1TZYD

Crystal structure of the core-histone octamer to 1.90 angstrom resolution
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
83
structure length
83
Chain Sequence
KVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H2A-IV
publication title High-resolution structure of the native histone octamer.
pubmed doi rcsb
molecule tags Dna binding protein
total genus 23
structure length 83
sequence length 83
chains with identical sequence H
ec nomenclature
pdb deposition date 2004-07-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1tzyD00
5AVCD 3REJA 4YS3C 2F8ND 5AVBA 5B31A 4YS3D 3AZHC 3MGSA 3REKB 3AZHD 5C3IB 1F66A 1U35C 5JA4A 1KX5B 1BH9A 4M6BA 5B0ZC 1U35D 3W99B 4J8WB 3MGPB 3AZEC 1P3AC 2FJ7A 3AZED 5B31G 3MNNB 1P3AD 3V9RA 3WA9B 1B6WA 4H9NB 1BH8B 2IO5B 3C1CA 1P3OA 2HUEB 5B32B 3AZJA 5B24A 1P3FB 1WWIA 5BS7A 5AV8A 4YM6B 5AY8A 2NQBA 3NQJA 3B6FC 3AZMC 3W96C 5GT3C 3B6FD 1P3LB 3AZMD 3W96D 5GT3D 3AV1C 5GSUB 2CV5B 5AV5C 5CPJA 1TZYA 4XZQC 3AZGB 3REHC 3AZLA 5AVCA 5B40B 3REHD 3AZNC 2F8NA 4YS3A 3AZND 2JSSA 1H3OA 5DNMA 5B0ZA 3MGRC 4H9PA 5B2JB 3MGRD 3B6GB 3AZEA 2F8NG 1P3AA 5E5AA 4KUDC 2BYKB 3RELD 4KUDD 4R8PB 4WU8B 4KGCC 3NQUB 3B0DC 3KWQB 4KGCD 1ZLAB 4J8XB 1KX3C 2NZDB 4J8VA 4ZBJC 1KX3D 1EQZC 5G49A 1P3IB 1P3KC 1EQZD 5B1MA 4CAYB 3AV2C 1P3KD 3AV2D 3B6FA 3AZMA 3W97B 3W96A 5GT3A 1P3MC 3AZKC 1M1AB 1P3MD 3KUYC 3AZKD 3AV1A 3KUYD 4EO5B 5AV5A 4XZQA 3REIB 3RELB 3REHA 3AN2C 5DNNB 3AN2D 3W98B 3LELB 3VH5T 3KXBA 5B0YC 3LZ0C 3LZ0D 3TU4C 3WKJB 4KUDA 3TU4D 4X23C 3UTAC 5AV9B 5BNXA 4X23D 2L5AA 2PYOB 1R4VA 4UUZA 1TAFB 3LJAA 1KX3A 5CP6C 4JJNC 5CP6D 4JJND 1EQZA 3AFAB 3X1SC 3AZIC 1N1JB 1P3KA 3AV2A 3X1SD 4Z66B 3AZID 4LD9C 4KHAB 1S32C 4LD9D 5B1LC 3B0CW 3AZJC 1P3MA 3AZKA 3AYWC 1S32D 5B1LD 3REJB 3LZ1C 3AZJD 3KUYA 3AYWD 3LZ1D 4Z5TA 5AV8C 5B31B 5AVBB 1JFIA 3WAAA 3MGSB 5AV8D 5JRGC 3X1VC 1F66B 5JRGD 4G92C 4HGAB 3AN2A 1BH9B 3X1VD 4AWLC 3O62C 3R45A 5CPIC 3O62D 5CPJC 5CPID 5F99C 2FJ7B 4QLCC 5CPJD 5F99D 3V9RB 4QLCD 1KU5A 5CHLB 3AZLD 5B0YA 3LZ0A 5B33C 3C1CB 1P3OB 5B33D 1HTAA 3TU4A 5DNMC 5B24B 4X23A 3UTAA 5DNMD 4H9OA 1P3BC 5B0ZD 5GT0A 5AY8B 1P3BD 2NQBB 3NQJB 5E5AC 1BFMA 5E5AD 5CP6A 2HIOC 4JJNA 4WZSB 2HIOD 3X1SA 3AZIA 1TZYB 1P3PA 3B0BA 4G91C 5KDMA 4LD9A 3AZLB 5AVCB 1S32A 5B1LA 3MGQC 4J8VC 3AYWA 3UTBC 3LZ1A 3MGQD 4J8VD 4YS3B 2AROC 2F8NB 4J8UA 3UTBD 3AZFA 2AROD 5B1MC 1H3OB 3AZHB 1M18C 5B1MD 1M18D 5JRGA 3X1VA 1U35B 5B0ZB 3X1UC 5AV6A 4DRAA 3O62A 3X1UD 5CPIA 3AZEB 5CPKC 3AV1D 1P3AB 5F99A 5AV5D 5B2IC 4QLCA 5CPKD 1P3GC 3VH6A 5B2ID 4XZQD 1P3GD 5B33A 3X1TC 3X1TD 5BNVA 4ZUXC 3KXBC 5G49B 1P3BA 3KXBD 3MNNA 3A6NC 3B6FB 3A6ND 3AZMB 3W96B 5GT3B 3WA9A 1M19C 1HQ3C 2HIOA 3C1BC 3AV1B 1M19D 1AOIA 1HQ3D 3C1BD 5AV5B 3UT9C 4XZQB 2CWEA 5B32A 3UT9D 3REHB 3LJAC 3MGQA 3AZNB 3LJAD 3UTBA 2AROA 4XUJC 1M18A 4XUJD 2YFVB 4H9QB 4CSRB 4Z2MH 5B32G 5GSUA 3X1UA 3MGRB 1ID3C 1ID3D 4Z5TC 3AZGA 5CPKA 3WAAC 1KX4C 4Z5TD 1P3GA 5B2IA 1KX4D 3WAAD 4KUDB 4KGCB 3B0DB 5BNXB 3X1TA 5GXQC 1P34C 1Q9CA 4UUZB 5GXQD 1P34D 1KX3B 1A7WA 4ZBJB 4ZUXA 1EQZB 3WTPC 1P3KB 3AV2B 5B0YD 3A6NA 3WTPD 4R8PA 1F1EA 1P3MB 3KWQA 3AZKB 1M19A 1HQ3A 3KUYB 3C1BA 3UTAD 4H9RA 1JFIB 5GT0C 3B0CT 3UT9A 5GT0D 4NE5A 3AN2B 4WU9C 3R45B 4NFTA 4WU9D 4XUJA 4WNNA 1P3PC 1P3PD 2YFWA 3MVDC 3MVDD 1ID3A 5B0YB 3LZ0B 4J8UC 3AZFC 4J8UD 3AZFD 1KX4A 3TU4B 3KSYA 5DNNA 5JA4B 4X23B 3UTAB 4H9OB 5AV6C 5AV6D 3VH6W 5GXQA 1P34A 5CP6B 4JJNB 3X1SB 3AZIB 3WTPA 3REKC 5C3IC 3WKJA 4LD9B 5FUGA 3REKD 3WTPE 1S32B 5B1LB 5BO0A 1KX5C 3AZJB 3AYWB 3W99C 1KX5D 3LZ1B 3W99D 3MGPC 4J8WC 5AV8B 4J8WD 3MGPD 3MNNC 4E45A 3MNND 5JRGB 3X1VB 3WA9C 4G92B 3WA9D 4AWLB 4WU9A 1AOIC 3O62B 2IO5C 1N1JA 5CPIB 4NE3A 1AOID 5CPJB 5F99B 2HUEC 2BYMA 4QLCB 5B32C 5B32D 3MVDA 1P3FC 1P3FD 4YM6C 5B33B 4YM6D 1P3LC 5BT1C 5DNMB 5BNVB 1P3LD 5BT1D 5GSUC 2CV5C 4H9PB 3VH5A 5GSUD 2CV5D 1P3BB 3AZGC 5E5AB 3AZGD 5B40C 5B40D 2HIOB 1AOIB 3REKA 4G91B 1KX5A 3MGQB 4J8VB 3W99A 3UTBB 5B2JC 3B6GC 2AROB 4J8WA 3MGPA 5B2JD 3B6GD 4ZUXD 2F8NK 5B1MB 1M18B 4WV4B 4R8PC 4WU8C 3KWQC 1B67A 4H9NA 4R8PD 2RVQC 3X1UB 4WU8D 3KWQD 1BH8A 2RVQD 1ZLAC 5CPKB 1ZLAD 1P3GB 5B2IB 4J8XC 2NZDC 4J8XD 2NZDD 1P3FA 1P3IC 3AZHA 4YM6A 3X1TB 4Z2MG 1P3ID 4DRBA 3W97C 1U35A 1M1AC 1P3LA 4NE6A 3W97D 1M1AD 4ZUXB 2CV5A 4EO5C 3KXBB 3REIC 3RELC 3A6NB 3REID 2F8NH 5DNNC 5B40A 1M19B 1HQ3B 5DNND 3C1BB 4H9SC 1ULYA 3W98C 4H9RB 3W98D 3UT9B 3LELC 3LELD 3LJAB 5B2JA 2LY8A 3B6GA 4XUJB 4WNNB 3WKJC 2BYKA 2YFWB 3WKJD 4WU8A 3NQUA 5AV9C 1ID3B 5AV9D 2PYOC 1ZLAA 4Z5TB 2PYOD 1KX4B 3WAAB 4J8XA 2NZDA 3AZNA 3AFAC 1P3IA 4CAYA 3AFAD 4Z66C 2YFVA 4H9QA 4CSRA 5GXQB 4Z66D 1P34B 3W97A 1M1AA 3REJC 3MGRA 3REJD 1WWSA 5AVBC 5B31C 3VH6T 3WTPB 5AVBD 5B31D 3MGSC 3REIA 3RELA 3MGSD 5FUGB 1F66C 5BO0B 4HGAC 1F66D 4KGCA 4H9SA 3VH5W 3W98A 2FJ7C 5GT0B 2FJ7D 3LELA 4WU9B 3C1CC 1P3OC 4E44A 3C1CD 1P3OD 2BYMB 1P3PB 5KDMB 5B24C 3MVDB 5AV9A 5BS7C 5B24D 2PYOA 4J8UB 3AZFB 5AY8C 2NQBC 5AY8D 2NQBD 1TAFA 5AV6B 3AFAA 1TZYC 4Z66A 1TZYD 4KHAA 3AZLC 5AVCC
