5B24B

The crystal structure of the nucleosome containing cyclobutane pyrimidine dimer
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
78
structure length
78
Chain Sequence
NIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.1
publication title Crystal structure of the nucleosome containing ultraviolet light-induced cyclobutane pyrimidine dimer
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 24
structure length 78
sequence length 78
chains with identical sequence F
ec nomenclature
pdb deposition date 2015-12-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5b24B00
5B24B 5GT3C 2F8NB 4H9RB 2PYOB 5B2JB 3LJAC 2CV5A 3LJAB 1F66C 4WU9D 3AZEC 1F66B 1JFIA 3AV1D 3AZEB 1S32A 3V9RA 5B0YD 5B31C 5E5AD 5F99D 5DNNB 4LD9A 5GXQD 3WAAC 1H3OB 3WAAB 2NZDD 1BH9B 1WWSA 2YFVA 5B40D 3C1CC 4KUDC 4J8VA 5AY8A 3W96C 1U35C 3LZ0A 5GSUD 4J8XB 3VH6T 3AZHD 1P3FA 3W96B 5AVCA 1M1AB 3W97C 4WU8D 5AV6A 4ZUXD 3WTPE 5B1MC 5AV8A 3AZID 5CP6C 3UT9D 5B1LB 5BO0B 3RELB 1P3KA 3X1VA 5CPIC 3AZKD 4G91B 5CPIB 2NQBA 3WA9A 3X1TA 3B0DC 2CV5D 4CSRA 1KU5A 3B0DB 4M6BA 3MGSA 3AV1C 4E45A 3AZLC 1AOIA 5B0YC 3X1UD 1KX4D 3W98D 3AZLB 3AZFC 3MNNB 2IO5C 5E5AC 5F99C 3AZFB 3AN2C 2IO5B 3AN2B 4H9OA 1EQZA 5GXQC 2F8NG 1HQ3D 5GXQB 4LD9D 3B0CT 2BYKB 5B40C 5CPJD 2F8NA 2PYOA 4KHAB 5B2JA 3LJAA 3AZHC 5GSUC 1F66A 4EO5B 3AZEA 4XUJD 4ZUXC 4Z2MH 4DRBA 3AZIC 1M19D 3X1SB 1KX3D 3UT9C 1KX5B 1P3KD 3WTPB 4WNNA 3AZKC 4UUZB 1H3OA 3WAAA 2AROB 1HTAA 3VH5A 3WA9D 4NE3A 3C1CA 3AYWC 4KUDA 3X1UC 3MGSD 3AYWB 1KX4C 3W98C 3X1UB 1KX4B 2HUEC 1AOID 3W96A 2HUEB 4J8XA 4E44A 3MGQB 4Z5TB 1HQ3C 3W97A 3LELD 4NFTA 1EQZD 4LD9C 5C3IB 5B1MA 3B6FD 5CP6A 5CPJC 4H9SC 5B1LA 5CPJB 5B24D 2PYOD 3AZMB 2HIOD 3REKC 5CPIA 5B2JD 3MGRC 3REKB 3MGRB 3LJAD 5B2ID 4XUJC 3AV1A 3A6NB 3AZLA 1M19C 5B0YA 1M19B 1KX3C 3MNNA 1KX3B 3AZFA 5E5AA 3AN2A 4H9QB 3NQUA 1M18C 3B6GC 1M18B 1P3KC 5GXQA 5DNND 3B6GB 2BYKA 3WA9C 5BT1D 1P3PC 5B40A 1P3PB 4KHAA 2F8NH 2L5AA 4J8XD 3W96D 4J8UB 1EQZC 3LELC 1M1AD 3LELB 4KGCD 3B6FC 1P3LB 3UT9A 5B24C 5B1LD 2PYOC 3RELD 2HIOC 4UUZA 5B2JC 3KUYB 2HIOB 3AZKA 1ID3D 2AROA 5CPID 3KWQD 5B2IC 3R45B 4WZSB 5B2IB 3AYWA 3X1UA 1KX4A 3W98A 3AZLD 3VH5W 3MNND 3AZFD 5DNNC 3AN2D 1HQ3A 5BT1C 4Z66B 5BS7C 5CPJA 4H9SA 3AZMA 5B0ZD 3REKA 3MGRA 5JA4B 1P34C 1P34B 4J8XC 1M1AC 4XUJA 4KGCC 1N1JB 5AVBD 1M19A 4KGCB 3X1SD 1KX3A 4H9QA 5B32B 5JRGC 1M18A 5B1LC 3TU4D 3RELC 5JRGB 3LZ1C 3B6GA 1KX5D 3C1BB 3LZ1B 5B33C 3WTPD 4G91C 1ID3C 5B33B 1ID3B 3KWQC 2AROD 4H9NB 3KWQB 1P3PA 4YM6B 3AZNB 3AYWD 3REJC 3MNNC 3AFAD 4ZBJC 4G92C 3REJB 1P3MB 4ZBJB 5FUGB 4Z5TD 3MGQD 4G92B 3LELA 1P3GB 5DNMD 1BH8B 4CAYA 1P3LA 3B6FA 5B24A 5B0ZC 1R4VA 4H9RA 2HIOA 5B0ZB 3AZMD 3REKD 4H9PB 3MGRD 3R45A 1TZYB 5B2IA 1P3AB 4EO5C 1ZLAC 1ZLAB 5AVBC 5CPKC 3A6ND 3MVDB 5AVBB 3X1SC 5CPKB 2FJ7D 3VH5T 3TU4C 3AZJB 3TU4B 1KX5C 5DNNA 1F1EA 4JJNC 1M18D 3WTPC 3B6GD 4JJNB 5BNVB 2AROC 1BH9A 5BS7A 5G49B 1P3PD 3MGPC 3W99C 3B0BA 3MGPB 3W99B 5JA4A 1P3OB 1P34A 5B32G 3AFAC 1P3BD 3KXBC 3AFAB 3MGQC 4Z5TC 3KXBB 4J8UD 1M1AA 5DNMC 1N1JA 4KGCA 5DNMB 5C3IC 3NQJB 4QLCB 1P3LD 5B32A 5JRGA 5BO0A 3RELA 3LZ1A 3AZMC 4J8WC 3KUYD 5B33A 4J8WB 1ID3A 4H9NA 3KWQA 5CHLB 2JSSA 3AZNA 5AV9D 3A6NC 5GT0D 4YS3B 2FJ7C 1S32B 3REJA 2FJ7B 3AZGD 1P3GA 1BFMA 3UTAD 4Z66D 5B0ZA 2LY8A 4H9PA 3REHC 3REHB 1P3AA 1P3BC 1P34D 1P3BB 4J8VB 4J8UC 4AWLC 1P3FB 3LZ0B 4AWLB 1ZLAA 5AVBA 3AV2C 5CPKA 1P3ID 3X1SA 3AV2B 1P3LC 3AZJA 5B32D 3TU4A 1KX5A 5JRGD 3KUYC 3C1BD 3WTPA 3LZ1D 4JJNA 3UTBD 5BNVA 5B33D 5G49A 4YM6D 1ULYA 3AZND 5AV9C 3MGPA 4HGAB 4CSRB 3W99A 5AV9B 5GT0C 5GT0B 1Q9CA 3AFAA 5AV5B 3AZGC 3KXBA 3REJD 3MGQA 4Z5TA 3AZGB 1P3MD 1P3GD 5DNMA 2RVQC 4R8PC 4R8PB 3UTAC 4Z66C 3UTAB 4J8WA 4Z2MG 5GT3B 1TZYD 1P3AD 1P3IC 1ZLAD 3A6NA 1P3IB 3MVDD 4YS3A 5CPKD 4WV4B 2FJ7A 5B32C 4XZQC 3AZJD 4NE5A 4XZQB 3C1BC 5B31B 3UTBC 3UTBB 4JJND 4WNNB 4YM6C 3AZNC 3WKJC 3MGPD 3W99D 3WKJB 2CWEA 3REHA 1P3OD 3C1CB 4KUDB 4DRAA 3O62C 1P3BA 3O62B 1P3MC 4J8UA 1TAFB 3KXBD 1P3GC 3KSYA 1U35B 3AV2A 4X23D 3REID 3W97B 4QLCD 5B1MB 3VH6A 5CP6B 3KUYA 4J8WD 1TZYC 1P3AC 5AV9A 4WU9C 4WU9B 5GT0A 3MVDC 3AV1B 5AV5A 4YS3D 1S32D 5B0YB 3AZJC 3AZGA 5E5AB 5F99B 3NQUB 4R8PA 2YFWB 3UTAA 4Z66A 2BYMB 4NE6A 2NZDC 2NZDB 5B40B 5GT3A 5BNXB 1P3OC 5KDMB 3REHD 4J8VD 5AY8D 5B31G 3AZHB 5GSUB 1P3FD 3LZ0D 1P3IA 4WU8C 4X23C 5AVCD 3REIC 4WU8B 1A7WA 4QLCC 4X23B 4ZUXB 3REIB 5AV6D 3AV2D 3AZIB 4XZQA 5AV8D 5B31A 3C1BA 3UTBA 3UT9B 3AZKB 3X1VD 4YM6A 2CV5C 2NQBD 3X1TD 2CV5B 3WKJA 4YS3C 1JFIB 1S32C 3O62A 3W98B 5AV5D 1P3MA 1TAFA 3V9RB 5FUGA 1U35A 1BH8A 2RVQD 4R8PD 1HQ3B 4LD9B 2YFVB 2F8ND 5GT3D 1B67A 1TZYA 4J8VC 5AY8C 5AY8B 3LZ0C 1P3FC 3VH6W 4WU9A 5AVCC 1F66D 3MVDA 4XUJB 5AVCB 3AZED 5AV6C 5AV6B 5AV8C 5AV8B 4XZQD 5F99A 5B31D 2YFWA 1P3KB 2BYMA 3X1VC 3X1VB 2NQBC 3X1TC 2NZDA 3WAAD 2NQBB 3WA9B 3X1TB 4HGAC 1B6WA 5BNXA 2F8NK 5KDMA 3WKJD 3MGSC 1P3OA 3C1CD 3MGSB 4KUDD 1AOIC 5AV5C 1AOIB 3O62D 3AZHA 5GSUA 1U35D 4WU8A 4X23A 3NQJA 4ZUXA 3REIA 4H9OB 4QLCA 1EQZB 3W97D 1WWIA 4CAYB 3AZIA 3B0CW 3B6FB 5B1MD 5CP6D
