5B24B

The crystal structure of the nucleosome containing cyclobutane pyrimidine dimer
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
78
structure length
78
Chain Sequence
NIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords Histone H3.1
publication title Crystal structure of the nucleosome containing ultraviolet light-induced cyclobutane pyrimidine dimer
pubmed doi rcsb
source organism Homo sapiens
total genus 24
structure length 78
sequence length 78
chains with identical sequence F
ec nomenclature
pdb deposition date 2015-12-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5b24B00
3C1BC 5B31B 4NE6A 3TU4B 1S32A 1P3AD 5GXQD 1F66D 1KX3D 3KXBC 5B0YB 2BYMA 1M18C 5G49A 5AV9A 5B32A 5GT0C 3MVDB 3AYWD 2CV5C 2FJ7A 5CP6C 4QLCD 5AVBB 1KX5D 4NE5A 1N1JA 4LD9B 1EQZD 3VH5T 3C1BB 3W99D 4WU9C 1P3MD 5JRGC 3MGSD 4CSRA 4KGCD 3KXBB 1M18B 3O62D 5AV5D 5BS7C 1AOID 5GT0B 1P3FC 3AZJC 2CV5B 3KUYA 4ZUXC 1P3BC 3UTBC 1S32C 3LJAC 3X1UA 3NQJA 1P3LA 4WU9B 5JRGB 5B31D 3WA9A 2NZDB 5B1LB 1TZYD 3MGQA 3WTPA 4UUZA 2PYOC 1P3FB 4J8VA 1TAFA 3AZJB 5B2IA 4ZUXB 4KHAA 1BH8B 5CPIC 4EO5C 4YM6B 1P3BB 4H9OB 3V9RA 5AVBD 5GXQA 1P3AA 1S32B 4Z2MH 1F66A 5B31G 3C1BD 1KX3A 1F1EA 2YFVB 4KUDC 5AV9B 3AYWA 3LZ0C 3KXBD 3KUYC 2LY8A 2PYOB 4QLCA 1KX5A 5GT0D 1EQZA 3X1VC 2CV5D 1N1JB 4Z2MG 5CPIB 4EO5B 5CP6D 3W99A 4AWLC 3MGSA 3A6NC 1JFIA 3NQUA 2CWEA 3AZMC 4KGCA 4WU9D 5JRGD 3O62A 5AV5A 4KUDB 1AOIA 4G92C 2HIOC 1U35C 5BNXA 3LZ0B 3KUYB 5B33C 1P3FD 3R45B 3AZJD 5JA4A 5GXQC 4ZUXD 4AWLB 5JA4B 5B31A 3AZKC 3A6NB 3X1TC 4HGAB 1P3BD 3UTBD 1KX3C 4XZQC 3AZEC 3LJAD 3AZMB 3AV1C 4G92B 3WTPB 4UUZB 4J8VB 5BT1C 4KHAB 2PYOD 5AVBA 1P3MC 3B0BA 5GXQB 3C1BA 5CPID 4H9SC 3AZKB 3X1TB 1KX3B 3AZLC 4XZQB 3AZEB 2BYKA 3O62C 3MGRC 3X1SC 3WAAC 3KXBA 3C1CC 3AV1B 4KUDD 1P3KC 5GT0A 2CV5A 3LZ0D 5CP6A 4H9QA 3W99B 1P3MB 3W96D 1A7WA 3B6GD 3X1VD 3AZIC 3NQUB 1TZYC 4WU9A 1B67A 5JRGA 3UTAC 4KGCB 3A6ND 3WKJC 3O62B 5AV5B 3X1SB 5B2JC 3REJC 4J8XC 2NQBC 3REIC 5C3IC 5BS7A 1P3KB 1P3FA 3AZJA 2HIOD 1U35D 3REHC 1KU5A 3VH5A 4ZUXA 4Z66D 5B33D 1P3BA 4H9OA 3UTBA 3LJAA 3AZIB 4NE3A 4ZBJC 1TZYB 3UTAB 3AZKD 1BFMA 3X1TD 2YFVA 4J8WC 3WKJB 4XZQD 3AZED 3REJB 4J8XB 2NQBB 2PYOA 3AV1D 3REHB 3AN2D 5BT1D 3AFAC 5CPIA 5AY8C 1ZLAC 3B0DC 4ZBJB 2BYKB 3AZLD 4KUDA 4X23C 3MGRD 3X1SD 3LZ0A 3WAAD 3C1CD 5B40C 5CP6B 1P3KD 3W96A 3R45A 4H9QB 3B6GA 3X1VA 3AFAB 3AZHC 1ZLAB 5FUGA 5BNVB 3A6NA 3KSYA 3B0DB 3AZID 3AZMA 3UTAD 3MGPC 3WKJD 4YS3C 3VH5W 3W98C 4X23B 2HIOA 1U35A 5B2JD 3REJD 5B40B 1P34C 5B33A 4J8XD 3REID 2NQBD 3REHD 3UTBB 3AZHB 3LJAB 1M1AD 3AZKA 3AV2C 3X1TA 5B1MC 4XZQA 3AZEA 3REKC 4WV4B 1WWSA 3MGPB 