chains in the Genus database with same CATH superfamily
4WJ3C 5AVCD 3REJA 4YS3C 2F8ND 5AVBA 5B31A 4YS3D 3AZHC 3MGSA 3REKB 3AZHD 5C3IB 1F66A 1U35C 5JA4A 1KX5B 1BH9A 4M6BA 5B0ZC 1U35D 3W99B 4J8WB 3MGPB 3AZEC 1P3AC 2FJ7A 3AZED 5B31G 3MNNB 1P3AD 2F2AC 3V9RA 3WA9B 1B6WA 4H9NB 1BH8B 2IO5B 3C1CA 1P3OA 2HUEB 2ZY2A 5B32B 3F6TA 3AZJA 5B24A 1P3FB 1WWIA 5BS7A 5AV8A 4YM6B 2Y2PA 5AY8A 2NQBA 3NQJA 3B6FC 3AZMC 3W96C 5GT3C 3B6FD 1P3LB 3AZMD 3W96D 5GT3D 3AV1C 5GSUB 2CV5B 5AV5C 2DF4C 5CPJA 1TZYA 4XZQC 3AZGB 2ZY4A 2Y2IA 3REHC 3AZLA 5AVCA 5B40B 3REHD 3AZNC 2F8NA 4YS3A 3AZND 2JSSA 1H3OA 5DNMA 5B0ZA 3MGRC 4H9PA 5B2JB 3MGRD 3B6GB 3AZEA 2F8NG 1P3AA 5E5AA 4KUDC 2BYKB 3RELD 4KUDD 4R8PB 4WU8B 4KGCC 3NQUB 3B0DC 3KWQB 4KGCD 1ZLAB 4J8XB 1KX3C 2NZDB 4J8VA 4ZBJC 1KX3D 1EQZC 5G49A 1P3IB 1P3KC 1EQZD 5B1MA 4CAYB 3AV2C 1P3KD 3AV2D 3B6FA 3AZMA 3W97B 3W96A 5GT3A 1P3MC 3AZKC 1M1AB 2BG1A 1P3MD 3KUYC 3P5JB 3AZKD 3AV1A 3KUYD 4EO5B 5AV5A 4XZQA 3REIB 3RELB 2ZY3A 3REHA 3AN2C 5DNNB 3EPJA 3AN2D 2FFFB 3W98B 3LELB 3VH5T 3KXBA 5B0YC 3LZ0C 3LZ0D 3TU4C 3WKJB 4KUDA 3TU4D 4X23C 3UTAC 5AV9B 5BNXA 4X23D 2L5AA 2PYOB 2DQNC 1R4VA 4UUZA 1TAFB 3LJAA 1KX3A 5CP6C 4JJNC 5CP6D 4JJND 1EQZA 3AFAB 3X1SC 3AZIC 1N1JB 1P3KA 3AV2A 3X1SD 4Z66B 3AZID 4LD9C 4KHAB 1S32C 4LD9D 5B1LC 3B0CW 3AZJC 1P3MA 3AZKA 3AYWC 1S32D 5B1LD 3REJB 3LZ1C 3AZJD 3KUYA 3AYWD 3LZ1D 4Z5TA 5AV8C 5B31B 5AVBB 1JFIA 3WAAA 3MGSB 5AV8D 5JRGC 3X1VC 1F66B 5JRGD 4G92C 4HGAB 3AN2A 1BH9B 3X1VD 4AWLC 3O62C 3R45A 5CPIC 3O62D 5CPJC 5CPID 5F99C 2FJ7B 4QLCC 5CPJD 5F99D 3V9RB 4QLCD 1KU5A 5CHLB 3AZLD 5B0YA 3LZ0A 5B33C 3C1CB 1P3OB 5B33D 1HTAA 3TU4A 2Y2JA 3EPKA 5DNMC 5B24B 4X23A 3UTAA 5DNMD 4H9OA 1P3BC 5B0ZD 5GT0A 5AY8B 1P3BD 2NQBB 3NQJB 5E5AC 1BFMA 2Y2MA 5E5AD 5CP6A 2HIOC 4JJNA 4WZSB 2HIOD 3X1SA 3AZIA 1TZYB 1P3PA 3B0BA 4G91C 5KDMA 4LD9A 3AZLB 5AVCB 1S32A 5B1LA 3MGQC 4J8VC 3AYWA 3UTBC 3LZ1A 3MGQD 4J8VD 4YS3B 2AROC 2F8NB 4J8UA 3UTBD 3AZFA 2AROD 5B1MC 1H3OB 3AZHB 1M18C 5B1MD 1M18D 5JRGA 3X1VA 1U35B 5B0ZB 3X1UC 2Y2OA 5AV6A 4DRAA 3O62A 3X1UD 5CPIA 3AZEB 5CPKC 3AV1D 1P3AB 5F99A 5AV5D 5B2IC 4QLCA 2Y2GA 5CPKD 1P3GC 3VH6A 5B2ID 4XZQD 1P3GD 5B33A 3X1TC 3X1TD 5BNVA 4ZUXC 3KXBC 5G49B 1P3BA 3KXBD 3MNNA 3A6NC 3IP4C 3B6FB 3A6ND 3AZMB 3W96B 5GT3B 3WA9A 1M19C 1HQ3C 2HIOA 3C1BC 3AV1B 1M19D 1AOIA 1HQ3D 3C1BD 5AV5B 2Y2LA 3UT9C 4XZQB 2CWEA 2VQRA 5B32A 3UT9D 3REHB 4DQYB 3LJAC 3MGQA 2UWXA 3AZNB 3LJAD 3UTBA 2AROA 4XUJC 1M18A 4XUJD 3A1KA 2Y2QA 2YFVB 4H9QB 4CSRB 4Z2MH 5B32G 5GSUA 3X1UA 3MGRB 1ID3C 2RIQA 1ID3D 4Z5TC 3AZGA 5CPKA 3WAAC 1KX4C 4Z5TD 1P3GA 5B2IA 1KX4D 1Z2CB 3WAAD 4KUDB 4KGCB 3B0DB 5BNXB 3X1TA 2XD5A 5GXQC 1P34C 1Q9CA 4UUZB 2J8PA 5GXQD 1P34D 1KX3B 3EPLA 1A7WA 4ZBJB 4ZUXA 1EQZB 3WTPC 1P3KB 3AV2B 5B0YD 3A6NA 3WTPD 4R8PA 1F1EA 1P3MB 3KWQA 3AZKB 1M19A 1HQ3A 3KUYB 3C1BA 3UTAD 4H9RA 1JFIB 5GT0C 3B0CT 3UT9A 5GT0D 4NE5A 3AN2B 4WU9C 3R45B 4NFTA 4WU9D 4XUJA 4WNNA 1P3PC 1P3PD 2YFWA 3MVDC 3MVDD 1ID3A 5B0YB 3EG5B 3LZ0B 4J8UC 3AZFC 4J8UD 3AZFD 1KX4A 3TU4B 3KSYA 2Y2NA 1T3UA 5DNNA 5JA4B 4X23B 3A1IA 3UTAB 3H0RC 4H9OB 5AV6C 5AV6D 3VH6W 5GXQA 1P34A 2W8SA 5CP6B 4JJNB 3X1SB 3AL0C 3AZIB 3WTPA 3REKC 5C3IC 3WKJA 4LD9B 5FUGA 3REKD 3WTPE 1S32B 5B1LB 5BO0A 1KX5C 3AZJB 3AYWB 3W99C 1KX5D 3LZ1B 3W99D 3MGPC 4J8WC 5AV8B 4J8WD 3MGPD 3MNNC 4E45A 3MNND 5JRGB 3X1VB 3WA9C 4G92B 3WA9D 4AWLB 4WU9A 1AOIC 3O62B 2IO5C 1N1JA 3H0LC 5CPIB 4NE3A 1AOID 5CPJB 5F99B 2HUEC 2BYMA 4QLCB 5B32C 5B32D 3MVDA 1P3FC 1P3FD 4YM6C 5B33B 4YM6D 1P3LC 5BT1C 5DNMB 2G5IC 5BNVB 1P3LD 5BT1D 5GSUC 2CV5C 4H9PB 3VH5A 5GSUD 2CV5D 1P3BB 3AZGC 5E5AB 3AZGD 5B40C 3FDDA 5B40D 2HIOB 1AOIB 3EPHA 3REKA 4G91B 1KX5A 3MGQB 4J8VB 3W99A 1W2EA 3UTBB 1PZRA 5B2JC 3B6GC 2AROB 4J8WA 3MGPA 5B2JD 3B6GD 4ZUXD 2F8NK 5B1MB 1M18B 2Y2KA 4WV4B 4R8PC 4WU8C 3KWQC 1B67A 4H9NA 4R8PD 2RVQC 3X1UB 4WU8D 3KWQD 1BH8A 2RVQD 1ZLAC 5CPKB 1ZLAD 1P3GB 5B2IB 4J8XC 2NZDC 4J8XD 3KFUG 2NZDD 1P3FA 2XD1A 1P3IC 