chains in the Genus database with same CATH superfamily
5B24B 5GT3C 2F8NB 4H9RB 2PYOB 5B2JB 3LJAC 2CV5A 3EPKA 3LJAB 3EPJA 1F66C 4WU9D 3AZEC 1F66B 1JFIA 3AV1D 3AZEB 3H0MC 1S32A 3V9RA 5B0YD 2VQRA 3H0LC 5B31C 5E5AD 5F99D 5DNNB 4LD9A 5GXQD 3WAAC 1H3OB 3WAAB 2NZDD 1BH9B 1WWSA 2YFVA 5B40D 3C1CC 4KUDC 4J8VA 5AY8A 3W96C 1U35C 3LZ0A 5GSUD 4J8XB 3VH6T 3AZHD 1P3FA 3W96B 5AVCA 1M1AB 3W97C 4WU8D 5AV6A 2Y2QA 4ZUXD 3WTPE 5B1MC 5AV8A 3AZID 5CP6C 3UT9D 5B1LB 5BO0B 3RELB 1P3KA 3X1VA 5CPIC 3AZKD 4G91B 5CPIB 2NQBA 3WA9A 3X1TA 3B0DC 2CV5D 4CSRA 1KU5A 3B0DB 4M6BA 2ZM5A 3MGSA 3AV1C 4E45A 3AZLC 1AOIA 5B0YC 3X1UD 1KX4D 3W98D 3AZLB 3AZFC 3MNNB 2IO5C 5E5AC 5F99C 3AZFB 3AN2C 2IO5B 3AN2B 4H9OA 1EQZA 5GXQC 2F8NG 1HQ3D 5GXQB 4LD9D 3B0CT 2BYKB 5B40C 5CPJD 2F8NA 2PYOA 4KHAB 5B2JA 3LJAA 3P5JB 5GSUC 3AZHC 1F66A 4EO5B 3AL0C 3AZEA 4XUJD 4ZUXC 4Z2MH 4DRBA 3AZIC 1M19D 3X1SB 1KX3D 3UT9C 1KX5B 2J8PA 1P3KD 3WTPB 4WNNA 3AZKC 4UUZB 1H3OA 3WAAA 2AROB 1HTAA 3VH5A 3WA9D 4NE3A 3C1CA 3AYWC 4KUDA 3X1UC 3MGSD 3AYWB 1KX4C 3W98C 3X1UB 1KX4B 2HUEC 1AOID 3W96A 2HUEB 4J8XA 4E44A 3MGQB 4Z5TB 1HQ3C 3W97A 3LELD 4NFTA 1EQZD 4LD9C 5C3IB 5B1MA 3B6FD 5CP6A 5CPJC 4H9SC 5B1LA 5CPJB 5B24D 2PYOD 3AZMB 2HIOD 3REKC 5CPIA 5B2JD 3MGRC 3REKB 3MGRB 3LJAD 5B2ID 3F6TA 4XUJC 3AV1A 2UWXA 3A6NB 3AZLA 1M19C 5B0YA 1M19B 1KX3C 3MNNA 1KX3B 3AZFA 5E5AA 3AN2A 4H9QB 3NQUA 1M18C 3B6GC 1M18B 1P3KC 5GXQA 5DNND 3B6GB 2BYKA 3WA9C 5BT1D 1P3PC 5B40A 1P3PB 4KHAA 2F8NH 2L5AA 4J8XD 3W96D 4J8UB 1EQZC 3LELC 1M1AD 3EPHA 3LELB 4KGCD 3B6FC 1P3LB 3UT9A 5B24C 5B1LD 2PYOC 3RELD 2HIOC 4UUZA 5B2JC 3KUYB 2HIOB 3AZKA 1ID3D 2AROA 5CPID 3KWQD 5B2IC 3R45B 4WZSB 5B2IB 3AYWA 3X1UA 1KX4A 2G5IC 3W98A 3AZLD 3VH5W 3MNND 3AZFD 5DNNC 3AN2D 1HQ3A 3A1KA 5BT1C 4Z66B 5BS7C 5CPJA 4H9SA 3AZMA 5B0ZD 2JCHA 3REKA 2ZY3A 3MGRA 5JA4B 1P34C 1P34B 4J8XC 1M1AC 4XUJA 2Y2LA 4KGCC 1N1JB 2DQNC 5AVBD 1M19A 4KGCB 3X1SD 1KX3A 4H9QA 5B32B 5JRGC 1M18A 5B1LC 3TU4D 3RELC 5JRGB 3LZ1C 3B6GA 1KX5D 3C1BB 3LZ1B 5B33C 3WTPD 4G91C 1ID3C 5B33B 1ID3B 3KWQC 2AROD 4H9NB 3KWQB 1P3PA 4YM6B 3AZNB 3AYWD 3IP4C 3REJC 3MNNC 3AFAD 4ZBJC 4G92C 3REJB 1P3MB 4ZBJB 5FUGB 4Z5TD 3MGQD 4G92B 3LELA 1P3GB 5DNMD 1BH8B 4CAYA 1P3LA 3A1IA 3B6FA 5B24A 5B0ZC 1R4VA 4H9RA 2HIOA 5B0ZB 3AZMD 3REKD 4H9PB 2JE5A 2Y2HA 3MGRD 3R45A 1TZYB 5B2IA 1P3AB 4EO5C 2XD1A 1ZLAC 1ZLAB 5AVBC 5CPKC 3A6ND 3MVDB 5AVBB 3X1SC 5CPKB 2FJ7D 3VH5T 3TU4C 3AZJB 3TU4B 1KX5C 5DNNA 1F1EA 4JJNC 1M18D 3WTPC 3B6GD 4JJNB 2AROC 5BNVB 4DQYB 1BH9A 5BS7A 5G49B 1P3PD 3MGPC 3W99C 3B0BA 3MGPB 3W99B 5JA4A 1P3OB 1P34A 5B32G 3AFAC 1P3BD 3KXBC 3AFAB 3MGQC 4Z5TC 3KXBB 4J8UD 1M1AA 5DNMC 1N1JA 4KGCA 5DNMB 1PZRA 5C3IC 3NQJB 4QLCB 1P3LD 5B32A 5JRGA 5BO0A 3RELA 3LZ1A 3AZMC 4J8WC 3KUYD 5B33A 4J8WB 1ID3A 4H9NA 3KWQA 5CHLB 2JSSA 3AZNA 5AV9D 3A6NC 5GT0D 4YS3B 2FJ7C 1S32B 3REJA 2FJ7B 3AZGD 1P3GA 1BFMA 3UTAD 2ZY5A 4Z66D 5B0ZA 2Y2GA 2LY8A 4H9PA 3REHC 3REHB 1P3AA 1P3BC 3FDDA 1P34D 1P3BB 4J8VB 4J8UC 4AWLC 1P3FB 3LZ0B 4AWLB 1ZLAA 5AVBA 3AV2C 5CPKA 1P3ID 3X1SA 3AV2B 1P3LC 3AZJA 5B32D 3TU4A 1KX5A 5JRGD 3KUYC 3C1BD 3WTPA 3LZ1D 4JJNA 3UTBD 5BNVA 5B33D 5G49A 4YM6D 1ULYA 3AZND 5AV9C 3MGPA 4HGAB 4CSRB 4UPKA 5AV9B 3W99A 5GT0C 5GT0B 1Q9CA 3AFAA 5AV5B 3AZGC 3KXBA 3REJD 3MGQA 4Z5TA 3AZGB 1P3MD 1P3GD 5DNMA 2RVQC 2Y2KA 4R8PC 4R8PB 3UTAC 4Z66C 3UTAB 4J8WA 4Z2MG 5GT3B 1Z2CB 1TZYD 1P3AD 1P3IC 1ZLAD 3A6NA 1P3IB 3MVDD 4YS3A 5CPKD 4WV4B 2FJ7A 5B32C 4XZQC 3AZJD 4NE5A 4XZQB 2RIQA 5B31B 3C1BC 3UTBC 3UTBB 4JJND 4WNNB 4YM6C 3AZNC 3WKJC 2F2AC 3MGPD 3W99D 3WKJB 2CWEA 3REHA 1P3OD 3C1CB 4KUDB 4DRAA 3O62C 1P3BA 3O62B 1P3MC 4J8UA 1TAFB 3KXBD 1P3GC 3KSYA 1U35B 3AV2A 4X23D 3REID 3W97B 4QLCD 3KFUG 5B1MB 3VH6A 2ZY4A 1W2EA 5CP6B 3KUYA 4J8WD 1TZYC 1P3AC 5AV9A 4WU9C 2Y2PA 5GT0A 3MVDC 4WU9B 3AV1B 5AV5A 4YS3D 1S32D 5B0YB 3AZJC 3AZGA 2Y2NA 5E5AB 5F99B 3NQUB 4R8PA 2YFWB 3UTAA 4Z66A 2BYMB 2DF4C 4NE6A 2NZDC 2NZDB 