0 B;  3B6F A;  1HQ3 A;  5CHL B;  3AZJ D;  3EG5 B;  3R45 B;  4YM6 A;  3AZH B;  1F1E A;  5GXQ D;  1KX4 B;  5B32 G;  3UT9 B;  4XZQ A;  3AZN D;  3C1C C;  3LEL C;  4J8U D;  3MGQ B;  3WAA A;  5JRG D;  4Z66 A;  1P3I A;  2F8N H;  3W98 C;  3C1B D;  5AVC A;  3FDD A;  4H9O A;  3X1U C;  2HUE C;  2ARO B;  1TZY C;  5AV9 D;  4JJN B;  3AZN C;  1TAF A;  3AN2 B;  3WA9 D;  5B1M D;  3W96 D;  3UTB C;  4WNN A;  4J8U C;  3AZE A;  3B6F D;  2G5I C;  1HQ3 D;  4AWL B;  2FJ7 A;  4YM6 D;  4J8V C;  1BFM A;  3V9R A;  1P3O B;  3MNN C;  3A6N B;  2DQN C;  3AZH C;  3WAA D;  1KX4 C;  4H9S A;  3UT9 C;  4Z66 D;  5BS7 A;  1ZLA C;  4XUJ A;  1KX5 A;  3AN2 D;  5E5A A;  3KFU G;  3MVD A;  4ZUX A;  5DNM A;  5CPJ D;  4Z2M G;  3MGQ C;  2UWX A;  2BG1 A;  5AY8 B;  5AVB B;  4WU8 B;  3B0C W;  3IP4 C;  2J8P A;  2VQR A;  3AFA B;  4H9R A;  4NFT A;  4R8P B;  5GT0 C;  1P3F A;  1P3B B;  3LJA B;  3W97 A;  3MGR B;  4J8X A;  5JA4 A;  3AZI A;  2FJ7 D;  4KGC B;  2ARO C;  4LD9 C;  3TU4 A;  1B67 A;  4JJN C;  3AN2 C;  2G5H C;  3AZL A;  4CAY B;  1U35 B;  1M1A B;  5B1L D;  4AWL C;  2PYO A;  1P3O C;  2HIO A;  5G49 B;  4KHA B;  4XUJ D;  3A6N C;  3MGS A;  5E5A D;  3AZG B;  3W99 A;  1P3B D;  4WU9 A;  3A1K A;  3WTP B;  5DNM D;  4WV4 B;  3MGR D;  1EQZ A;  5B31 B;  1P3G A;  5B24 B;  3X1V A;  3MGP B;  3VH6 T;  4H9N A;  1M1A D;  1P3F D;  3AZK B;  5AY8 C;  2CWE A;  3LZ1 A;  4J8X D;  5AVB C;  2Y2I A;  4WU8 C;  1BH9 B;  3AFA C;  3F6T A;  4R8P C;  3AZG D;  1H3O B;  3AZL D;  1P3B C;  1AOI A;  3LZ0 B;  3H0R C;  5CP6 B;  3LJA C;  3REJ B;  5B31 D;  4KGC C;  2PYO D;  5B0Y D;  4YS3 A;  4J8W A;  3AL0 C;  3AYW A;  5GSU B;  1M18 B;  4Z5T B;  1P3K B;  1U35 C;  3W99 D;  1P3M B;  5DNN B;  4KUD A;  1EQZ D;  2Y2J A;  2CV5 D;  5AV5 D;  4ZBJ B;  3AZG C;  5CPK A;  3NQU A;  3WTP C;  3LZ0 D;  4X23 B;  2Y2O A;  3KUY B;  5B31 C;  3VH5 W;  2F8N A;  5B24 C;  1Q9C A;  3MGP C;  5GT3 B;  2YFV A;  1M18 D;  1WWS A;  2IO5 B;  3C1C A;  3AZJ B;  1N1J A;  5GXQ B;  3AZK C;  3NQJ B;  4DRA A;  3B0B A;  3X1S C;  5B2I A;  4J8W D;  3P5J B;  4X23 D;  3VH6 W;  3LZ0 C;  5CP6 C;  3REJ C;  3REI A;  3AZM A;  4G92 C;  1P3L A;  1A7W A;  1TZY A;  4Z5T C;  5GSU C;  1P3K C;  3O62 A;  4UPK A;  3C1B B;  2NZD A;  1P3M C;  5DNN C;  2Y2N A;  5AV9 B;  3WA9 B;  2F8N D;  4NE6 A;  5B1M B;  3REH D;  3W96 B;  2BYK B;  5BO0 A;  5B31 G;  3B6F B;  1KX3 A;  1HQ3 B;  5B0Z C;  2XD1 A;  3AZH A;  4YM6 B;  1JFI B;  3KUY C;  3UT9 A;  5AV8 A;  4WZS B;  1ZLA A;  3REL D;  5GT3 C;  2IO5 C;  5AV6 D;  2ZM5 A;  2ZY5 A;  3AZJ C;  3MGQ A;  5B40 D;  5GXQ C;  3WAA B;  4Z66 B;  3KWQ A;  1P3I B;  5F99 A;  3AZM D;  1HTA A;  5CPI A;  3O62 D;  5GT0 A;  3UTA A;  5CPJ B;  5JRG C;  3EPL A;  3B6G A;  2NZD D;  3WKJ A;  4LD9 A;  4XZQ D;  1M19 A;  3C1B C;  1TAF B;  1S32 A;  3EPH A;  4WNN B;  3AZE B;  1KX3 D;  2FJ7 B;  1P3I D;  3V9R B;  5AV9 C;  1P3O A;  3WA9 C;  5AV8 D;  3W96 C;  5B1M C;  3A6N A;  3B6F C;  1HQ3 C;  5AVC D;  4NE5 A;  2Y2H A;  5B1L B;  4YM6 C;  5B33 A;  1KU5 A;  4XUJ B;  1KX5 B;  5F99 D;  5E5A B;  3AZE D;  5DNM B;  5CPI D;  3UTA D;  3WAA C;  4Z66 C;  5AY8 A;  3KXB A;  3AV2 A;  4QLC A;  5KDM A;  2RVQ D;  4WU8 A;  4M6B A;  1P3A A;  4R8P A;  5CPJ C;  4H9R B;  4E44 A;  1M19 D;  1S32 D;  1P3F B;  3REK A;  5BT1 D;  3LJA A;  4J8X B;  1KX5 D;  4UUZ B;  4E45 A;  3MVD D;  4ZUX D;  3AZL B;  3AZE C;  1U35 A;  2BYM A;  2FJ7 C;  5BNV A;  1P3P A;  3X1T A;  1PZR A;  5B33 D;  2PYO B;  5B0Y B;  4KHA A;  3H0L C;  5B32 A;  1Z2C B;  3WTP A;  3W99 B;  5B1L C;  4WU9 B;  5BT1 C;  3AZF A;  1T3U A;  3W97 D;  2NQB A;  1EQZ B;  3AZI D;  4H9S C;  5FUG A;  5BS7 C;  2CV5 B;  3KXB D;  4XUJ C;  3TU4 D;  3AV2 D;  5AV5 B;  4QLC D;  1P3G B;  3MGP A;  5E5A C;  1P3A D;  1F66 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...