3AZHA 4YM6A 3X1TB 4Z2MG 1P3ID 4DRBA 3W97C 1U35A 1M1AC 1P3LA 4NE6A 3W97D 1M1AD 4ZUXB 2CV5A 4EO5C 3KXBB 2G5HC 3REIC 3RELC 3A6NB 3REID 2F8NH 4UPKA 5DNNC 5B40A 1M19B 1HQ3B 5DNND 3C1BB 4H9SC 1ULYA 3W98C 4H9RB 3W98D 3UT9B 3LELC 3LELD 3LJAB 5B2JA 2LY8A 3B6GA 4XUJB 4WNNB 2ZY5A 3WKJC 2JCHA 2BYKA 2YFWB 3WKJD 4WU8A 3NQUA 5AV9C 1ID3B 5AV9D 2ZM5A 2PYOC 1ZLAA 4Z5TB 2PYOD 1KX4B 3WAAB 4J8XA 2NZDA 3AZNA 3AFAC 1P3IA 4CAYA 3AFAD 4Z66C 2YFVA 4H9QA 4CSRA 5GXQB 4Z66D 1P34B 3W97A 1M1AA 3REJC 3H0MC 3MGRA 3REJD 1WWSA 5AVBC 5B31C 2Y2HA 3VH6T 3WTPB 5AVBD 5B31D 3MGSC 3REIA 3RELA 3MGSD 5FUGB 1F66C 5BO0B 4HGAC 1F66D 4KGCA 4H9SA 3VH5W 3W98A 2FJ7C 5GT0B 2FJ7D 3LELA 4WU9B 3C1CC 1P3OC 4E44A 3C1CD 1P3OD 2BYMB 1P3PB 2JE5A 5KDMB 5B24C 3MVDB 5AV9A 5BS7C 5B24D 2PYOA 4J8UB 3AZFB 5AY8C 2NQBC 5AY8D 2NQBD 1TAFA 5AV6B 3AFAA 1TZYC 4Z66A 1TZYD 4KHAA 3AZLC 5AVCC
chains in the Genus database with same CATH topology
4WJ3C 5AVCD 3REJA 4YS3C 2F8ND 5AVBA 5B31A 4YS3D 3AZHC 3MGSA 3REKB 3AZHD 5C3IB 1F66A 1U35C 5JA4A 1KX5B 1BH9A 4M6BA 5B0ZC 1U35D 3W99B 4J8WB 3MGPB 3AZEC 1P3AC 2FJ7A 3AZED 5B31G 3MNNB 1P3AD 2F2AC 3V9RA 3WA9B 1B6WA 4H9NB 1BH8B 2IO5B 3C1CA 1P3OA 2HUEB 2ZY2A 5B32B 3F6TA 3AZJA 5B24A 1P3FB 1WWIA 5BS7A 5AV8A 4YM6B 2Y2PA 5AY8A 2NQBA 3NQJA 3B6FC 3AZMC 3W96C 5GT3C 3B6FD 1P3LB 3AZMD 3W96D 5GT3D 3AV1C 5GSUB 2CV5B 5AV5C 2DF4C 5CPJA 1TZYA 4XZQC 3AZGB 2ZY4A 2Y2IA 3REHC 3AZLA 5AVCA 5B40B 3REHD 3AZNC 2F8NA 4YS3A 3AZND 2JSSA 1H3OA 5DNMA 5B0ZA 3MGRC 4H9PA 5B2JB 3MGRD 3B6GB 3AZEA 2F8NG 1P3AA 5E5AA 4KUDC 2BYKB 3RELD 4KUDD 4R8PB 4WU8B 4KGCC 3NQUB 3B0DC 3KWQB 4KGCD 1ZLAB 4J8XB 1KX3C 2NZDB 4J8VA 4ZBJC 1KX3D 1EQZC 5G49A 1P3IB 1P3KC 1EQZD 5B1MA 4CAYB 3AV2C 1P3KD 3AV2D 3B6FA 3AZMA 3W97B 3W96A 5GT3A 1P3MC 3AZKC 1M1AB 2BG1A 1P3MD 3KUYC 3P5JB 3AZKD 3AV1A 3KUYD 4EO5B 5AV5A 4XZQA 3REIB 3RELB 2ZY3A 3REHA 3AN2C 5DNNB 3EPJA 3AN2D 2FFFB 3W98B 3LELB 3VH5T 3KXBA 5B0YC 3LZ0C 3LZ0D 3TU4C 3WKJB 4KUDA 3TU4D 4X23C 3UTAC 5AV9B 5BNXA 4X23D 2L5AA 2PYOB 2DQNC 1R4VA 4UUZA 1TAFB 3LJAA 1KX3A 5CP6C 4JJNC 5CP6D 4JJND 1EQZA 3AFAB 3X1SC 3AZIC 1N1JB 1P3KA 3AV2A 3X1SD 4Z66B 3AZID 4LD9C 4KHAB 1S32C 4LD9D 5B1LC 3B0CW 3AZJC 1P3MA 3AZKA 3AYWC 1S32D 5B1LD 3REJB 3LZ1C 3AZJD 3KUYA 3AYWD 3LZ1D 4Z5TA 5AV8C 5B31B 5AVBB 1JFIA 3WAAA 3MGSB 5AV8D 5JRGC 3X1VC 1F66B 5JRGD 4G92C 4HGAB 3AN2A 1BH9B 3X1VD 4AWLC 3O62C 3R45A 5CPIC 3O62D 5CPJC 5CPID 5F99C 2FJ7B 4QLCC 5CPJD 5F99D 3V9RB 4QLCD 1KU5A 5CHLB 3AZLD 5B0YA 3LZ0A 5B33C 3C1CB 1P3OB 5B33D 1HTAA 3TU4A 2Y2JA 3EPKA 5DNMC 5B24B 4X23A 3UTAA 5DNMD 4H9OA 1P3BC 5B0ZD 5GT0A 5AY8B 1P3BD 2NQBB 3NQJB 5E5AC 1BFMA 2Y2MA 5E5AD 5CP6A 2HIOC 4JJNA 4WZSB 2HIOD 3X1SA 3AZIA 1TZYB 1P3PA 3B0BA 4G91C 5KDMA 4LD9A 3AZLB 5AVCB 1S32A 5B1LA 3MGQC 4J8VC 3AYWA 3UTBC 3LZ1A 3MGQD 4J8VD 4YS3B 2AROC 2F8NB 4J8UA 3UTBD 3AZFA 2AROD 5B1MC 1H3OB 3AZHB 1M18C 5B1MD 1M18D 5JRGA 3X1VA 1U35B 5B0ZB 3X1UC 2Y2OA 5AV6A 4DRAA 3O62A 3X1UD 5CPIA 3AZEB 5CPKC 3AV1D 1P3AB 5F99A 5AV5D 5B2IC 4QLCA 2Y2GA 5CPKD 1P3GC 3VH6A 5B2ID 4XZQD 1P3GD 5B33A 3X1TC 3X1TD 5BNVA 4ZUXC 3KXBC 5G49B 1P3BA 3KXBD 3MNNA 3A6NC 3IP4C 3B6FB 3A6ND 3AZMB 3W96B 5GT3B 3WA9A 1M19C 1HQ3C 2HIOA 3C1BC 3AV1B 1M19D 1AOIA 1HQ3D 3C1BD 5AV5B 2Y2LA 3UT9C 4XZQB 2CWEA 2VQRA 5B32A 3UT9D 3REHB 4DQYB 3LJAC 3MGQA 2UWXA 3AZNB 3LJAD 3UTBA 2AROA 4XUJC 1M18A 4XUJD 3A1KA 2Y2QA 2YFVB 4H9QB 4CSRB 4Z2MH 5B32G 5GSUA 3X1UA 3MGRB 1ID3C 2RIQA 1ID3D 4Z5TC 3AZGA 5CPKA 3WAAC 1KX4C 4Z5TD 1P3GA 5B2IA 1KX4D 1Z2CB 3WAAD 4KUDB 4KGCB 3B0DB 5BNXB 3X1TA 2XD5A 5GXQC 1P34C 1Q9CA 4UUZB 2J8PA 5GXQD 1P34D 1KX3B 3EPLA 1A7WA 4ZBJB 4ZUXA 1EQZB 3WTPC 1P3KB 3AV2B 5B0YD 3A6NA 3WTPD 4R8PA 1F1EA 1P3MB 3KWQA 3AZKB 1M19A 1HQ3A 3KUYB 3C1BA 3UTAD 4H9RA 1JFIB 5GT0C 3B0CT 3UT9A 5GT0D 4NE5A 3AN2B 4WU9C 3R45B 4NFTA 4WU9D 4XUJA 4WNNA 1P3PC 1P3PD 2YFWA 3MVDC 3MVDD 1ID3A 5B0YB 3EG5B 3LZ0B 4J8UC 3AZFC 4J8UD 3AZFD 1KX4A 3TU4B 3KSYA 2Y2NA 1T3UA 5DNNA 5JA4B 4X23B 3A1IA 3UTAB 3H0RC 4H9OB 5AV6C 5AV6D 3VH6W 5GXQA 1P34A 2W8SA 5CP6B 4JJNB 3X1SB 3AL0C 3AZIB 3WTPA 3REKC 5C3IC 3WKJA 4LD9B 5FUGA 3REKD 3WTPE 1S32B 5B1LB 5BO0A 1KX5C 3AZJB 3AYWB 3W99C 1KX5D 3LZ1B 3W99D 3MGPC 4J8WC 5AV8B 4J8WD 3MGPD 3MNNC 4E45A 3MNND 5JRGB 3X1VB 3WA9C 4G92B 3WA9D 4AWLB 4WU9A 1AOIC 3O62B 2IO5C 1N1JA 3H0LC 5CPIB 4NE3A 1AOID 5CPJB 5F99B 2HUEC 2BYMA 4QLCB 5B32C 5B32D 3MVDA 1P3FC 1P3FD 4YM6C 5B33B 4YM6D 1P3LC 5BT1C 5DNMB 2G5IC 5BNVB 1P3LD 5BT1D 5GSUC 2CV5C 4H9PB 3VH5A 5GSUD 2CV5D 1P3BB 3AZGC 