5B40B 5GT3A 5BNXB 1P3OC 5KDMB 3H0RC 3REHD 4J8VD 2G5HC 4WJ3C 5AY8D 5B31G 3AZHB 5GSUB 1P3FD 3LZ0D 1P3IA 4WU8C 4X23C 5AVCD 3REIC 4WU8B 1A7WA 4QLCC 4X23B 4ZUXB 3REIB 5AV6D 3AV2D 3AZIB 4XZQA 5AV8D 5B31A 3C1BA 3UTBA 3UT9B 2Y2MA 3AZKB 3X1VD 4YM6A 2CV5C 2NQBD 3X1TD 3EG5B 2CV5B 3WKJA 4YS3C 1JFIB 1S32C 3O62A 3W98B 5AV5D 1P3MA 1TAFA 3V9RB 5FUGA 1U35A 1BH8A 2RVQD 4R8PD 1HQ3B 4LD9B 1T3UA 2YFVB 2F8ND 5GT3D 1B67A 1TZYA 4J8VC 5AY8C 5AY8B 3LZ0C 1P3FC 3VH6W 4WU9A 5AVCC 1F66D 3MVDA 4XUJB 5AVCB 3AZED 5AV6C 5AV6B 5AV8C 5AV8B 4XZQD 5F99A 5B31D 2Y2IA 2XD5A 2YFWA 1P3KB 2BYMA 3X1VC 3X1VB 2NQBC 3X1TC 2NZDA 3WAAD 2NQBB 3WA9B 3X1TB 4HGAC 1B6WA 5BNXA 2F8NK 5KDMA 3WKJD 2W8SA 3MGSC 1P3OA 3C1CD 3MGSB 4KUDD 1AOIC 5AV5C 3EPLA 1AOIB 3O62D 3AZHA 5GSUA 2Y2OA 1U35D 4WU8A 4X23A 2ZY2A 3NQJA 4ZUXA 4H9OB 4QLCA 3REIA 2Y2JA 1WWIA 4CAYB 3AZIA 1EQZB 3W97D 3B0CW 3B6FB 2FFFB 5B1MD 5CP6D 2BG1A
chains in the Genus database with same CATH topology
5B24B 5GT3C 2F8NB 4H9RB 2PYOB 5B2JB 3LJAC 2CV5A 3EPKA 3LJAB 3EPJA 1F66C 4WU9D 3AZEC 1F66B 1JFIA 3AV1D 3AZEB 3H0MC 1S32A 3V9RA 5B0YD 2VQRA 3H0LC 5B31C 5E5AD 5F99D 5DNNB 4LD9A 5GXQD 3WAAC 1H3OB 3WAAB 2NZDD 1BH9B 1WWSA 2YFVA 5B40D 3C1CC 4KUDC 4J8VA 5AY8A 3W96C 1U35C 3LZ0A 5GSUD 4J8XB 3VH6T 3AZHD 1P3FA 3W96B 5AVCA 1M1AB 3W97C 4WU8D 5AV6A 2Y2QA 4ZUXD 3WTPE 5B1MC 5AV8A 3AZID 5CP6C 3UT9D 5B1LB 5BO0B 3RELB 1P3KA 3X1VA 5CPIC 3AZKD 4G91B 5CPIB 2NQBA 3WA9A 3X1TA 3B0DC 2CV5D 4CSRA 1KU5A 3B0DB 4M6BA 2ZM5A 3MGSA 3AV1C 4E45A 3AZLC 1AOIA 5B0YC 3X1UD 1KX4D 3W98D 3AZLB 3AZFC 3MNNB 2IO5C 5E5AC 5F99C 3AZFB 3AN2C 2IO5B 3AN2B 4H9OA 1EQZA 5GXQC 2F8NG 1HQ3D 5GXQB 4LD9D 3B0CT 2BYKB 5B40C 5CPJD 2F8NA 2PYOA 4KHAB 5B2JA 3LJAA 3P5JB 5GSUC 3AZHC 1F66A 4EO5B 3AL0C 3AZEA 4XUJD 4ZUXC 4Z2MH 4DRBA 3AZIC 1M19D 3X1SB 1KX3D 3UT9C 1KX5B 2J8PA 1P3KD 3WTPB 4WNNA 3AZKC 4UUZB 1H3OA 3WAAA 2AROB 1HTAA 3VH5A 3WA9D 4NE3A 3C1CA 3AYWC 4KUDA 3X1UC 3MGSD 3AYWB 1KX4C 3W98C 3X1UB 1KX4B 2HUEC 1AOID 3W96A 2HUEB 4J8XA 4E44A 3MGQB 4Z5TB 1HQ3C 3W97A 3LELD 4NFTA 1EQZD 4LD9C 5C3IB 5B1MA 3B6FD 5CP6A 5CPJC 4H9SC 5B1LA 5CPJB 5B24D 2PYOD 3AZMB 2HIOD 3REKC 5CPIA 5B2JD 3MGRC 3REKB 3MGRB 3LJAD 5B2ID 3F6TA 4XUJC 3AV1A 2UWXA 3A6NB 3AZLA 1M19C 5B0YA 1M19B 1KX3C 3MNNA 1KX3B 3AZFA 5E5AA 3AN2A 4H9QB 3NQUA 1M18C 3B6GC 1M18B 1P3KC 5GXQA 5DNND 3B6GB 2BYKA 3WA9C 5BT1D 1P3PC 5B40A 1P3PB 4KHAA 2F8NH 2L5AA 4J8XD 3W96D 4J8UB 1EQZC 3LELC 1M1AD 3EPHA 3LELB 4KGCD 3B6FC 1P3LB 3UT9A 5B24C 5B1LD 2PYOC 3RELD 2HIOC 4UUZA 5B2JC 3KUYB 2HIOB 3AZKA 1ID3D 2AROA 5CPID 3KWQD 5B2IC 3R45B 4WZSB 5B2IB 3AYWA 3X1UA 1KX4A 2G5IC 3W98A 3AZLD 3VH5W 3MNND 3AZFD 5DNNC 3AN2D 1HQ3A 3A1KA 5BT1C 4Z66B 5BS7C 5CPJA 4H9SA 3AZMA 5B0ZD 2JCHA 3REKA 2ZY3A 3MGRA 5JA4B 1P34C 1P34B 4J8XC 1M1AC 4XUJA 2Y2LA 4KGCC 1N1JB 2DQNC 5AVBD 1M19A 4KGCB 3X1SD 1KX3A 4H9QA 5B32B 5JRGC 1M18A 5B1LC 3TU4D 3RELC 5JRGB 3LZ1C 3B6GA 1KX5D 3C1BB 3LZ1B 5B33C 3WTPD 4G91C 1ID3C 5B33B 1ID3B 3KWQC 2AROD 4H9NB 3KWQB 1P3PA 4YM6B 3AZNB 3AYWD 3IP4C 3REJC 3MNNC 3AFAD 4ZBJC 4G92C 3REJB 1P3MB 4ZBJB 5FUGB 4Z5TD 3MGQD 4G92B 3LELA 1P3GB 5DNMD 1BH8B 4CAYA 1P3LA 3A1IA 3B6FA 5B24A 5B0ZC 1R4VA 4H9RA 2HIOA 5B0ZB 3AZMD 3REKD 4H9PB 2JE5A 2Y2HA 3MGRD 3R45A 1TZYB 5B2IA 1P3AB 4EO5C 2XD1A 1ZLAC 1ZLAB 5AVBC 5CPKC 3A6ND 3MVDB 5AVBB 3X1SC 5CPKB 2FJ7D 3VH5T 3TU4C 3AZJB 3TU4B 1KX5C 5DNNA 1F1EA 4JJNC 1M18D 3WTPC 3B6GD 4JJNB 2AROC 5BNVB 4DQYB 1BH9A 5BS7A 5G49B 1P3PD 3MGPC 3W99C 3B0BA 3MGPB 3W99B 5JA4A 1P3OB 1P34A 5B32G 3AFAC 1P3BD 3KXBC 3AFAB 3MGQC 4Z5TC 3KXBB 4J8UD 1M1AA 5DNMC 1N1JA 4KGCA 5DNMB 1PZRA 5C3IC 3NQJB 4QLCB 1P3LD 5B32A 5JRGA 5BO0A 3RELA 3LZ1A 3AZMC 4J8WC 3KUYD 5B33A 4J8WB 1ID3A 4H9NA 3KWQA 5CHLB 2JSSA 3AZNA 5AV9D 3A6NC 5GT0D 4YS3B 2FJ7C 1S32B 3REJA 2FJ7B 3AZGD 1P3GA 1BFMA 3UTAD 2ZY5A 4Z66D 5B0ZA 2Y2GA 2LY8A 4H9PA 3REHC 3REHB 1P3AA 1P3BC 3FDDA 1P34D 1P3BB 4J8VB 4J8UC 4AWLC 1P3FB 3LZ0B 4AWLB 1ZLAA 5AVBA 3AV2C 5CPKA 1P3ID 3X1SA 3AV2B 1P3LC 3AZJA 5B32D 3TU4A 1KX5A 5JRGD 3KUYC 3C1BD 3WTPA 3LZ1D 4JJNA 3UTBD 5BNVA 5B33D 5G49A 4YM6D 1ULYA 3AZND 5AV9C 3MGPA 4HGAB 4CSRB 4UPKA 5AV9B 3W99A 5GT0C 5GT0B 1Q9CA 3AFAA 5AV5B 3AZGC 3KXBA 3REJD 3MGQA 4Z5TA 3AZGB 1P3MD 1P3GD 5DNMA 2RVQC 2Y2KA 4R8PC 4R8PB 3UTAC 4Z66C 3UTAB 4J8WA 4Z2MG 5GT3B 1Z2CB 1TZYD 1P3AD 1P3IC 1ZLAD 3A6NA 1P3IB 3MVDD 4YS3A 5CPKD 4WV4B 2FJ7A 5B32C 4XZQC 3AZJD 4NE5A 4XZQB 2RIQA 5B31B 3C1BC 3UTBC 3UTBB 4JJND 4WNNB 4YM6C 3AZNC 3WKJC 2F2AC 3MGPD 3W99D 3WKJB 2CWEA 3REHA 1P3OD 