3LELC 4J8WD 3AV1A 1P3ID 4YS3B 3B6FD 3W98B 3AN2A 3W96C 3B6GC 4Z5TD 2AROC 3MNND 3LZ1C 1P3MA 3AFAD 4H9SA 3RELC 5AY8D 3AV2B 3AZLA 1ZLAD 3REKB 3MGRA 3X1SA 3WAAA 3C1CA 3LELB 5AV8C 4Z66C 5CPKD 1P3KA 4X23D 3KWQC 3W96B 1HTAA 5B24C 3B6GB 5B40D 3X1VB 2AROB 3LZ1B 5FUGB 3AZIA 5GT3C 5DNND 5E5AD 3AZHD 1TZYA 3RELB 1HQ3D 3UTAA 3W97C 3WKJA 3AZNC 5B2JA 3REJA 2HIOB 1U35B 2F8ND 4J8XA 3AN2C 3REIA 2NQBA 3MGPD 5AV8B 4Z66B 5B33B 4YS3D 3W98D 4J8UC 3REHA 5B0ZD 5B24B 5KDMB 1P34D 5GT3B 3AV2D 4J8WA 5B1MD 1P3IA 3B6FA 3AZNB 3REKD 3AZGC 5CPJC 2F8NG 3AN2B 4Z5TA 3MNNA 3LELD 4J8UB 3AFAA 4H9NA 2AROD 5BO0A 3LZ1D 5AY8A 1ZLAA 2RVQC 5BNVA 3AZLB 5AV6C 4E44A 4H9RB 4WNNA 3UT9C 1P3PC 1KX4C 1M19C 3MGRB 3RELD 3WAAB 3C1CB 5CPKA 4X23A 3AZGB 2JSSA 5CPJB 5B40A 1P3OC 5F99C 5AV8D 1M1AC 3KWQD 5DNNA 2IO5C 4M6BA 5B24D 3AZHA 5GSUC 2HUEC 5AV6B 5GT3D 3TU4C 3B6FC 3UT9B 1P3IC 1P3PB 1P3GC 4CAYA 1M19B 1H3OB 1KX4B 2F8NK 2F8NA 5B2JB 3MGPA 3W97D 1P3LD 4Z5TC 3REIB 3MNNC 5C3IB 3AZND 4YS3A 3W98A 1WWIA 5B0ZA 1P34A 1P3OB 5F99B 1M1AB 4J8UD 3AZFC 2IO5B 5B2ID 3AV2A 5B1MA 1Q9CA 4J8WB 4WU8C 3B6FB 3REKA 1P3IB 5CPKC 1P3GB 3LELA 4Z5TB 3MNNB 5CPJD 4H9PA 3AZGD 2AROA 5DNNC 3LZ1A 5E5AC 4H9NB 5BO0B 5DNMC 1HQ3C 5AY8B 3AZFB 1ULYA 3WTPE 4JJNC 4WNNB 3RELA 2RVQD 4R8PC 1BH9A 4WU8B 5AV6D 5AVCC 5CPKB 3UT9D 1P3PD 1KX4D 1M19D 2NZDC 5B1LC 5B0ZC 1ID3C 5AV8A 4Z66A 3KWQA 5B24A 5KDMA 1P3OD 5DNNB 5E5AB 5F99D 5DNMB 1HQ3B 4YM6C 5GT3A 4WZSB 4JJNB 5GSUD 3W97A 4CAYB 4XUJD 4R8PB 2F8NB 3AZNA 5AVCB 3TU4D 1P3GD 5B0ZB 5AV9C 1ID3B 5B32C 1P34B 4G91C 5B0YD 4J8UA 2FJ7C 3MVDD 3AZFD 4E45A 5B1MB 4H9RA 4LD9D 4WU8D 3AZGA 5CPJA 2BYMB 4H9PB 5G49B 5B32B 2L5AA 4G91B 1M18D 3VH6A 4NFTA 2YFWA 2FJ7B 5DNMD 3X1UC 1BH9B 5AV6A 1P3LC 4HGAC 3UT9A 1P3PA 1KX4A 1M19A 4JJND 1H3OA 3WA9C 4R8PD 3MGQC 4CSRB 5AVCD 2NZDD 5B1LD 3WTPC 3KWQB 2F8NH 1P3OA 1ID3D 5F99A 4J8VC 5B2IC 1M1AA 3B0CT 4DRBA 3VH6T 5GSUA 1P3AC 4XUJA 3X1UB 1F66C 3NQJB 4YM6D 3W97B 3TU4A 4DRAA 1P3LB 1P3GA 1S32D 3WA9B 3MGQB 5B0YA 3AYWC 1B6WA 3MVDA 4QLCC 5AV9D 1R4VA 5B32D 1KX5C 1TAFB 5B2IB 1EQZC 3AZFA 2FJ7D 3W99C 4LD9A 3MGSC 3V9RB 1P3AB 1F66B 4WU8A 4KGCC 5AV5C 3B0CW 1AOIC 3VH6W 1M18A 3AYWB 5B32G 4QLCB 1KX5B 2YFWB 5E5AA 1EQZB 5DNMA 1HQ3A 3KUYD 5CHLB 4XUJC 5B31C 3MGSB 4JJNA 1JFIB 4R8PA 3X1UD 5AVCA 5B0YC 2NZDA 5B1LA 3WA9D 3AZMD 1ID3A 1AOIB 3MGQD 3MVDC 5BNXB 3WTPD 5AVBC 4J8VD 4LD9C 5GSUB 1BH8A 4YM6A 2HUEB 4XUJB
chains in the Genus database with same CATH superfamily