5E5AB 3AZGD 5B40C 3FDDA 5B40D 2HIOB 1AOIB 3EPHA 3REKA 4G91B 1KX5A 3MGQB 4J8VB 3W99A 1W2EA 3UTBB 1PZRA 5B2JC 3B6GC 2AROB 4J8WA 3MGPA 5B2JD 3B6GD 4ZUXD 2F8NK 5B1MB 1M18B 2Y2KA 4WV4B 4R8PC 4WU8C 3KWQC 1B67A 4H9NA 4R8PD 2RVQC 3X1UB 4WU8D 3KWQD 1BH8A 2RVQD 1ZLAC 5CPKB 1ZLAD 1P3GB 5B2IB 4J8XC 2NZDC 4J8XD 3KFUG 2NZDD 1P3FA 2XD1A 1P3IC 3AZHA 4YM6A 3X1TB 4Z2MG 1P3ID 4DRBA 3W97C 1U35A 1M1AC 1P3LA 4NE6A 3W97D 1M1AD 4ZUXB 2CV5A 4EO5C 3KXBB 2G5HC 3REIC 3RELC 3A6NB 3REID 2F8NH 4UPKA 5DNNC 5B40A 1M19B 1HQ3B 5DNND 3C1BB 4H9SC 1ULYA 3W98C 4H9RB 3W98D 3UT9B 3LELC 3LELD 3LJAB 5B2JA 2LY8A 3B6GA 4XUJB 4WNNB 2ZY5A 3WKJC 2JCHA 2BYKA 2YFWB 3WKJD 4WU8A 3NQUA 5AV9C 1ID3B 5AV9D 2ZM5A 2PYOC 1ZLAA 4Z5TB 2PYOD 1KX4B 3WAAB 4J8XA 2NZDA 3AZNA 3AFAC 1P3IA 4CAYA 3AFAD 4Z66C 2YFVA 4H9QA 4CSRA 5GXQB 4Z66D 1P34B 3W97A 1M1AA 3REJC 3H0MC 3MGRA 3REJD 1WWSA 5AVBC 5B31C 2Y2HA 3VH6T 3WTPB 5AVBD 5B31D 3MGSC 3REIA 3RELA 3MGSD 5FUGB 1F66C 5BO0B 4HGAC 1F66D 4KGCA 4H9SA 3VH5W 3W98A 2FJ7C 5GT0B 2FJ7D 3LELA 4WU9B 3C1CC 1P3OC 4E44A 3C1CD 1P3OD 2BYMB 1P3PB 2JE5A 5KDMB 5B24C 3MVDB 5AV9A 5BS7C 5B24D 2PYOA 4J8UB 3AZFB 5AY8C 2NQBC 5AY8D 2NQBD 1TAFA 5AV6B 3AFAA 1TZYC 4Z66A 1TZYD 4KHAA 3AZLC 5AVCC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AVC D;  3REJ A;  4YS3 C;  2F8N D;  5AVB A;  5B31 A;  4YS3 D;  3AZH C;  3MGS A;  3REK B;  3AZH D;  5C3I B;  1F66 A;  1U35 C;  5JA4 A;  1KX5 B;  1BH9 A;  4M6B A;  5B0Z C;  1U35 D;  3W99 B;  4J8W B;  3MGP B;  3AZE C;  1P3A C;  2FJ7 A;  3AZE D;  5B31 G;  3MNN B;  1P3A D;  3V9R A;  3WA9 B;  1B6W A;  4H9N B;  1BH8 B;  2IO5 B;  3C1C A;  1P3O A;  2HUE B;  5B32 B;  3AZJ A;  5B24 A;  1P3F B;  1WWI A;  5BS7 A;  5AV8 A;  4YM6 B;  5AY8 A;  2NQB A;  3NQJ A;  3B6F C;  3AZM C;  3W96 C;  5GT3 C;  3B6F D;  1P3L B;  3AZM D;  3W96 D;  5GT3 D;  3AV1 C;  5GSU B;  2CV5 B;  5AV5 C;  5CPJ A;  1TZY A;  4XZQ C;  3AZG B;  3REH C;  3AZL A;  5AVC A;  5B40 B;  3REH D;  3AZN C;  2F8N A;  4YS3 A;  3AZN D;  2JSS A;  1H3O A;  5DNM A;  5B0Z A;  3MGR C;  4H9P A;  5B2J B;  3MGR D;  3B6G B;  3AZE A;  2F8N G;  1P3A A;  5E5A A;  4KUD C;  2BYK B;  3REL D;  4KUD D;  4R8P B;  4WU8 B;  4KGC C;  3NQU B;  3B0D C;  3KWQ B;  4KGC D;  1ZLA B;  4J8X B;  1KX3 C;  2NZD B;  4J8V A;  4ZBJ C;  1KX3 D;  1EQZ C;  5G49 A;  1P3I B;  1P3K C;  1EQZ D;  5B1M A;  4CAY B;  3AV2 C;  1P3K D;  3AV2 D;  3B6F A;  3AZM A;  3W97 B;  3W96 A;  5GT3 A;  1P3M C;  3AZK C;  1M1A B;  1P3M D;  3KUY C;  3AZK D;  3AV1 A;  3KUY D;  4EO5 B;  5AV5 A;  4XZQ A;  3REI B;  3REL B;  3REH A;  3AN2 C;  5DNN B;  3AN2 D;  3W98 B;  3LEL B;  3VH5 T;  3KXB A;  5B0Y C;  3LZ0 C;  3LZ0 D;  3TU4 C;  3WKJ B;  4KUD A;  3TU4 D;  4X23 C;  3UTA C;  5AV9 B;  5BNX A;  4X23 D;  2L5A A;  2PYO B;  1R4V A;  4UUZ A;  1TAF B;  3LJA A;  1KX3 A;  5CP6 C;  4JJN C;  5CP6 D;  4JJN D;  1EQZ A;  3AFA B;  3X1S C;  3AZI C;  1N1J B;  1P3K A;  3AV2 A;  3X1S D;  4Z66 B;  3AZI D;  4LD9 C;  4KHA B;  1S32 C;  4LD9 D;  5B1L C;  3B0C W;  3AZJ C;  1P3M A;  3AZK A;  3AYW C;  1S32 D;  5B1L D;  3REJ B;  3LZ1 C;  3AZJ D;  3KUY A;  3AYW D;  3LZ1 D;  4Z5T A;  5AV8 C;  5B31 B;  5AVB B;  1JFI A;  3WAA A;  3MGS B;  5AV8 D;  5JRG C;  3X1V C;  1F66 B;  5JRG D;  4G92 C;  4HGA B;  3AN2 A;  1BH9 B;  3X1V D;  4AWL C;  3O62 C;  3R45 A;  5CPI C;  3O62 D;  5CPJ C;  5CPI D;  5F99 C;  2FJ7 B;  4QLC C;  5CPJ D;  5F99 D;  3V9R B;  4QLC D;  1KU5 A;  5CHL B;  3AZL D;  5B0Y A;  3LZ0 A;  5B33 C;  3C1C B;  1P3O B;  5B33 D;  1HTA A;  3TU4 A;  5DNM C;  5B24 B;  4X23 A;  3UTA A;  5DNM D;  4H9O A;  1P3B C;  5B0Z D;  5GT0 A;  5AY8 B;  1P3B D;  2NQB B;  3NQJ B;  5E5A C;  1BFM A;  5E5A D;  5CP6 A;  2HIO C;  4JJN A;  4WZS B;  2HIO D;  3X1S A;  3AZI A;  1TZY B;  1P3P A;  3B0B A;  4G91 C;  5KDM A;  4LD9 A;  3AZL B;  5AVC B;  1S32 A;  5B1L A;  3MGQ C;  4J8V C;  3AYW A;  3UTB C;  3LZ1 A;  3MGQ D;  4J8V D;  4YS3 B;  2ARO C;  2F8N B;  4J8U A;  3UTB D;  3AZF A;  2ARO D;  5B1M C;  1H3O B;  3AZH B;  1M18 C;  5B1M D;  1M18 D;  5JRG A;  3X1V A;  1U35 B;  5B0Z B;  3X1U C;  5AV6 A;  4DRA A;  3O62 A;  3X1U D;  5CPI A;  3AZE B;  5CPK C;  3AV1 D;  1P3A B;  5F99 A;  5AV5 D;  5B2I C;  4QLC A;  5CPK D;  1P3G C;  3VH6 A;  5B2I D;  4XZQ D;  1P3G D;  5B33 A;  3X1T C;  3X1T D;  5BNV A;  4ZUX C;  3KXB C;  5G49 B;  1P3B A;  3KXB D;  3MNN A;  3A6N C;  3B6F B;  3A6N D;  3AZM B;  3W96 B;  5GT3 B;  3WA9 A;  1M19 C;  1HQ3 C;  2HIO A;  3C1B C;  3AV1 B;  1M19 