3C1CB 4KUDB 4DRAA 3O62C 1P3BA 3O62B 1P3MC 4J8UA 1TAFB 3KXBD 1P3GC 3KSYA 1U35B 3AV2A 4X23D 3REID 3W97B 4QLCD 3KFUG 5B1MB 3VH6A 2ZY4A 1W2EA 5CP6B 3KUYA 4J8WD 1TZYC 1P3AC 5AV9A 4WU9C 2Y2PA 5GT0A 3MVDC 4WU9B 3AV1B 5AV5A 4YS3D 1S32D 5B0YB 3AZJC 3AZGA 2Y2NA 5E5AB 5F99B 3NQUB 4R8PA 2YFWB 3UTAA 4Z66A 2BYMB 2DF4C 4NE6A 2NZDC 2NZDB 5B40B 5GT3A 5BNXB 1P3OC 5KDMB 3H0RC 3REHD 4J8VD 2G5HC 4WJ3C 5AY8D 5B31G 3AZHB 5GSUB 1P3FD 3LZ0D 1P3IA 4WU8C 4X23C 5AVCD 3REIC 4WU8B 1A7WA 4QLCC 4X23B 4ZUXB 3REIB 5AV6D 3AV2D 3AZIB 4XZQA 5AV8D 5B31A 3C1BA 3UTBA 3UT9B 2Y2MA 3AZKB 3X1VD 4YM6A 2CV5C 2NQBD 3X1TD 3EG5B 2CV5B 3WKJA 4YS3C 1JFIB 1S32C 3O62A 3W98B 5AV5D 1P3MA 1TAFA 3V9RB 5FUGA 1U35A 1BH8A 2RVQD 4R8PD 1HQ3B 4LD9B 1T3UA 2YFVB 2F8ND 5GT3D 1B67A 1TZYA 4J8VC 5AY8C 5AY8B 3LZ0C 1P3FC 3VH6W 4WU9A 5AVCC 1F66D 3MVDA 4XUJB 5AVCB 3AZED 5AV6C 5AV6B 5AV8C 5AV8B 4XZQD 5F99A 5B31D 2Y2IA 2XD5A 2YFWA 1P3KB 2BYMA 3X1VC 3X1VB 2NQBC 3X1TC 2NZDA 3WAAD 2NQBB 3WA9B 3X1TB 4HGAC 1B6WA 5BNXA 2F8NK 5KDMA 3WKJD 2W8SA 3MGSC 1P3OA 3C1CD 3MGSB 4KUDD 1AOIC 5AV5C 3EPLA 1AOIB 3O62D 3AZHA 5GSUA 2Y2OA 1U35D 4WU8A 4X23A 2ZY2A 3NQJA 4ZUXA 4H9OB 4QLCA 3REIA 2Y2JA 1WWIA 4CAYB 3AZIA 1EQZB 3W97D 3B0CW 3B6FB 2FFFB 5B1MD 5CP6D 2BG1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5B24 B;  5GT3 C;  2F8N B;  4H9R B;  2PYO B;  5B2J B;  3LJA C;  2CV5 A;  3LJA B;  1F66 C;  4WU9 D;  3AZE C;  1F66 B;  1JFI A;  3AV1 D;  3AZE B;  1S32 A;  3V9R A;  5B0Y D;  5B31 C;  5E5A D;  5F99 D;  5DNN B;  4LD9 A;  5GXQ D;  3WAA C;  1H3O B;  3WAA B;  2NZD D;  1BH9 B;  1WWS A;  2YFV A;  5B40 D;  3C1C C;  4KUD C;  4J8V A;  5AY8 A;  3W96 C;  1U35 C;  3LZ0 A;  5GSU D;  4J8X B;  3VH6 T;  3AZH D;  1P3F A;  3W96 B;  5AVC A;  1M1A B;  3W97 C;  4WU8 D;  5AV6 A;  4ZUX D;  3WTP E;  5B1M C;  5AV8 A;  3AZI D;  5CP6 C;  3UT9 D;  5B1L B;  5BO0 B;  3REL B;  1P3K A;  3X1V A;  5CPI C;  3AZK D;  4G91 B;  5CPI B;  2NQB A;  3WA9 A;  3X1T A;  3B0D C;  2CV5 D;  4CSR A;  1KU5 A;  3B0D B;  4M6B A;  3MGS A;  3AV1 C;  4E45 A;  3AZL C;  1AOI A;  5B0Y C;  3X1U D;  1KX4 D;  3W98 D;  3AZL B;  3AZF C;  3MNN B;  2IO5 C;  5E5A C;  5F99 C;  3AZF B;  3AN2 C;  2IO5 B;  3AN2 B;  4H9O A;  1EQZ A;  5GXQ C;  2F8N G;  1HQ3 D;  5GXQ B;  4LD9 D;  3B0C T;  2BYK B;  5B40 C;  5CPJ D;  2F8N A;  2PYO A;  4KHA B;  5B2J A;  3LJA A;  3AZH C;  5GSU C;  1F66 A;  4EO5 B;  3AZE A;  4XUJ D;  4ZUX C;  4Z2M H;  4DRB A;  3AZI C;  1M19 D;  3X1S B;  1KX3 D;  3UT9 C;  1KX5 B;  1P3K D;  3WTP B;  4WNN A;  3AZK C;  4UUZ B;  1H3O A;  3WAA A;  2ARO B;  1HTA A;  3VH5 A;  3WA9 D;  4NE3 A;  3C1C A;  3AYW C;  4KUD A;  3X1U C;  3MGS D;  3AYW B;  1KX4 C;  3W98 C;  3X1U B;  1KX4 B;  2HUE C;  1AOI D;  3W96 A;  2HUE B;  4J8X A;  4E44 A;  3MGQ B;  4Z5T B;  1HQ3 C;  3W97 A;  3LEL D;  4NFT A;  1EQZ D;  4LD9 C;  5C3I B;  5B1M A;  3B6F D;  5CP6 A;  5CPJ C;  4H9S C;  5B1L A;  5CPJ B;  5B24 D;  2PYO D;  3AZM B;  2HIO D;  3REK C;  5CPI A;  5B2J D;  3MGR C;  3REK B;  3MGR B;  3LJA D;  5B2I D;  4XUJ C;  3AV1 A;  3A6N B;  3AZL A;  1M19 C;  5B0Y A;  1M19 B;  1KX3 C;  3MNN A;  1KX3 B;  3AZF A;  5E5A A;  3AN2 A;  4H9Q B;  3NQU A;  1M18 C;  3B6G C;  1M18 B;  1P3K C;  5GXQ A;  5DNN D;  3B6G B;  2BYK A;  3WA9 C;  5BT1 D;  1P3P C;  5B40 A;  1P3P B;  4KHA A;  2F8N H;  2L5A A;  4J8X D;  3W96 D;  4J8U B;  1EQZ C;  3LEL C;  1M1A D;  3LEL B;  4KGC D;  3B6F C;  1P3L B;  3UT9 A;  5B24 C;  5B1L D;  2PYO C;  3REL D;  2HIO C;  4UUZ A;  5B2J C;  3KUY B;  2HIO B;  3AZK A;  1ID3 D;  2ARO A;  5CPI D;  3KWQ D;  5B2I C;  3R45 B;  4WZS B;  5B2I B;  3AYW A;  3X1U A;  1KX4 A;  3W98 A;  3AZL D;  3VH5 W;  3MNN D;  3AZF D;  5DNN C;  3AN2 D;  1HQ3 A;  5BT1 C;  4Z66 B;  5BS7 C;  5CPJ A;  4H9S A;  3AZM A;  5B0Z D;  3REK A;  3MGR A;  5JA4 B;  1P34 C;  1P34 B;  4J8X C;  1M1A C;  4XUJ A;  4KGC C;  1N1J B;  5AVB D;  1M19 A;  4KGC B;  3X1S D;  1KX3 A;  4H9Q A;  5B32 B;  5JRG C;  1M18 A;  5B1L C;  3TU4 D;  3REL C;  5JRG B;  3LZ1 C;  3B6G A;  1KX5 D;  3C1B B;  3LZ1 B;  5B33 C;  3WTP D;  4G91 C;  1ID3 C;  5B33 B;  1ID3 B;  3KWQ C;  2ARO D;  4H9N B;  3KWQ B;  1P3P A;  4YM6 B;  3AZN B;  3AYW D;  3REJ C;  3MNN C;  3AFA D;  4ZBJ C;  4G92 C;  3REJ B;  1P3M B;  4ZBJ B;  5FUG B;  4Z5T D;  3MGQ D;  4G92 B;  3LEL A;  1P3G B;  5DNM D;  1BH8 B;  4CAY A;  1P3L A;  3B6F A;  5B24 A;  5B0Z C;  1R4V A;  4H9R A;  2HIO A;  5B0Z B;  3AZM D;  3REK D;  4H9P B;  3MGR D;  3R45 A;  1TZY B;  