3C1BC 5B31B 4NE6A 3TU4B 1S32A 1P3AD 5GXQD 1F66D 1KX3D 3KXBC 5B0YB 2BYMA 1M18C 5G49A 5AV9A 5B32A 5GT0C 3MVDB 3AYWD 2CV5C 2FJ7A 5CP6C 4QLCD 5AVBB 1KX5D 4NE5A 1N1JA 4LD9B 1EQZD 3VH5T 3C1BB 3W99D 4WU9C 1P3MD 5JRGC 3MGSD 4CSRA 4KGCD 3KXBB 1M18B 3O62D 5AV5D 2Y2JA 5BS7C 1AOID 5GT0B 1P3FC 3AZJC 2CV5B 3KUYA 4ZUXC 1P3BC 3UTBC 1S32C 3LJAC 3X1UA 3NQJA 1P3LA 4WU9B 5JRGB 5B31D 3WA9A 2NZDB 5B1LB 1TZYD 3MGQA 3WTPA 4UUZA 2PYOC 1P3FB 4J8VA 1TAFA 3AZJB 5B2IA 4ZUXB 4KHAA 1BH8B 5CPIC 4EO5C 4YM6B 1P3BB 4H9OB 3V9RA 5AVBD 5GXQA 1P3AA 1S32B 4Z2MH 1F66A 5B31G 3C1BD 1KX3A 1F1EA 2YFVB 4KUDC 5AV9B 3AYWA 3LZ0C 3KXBD 3KUYC 2Y2QA 2LY8A 2PYOB 4QLCA 1KX5A 5GT0D 3P5JB 1EQZA 3X1VC 2CV5D 1N1JB 4Z2MG 5CPIB 5CP6D 4EO5B 3W99A 4AWLC 3MGSA 3A6NC 1JFIA 3NQUA 2CWEA 3AZMC 4KGCA 4WU9D 5JRGD 3O62A 5AV5A 4KUDB 1AOIA 4G92C 2HIOC 1U35C 5BNXA 3LZ0B 3KUYB 5B33C 1P3FD 3R45B 3AZJD 5JA4A 5GXQC 4ZUXD 4AWLB 5JA4B 5B31A 3AZKC 3A6NB 3X1TC 4HGAB 1P3BD 3UTBD 1KX3C 4XZQC 2UWXA 3LJAD 3AZEC 3AZMB 3AV1C 4G92B 3WTPB 4UUZB 4J8VB 5BT1C 4KHAB 2PYOD 2ZY2A 5AVBA 1P3MC 3B0BA 5GXQB 2Y2OA 3C1BA 5CPID 4H9SC 1W2EA 3AZKB 3X1TB 1KX3B 3AZLC 4XZQB 3AZEB 2BYKA 3O62C 3MGRC 3X1SC 3WAAC 3KXBA 3C1CC 3AV1B 4KUDD 1P3KC 5GT0A 2CV5A 3LZ0D 5CP6A 4H9QA 3W99B 1P3MB 3W96D 1A7WA 3B6GD 3X1VD 3AZIC 3NQUB 1TZYC 2BG1A 4WU9A 1B67A 5JRGA 3UTAC 4KGCB 3A6ND 3WKJC 3O62B 5AV5B 3EPJA 3X1SB 5B2JC 3REJC 4J8XC 2NQBC 3REIC 5C3IC 2Y2PA 5BS7A 1P3KB 1P3FA 3AZJA 3H0LC 2HIOD 1U35D 3REHC 1KU5A 3VH5A 4ZUXA 4Z66D 5B33D 1P3BA 3KFUG 4H9OA 3UTBA 3LJAA 3AZIB 4NE3A 4ZBJC 1TZYB 3UTAB 3AZKD 1BFMA 3X1TD 2YFVA 4J8WC 3WKJB 4XZQD 3AZED 2Y2IA 3REJB 4WJ3C 4J8XB 2NQBB 2PYOA 3AV1D 2G5HC 3REHB 3AN2D 5BT1D 3AFAC 5CPIA 5AY8C 1ZLAC 3B0DC 4ZBJB 2BYKB 3AZLD 4KUDA 4X23C 3MGRD 3X1SD 3A1IA 3LZ0A 3WAAD 3C1CD 5B40C 5CP6B 1P3KD 3W96A 3R45A 4H9QB 3B6GA 3X1VA 3AFAB 3AZHC 4DQYB 1ZLAB 5FUGA 5BNVB 3A6NA 3KSYA 3B0DB 3AZID 3AZMA 3UTAD 3MGPC 3WKJD 4YS3C 3VH5W 3W98C 4X23B 2HIOA 1U35A 5B2JD 3REJD 5B40B 1P34C 5B33A 4J8XD 3REID 2NQBD 3REHD 3UTBB 3AZHB 3LJAB 1M1AD 3AZKA 3AV2C 3X1TA 2FFFB 5B1MC 4XZQA 3AZEA 3F6TA 3REKC 4WV4B 1WWSA 3MGPB 3LELC 4J8WD 3AV1A 1P3ID 4YS3B 3B6FD 3W98B 3AN2A 3W96C 3B6GC 2ZY3A 4Z5TD 2AROC 3MNND 3LZ1C 1Z2CB 1P3MA 2ZY5A 3AFAD 4H9SA 3RELC 5AY8D 3AV2B 3AZLA 1ZLAD 3REKB 3MGRA 3X1SA 3WAAA 3C1CA 3LELB 3FDDA 5AV8C 4Z66C 5CPKD 1P3KA 2Y2MA 4X23D 3KWQC 3W96B 1HTAA 5B24C 3B6GB 5B40D 3X1VB 2AROB 3LZ1B 5FUGB 3AZIA 5GT3C 5DNND 5E5AD 3AZHD 1TZYA 3RELB 1HQ3D 3UTAA 3W97C 3WKJA 2VQRA 3AZNC 5B2JA 3REJA 2HIOB 1U35B 2F8ND 4J8XA 3AN2C 3REIA 2NQBA 3MGPD 5AV8B 4Z66B 5B33B 4YS3D 3W98D 4J8UC 3REHA 5B0ZD 5B24B 5KDMB 1P34D 5GT3B 3AV2D 4J8WA 5B1MD 3EPLA 1P3IA 3B6FA 3AZNB 3REKD 3AZGC 5CPJC 2F8NG 3AN2B 2DQNC 4Z5TA 3MNNA 3LELD 4J8UB 3AFAA 4H9NA 2AROD 5BO0A 3LZ1D 5AY8A 3EPKA 1ZLAA 2RVQC 5BNVA 3AZLB 5AV6C 4E44A 