D;  1AOI A;  1HQ3 D;  3C1B D;  5AV5 B;  3UT9 C;  4XZQ B;  2CWE A;  5B32 A;  3UT9 D;  3REH B;  3LJA C;  3MGQ A;  3AZN B;  3LJA D;  3UTB A;  2ARO A;  4XUJ C;  1M18 A;  4XUJ D;  2YFV B;  4H9Q B;  4CSR B;  4Z2M H;  5B32 G;  5GSU A;  3X1U A;  3MGR B;  1ID3 C;  1ID3 D;  4Z5T C;  3AZG A;  5CPK A;  3WAA C;  1KX4 C;  4Z5T D;  1P3G A;  5B2I A;  1KX4 D;  3WAA D;  4KUD B;  4KGC B;  3B0D B;  5BNX B;  3X1T A;  5GXQ C;  1P34 C;  1Q9C A;  4UUZ B;  5GXQ D;  1P34 D;  1KX3 B;  1A7W A;  4ZBJ B;  4ZUX A;  1EQZ B;  3WTP C;  1P3K B;  3AV2 B;  5B0Y D;  3A6N A;  3WTP D;  4R8P A;  1F1E A;  1P3M B;  3KWQ A;  3AZK B;  1M19 A;  1HQ3 A;  3KUY B;  3C1B A;  3UTA D;  4H9R A;  1JFI B;  5GT0 C;  3B0C T;  3UT9 A;  5GT0 D;  4NE5 A;  3AN2 B;  4WU9 C;  3R45 B;  4NFT A;  4WU9 D;  4XUJ A;  4WNN A;  1P3P C;  1P3P D;  2YFW A;  3MVD C;  3MVD D;  1ID3 A;  5B0Y B;  3LZ0 B;  4J8U C;  3AZF C;  4J8U D;  3AZF D;  1KX4 A;  3TU4 B;  3KSY A;  5DNN A;  5JA4 B;  4X23 B;  3UTA B;  4H9O B;  5AV6 C;  5AV6 D;  3VH6 W;  5GXQ A;  1P34 A;  5CP6 B;  4JJN B;  3X1S B;  3AZI B;  3WTP A;  3REK C;  5C3I C;  3WKJ A;  4LD9 B;  5FUG A;  3REK D;  3WTP E;  1S32 B;  5B1L B;  5BO0 A;  1KX5 C;  3AZJ B;  3AYW B;  3W99 C;  1KX5 D;  3LZ1 B;  3W99 D;  3MGP C;  4J8W C;  5AV8 B;  4J8W D;  3MGP D;  3MNN C;  4E45 A;  3MNN D;  5JRG B;  3X1V B;  3WA9 C;  4G92 B;  3WA9 D;  4AWL B;  4WU9 A;  1AOI C;  3O62 B;  2IO5 C;  1N1J A;  5CPI B;  4NE3 A;  1AOI D;  5CPJ B;  5F99 B;  2HUE C;  2BYM A;  4QLC B;  5B32 C;  5B32 D;  3MVD A;  1P3F C;  1P3F D;  4YM6 C;  5B33 B;  4YM6 D;  1P3L C;  5BT1 C;  5DNM B;  5BNV B;  1P3L D;  5BT1 D;  5GSU C;  2CV5 C;  4H9P B;  3VH5 A;  5GSU D;  2CV5 D;  1P3B B;  3AZG C;  5E5A B;  3AZG D;  5B40 C;  5B40 D;  2HIO B;  1AOI B;  3REK A;  4G91 B;  1KX5 A;  3MGQ B;  4J8V B;  3W99 A;  3UTB B;  5B2J C;  3B6G C;  2ARO B;  4J8W A;  3MGP A;  5B2J D;  3B6G D;  4ZUX D;  2F8N K;  5B1M B;  1M18 B;  4WV4 B;  4R8P C;  4WU8 C;  3KWQ C;  1B67 A;  4H9N A;  4R8P D;  2RVQ C;  3X1U B;  4WU8 D;  3KWQ D;  1BH8 A;  2RVQ D;  1ZLA C;  5CPK B;  1ZLA D;  1P3G B;  5B2I B;  4J8X C;  2NZD C;  4J8X D;  2NZD D;  1P3F A;  1P3I C;  3AZH A;  4YM6 A;  3X1T B;  4Z2M G;  1P3I D;  4DRB A;  3W97 C;  1U35 A;  1M1A C;  1P3L A;  4NE6 A;  3W97 D;  1M1A D;  4ZUX B;  2CV5 A;  4EO5 C;  3KXB B;  3REI C;  3REL C;  3A6N B;  3REI D;  2F8N H;  5DNN C;  5B40 A;  1M19 B;  1HQ3 B;  5DNN D;  3C1B B;  4H9S C;  1ULY A;  3W98 C;  4H9R B;  3W98 D;  3UT9 B;  3LEL C;  3LEL D;  3LJA B;  5B2J A;  2LY8 A;  3B6G A;  4XUJ B;  4WNN B;  3WKJ C;  2BYK A;  2YFW B;  3WKJ D;  4WU8 A;  3NQU A;  5AV9 C;  1ID3 B;  5AV9 D;  2PYO C;  1ZLA A;  4Z5T B;  2PYO D;  1KX4 B;  3WAA B;  4J8X A;  2NZD A;  3AZN A;  3AFA C;  1P3I A;  4CAY A;  3AFA D;  4Z66 C;  2YFV A;  4H9Q A;  4CSR A;  5GXQ B;  4Z66 D;  1P34 B;  3W97 A;  1M1A A;  3REJ C;  3MGR A;  3REJ D;  1WWS A;  5AVB C;  5B31 C;  3VH6 T;  3WTP B;  5AVB D;  5B31 D;  3MGS C;  3REI A;  3REL A;  3MGS D;  5FUG B;  1F66 C;  5BO0 B;  4HGA C;  1F66 D;  4KGC A;  4H9S A;  3VH5 W;  3W98 A;  2FJ7 C;  5GT0 B;  2FJ7 D;  3LEL A;  4WU9 B;  3C1C C;  1P3O C;  4E44 A;  3C1C D;  1P3O D;  2BYM B;  1P3P B;  5KDM B;  5B24 C;  3MVD B;  5AV9 A;  5BS7 C;  5B24 D;  2PYO A;  4J8U B;  3AZF B;  5AY8 C;  2NQB C;  5AY8 D;  2NQB D;  1TAF A;  5AV6 B;  3AFA A;  1TZY C;  4Z66 A;  1TZY D;  4KHA A;  3AZL C;  5AVC C; 
#chains in the Genus database with same CATH topology
 4WJ3 C;  5AVC D;  3REJ A;  4YS3 C;  2F8N D;  5AVB A;  5B31 A;  4YS3 D;  3AZH C;  3MGS A;  3REK B;  3AZH D;  5C3I B;  1F66 A;  1U35 C;  5JA4 A;  1KX5 B;  1BH9 A;  4M6B A;  5B0Z C;  1U35 D;  3W99 B;  4J8W B;  3MGP B;  3AZE C;  1P3A C;  2FJ7 A;  3AZE D;  5B31 G;  3MNN B;  1P3A D;  2F2A C;  3V9R A;  3WA9 B;  1B6W A;  4H9N B;  1BH8 B;  2IO5 B;  3C1C A;  1P3O A;  2HUE B;  2ZY2 A;  5B32 B;  3F6T A;  3AZJ A;  5B24 A;  1P3F B;  1WWI A;  5BS7 A;  5AV8 A;  4YM6 B;  2Y2P A;  5AY8 A;  2NQB A;  3NQJ A;  3B6F C;  3AZM C;  3W96 C;  5GT3 C;  3B6F D;  1P3L B;  3AZM D;  3W96 D;  5GT3 D;  3AV1 C;  5GSU B;  2CV5 B;  5AV5 C;  2DF4 C;  5CPJ A;  1TZY A;  4XZQ C;  3AZG B;  2ZY4 A;  2Y2I A;  3REH C;  3AZL A;  5AVC A;  5B40 B;  3REH D;  3AZN C;  2F8N A;  4YS3 A;  3AZN D;  2JSS A;  1H3O A;  5DNM A;  5B0Z A;  3MGR C;  4H9P A;  5B2J B;  3MGR D;  3B6G B;  3AZE A;  2F8N G;  1P3A A;  5E5A A;  4KUD C;  2BYK B;  3REL D;  4KUD D;  4R8P B;  4WU8 B;  4KGC