5B2I A;  1P3A B;  4EO5 C;  1ZLA C;  1ZLA B;  5AVB C;  5CPK C;  3A6N D;  3MVD B;  5AVB B;  3X1S C;  5CPK B;  2FJ7 D;  3VH5 T;  3TU4 C;  3AZJ B;  3TU4 B;  1KX5 C;  5DNN A;  1F1E A;  4JJN C;  1M18 D;  3WTP C;  3B6G D;  4JJN B;  5BNV B;  2ARO C;  1BH9 A;  5BS7 A;  5G49 B;  1P3P D;  3MGP C;  3W99 C;  3B0B A;  3MGP B;  3W99 B;  5JA4 A;  1P3O B;  1P34 A;  5B32 G;  3AFA C;  1P3B D;  3KXB C;  3AFA B;  3MGQ C;  4Z5T C;  3KXB B;  4J8U D;  1M1A A;  5DNM C;  1N1J A;  4KGC A;  5DNM B;  5C3I C;  3NQJ B;  4QLC B;  1P3L D;  5B32 A;  5JRG A;  5BO0 A;  3REL A;  3LZ1 A;  3AZM C;  4J8W C;  3KUY D;  5B33 A;  4J8W B;  1ID3 A;  4H9N A;  3KWQ A;  5CHL B;  2JSS A;  3AZN A;  5AV9 D;  3A6N C;  5GT0 D;  4YS3 B;  2FJ7 C;  1S32 B;  3REJ A;  2FJ7 B;  3AZG D;  1P3G A;  1BFM A;  3UTA D;  4Z66 D;  5B0Z A;  2LY8 A;  4H9P A;  3REH C;  3REH B;  1P3A A;  1P3B C;  1P34 D;  1P3B B;  4J8V B;  4J8U C;  4AWL C;  1P3F B;  3LZ0 B;  4AWL B;  1ZLA A;  5AVB A;  3AV2 C;  5CPK A;  1P3I D;  3X1S A;  3AV2 B;  1P3L C;  3AZJ A;  5B32 D;  3TU4 A;  1KX5 A;  5JRG D;  3KUY C;  3C1B D;  3WTP A;  3LZ1 D;  4JJN A;  3UTB D;  5BNV A;  5B33 D;  5G49 A;  4YM6 D;  1ULY A;  3AZN D;  5AV9 C;  3MGP A;  4HGA B;  4CSR B;  3W99 A;  5AV9 B;  5GT0 C;  5GT0 B;  1Q9C A;  3AFA A;  5AV5 B;  3AZG C;  3KXB A;  3REJ D;  3MGQ A;  4Z5T A;  3AZG B;  1P3M D;  1P3G D;  5DNM A;  2RVQ C;  4R8P C;  4R8P B;  3UTA C;  4Z66 C;  3UTA B;  4J8W A;  4Z2M G;  5GT3 B;  1TZY D;  1P3A D;  1P3I C;  1ZLA D;  3A6N A;  1P3I B;  3MVD D;  4YS3 A;  5CPK D;  4WV4 B;  2FJ7 A;  5B32 C;  4XZQ C;  3AZJ D;  4NE5 A;  4XZQ B;  3C1B C;  5B31 B;  3UTB C;  3UTB B;  4JJN D;  4WNN B;  4YM6 C;  3AZN C;  3WKJ C;  3MGP D;  3W99 D;  3WKJ B;  2CWE A;  3REH A;  1P3O D;  3C1C B;  4KUD B;  4DRA A;  3O62 C;  1P3B A;  3O62 B;  1P3M C;  4J8U A;  1TAF B;  3KXB D;  1P3G C;  3KSY A;  1U35 B;  3AV2 A;  4X23 D;  3REI D;  3W97 B;  4QLC D;  5B1M B;  3VH6 A;  5CP6 B;  3KUY A;  4J8W D;  1TZY C;  1P3A C;  5AV9 A;  4WU9 C;  4WU9 B;  5GT0 A;  3MVD C;  3AV1 B;  5AV5 A;  4YS3 D;  1S32 D;  5B0Y B;  3AZJ C;  3AZG A;  5E5A B;  5F99 B;  3NQU B;  4R8P A;  2YFW B;  3UTA A;  4Z66 A;  2BYM B;  4NE6 A;  2NZD C;  2NZD B;  5B40 B;  5GT3 A;  5BNX B;  1P3O C;  5KDM B;  3REH D;  4J8V D;  5AY8 D;  5B31 G;  3AZH B;  5GSU B;  1P3F D;  3LZ0 D;  1P3I A;  4WU8 C;  4X23 C;  5AVC D;  3REI C;  4WU8 B;  1A7W A;  4QLC C;  4X23 B;  4ZUX B;  3REI B;  5AV6 D;  3AV2 D;  3AZI B;  4XZQ A;  5AV8 D;  5B31 A;  3C1B A;  3UTB A;  3UT9 B;  3AZK B;  3X1V D;  4YM6 A;  2CV5 C;  2NQB D;  3X1T D;  2CV5 B;  3WKJ A;  4YS3 C;  1JFI B;  1S32 C;  3O62 A;  3W98 B;  5AV5 D;  1P3M A;  1TAF A;  3V9R B;  5FUG A;  1U35 A;  1BH8 A;  2RVQ D;  4R8P D;  1HQ3 B;  4LD9 B;  2YFV B;  2F8N D;  5GT3 D;  1B67 A;  1TZY A;  4J8V C;  5AY8 C;  5AY8 B;  3LZ0 C;  1P3F C;  3VH6 W;  4WU9 A;  5AVC C;  1F66 D;  3MVD A;  4XUJ B;  5AVC B;  3AZE D;  5AV6 C;  5AV6 B;  5AV8 C;  5AV8 B;  4XZQ D;  5F99 A;  5B31 D;  2YFW A;  1P3K B;  2BYM A;  3X1V C;  3X1V B;  2NQB C;  3X1T C;  2NZD A;  3WAA D;  2NQB B;  3WA9 B;  3X1T B;  4HGA C;  1B6W A;  5BNX A;  2F8N K;  5KDM A;  3WKJ D;  3MGS C;  1P3O A;  3C1C D;  3MGS B;  4KUD D;  1AOI C;  5AV5 C;  1AOI B;  3O62 D;  3AZH A;  5GSU A;  1U35 D;  4WU8 A;  4X23 A;  3NQJ A;  4ZUX A;  3REI A;  4H9O B;  4QLC A;  1EQZ B;  3W97 D;  1WWI A;  4CAY B;  3AZI A;  3B0C W;  3B6F B;  5B1M D;  5CP6 D; 
#chains in the Genus database with same CATH topology
 5B24 B;  5GT3 C;  2F8N B;  4H9R B;  2PYO B;  5B2J B;  3LJA C;  2CV5 A;  3EPK A;  3LJA B;  3EPJ A;  1F66 C;  4WU9 D;  3AZE C;  1F66 B;  1JFI A;  3AV1 D;  3AZE B;  3H0M C;  1S32 A;  3V9R A;  5B0Y D;  2VQR A;  3H0L C;  5B31 C;  5E5A D;  5F99 D;  5DNN B;  4LD9 A;  5GXQ D;  3WAA C;  1H3O B;  3WAA B;  2NZD D;  1BH9 B;  1WWS A;  2YFV A;  5B40 D;  3C1C C;  4KUD C;  4J8V A;  5AY8 A;  3W96 C;  1U35 C;  3LZ0 A;  5GSU D;  4J8X B;  3VH6 T;  3AZH D;  1P3F A;  3W96 B;  5AVC A;  1M1A B;  3W97 C;  4WU8 D;  5AV6 A;  2Y2Q A;  4ZUX D;  3WTP E;  5B1M C;  5AV8 A;  3AZI D;  5CP6 C;  3UT9 D;  5B1L B;  5BO0 B;  3REL B;  1P3K A;  3X1V A;  5CPI C;  3AZK D;  4G91 B;  5CPI B;  2NQB A;  3WA9 A;  3X1T A;  3B0D C;  2CV5 D;  4CSR A;  1KU5 A;  3B0D B;  4M6B A;  2ZM5 A;  3MGS A;  3AV1 C;  4E45 A;  3AZL C;  1AOI A;  5B0Y C;  3X1U D;  1KX4 D;  3W98 D;  3AZL B;  3AZF C;  3MNN B;  2IO5 C;  5E5A C;  5F99 C;  3AZF B;  3AN2 C;  2IO5 B;  3AN2 B;  