4H9RB 4WNNA 3UT9C 1P3PC 1KX4C 1M19C 3MGRB 3RELD 2RIQA 2W8SA 3IP4C 3C1CB 3WAAB 5CPKA 4X23A 3AZGB 2JSSA 5CPJB 5B40A 1P3OC 5F99C 5AV8D 3AL0C 1M1AC 3KWQD 5DNNA 2IO5C 4M6BA 5B24D 3AZHA 5GSUC 2HUEC 5AV6B 5GT3D 3TU4C 3B6FC 3UT9B 1P3IC 1P3PB 1P3GC 4CAYA 1M19B 1H3OB 1KX4B 2F8NK 2F8NA 5B2JB 3MGPA 3W97D 1P3LD 4Z5TC 3REIB 1T3UA 5C3IB 3MNNC 2JCHA 3AZND 4YS3A 1WWIA 5B0ZA 3W98A 1P34A 1P3OB 5F99B 1M1AB 3EG5B 4J8UD 3AZFC 2Y2NA 2IO5B 5B2ID 3AV2A 5B1MA 1Q9CA 4J8WB 4WU8C 3B6FB 3REKA 1P3IB 5CPKC 1P3GB 3LELA 4Z5TB 3MNNB 5CPJD 3A1KA 4H9PA 2Y2LA 3AZGD 2AROA 5DNNC 3LZ1A 5E5AC 4H9NB 5BO0B 5DNMC 1HQ3C 5AY8B 3AZFB 1ULYA 3WTPE 4JJNC 4WNNB 3RELA 2RVQD 4R8PC 1BH9A 2Y2GA 4WU8B 5AV6D 5AVCC 5CPKB 3UT9D 1P3PD 1KX4D 1M19D 2NZDC 5B1LC 5B0ZC 1ID3C 5AV8A 4Z66A 3KWQA 5B24A 5KDMA 1P3OD 5DNNB 5E5AB 5F99D 2DF4C 5DNMB 1HQ3B 2Y2HA 4YM6C 5GT3A 4WZSB 4JJNB 5GSUD 3W97A 4CAYB 4XUJD 4R8PB 2F8NB 3AZNA 5AVCB 3TU4D 1P3GD 5B0ZB 5AV9C 1ID3B 5B32C 1P34B 4G91C 5B0YD 4J8UA 2FJ7C 3MVDD 4UPKA 3AZFD 4E45A 5B1MB 2XD5A 4H9RA 2F2AC 4LD9D 3H0MC 2G5IC 4WU8D 3AZGA 5CPJA 2BYMB 4H9PB 5G49B 3EPHA 5B32B 2L5AA 4G91B 1M18D 3VH6A 4NFTA 2YFWA 3H0RC 2FJ7B 5DNMD 3X1UC 1BH9B 5AV6A 1P3LC 4HGAC 3UT9A 1P3PA 1KX4A 1M19A 4JJND 1H3OA 3WA9C 4R8PD 3MGQC 4CSRB 5AVCD 2NZDD 5B1LD 3WTPC 3KWQB 2F8NH 1P3OA 1ID3D 5F99A 4J8VC 2XD1A 5B2IC 1M1AA 3B0CT 4DRBA 3VH6T 2JE5A 5GSUA 1P3AC 4XUJA 2Y2KA 3X1UB 1F66C 3NQJB 4YM6D 3W97B 3TU4A 4DRAA 1P3LB 1P3GA 1S32D 3WA9B 3MGQB 5B0YA 3AYWC 1B6WA 2ZY4A 3MVDA 4QLCC 5AV9D 1R4VA 5B32D 1KX5C 1TAFB 5B2IB 1EQZC 3AZFA 2FJ7D 3W99C 4LD9A 3MGSC 3V9RB 1P3AB 1F66B 4WU8A 4KGCC 2J8PA 5AV5C 3B0CW 1AOIC 3VH6W 1M18A 3AYWB 5B32G 2ZM5A 4QLCB 1KX5B 2YFWB 5E5AA 1EQZB 5DNMA 1HQ3A 3KUYD 5CHLB 4XUJC 5B31C 3MGSB 4JJNA 1PZRA 1JFIB 4R8PA 3X1UD 5AVCA 5B0YC 2NZDA 5B1LA 3WA9D 3AZMD 1ID3A 1AOIB 3MGQD 3MVDC 5BNXB 3WTPD 5AVBC 4J8VD 4LD9C 5GSUB 1BH8A 4YM6A 2HUEB 4XUJB
chains in the Genus database with same CATH topology
3C1BC 5B31B 4NE6A 3TU4B 1S32A 1P3AD 5GXQD 1F66D 1KX3D 3KXBC 5B0YB 2BYMA 1M18C 5G49A 5AV9A 5B32A 5GT0C 3MVDB 3AYWD 2CV5C 2FJ7A 5CP6C 4QLCD 5AVBB 1KX5D 4NE5A 1N1JA 4LD9B 1EQZD 3VH5T 3C1BB 3W99D 4WU9C 1P3MD 5JRGC 3MGSD 4CSRA 4KGCD 3KXBB 1M18B 3O62D 5AV5D 2Y2JA 5BS7C 1AOID 5GT0B 1P3FC 3AZJC 2CV5B 3KUYA 4ZUXC 1P3BC 3UTBC 1S32C 3LJAC 3X1UA 3NQJA 1P3LA 4WU9B 5JRGB 5B31D 3WA9A 2NZDB 5B1LB 1TZYD 3MGQA 3WTPA 4UUZA 2PYOC 1P3FB 4J8VA 1TAFA 3AZJB 5B2IA 4ZUXB 4KHAA 1BH8B 5CPIC 4EO5C 4YM6B 1P3BB 4H9OB 3V9RA 5AVBD 5GXQA 1P3AA 1S32B 4Z2MH 1F66A 5B31G 3C1BD 1KX3A 1F1EA 2YFVB 4KUDC 5AV9B 3AYWA 3LZ0C 3KXBD 3KUYC 2Y2QA 2LY8A 2PYOB 4QLCA 1KX5A 5GT0D 3P5JB 1EQZA 