C;  3NQU B;  3B0D C;  3KWQ B;  4KGC D;  1ZLA B;  4J8X B;  1KX3 C;  2NZD B;  4J8V A;  4ZBJ C;  1KX3 D;  1EQZ C;  5G49 A;  1P3I B;  1P3K C;  1EQZ D;  5B1M A;  4CAY B;  3AV2 C;  1P3K D;  3AV2 D;  3B6F A;  3AZM A;  3W97 B;  3W96 A;  5GT3 A;  1P3M C;  3AZK C;  1M1A B;  2BG1 A;  1P3M D;  3KUY C;  3P5J B;  3AZK D;  3AV1 A;  3KUY D;  4EO5 B;  5AV5 A;  4XZQ A;  3REI B;  3REL B;  2ZY3 A;  3REH A;  3AN2 C;  5DNN B;  3EPJ A;  3AN2 D;  2FFF B;  3W98 B;  3LEL B;  3VH5 T;  3KXB A;  5B0Y C;  3LZ0 C;  3LZ0 D;  3TU4 C;  3WKJ B;  4KUD A;  3TU4 D;  4X23 C;  3UTA C;  5AV9 B;  5BNX A;  4X23 D;  2L5A A;  2PYO B;  2DQN C;  1R4V A;  4UUZ A;  1TAF B;  3LJA A;  1KX3 A;  5CP6 C;  4JJN C;  5CP6 D;  4JJN D;  1EQZ A;  3AFA B;  3X1S C;  3AZI C;  1N1J B;  1P3K A;  3AV2 A;  3X1S D;  4Z66 B;  3AZI D;  4LD9 C;  4KHA B;  1S32 C;  4LD9 D;  5B1L C;  3B0C W;  3AZJ C;  1P3M A;  3AZK A;  3AYW C;  1S32 D;  5B1L D;  3REJ B;  3LZ1 C;  3AZJ D;  3KUY A;  3AYW D;  3LZ1 D;  4Z5T A;  5AV8 C;  5B31 B;  5AVB B;  1JFI A;  3WAA A;  3MGS B;  5AV8 D;  5JRG C;  3X1V C;  1F66 B;  5JRG D;  4G92 C;  4HGA B;  3AN2 A;  1BH9 B;  3X1V D;  4AWL C;  3O62 C;  3R45 A;  5CPI C;  3O62 D;  5CPJ C;  5CPI D;  5F99 C;  2FJ7 B;  4QLC C;  5CPJ D;  5F99 D;  3V9R B;  4QLC D;  1KU5 A;  5CHL B;  3AZL D;  5B0Y A;  3LZ0 A;  5B33 C;  3C1C B;  1P3O B;  5B33 D;  1HTA A;  3TU4 A;  2Y2J A;  3EPK A;  5DNM C;  5B24 B;  4X23 A;  3UTA A;  5DNM D;  4H9O A;  1P3B C;  5B0Z D;  5GT0 A;  5AY8 B;  1P3B D;  2NQB B;  3NQJ B;  5E5A C;  1BFM A;  2Y2M A;  5E5A D;  5CP6 A;  2HIO C;  4JJN A;  4WZS B;  2HIO D;  3X1S A;  3AZI A;  1TZY B;  1P3P A;  3B0B A;  4G91 C;  5KDM A;  4LD9 A;  3AZL B;  5AVC B;  1S32 A;  5B1L A;  3MGQ C;  4J8V C;  3AYW A;  3UTB C;  3LZ1 A;  3MGQ D;  4J8V D;  4YS3 B;  2ARO C;  2F8N B;  4J8U A;  3UTB D;  3AZF A;  2ARO D;  5B1M C;  1H3O B;  3AZH B;  1M18 C;  5B1M D;  1M18 D;  5JRG A;  3X1V A;  1U35 B;  5B0Z B;  3X1U C;  2Y2O A;  5AV6 A;  4DRA A;  3O62 A;  3X1U D;  5CPI A;  3AZE B;  5CPK C;  3AV1 D;  1P3A B;  5F99 A;  5AV5 D;  5B2I C;  4QLC A;  2Y2G A;  5CPK D;  1P3G C;  3VH6 A;  5B2I D;  4XZQ D;  1P3G D;  5B33 A;  3X1T C;  3X1T D;  5BNV A;  4ZUX C;  3KXB C;  5G49 B;  1P3B A;  3KXB D;  3MNN A;  3A6N C;  3IP4 C;  3B6F B;  3A6N D;  3AZM B;  3W96 B;  5GT3 B;  3WA9 A;  1M19 C;  1HQ3 C;  2HIO A;  3C1B C;  3AV1 B;  1M19 D;  1AOI A;  1HQ3 D;  3C1B D;  5AV5 B;  2Y2L A;  3UT9 C;  4XZQ B;  2CWE A;  2VQR A;  5B32 A;  3UT9 D;  3REH B;  4DQY B;  3LJA C;  3MGQ A;  2UWX A;  3AZN B;  3LJA D;  3UTB A;  2ARO A;  4XUJ C;  1M18 A;  4XUJ D;  3A1K A;  2Y2Q A;  2YFV B;  4H9Q B;  4CSR B;  4Z2M H;  5B32 G;  5GSU A;  3X1U A;  3MGR B;  1ID3 C;  2RIQ A;  1ID3 D;  4Z5T C;  3AZG A;  5CPK A;  3WAA C;  1KX4 C;  4Z5T D;  1P3G A;  5B2I A;  1KX4 D;  1Z2C B;  3WAA D;  4KUD B;  4KGC B;  3B0D B;  5BNX B;  3X1T A;  2XD5 A;  5GXQ C;  1P34 C;  1Q9C A;  4UUZ B;  2J8P A;  5GXQ D;  1P34 D;  1KX3 B;  3EPL A;  1A7W A;  4ZBJ B;  4ZUX A;  1EQZ B;  3WTP C;  1P3K B;  3AV2 B;  5B0Y D;  3A6N A;  3WTP D;  4R8P A;  1F1E A;  1P3M B;  3KWQ A;  3AZK B;  1M19 A;  1HQ3 A;  3KUY B;  3C1B A;  3UTA D;  4H9R A;  1JFI B;  5GT0 C;  3B0C T;  3UT9 A;  5GT0 D;  4NE5 A;  3AN2 B;  4WU9 C;  3R45 B;  4NFT A;  4WU9 D;  4XUJ A;  4WNN A;  1P3P C;  1P3P D;  2YFW A;  3MVD C;  3MVD D;  1ID3 A;  5B0Y B;  3EG5 B;  3LZ0 B;  4J8U C;  3AZF C;  4J8U D;  3AZF D;  1KX4 A;  3TU4 B;  3KSY A;  2Y2N A;  1T3U A;  5DNN A;  5JA4 B;  4X23 B;  3A1I A;  3UTA B;  3H0R C;  4H9O B;  5AV6 C;  5AV6 D;  3VH6 W;  5GXQ A;  1P34 A;  2W8S A;  5CP6 B;  4JJN B;  3X1S B;  3AL0 C;  3AZI B;  3WTP A;  3REK C;  5C3I C;  3WKJ A;  4LD9 B;  5FUG A;  3REK D;  3WTP E;  1S32 B;  5B1L B;  5BO0 A;  1KX5 C;  3AZJ B;  3AYW B;  3W99 C;  1KX5 D;  3LZ1 B;  3W99 D;  3MGP C;  4J8W C;  5AV8 B;  4J8W D;  3MGP D;  3MNN C;  4E45 A;  3MNN D;  5JRG B;  3X1V B;  3WA9 C;  4G92 B;  3WA9 D;  4AWL B;  4WU9 A;  1AOI C;  3O62 B;  2IO5 C;  1N1J A;  3H0L C;  5CPI B;  4NE3 A;  1AOI D;  5CPJ B;  5F99 B;  2HUE C;  2BYM A;  4QLC B;  5B32 C;  5B32 D;  3MVD A;  1P3F C;  1P3F D;  4YM6 C;  5B33 B;  4YM6 D;  1P3L C;  5BT1 C;  5DNM B;  2G5I C;  5BNV B;  1P3L D;  5BT1 D;  5GSU C;  2CV5 C;  4H9P B;  3VH5 A;  5GSU D;  2CV5 D;  1P3B B;  3AZG C;  5E5A B;  3AZG D;  5B40 C;  3FDD A;  5B40 D;  2HIO B;  1AOI B;  3EPH A;  3REK A;  4G91 B;  1KX5 A;  3MGQ B;  4J8V B;  3W99 A;  1W2E A;  3UTB B;  