4H9O A;  1EQZ A;  5GXQ C;  2F8N G;  1HQ3 D;  5GXQ B;  4LD9 D;  3B0C T;  2BYK B;  5B40 C;  5CPJ D;  2F8N A;  2PYO A;  4KHA B;  5B2J A;  3LJA A;  3P5J B;  5GSU C;  3AZH C;  1F66 A;  4EO5 B;  3AL0 C;  3AZE A;  4XUJ D;  4ZUX C;  4Z2M H;  4DRB A;  3AZI C;  1M19 D;  3X1S B;  1KX3 D;  3UT9 C;  1KX5 B;  2J8P A;  1P3K D;  3WTP B;  4WNN A;  3AZK C;  4UUZ B;  1H3O A;  3WAA A;  2ARO B;  1HTA A;  3VH5 A;  3WA9 D;  4NE3 A;  3C1C A;  3AYW C;  4KUD A;  3X1U C;  3MGS D;  3AYW B;  1KX4 C;  3W98 C;  3X1U B;  1KX4 B;  2HUE C;  1AOI D;  3W96 A;  2HUE B;  4J8X A;  4E44 A;  3MGQ B;  4Z5T B;  1HQ3 C;  3W97 A;  3LEL D;  4NFT A;  1EQZ D;  4LD9 C;  5C3I B;  5B1M A;  3B6F D;  5CP6 A;  5CPJ C;  4H9S C;  5B1L A;  5CPJ B;  5B24 D;  2PYO D;  3AZM B;  2HIO D;  3REK C;  5CPI A;  5B2J D;  3MGR C;  3REK B;  3MGR B;  3LJA D;  5B2I D;  3F6T A;  4XUJ C;  3AV1 A;  2UWX A;  3A6N B;  3AZL A;  1M19 C;  5B0Y A;  1M19 B;  1KX3 C;  3MNN A;  1KX3 B;  3AZF A;  5E5A A;  3AN2 A;  4H9Q B;  3NQU A;  1M18 C;  3B6G C;  1M18 B;  1P3K C;  5GXQ A;  5DNN D;  3B6G B;  2BYK A;  3WA9 C;  5BT1 D;  1P3P C;  5B40 A;  1P3P B;  4KHA A;  2F8N H;  2L5A A;  4J8X D;  3W96 D;  4J8U B;  1EQZ C;  3LEL C;  1M1A D;  3EPH A;  3LEL B;  4KGC D;  3B6F C;  1P3L B;  3UT9 A;  5B24 C;  5B1L D;  2PYO C;  3REL D;  2HIO C;  4UUZ A;  5B2J C;  3KUY B;  2HIO B;  3AZK A;  1ID3 D;  2ARO A;  5CPI D;  3KWQ D;  5B2I C;  3R45 B;  4WZS B;  5B2I B;  3AYW A;  3X1U A;  1KX4 A;  2G5I C;  3W98 A;  3AZL D;  3VH5 W;  3MNN D;  3AZF D;  5DNN C;  3AN2 D;  1HQ3 A;  3A1K A;  5BT1 C;  4Z66 B;  5BS7 C;  5CPJ A;  4H9S A;  3AZM A;  5B0Z D;  2JCH A;  3REK A;  2ZY3 A;  3MGR A;  5JA4 B;  1P34 C;  1P34 B;  4J8X C;  1M1A C;  4XUJ A;  2Y2L A;  4KGC C;  1N1J B;  2DQN C;  5AVB D;  1M19 A;  4KGC B;  3X1S D;  1KX3 A;  4H9Q A;  5B32 B;  5JRG C;  1M18 A;  5B1L C;  3TU4 D;  3REL C;  5JRG B;  3LZ1 C;  3B6G A;  1KX5 D;  3C1B B;  3LZ1 B;  5B33 C;  3WTP D;  4G91 C;  1ID3 C;  5B33 B;  1ID3 B;  3KWQ C;  2ARO D;  4H9N B;  3KWQ B;  1P3P A;  4YM6 B;  3AZN B;  3AYW D;  3IP4 C;  3REJ C;  3MNN C;  3AFA D;  4ZBJ C;  4G92 C;  3REJ B;  1P3M B;  4ZBJ B;  5FUG B;  4Z5T D;  3MGQ D;  4G92 B;  3LEL A;  1P3G B;  5DNM D;  1BH8 B;  4CAY A;  1P3L A;  3A1I A;  3B6F A;  5B24 A;  5B0Z C;  1R4V A;  4H9R A;  2HIO A;  5B0Z B;  3AZM D;  3REK D;  4H9P B;  2JE5 A;  2Y2H A;  3MGR D;  3R45 A;  1TZY B;  5B2I A;  1P3A B;  4EO5 C;  2XD1 A;  1ZLA C;  1ZLA B;  5AVB C;  5CPK C;  3A6N D;  3MVD B;  5AVB B;  3X1S C;  5CPK B;  2FJ7 D;  3VH5 T;  3TU4 C;  3AZJ B;  3TU4 B;  1KX5 C;  5DNN A;  1F1E A;  4JJN C;  1M18 D;  3WTP C;  3B6G D;  4JJN B;  2ARO C;  5BNV B;  4DQY B;  1BH9 A;  5BS7 A;  5G49 B;  1P3P D;  3MGP C;  3W99 C;  3B0B A;  3MGP B;  3W99 B;  5JA4 A;  1P3O B;  1P34 A;  5B32 G;  3AFA C;  1P3B D;  3KXB C;  3AFA B;  3MGQ C;  4Z5T C;  3KXB B;  4J8U D;  1M1A A;  5DNM C;  1N1J A;  4KGC A;  5DNM B;  1PZR A;  5C3I C;  3NQJ B;  4QLC B;  1P3L D;  5B32 A;  5JRG A;  5BO0 A;  3REL A;  3LZ1 A;  3AZM C;  4J8W C;  3KUY D;  5B33 A;  4J8W B;  1ID3 A;  4H9N A;  3KWQ A;  5CHL B;  2JSS A;  3AZN A;  5AV9 D;  3A6N C;  5GT0 D;  4YS3 B;  2FJ7 C;  1S32 B;  3REJ A;  2FJ7 B;  3AZG D;  1P3G A;  1BFM A;  3UTA D;  2ZY5 A;  4Z66 D;  5B0Z A;  2Y2G A;  2LY8 A;  4H9P A;  3REH C;  3REH B;  1P3A A;  1P3B C;  3FDD A;  1P34 D;  1P3B B;  4J8V B;  4J8U C;  4AWL C;  1P3F B;  3LZ0 B;  4AWL B;  1ZLA A;  5AVB A;  3AV2 C;  5CPK A;  1P3I D;  3X1S A;  3AV2 B;  1P3L C;  3AZJ A;  5B32 D;  3TU4 A;  1KX5 A;  5JRG D;  3KUY C;  3C1B D;  3WTP A;  3LZ1 D;  4JJN A;  3UTB D;  5BNV A;  5B33 D;  5G49 A;  4YM6 D;  1ULY A;  3AZN D;  5AV9 C;  3MGP A;  4HGA B;  4CSR B;  4UPK A;  5AV9 B;  3W99 A;  5GT0 C;  5GT0 B;  1Q9C A;  3AFA A;  5AV5 B;  3AZG C;  3KXB A;  3REJ D;  3MGQ A;  4Z5T A;  3AZG B;  1P3M D;  1P3G D;  5DNM A;  2RVQ C;  2Y2K A;  4R8P C;  4R8P B;  3UTA C;  4Z66 C;  3UTA B;  4J8W A;  4Z2M G;  5GT3 B;  1Z2C B;  1TZY D;  1P3A D;  1P3I C;  1ZLA D;  3A6N A;  1P3I B;  3MVD D;  4YS3 A;  5CPK D;  4WV4 B;  2FJ7 A;  5B32 C;  4XZQ C;  3AZJ D;  4NE5 A;  4XZQ B;  2RIQ A;  5B31 B;  3C1B C;  3UTB C;  3UTB B;  4JJN D;  4WNN B;  4YM6 C;  3AZN C;  3WKJ C;  2F2A C;  3MGP D;  3W99 D;  3WKJ B;  2CWE A;  3REH A;  1P3O D;  3C1C B;  4KUD B;  4DRA A;  3O62 C;  1P3B A;  3O62 B;  1P3M C;  4J8U A;  1TAF B;  3KXB D;  1P3G C;  3KSY A;  1U35 B;  3AV2 A;  4X23 D;  3REI D;  3W97 B;  4QLC D;  3KFU G;  