3X1VC 2CV5D 1N1JB 4Z2MG 5CPIB 5CP6D 4EO5B 3W99A 4AWLC 3MGSA 3A6NC 1JFIA 3NQUA 2CWEA 3AZMC 4KGCA 4WU9D 5JRGD 3O62A 5AV5A 4KUDB 1AOIA 4G92C 2HIOC 1U35C 5BNXA 3LZ0B 3KUYB 5B33C 1P3FD 3R45B 3AZJD 5JA4A 5GXQC 4ZUXD 4AWLB 5JA4B 5B31A 3AZKC 3A6NB 3X1TC 4HGAB 1P3BD 3UTBD 1KX3C 4XZQC 2UWXA 3LJAD 3AZEC 3AZMB 3AV1C 4G92B 3WTPB 4UUZB 4J8VB 5BT1C 4KHAB 2PYOD 2ZY2A 5AVBA 1P3MC 3B0BA 5GXQB 2Y2OA 3C1BA 5CPID 4H9SC 1W2EA 3AZKB 3X1TB 1KX3B 3AZLC 4XZQB 3AZEB 2BYKA 3O62C 3MGRC 3X1SC 3WAAC 3KXBA 3C1CC 3AV1B 4KUDD 1P3KC 5GT0A 2CV5A 3LZ0D 5CP6A 4H9QA 3W99B 1P3MB 3W96D 1A7WA 3B6GD 3X1VD 3AZIC 3NQUB 1TZYC 2BG1A 4WU9A 1B67A 5JRGA 3UTAC 4KGCB 3A6ND 3WKJC 3O62B 5AV5B 3EPJA 3X1SB 5B2JC 3REJC 4J8XC 2NQBC 3REIC 5C3IC 2Y2PA 5BS7A 1P3KB 1P3FA 3AZJA 3H0LC 2HIOD 1U35D 3REHC 1KU5A 3VH5A 4ZUXA 4Z66D 5B33D 1P3BA 3KFUG 4H9OA 3UTBA 3LJAA 3AZIB 4NE3A 4ZBJC 1TZYB 3UTAB 3AZKD 1BFMA 3X1TD 2YFVA 4J8WC 3WKJB 4XZQD 3AZED 2Y2IA 3REJB 4WJ3C 4J8XB 2NQBB 2PYOA 3AV1D 2G5HC 3REHB 3AN2D 5BT1D 3AFAC 5CPIA 5AY8C 1ZLAC 3B0DC 4ZBJB 2BYKB 3AZLD 4KUDA 4X23C 3MGRD 3X1SD 3A1IA 3LZ0A 3WAAD 3C1CD 5B40C 5CP6B 1P3KD 3W96A 3R45A 4H9QB 3B6GA 3X1VA 3AFAB 3AZHC 4DQYB 1ZLAB 5FUGA 5BNVB 3A6NA 3KSYA 3B0DB 3AZID 3AZMA 3UTAD 3MGPC 3WKJD 4YS3C 3VH5W 3W98C 4X23B 2HIOA 1U35A 5B2JD 3REJD 5B40B 1P34C 5B33A 4J8XD 3REID 2NQBD 3REHD 3UTBB 3AZHB 3LJAB 1M1AD 3AZKA 3AV2C 3X1TA 2FFFB 5B1MC 4XZQA 3AZEA 3F6TA 3REKC 4WV4B 1WWSA 3MGPB 3LELC 4J8WD 3AV1A 1P3ID 4YS3B 3B6FD 3W98B 3AN2A 3W96C 3B6GC 2ZY3A 4Z5TD 2AROC 3MNND 3LZ1C 1Z2CB 1P3MA 2ZY5A 3AFAD 4H9SA 3RELC 5AY8D 3AV2B 3AZLA 1ZLAD 3REKB 3MGRA 3X1SA 3WAAA 3C1CA 3LELB 3FDDA 5AV8C 4Z66C 5CPKD 1P3KA 2Y2MA 4X23D 3KWQC 3W96B 1HTAA 5B24C 3B6GB 5B40D 3X1VB 2AROB 3LZ1B 5FUGB 3AZIA 5GT3C 5DNND 5E5AD 3AZHD 1TZYA 3RELB 1HQ3D 3UTAA 3W97C 3WKJA 2VQRA 3AZNC 5B2JA 3REJA 2HIOB 1U35B 2F8ND 4J8XA 3AN2C 3REIA 2NQBA 3MGPD 5AV8B 4Z66B 5B33B 4YS3D 3W98D 4J8UC 3REHA 5B0ZD 5B24B 5KDMB 1P34D 5GT3B 3AV2D 4J8WA 5B1MD 3EPLA 1P3IA 3B6FA 3AZNB 3REKD 3AZGC 5CPJC 2F8NG 3AN2B 2DQNC 4Z5TA 3MNNA 3LELD 4J8UB 3AFAA 4H9NA 2AROD 5BO0A 3LZ1D 5AY8A 3EPKA 1ZLAA 2RVQC 5BNVA 3AZLB 5AV6C 4E44A 4H9RB 4WNNA 3UT9C 1P3PC 1KX4C 1M19C 3MGRB 3RELD 2RIQA 2W8SA 3IP4C 3C1CB 3WAAB 5CPKA 4X23A 3AZGB 2JSSA 5CPJB 5B40A 1P3OC 5F99C 5AV8D 3AL0C 1M1AC 3KWQD 5DNNA 2IO5C 4M6BA 5B24D 3AZHA 5GSUC 2HUEC 5AV6B 5GT3D 3TU4C 3B6FC 3UT9B 1P3IC 1P3PB 1P3GC 4CAYA 1M19B 1H3OB 1KX4B 2F8NK 2F8NA 5B2JB 3MGPA 3W97D 1P3LD 4Z5TC 3REIB 1T3UA 5C3IB 3MNNC 2JCHA 3AZND 4YS3A 1WWIA 5B0ZA 3W98A 1P34A 1P3OB 5F99B 1M1AB 3EG5B 4J8UD 3AZFC 2Y2NA 2IO5B 5B2ID 3AV2A 5B1MA 1Q9CA 4J8WB 4WU8C 3B6FB 