1PZR A;  5B2J C;  3B6G C;  2ARO B;  4J8W A;  3MGP A;  5B2J D;  3B6G D;  4ZUX D;  2F8N K;  5B1M B;  1M18 B;  2Y2K A;  4WV4 B;  4R8P C;  4WU8 C;  3KWQ C;  1B67 A;  4H9N A;  4R8P D;  2RVQ C;  3X1U B;  4WU8 D;  3KWQ D;  1BH8 A;  2RVQ D;  1ZLA C;  5CPK B;  1ZLA D;  1P3G B;  5B2I B;  4J8X C;  2NZD C;  4J8X D;  3KFU G;  2NZD D;  1P3F A;  2XD1 A;  1P3I C;  3AZH A;  4YM6 A;  3X1T B;  4Z2M G;  1P3I D;  4DRB A;  3W97 C;  1U35 A;  1M1A C;  1P3L A;  4NE6 A;  3W97 D;  1M1A D;  4ZUX B;  2CV5 A;  4EO5 C;  3KXB B;  2G5H C;  3REI C;  3REL C;  3A6N B;  3REI D;  2F8N H;  4UPK A;  5DNN C;  5B40 A;  1M19 B;  1HQ3 B;  5DNN D;  3C1B B;  4H9S C;  1ULY A;  3W98 C;  4H9R B;  3W98 D;  3UT9 B;  3LEL C;  3LEL D;  3LJA B;  5B2J A;  2LY8 A;  3B6G A;  4XUJ B;  4WNN B;  2ZY5 A;  3WKJ C;  2JCH A;  2BYK A;  2YFW B;  3WKJ D;  4WU8 A;  3NQU A;  5AV9 C;  1ID3 B;  5AV9 D;  2ZM5 A;  2PYO C;  1ZLA A;  4Z5T B;  2PYO D;  1KX4 B;  3WAA B;  4J8X A;  2NZD A;  3AZN A;  3AFA C;  1P3I A;  4CAY A;  3AFA D;  4Z66 C;  2YFV A;  4H9Q A;  4CSR A;  5GXQ B;  4Z66 D;  1P34 B;  3W97 A;  1M1A A;  3REJ C;  3H0M C;  3MGR A;  3REJ D;  1WWS A;  5AVB C;  5B31 C;  2Y2H A;  3VH6 T;  3WTP B;  5AVB D;  5B31 D;  3MGS C;  3REI A;  3REL A;  3MGS D;  5FUG B;  1F66 C;  5BO0 B;  4HGA C;  1F66 D;  4KGC A;  4H9S A;  3VH5 W;  3W98 A;  2FJ7 C;  5GT0 B;  2FJ7 D;  3LEL A;  4WU9 B;  3C1C C;  1P3O C;  4E44 A;  3C1C D;  1P3O D;  2BYM B;  1P3P B;  2JE5 A;  5KDM B;  5B24 C;  3MVD B;  5AV9 A;  5BS7 C;  5B24 D;  2PYO A;  4J8U B;  3AZF B;  5AY8 C;  2NQB C;  5AY8 D;  2NQB D;  1TAF A;  5AV6 B;  3AFA A;  1TZY C;  4Z66 A;  1TZY D;  4KHA A;  3AZL C;  5AVC C; 
#chains in the Genus database with same CATH homology
 4WJ3 C;  5AVC D;  3REJ A;  4YS3 C;  2F8N D;  5AVB A;  5B31 A;  4YS3 D;  3AZH C;  3MGS A;  3REK B;  3AZH D;  5C3I B;  1F66 A;  1U35 C;  5JA4 A;  1KX5 B;  1BH9 A;  4M6B A;  5B0Z C;  1U35 D;  3W99 B;  4J8W B;  3MGP B;  3AZE C;  1P3A C;  2FJ7 A;  3AZE D;  5B31 G;  3MNN B;  1P3A D;  2F2A C;  3V9R A;  3WA9 B;  1B6W A;  4H9N B;  1BH8 B;  2IO5 B;  3C1C A;  1P3O A;  2HUE B;  2ZY2 A;  5B32 B;  3F6T A;  3AZJ A;  5B24 A;  1P3F B;  1WWI A;  5BS7 A;  5AV8 A;  4YM6 B;  2Y2P A;  5AY8 A;  2NQB A;  3NQJ A;  3B6F C;  3AZM C;  3W96 C;  5GT3 C;  3B6F D;  1P3L B;  3AZM D;  3W96 D;  5GT3 D;  3AV1 C;  5GSU B;  2CV5 B;  5AV5 C;  2DF4 C;  5CPJ A;  1TZY A;  4XZQ C;  3AZG B;  2ZY4 A;  2Y2I A;  3REH C;  3AZL A;  5AVC A;  5B40 B;  3REH D;  3AZN C;  2F8N A;  4YS3 A;  3AZN D;  2JSS A;  1H3O A;  5DNM A;  5B0Z A;  3MGR C;  4H9P A;  5B2J B;  3MGR D;  3B6G B;  3AZE A;  2F8N G;  1P3A A;  5E5A A;  4KUD C;  2BYK B;  3REL D;  4KUD D;  4R8P B;  4WU8 B;  4KGC C;  3NQU B;  3B0D C;  3KWQ B;  4KGC D;  1ZLA B;  4J8X B;  1KX3 C;  2NZD B;  4J8V A;  4ZBJ C;  1KX3 D;  1EQZ C;  5G49 A;  1P3I B;  1P3K C;  1EQZ D;  5B1M A;  4CAY B;  3AV2 C;  1P3K D;  3AV2 D;  3B6F A;  3AZM A;  3W97 B;  3W96 A;  5GT3 A;  1P3M C;  3AZK C;  1M1A B;  2BG1 A;  1P3M D;  3KUY C;  3P5J B;  3AZK D;  3AV1 A;  3KUY D;  4EO5 B;  5AV5 A;  4XZQ A;  3REI B;  3REL B;  2ZY3 A;  3REH A;  3AN2 C;  5DNN B;  3EPJ A;  3AN2 D;  2FFF B;  3W98 B;  3LEL B;  3VH5 T;  3KXB A;  5B0Y C;  3LZ0 C;  3LZ0 D;  3TU4 C;  3WKJ B;  4KUD A;  3TU4 D;  4X23 C;  3UTA C;  5AV9 B;  5BNX A;  4X23 D;  2L5A A;  2PYO B;  2DQN C;  1R4V A;  4UUZ A;  1TAF B;  3LJA A;  1KX3 A;  5CP6 C;  4JJN C;  5CP6 D;  4JJN D;  1EQZ A;  3AFA B;  3X1S C;  3AZI C;  1N1J B;  1P3K A;  3AV2 A;  3X1S D;  4Z66 B;  3AZI D;  4LD9 C;  4KHA B;  1S32 C;  4LD9 D;  5B1L C;  3B0C W;  3AZJ C;  1P3M A;  3AZK A;  3AYW C;  1S32 D;  5B1L D;  3REJ B;  3LZ1 C;  3AZJ D;  3KUY A;  3AYW D;  3LZ1 D;  4Z5T A;  5AV8 C;  5B31 B;  5AVB B;  1JFI A;  3WAA A;  3MGS B;  5AV8 D;  5JRG C;  3X1V C;  1F66 B;  5JRG D;  4G92 C;  4HGA B;  3AN2 A;  1BH9 B;  3X1V D;  4AWL C;  3O62 C;  3R45 A;  5CPI C;  3O62 D;  5CPJ C;  5CPI D;  5F99 C;  2FJ7 B;  4QLC C;  5CPJ D;  5F99 D;  3V9R B;  4QLC D;  1KU5 A;  5CHL B;  3AZL D;  5B0Y A;  3LZ0 A;  5B33 C;  3C1C B;  1P3O B;  5B33 D;  1HTA A;  3TU4 A;  2Y2J A;  3EPK A;  5DNM C;  5B24 B;  4X23 A;  3UTA A;  5DNM D;  4H9O A;  1P3B C;  5B0Z D;  5GT0 A;  5AY8 B;  1P3B D;  2NQB B;  3NQJ B;  5E5A C;  1BFM A;  2Y2M A;  5E5A D;  5CP6 A;  2HIO C;  4JJN A;  4WZS B;  2HIO D;  3X1S A;  3AZI A;  1TZY B;  1P3P A;  3B0B A;  4G91 C;  5KDM A;  4LD9 A;  3AZL B;  5AVC B;  1S32 A;  5B1L A;  3MGQ C;  4J8V C;  3AYW A;  3UTB C;  3LZ1 A;  3MGQ D;  4J8V D;  4YS3 B;  2ARO C;  2F8N B;  4J8U A;  3UTB D;  3AZF A;  2ARO D;  5B1M C;  1H3O B;  3AZH B;  1M18 C;  5B1M D;  1M18 D;  5JRG A;  3X1V A;  1U35 B;  5B0Z B;  3X1U C;  2Y2O A;  5AV6 A;  4DRA A;  3O62 A;  3X1U D;  5CPI A;  3AZE B;  5CPK C;  3AV1 D;  1P3A B;  5F99 A;  5AV5 D;  5B2I C;  4QLC A;  2Y2G A;  5CPK D;  1P3G C;  3VH6 A;  5B2I D;  4XZQ D;  1P3G D;  5B33 A;  3X1T C;  3X1T D;  5BNV A;  4ZUX C;  3KXB C;  5G49 B;  1P3B A;  3KXB D;  3MNN A;  3A6N C;  3IP4 C;  3B6F B;  3A6N D;  3AZM B;  3W96 B;  5GT3 B;  3WA9 A;  1M19 C;  1HQ3 C;  2HIO A;  3C1B C;  3AV1 B;  1M19 D;  1AOI A;  1HQ3 D;  3C1B D;  5AV5 B;  2Y2L A;  3UT9 C;  4XZQ B;  2CWE A;  2VQR A;  5B32 A;  3UT9 D;  3REH B;  4DQY B;  3LJA C;  3MGQ A;  2UWX A;  3AZN B;  3LJA D;  3UTB A;  2ARO A;  4XUJ C;  1M18 A;  4XUJ D;  3A1K A;  2Y2Q A;  2YFV B;  4H9Q B;  4CSR B;  4Z2M H;  5B32 G;  5GSU A;  3X1U A;  3MGR B;  1ID3 C;  2RIQ A;  1ID3 D;  4Z5T C;  3AZG A;  5CPK A;  3WAA C;  1KX4 C;  4Z5T D;  1P3G A;  5B2I A;  1KX4 D;  1Z2C B;  3WAA D;  4KUD B;  4KGC B;  3B0D B;  5BNX B;  3X1T A;  2XD5 A;  5GXQ C;  1P34 C;  1Q9C A;  4UUZ B;  2J8P A;  5GXQ D;  1P34 D;  1KX3 B;  3EPL A;  1A7W A;  4ZBJ B;  4ZUX A;  1EQZ B;  3WTP C;  1P3K B;  3AV2 B;  5B0Y D;  3A6N A;  3WTP D;  4R8P A;  1F1E A;  1P3M B;  3KWQ A;  3AZK B;  1M19 A;  1HQ3 A;  3KUY B;  3C1B A;  3UTA D;  4H9R A;  1JFI B;  5GT0 C;  3B0C T;  3UT9 A;  5GT0 D;  4NE5 A;  3AN2 B;  4WU9 C;  3R45 B;  4NFT A;  4WU9 D;  4XUJ A;  4WNN A;  1P3P C;  1P3P D;  2YFW A;  3MVD C;  3MVD D;  1ID3 A;  5B0Y B;  3EG5 B;  3LZ0 B;  4J8U C;  3AZF C;  4J8U D;  3AZF D;  1KX4 A;  3TU4 B;  3KSY A;  2Y2N A;  1T3U A;  5DNN A;  5JA4 B;  4X23 B;  3A1I A;  3UTA B;  3H0R C;  4H9O B;  5AV6 C;  5AV6 D;  3VH6 W;  5GXQ A;  1P34 A;  2W8S A;  5CP6 B;  4JJN B;  3X1S B;  3AL0 C;  3AZI B;  3WTP A;  3REK C;  5C3I C;  3WKJ A;  4LD9 B;  5FUG A;  3REK D;  3WTP E;  1S32 B;  5B1L B;  5BO0 A;  1KX5 C;  3AZJ B;  3AYW B;  3W99 C;  1KX5 D;  3LZ1 B;  3W99 D;  3MGP C;  4J8W C;  5AV8 B;  4J8W D;  3MGP D;  3MNN C;  4E45 A;  3MNN D;  5JRG B;  3X1V B;  3WA9 C;  4G92 B;  3WA9 D;  4AWL B;  4WU9 A;  1AOI C;  3O62 B;  2IO5 C;  1N1J A;  3H0L C;  5CPI B;  4NE3 A;  1AOI D;  5CPJ B;  5F99 B;  2HUE C;  2BYM A;  4QLC B;  5B32 C;  5B32 D;  3MVD A;  1P3F C;  1P3F D;  4YM6 C;  5B33 B;  4YM6 D;  1P3L C;  5BT1 C;  5DNM B;  2G5I C;  5BNV B;  1P3L D;  5BT1 D;  5GSU C;  2CV5 C;  4H9P B;  3VH5 A;  5GSU D;  2CV5 D;  1P3B B;  3AZG C;  5E5A B;  3AZG D;  5B40 C;  3FDD A;  5B40 D;  2HIO B;  1AOI B;  3EPH A;  3REK A;  4G91 B;  1KX5 A;  3MGQ B;  4J8V B;  3W99 A;  1W2E A;  3UTB B;  1PZR A;  5B2J C;  3B6G C;  2ARO B;  4J8W A;  3MGP A;  5B2J D;  3B6G D;  4ZUX D;  2F8N K;  5B1M B;  1M18 B;  2Y2K A;  4WV4 B;  4R8P C;  4WU8 C;  3KWQ C;  1B67 A;  4H9N A;  4R8P D;  2RVQ C;  3X1U B;  4WU8 D;  3KWQ D;  1BH8 A;  2RVQ D;  1ZLA C;  5CPK B;  1ZLA D;  1P3G B;  5B2I B;  4J8X C;  2NZD C;  4J8X D;  3KFU G;  2NZD D;  1P3F A;  2XD1 A;  1P3I C;  3AZH A;  4YM6 A;  3X1T B;  4Z2M G;  1P3I D;  4DRB A;  3W97 C;  1U35 A;  1M1A C;  1P3L A;  4NE6 A;  3W97 D;  1M1A D;  4ZUX B;  2CV5 A;  4EO5 C;  3KXB B;  2G5H C;  3REI C;  3REL C;  3A6N B;  3REI D;  2F8N H;  4UPK A;  5DNN C;  5B40 A;  1M19 B;  1HQ3 B;  5DNN D;  3C1B B;  4H9S C;  1ULY A;  3W98 C;  4H9R B;  3W98 D;  3UT9 B;  3LEL C;  3LEL D;  3LJA B;  5B2J A;  2LY8 A;  3B6G A;  4XUJ B;  4WNN B;  2ZY5 A;  3WKJ C;  2JCH A;  2BYK A;  2YFW B;  3WKJ D;  4WU8 A;  3NQU A;  5AV9 C;  1ID3 B;  5AV9 D;  2ZM5 A;  2PYO C;  1ZLA A;  4Z5T B;  2PYO D;  1KX4 B;  3WAA B;  4J8X A;  2NZD A;  3AZN A;  3AFA C;  1P3I A;  4CAY A;  3AFA D;  4Z66 C;  2YFV A;  4H9Q A;  4CSR A;  5GXQ B;  4Z66 D;  1P34 B;  3W97 A;  1M1A A;  3REJ C;  3H0M C;  3MGR A;  3REJ D;  1WWS A;  5AVB C;  5B31 C;  2Y2H A;  3VH6 T;  3WTP B;  5AVB D;  5B31 D;  3MGS C;  3REI A;  3REL A;  3MGS D;  5FUG B;  1F66 C;  5BO0 B;  4HGA C;  1F66 D;  4KGC A;  4H9S A;  3VH5 W;  3W98 A;  2FJ7 C;  5GT0 B;  2FJ7 D;  3LEL A;  4WU9 B;  3C1C C;  1P3O C;  4E44 A;  3C1C D;  1P3O D;  2BYM B;  1P3P B;  2JE5 A;  5KDM B;  5B24 C;  3MVD B;  5AV9 A;  5BS7 C;  5B24 D;  2PYO A;  4J8U B;  3AZF B;  5AY8 C;  2NQB C;  5AY8 D;  2NQB D;  1TAF A;  5AV6 B;  3AFA A;  1TZY C;  4Z66 A;  1TZY D;  4KHA A;  3AZL C;  5AVC C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...