5B1M B;  3VH6 A;  2ZY4 A;  1W2E A;  5CP6 B;  3KUY A;  4J8W D;  1TZY C;  1P3A C;  5AV9 A;  4WU9 C;  2Y2P A;  5GT0 A;  3MVD C;  4WU9 B;  3AV1 B;  5AV5 A;  4YS3 D;  1S32 D;  5B0Y B;  3AZJ C;  3AZG A;  2Y2N A;  5E5A B;  5F99 B;  3NQU B;  4R8P A;  2YFW B;  3UTA A;  4Z66 A;  2BYM B;  2DF4 C;  4NE6 A;  2NZD C;  2NZD B;  5B40 B;  5GT3 A;  5BNX B;  1P3O C;  5KDM B;  3H0R C;  3REH D;  4J8V D;  2G5H C;  4WJ3 C;  5AY8 D;  5B31 G;  3AZH B;  5GSU B;  1P3F D;  3LZ0 D;  1P3I A;  4WU8 C;  4X23 C;  5AVC D;  3REI C;  4WU8 B;  1A7W A;  4QLC C;  4X23 B;  4ZUX B;  3REI B;  5AV6 D;  3AV2 D;  3AZI B;  4XZQ A;  5AV8 D;  5B31 A;  3C1B A;  3UTB A;  3UT9 B;  2Y2M A;  3AZK B;  3X1V D;  4YM6 A;  2CV5 C;  2NQB D;  3X1T D;  3EG5 B;  2CV5 B;  3WKJ A;  4YS3 C;  1JFI B;  1S32 C;  3O62 A;  3W98 B;  5AV5 D;  1P3M A;  1TAF A;  3V9R B;  5FUG A;  1U35 A;  1BH8 A;  2RVQ D;  4R8P D;  1HQ3 B;  4LD9 B;  1T3U A;  2YFV B;  2F8N D;  5GT3 D;  1B67 A;  1TZY A;  4J8V C;  5AY8 C;  5AY8 B;  3LZ0 C;  1P3F C;  3VH6 W;  4WU9 A;  5AVC C;  1F66 D;  3MVD A;  4XUJ B;  5AVC B;  3AZE D;  5AV6 C;  5AV6 B;  5AV8 C;  5AV8 B;  4XZQ D;  5F99 A;  5B31 D;  2Y2I A;  2XD5 A;  2YFW A;  1P3K B;  2BYM A;  3X1V C;  3X1V B;  2NQB C;  3X1T C;  2NZD A;  3WAA D;  2NQB B;  3WA9 B;  3X1T B;  4HGA C;  1B6W A;  5BNX A;  2F8N K;  5KDM A;  3WKJ D;  2W8S A;  3MGS C;  1P3O A;  3C1C D;  3MGS B;  4KUD D;  1AOI C;  5AV5 C;  3EPL A;  1AOI B;  3O62 D;  3AZH A;  5GSU A;  2Y2O A;  1U35 D;  4WU8 A;  4X23 A;  2ZY2 A;  3NQJ A;  4ZUX A;  4H9O B;  4QLC A;  3REI A;  2Y2J A;  1WWI A;  4CAY B;  3AZI A;  1EQZ B;  3W97 D;  3B0C W;  3B6F B;  2FFF B;  5B1M D;  5CP6 D;  2BG1 A; 
#chains in the Genus database with same CATH homology
 5B24 B;  5GT3 C;  2F8N B;  4H9R B;  2PYO B;  5B2J B;  3LJA C;  2CV5 A;  3EPK A;  3LJA B;  3EPJ A;  1F66 C;  4WU9 D;  3AZE C;  1F66 B;  1JFI A;  3AV1 D;  3AZE B;  3H0M C;  1S32 A;  3V9R A;  5B0Y D;  2VQR A;  3H0L C;  5B31 C;  5E5A D;  5F99 D;  5DNN B;  4LD9 A;  5GXQ D;  3WAA C;  1H3O B;  3WAA B;  2NZD D;  1BH9 B;  1WWS A;  2YFV A;  5B40 D;  3C1C C;  4KUD C;  4J8V A;  5AY8 A;  3W96 C;  1U35 C;  3LZ0 A;  5GSU D;  4J8X B;  3VH6 T;  3AZH D;  1P3F A;  3W96 B;  5AVC A;  1M1A B;  3W97 C;  4WU8 D;  5AV6 A;  2Y2Q A;  4ZUX D;  3WTP E;  5B1M C;  5AV8 A;  3AZI D;  5CP6 C;  3UT9 D;  5B1L B;  5BO0 B;  3REL B;  1P3K A;  3X1V A;  5CPI C;  3AZK D;  4G91 B;  5CPI B;  2NQB A;  3WA9 A;  3X1T A;  3B0D C;  2CV5 D;  4CSR A;  1KU5 A;  3B0D B;  4M6B A;  2ZM5 A;  3MGS A;  3AV1 C;  4E45 A;  3AZL C;  1AOI A;  5B0Y C;  3X1U D;  1KX4 D;  3W98 D;  3AZL B;  3AZF C;  3MNN B;  2IO5 C;  5E5A C;  5F99 C;  3AZF B;  3AN2 C;  2IO5 B;  3AN2 B;  4H9O A;  1EQZ A;  5GXQ C;  2F8N G;  1HQ3 D;  5GXQ B;  4LD9 D;  3B0C T;  2BYK B;  5B40 C;  5CPJ D;  2F8N A;  2PYO A;  4KHA B;  5B2J A;  3LJA A;  3P5J B;  5GSU C;  3AZH C;  1F66 A;  4EO5 B;  3AL0 C;  3AZE A;  4XUJ D;  4ZUX C;  4Z2M H;  4DRB A;  3AZI C;  1M19 D;  3X1S B;  1KX3 D;  3UT9 C;  1KX5 B;  2J8P A;  1P3K D;  3WTP B;  4WNN A;  3AZK C;  4UUZ B;  1H3O A;  3WAA A;  2ARO B;  1HTA A;  3VH5 A;  3WA9 D;  4NE3 A;  3C1C A;  3AYW C;  4KUD A;  3X1U C;  3MGS D;  3AYW B;  1KX4 C;  3W98 C;  3X1U B;  1KX4 B;  2HUE C;  1AOI D;  3W96 A;  2HUE B;  4J8X A;  4E44 A;  3MGQ B;  4Z5T B;  1HQ3 C;  3W97 A;  3LEL D;  4NFT A;  1EQZ D;  4LD9 C;  5C3I B;  5B1M A;  3B6F D;  5CP6 A;  5CPJ C;  4H9S C;  5B1L A;  5CPJ B;  5B24 D;  2PYO D;  3AZM B;  2HIO D;  3REK C;  5CPI A;  5B2J D;  3MGR C;  3REK B;  3MGR B;  3LJA D;  5B2I D;  3F6T A;  4XUJ C;  3AV1 A;  2UWX A;  3A6N B;  3AZL A;  1M19 C;  5B0Y A;  1M19 B;  1KX3 C;  3MNN A;  1KX3 B;  3AZF A;  5E5A A;  3AN2 A;  4H9Q B;  3NQU A;  1M18 C;  3B6G C;  1M18 B;  1P3K C;  5GXQ A;  5DNN D;  3B6G B;  2BYK A;  3WA9 C;  5BT1 D;  1P3P C;  5B40 A;  1P3P B;  4KHA A;  2F8N H;  2L5A A;  4J8X D;  3W96 D;  4J8U B;  1EQZ C;  3LEL C;  1M1A D;  3EPH A;  3LEL B;  4KGC D;  3B6F C;  1P3L B;  3UT9 A;  5B24 C;  5B1L D;  2PYO C;  3REL D;  2HIO C;  4UUZ A;  5B2J C;  3KUY B;  2HIO B;  3AZK A;  1ID3 D;  2ARO A;  5CPI D;  3KWQ D;  5B2I C;  3R45 B;  4WZS B;  5B2I B;  3AYW A;  3X1U A;  1KX4 A;  2G5I C;  3W98 A;  3AZL D;  3VH5 W;  3MNN D;  3AZF D;  5DNN C;  3AN2 D;  1HQ3 A;  3A1K A;  5BT1 C;  4Z66 B;  5BS7 C;  5CPJ A;  4H9S A;  3AZM A;  5B0Z D;  2JCH A;  3REK A;  2ZY3 A;  3MGR A;  5JA4 B;  1P34 C;  1P34 B;  4J8X C;  1M1A C;  4XUJ A;  2Y2L