3REKA 1P3IB 5CPKC 1P3GB 3LELA 4Z5TB 3MNNB 5CPJD 3A1KA 4H9PA 2Y2LA 3AZGD 2AROA 5DNNC 3LZ1A 5E5AC 4H9NB 5BO0B 5DNMC 1HQ3C 5AY8B 3AZFB 1ULYA 3WTPE 4JJNC 4WNNB 3RELA 2RVQD 4R8PC 1BH9A 2Y2GA 4WU8B 5AV6D 5AVCC 5CPKB 3UT9D 1P3PD 1KX4D 1M19D 2NZDC 5B1LC 5B0ZC 1ID3C 5AV8A 4Z66A 3KWQA 5B24A 5KDMA 1P3OD 5DNNB 5E5AB 5F99D 2DF4C 5DNMB 1HQ3B 2Y2HA 4YM6C 5GT3A 4WZSB 4JJNB 5GSUD 3W97A 4CAYB 4XUJD 4R8PB 2F8NB 3AZNA 5AVCB 3TU4D 1P3GD 5B0ZB 5AV9C 1ID3B 5B32C 1P34B 4G91C 5B0YD 4J8UA 2FJ7C 3MVDD 4UPKA 3AZFD 4E45A 5B1MB 2XD5A 4H9RA 2F2AC 4LD9D 3H0MC 2G5IC 4WU8D 3AZGA 5CPJA 2BYMB 4H9PB 5G49B 3EPHA 5B32B 2L5AA 4G91B 1M18D 3VH6A 4NFTA 2YFWA 3H0RC 2FJ7B 5DNMD 3X1UC 1BH9B 5AV6A 1P3LC 4HGAC 3UT9A 1P3PA 1KX4A 1M19A 4JJND 1H3OA 3WA9C 4R8PD 3MGQC 4CSRB 5AVCD 2NZDD 5B1LD 3WTPC 3KWQB 2F8NH 1P3OA 1ID3D 5F99A 4J8VC 2XD1A 5B2IC 1M1AA 3B0CT 4DRBA 3VH6T 2JE5A 5GSUA 1P3AC 4XUJA 2Y2KA 3X1UB 1F66C 3NQJB 4YM6D 3W97B 3TU4A 4DRAA 1P3LB 1P3GA 1S32D 3WA9B 3MGQB 5B0YA 3AYWC 1B6WA 2ZY4A 3MVDA 4QLCC 5AV9D 1R4VA 5B32D 1KX5C 1TAFB 5B2IB 1EQZC 3AZFA 2FJ7D 3W99C 4LD9A 3MGSC 3V9RB 1P3AB 1F66B 4WU8A 4KGCC 2J8PA 5AV5C 3B0CW 1AOIC 3VH6W 1M18A 3AYWB 5B32G 2ZM5A 4QLCB 1KX5B 2YFWB 5E5AA 1EQZB 5DNMA 1HQ3A 3KUYD 5CHLB 4XUJC 5B31C 3MGSB 4JJNA 1PZRA 1JFIB 4R8PA 3X1UD 5AVCA 5B0YC 2NZDA 5B1LA 3WA9D 3AZMD 1ID3A 1AOIB 3MGQD 3MVDC 5BNXB 3WTPD 5AVBC 4J8VD 4LD9C 5GSUB 1BH8A 4YM6A 2HUEB 4XUJB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3C1B C;  5B31 B;  4NE6 A;  3TU4 B;  1S32 A;  1P3A D;  5GXQ D;  1F66 D;  1KX3 D;  3KXB C;  5B0Y B;  2BYM A;  1M18 C;  5G49 A;  5AV9 A;  5B32 A;  5GT0 C;  3MVD B;  3AYW D;  2CV5 C;  2FJ7 A;  5CP6 C;  4QLC D;  5AVB B;  1KX5 D;  4NE5 A;  1N1J A;  4LD9 B;  1EQZ D;  3VH5 T;  3C1B B;  3W99 D;  4WU9 C;  1P3M D;  5JRG C;  3MGS D;  4CSR A;  4KGC D;  3KXB B;  1M18 B;  3O62 D;  5AV5 D;  5BS7 C;  1AOI D;  5GT0 B;  1P3F C;  3AZJ C;  2CV5 B;  3KUY A;  4ZUX C;  1P3B C;  3UTB C;  1S32 C;  3LJA C;  3X1U A;  3NQJ A;  1P3L A;  4WU9 B;  5JRG B;  5B31 D;  3WA9 A;  2NZD B;  5B1L B;  1TZY D;  3MGQ A;  3WTP A;  4UUZ A;  2PYO C;  1P3F B;  4J8V A;  1TAF A;  3AZJ B;  5B2I A;  4ZUX B;  4KHA A;  1BH8 B;  5CPI C;  4EO5 C;  4YM6 B;  1P3B B;  4H9O B;  3V9R A;  5AVB D;  5GXQ A;  1P3A A;  1S32 B;  4Z2M H;  1F66 A;  5B31 G;  3C1B D;  1KX3 A;  1F1E A;  2YFV B;  4KUD C;  5AV9 B;  3AYW A;  3LZ0 C;  3KXB D;  3KUY C;  2LY8 A;  2PYO B;  4QLC A;  1KX5 A;  5GT0 D;  1EQZ A;  3X1V C;  2CV5 D;  1N1J B;  4Z2M G;  5CPI B;  4EO5 B;  5CP6 D;  3W99 A;  4AWL C;  3MGS A;  3A6N C;  1JFI A;  3NQU A;  2CWE A;  3AZM C;  4KGC A;  4WU9 D;  5JRG D;  3O62 A;  5AV5 A;  4KUD B;  1AOI A;  4G92 C;  2HIO C;  1U35 C;  5BNX A;  3LZ0 B;  3KUY B;  5B33 C;  1P3F D;  3R45 B;  3AZJ D;  5JA4 A;  5GXQ C;  4ZUX D;  4AWL B;  5JA4 B;  5B31 A;  3AZK C;  3A6N B;  3X1T C;  4HGA B;  1P3B D;  3UTB D;  1KX3 C;  4XZQ C;  3AZE C;  3LJA D;  3AZM B;  3AV1 C;  4G92 B;  3WTP B;  4UUZ B;  4J8V B;  5BT1 C;  4KHA B;  2PYO D;  5AVB A;  1P3M C;  3B0B A;  5GXQ B;  3C1B A;  5CPI D;  4H9S C;  3AZK B;  3X1T B;  1KX3 B;  3AZL C;  4XZQ B;  3AZE B;  2BYK A;  3O62 C;  3MGR C;  3X1S C;  3WAA C;  3KXB A;  3C1C C;  3AV1 B;  4KUD D;  1P3K C;  5GT0 A;  2CV5 A;  3LZ0 D;  5CP6 A;  4H9Q A;  3W99 B;  1P3M B;  3W96 D;  1A7W A;  3B6G D;  3X1V D;  3AZI C;  3NQU B;  1TZY C;  4WU9 A;  1B67 A;  5JRG A;  3UTA C;  4KGC B;  3A6N D;  3WKJ C;  3O62 B;  5AV5 B;  3X1S B;  5B2J C;  3REJ C;  4J8X C;  2NQB C;  3REI C;  5C3I C;  5BS7 A;  1P3K B;  1P3F A;  3AZJ A;  2HIO D;  1U35 D;  3REH C;  1KU5 A;  3VH5 A;  4ZUX A;  4Z66 D;  5B33 D;  1P3B A;  4H9O A;  3UTB A;  3LJA A;  3AZI B;  4NE3 A;  4ZBJ C;  1TZY B;  3UTA B;  3AZK D;  1BFM A;  3X1T D;  2YFV A;  4J8W C;  3WKJ B;  4XZQ D;  3AZE D;  3REJ B;  4J8X B;  2NQB B;  2PYO A;  3AV1 D;  3REH B;  3AN2 D;  5BT1 D;  3AFA C;  5CPI A;  5AY8 C;  1ZLA C;  3B0D C;  4ZBJ B;  2BYK B;  3AZL D;  4KUD A;  4X23 C;  3MGR D;  3X1S D;  3LZ0 A;  3WAA D;  3C1C D;  5B40 C;  5CP6 B;  1P3K D;  3W96 A;  3R45 A;  4H9Q B;  3B6G A;  3X1V A;  3AFA B;  3AZH C;  1ZLA B;  5FUG A;  5BNV B;  3A6N A;  3KSY A;  3B0D B;  3AZI D;  3AZM A;  3UTA D;  3MGP C;  3WKJ D;  4YS3 C;  3VH5 W;  3W98 C;  4X23 B;  2HIO A;  1U35 A;  5B2J D;  3REJ D;  5B40 B;  1P34 C;  5B33 A;  4J8X D;  3REI D;  2NQB D;  3REH D;  3UTB B;  3AZH B;  3LJA B;  1M1A D;  3AZK A;  3AV2 C;  3X1T A;  5B1M C;  4XZQ A;  3AZE A;  3REK C;  4WV4 B;  1WWS A;  3MGP B;  3LEL C;  4J8W D;  3AV1 A;  1P3I D;  4YS3 B;  3B6F D;  3W98 B;  3AN2 A;  3W96 C;  3B6G C;  4Z5T D;  2ARO C;  3MNN D;  3LZ1 C;  1P3M A;  3AFA D;  4H9S A;  3REL C;  5AY8 D;  3AV2 B;  3AZL A;  1ZLA D;  3REK B;  3MGR A;  3X1S A;  3WAA A;  3C1C A;  3LEL B;  5AV8 C;  4Z66 C;  5CPK D;  1P3K A;  4X23 D;  3KWQ C;  3W96 B;  1HTA A;  5B24 C;  3B6G B;  5B40 D;  3X1V B;  2ARO B;  3LZ1 B;  5FUG B;  3AZI A;  5GT3 C;  5DNN D;  5E5A D;  3AZH D;  1TZY A;  3REL B;  1HQ3 D;  3UTA A;  3W97 C;  3WKJ A;  3AZN C;  5B2J A;  3REJ A;  2HIO B;  1U35 B;  2F8N D;  4J8X A;  3AN2 C;  3REI A;  2NQB A;  3MGP D;  5AV8 B;  4Z66 B;  5B33 B;  4YS3 D;  3W98 D;  4J8U C;  3REH A;  5B0Z D;  5B24 B;  5KDM B;  1P34 D;  5GT3 B;  3AV2 D;  4J8W A;  5B1M D;  1P3I A;  3B6F A;  3AZN B;  3REK D;  3AZG C;  5CPJ C;  