A;  4KGC C;  1N1J B;  2DQN C;  5AVB D;  1M19 A;  4KGC B;  3X1S D;  1KX3 A;  4H9Q A;  5B32 B;  5JRG C;  1M18 A;  5B1L C;  3TU4 D;  3REL C;  5JRG B;  3LZ1 C;  3B6G A;  1KX5 D;  3C1B B;  3LZ1 B;  5B33 C;  3WTP D;  4G91 C;  1ID3 C;  5B33 B;  1ID3 B;  3KWQ C;  2ARO D;  4H9N B;  3KWQ B;  1P3P A;  4YM6 B;  3AZN B;  3AYW D;  3IP4 C;  3REJ C;  3MNN C;  3AFA D;  4ZBJ C;  4G92 C;  3REJ B;  1P3M B;  4ZBJ B;  5FUG B;  4Z5T D;  3MGQ D;  4G92 B;  3LEL A;  1P3G B;  5DNM D;  1BH8 B;  4CAY A;  1P3L A;  3A1I A;  3B6F A;  5B24 A;  5B0Z C;  1R4V A;  4H9R A;  2HIO A;  5B0Z B;  3AZM D;  3REK D;  4H9P B;  2JE5 A;  2Y2H A;  3MGR D;  3R45 A;  1TZY B;  5B2I A;  1P3A B;  4EO5 C;  2XD1 A;  1ZLA C;  1ZLA B;  5AVB C;  5CPK C;  3A6N D;  3MVD B;  5AVB B;  3X1S C;  5CPK B;  2FJ7 D;  3VH5 T;  3TU4 C;  3AZJ B;  3TU4 B;  1KX5 C;  5DNN A;  1F1E A;  4JJN C;  1M18 D;  3WTP C;  3B6G D;  4JJN B;  2ARO C;  5BNV B;  4DQY B;  1BH9 A;  5BS7 A;  5G49 B;  1P3P D;  3MGP C;  3W99 C;  3B0B A;  3MGP B;  3W99 B;  5JA4 A;  1P3O B;  1P34 A;  5B32 G;  3AFA C;  1P3B D;  3KXB C;  3AFA B;  3MGQ C;  4Z5T C;  3KXB B;  4J8U D;  1M1A A;  5DNM C;  1N1J A;  4KGC A;  5DNM B;  1PZR A;  5C3I C;  3NQJ B;  4QLC B;  1P3L D;  5B32 A;  5JRG A;  5BO0 A;  3REL A;  3LZ1 A;  3AZM C;  4J8W C;  3KUY D;  5B33 A;  4J8W B;  1ID3 A;  4H9N A;  3KWQ A;  5CHL B;  2JSS A;  3AZN A;  5AV9 D;  3A6N C;  5GT0 D;  4YS3 B;  2FJ7 C;  1S32 B;  3REJ A;  2FJ7 B;  3AZG D;  1P3G A;  1BFM A;  3UTA D;  2ZY5 A;  4Z66 D;  5B0Z A;  2Y2G A;  2LY8 A;  4H9P A;  3REH C;  3REH B;  1P3A A;  1P3B C;  3FDD A;  1P34 D;  1P3B B;  4J8V B;  4J8U C;  4AWL C;  1P3F B;  3LZ0 B;  4AWL B;  1ZLA A;  5AVB A;  3AV2 C;  5CPK A;  1P3I D;  3X1S A;  3AV2 B;  1P3L C;  3AZJ A;  5B32 D;  3TU4 A;  1KX5 A;  5JRG D;  3KUY C;  3C1B D;  3WTP A;  3LZ1 D;  4JJN A;  3UTB D;  5BNV A;  5B33 D;  5G49 A;  4YM6 D;  1ULY A;  3AZN D;  5AV9 C;  3MGP A;  4HGA B;  4CSR B;  4UPK A;  5AV9 B;  3W99 A;  5GT0 C;  5GT0 B;  1Q9C A;  3AFA A;  5AV5 B;  3AZG C;  3KXB A;  3REJ D;  3MGQ A;  4Z5T A;  3AZG B;  1P3M D;  1P3G D;  5DNM A;  2RVQ C;  2Y2K A;  4R8P C;  4R8P B;  3UTA C;  4Z66 C;  3UTA B;  4J8W A;  4Z2M G;  5GT3 B;  1Z2C B;  1TZY D;  1P3A D;  1P3I C;  1ZLA D;  3A6N A;  1P3I B;  3MVD D;  4YS3 A;  5CPK D;  4WV4 B;  2FJ7 A;  5B32 C;  4XZQ C;  3AZJ D;  4NE5 A;  4XZQ B;  2RIQ A;  5B31 B;  3C1B C;  3UTB C;  3UTB B;  4JJN D;  4WNN B;  4YM6 C;  3AZN C;  3WKJ C;  2F2A C;  3MGP D;  3W99 D;  3WKJ B;  2CWE A;  3REH A;  1P3O D;  3C1C B;  4KUD B;  4DRA A;  3O62 C;  1P3B A;  3O62 B;  1P3M C;  4J8U A;  1TAF B;  3KXB D;  1P3G C;  3KSY A;  1U35 B;  3AV2 A;  4X23 D;  3REI D;  3W97 B;  4QLC D;  3KFU G;  5B1M B;  3VH6 A;  2ZY4 A;  1W2E A;  5CP6 B;  3KUY A;  4J8W D;  1TZY C;  1P3A C;  5AV9 A;  4WU9 C;  2Y2P A;  5GT0 A;  3MVD C;  4WU9 B;  3AV1 B;  5AV5 A;  4YS3 D;  1S32 D;  5B0Y B;  3AZJ C;  3AZG A;  2Y2N A;  5E5A B;  5F99 B;  3NQU B;  4R8P A;  2YFW B;  3UTA A;  4Z66 A;  2BYM B;  2DF4 C;  4NE6 A;  2NZD C;  2NZD B;  5B40 B;  5GT3 A;  5BNX B;  1P3O C;  5KDM B;  3H0R C;  3REH D;  4J8V D;  2G5H C;  4WJ3 C;  5AY8 D;  5B31 G;  3AZH B;  5GSU B;  1P3F D;  3LZ0 D;  1P3I A;  4WU8 C;  4X23 C;  5AVC D;  3REI C;  4WU8 B;  1A7W A;  4QLC C;  4X23 B;  4ZUX B;  3REI B;  5AV6 D;  3AV2 D;  3AZI B;  4XZQ A;  5AV8 D;  5B31 A;  3C1B A;  3UTB A;  3UT9 B;  2Y2M A;  3AZK B;  3X1V D;  4YM6 A;  2CV5 C;  2NQB D;  3X1T D;  3EG5 B;  2CV5 B;  3WKJ A;  4YS3 C;  1JFI B;  1S32 C;  3O62 A;  3W98 B;  5AV5 D;  1P3M A;  1TAF A;  3V9R B;  5FUG A;  1U35 A;  1BH8 A;  2RVQ D;  4R8P D;  1HQ3 B;  4LD9 B;  1T3U A;  2YFV B;  2F8N D;  5GT3 D;  1B67 A;  1TZY A;  4J8V C;  5AY8 C;  5AY8 B;  3LZ0 C;  1P3F C;  3VH6 W;  4WU9 A;  5AVC C;  1F66 D;  3MVD A;  4XUJ B;  5AVC B;  3AZE D;  5AV6 C;  5AV6 B;  5AV8 C;  5AV8 B;  4XZQ D;  5F99 A;  5B31 D;  2Y2I A;  2XD5 A;  2YFW A;  1P3K B;  2BYM A;  3X1V C;  3X1V B;  2NQB C;  3X1T C;  2NZD A;  3WAA D;  2NQB B;  3WA9 B;  3X1T B;  4HGA C;  1B6W A;  5BNX A;  2F8N K;  5KDM A;  3WKJ D;  2W8S A;  3MGS C;  1P3O A;  3C1C D;  3MGS B;  4KUD D;  1AOI C;  5AV5 C;  3EPL A;  1AOI B;  3O62 D;  3AZH A;  5GSU A;  2Y2O A;  1U35 D;  4WU8 A;  4X23 A;  2ZY2 A;  3NQJ A;  4ZUX A;  4H9O B;  4QLC A;  3REI A;  2Y2J A;  1WWI A;  4CAY B;  3AZI A;  1EQZ B;  3W97 D;  3B0C W;  3B6F B;  2FFF B;  5B1M D;  5CP6 D;  2BG1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...