2F8N G;  3AN2 B;  4Z5T A;  3MNN A;  3LEL D;  4J8U B;  3AFA A;  4H9N A;  2ARO D;  5BO0 A;  3LZ1 D;  5AY8 A;  1ZLA A;  2RVQ C;  5BNV A;  3AZL B;  5AV6 C;  4E44 A;  4H9R B;  4WNN A;  3UT9 C;  1P3P C;  1KX4 C;  1M19 C;  3MGR B;  3REL D;  3WAA B;  3C1C B;  5CPK A;  4X23 A;  3AZG B;  2JSS A;  5CPJ B;  5B40 A;  1P3O C;  5F99 C;  5AV8 D;  1M1A C;  3KWQ D;  5DNN A;  2IO5 C;  4M6B A;  5B24 D;  3AZH A;  5GSU C;  2HUE C;  5AV6 B;  5GT3 D;  3TU4 C;  3B6F C;  3UT9 B;  1P3I C;  1P3P B;  1P3G C;  4CAY A;  1M19 B;  1H3O B;  1KX4 B;  2F8N K;  2F8N A;  5B2J B;  3MGP A;  3W97 D;  1P3L D;  4Z5T C;  3REI B;  3MNN C;  5C3I B;  3AZN D;  4YS3 A;  3W98 A;  1WWI A;  5B0Z A;  1P34 A;  1P3O B;  5F99 B;  1M1A B;  4J8U D;  3AZF C;  2IO5 B;  5B2I D;  3AV2 A;  5B1M A;  1Q9C A;  4J8W B;  4WU8 C;  3B6F B;  3REK A;  1P3I B;  5CPK C;  1P3G B;  3LEL A;  4Z5T B;  3MNN B;  5CPJ D;  4H9P A;  3AZG D;  2ARO A;  5DNN C;  3LZ1 A;  5E5A C;  4H9N B;  5BO0 B;  5DNM C;  1HQ3 C;  5AY8 B;  3AZF B;  1ULY A;  3WTP E;  4JJN C;  4WNN B;  3REL A;  2RVQ D;  4R8P C;  1BH9 A;  4WU8 B;  5AV6 D;  5AVC C;  5CPK B;  3UT9 D;  1P3P D;  1KX4 D;  1M19 D;  2NZD C;  5B1L C;  5B0Z C;  1ID3 C;  5AV8 A;  4Z66 A;  3KWQ A;  5B24 A;  5KDM A;  1P3O D;  5DNN B;  5E5A B;  5F99 D;  5DNM B;  1HQ3 B;  4YM6 C;  5GT3 A;  4WZS B;  4JJN B;  5GSU D;  3W97 A;  4CAY B;  4XUJ D;  4R8P B;  2F8N B;  3AZN A;  5AVC B;  3TU4 D;  1P3G D;  5B0Z B;  5AV9 C;  1ID3 B;  5B32 C;  1P34 B;  4G91 C;  5B0Y D;  4J8U A;  2FJ7 C;  3MVD D;  3AZF D;  4E45 A;  5B1M B;  4H9R A;  4LD9 D;  4WU8 D;  3AZG A;  5CPJ A;  2BYM B;  4H9P B;  5G49 B;  5B32 B;  2L5A A;  4G91 B;  1M18 D;  3VH6 A;  4NFT A;  2YFW A;  2FJ7 B;  5DNM D;  3X1U C;  1BH9 B;  5AV6 A;  1P3L C;  4HGA C;  3UT9 A;  1P3P A;  1KX4 A;  1M19 A;  4JJN D;  1H3O A;  3WA9 C;  4R8P D;  3MGQ C;  4CSR B;  5AVC D;  2NZD D;  5B1L D;  3WTP C;  3KWQ B;  2F8N H;  1P3O A;  1ID3 D;  5F99 A;  4J8V C;  5B2I C;  1M1A A;  3B0C T;  4DRB A;  3VH6 T;  5GSU A;  1P3A C;  4XUJ A;  3X1U B;  1F66 C;  3NQJ B;  4YM6 D;  3W97 B;  3TU4 A;  4DRA A;  1P3L B;  1P3G A;  1S32 D;  3WA9 B;  3MGQ B;  5B0Y A;  3AYW C;  1B6W A;  3MVD A;  4QLC C;  5AV9 D;  1R4V A;  5B32 D;  1KX5 C;  1TAF B;  5B2I B;  1EQZ C;  3AZF A;  2FJ7 D;  3W99 C;  4LD9 A;  3MGS C;  3V9R B;  1P3A B;  1F66 B;  4WU8 A;  4KGC C;  5AV5 C;  3B0C W;  1AOI C;  3VH6 W;  1M18 A;  3AYW B;  5B32 G;  4QLC B;  1KX5 B;  2YFW B;  5E5A A;  1EQZ B;  5DNM A;  1HQ3 A;  3KUY D;  5CHL B;  4XUJ C;  5B31 C;  3MGS B;  4JJN A;  1JFI B;  4R8P A;  3X1U D;  5AVC A;  5B0Y C;  2NZD A;  5B1L A;  3WA9 D;  3AZM D;  1ID3 A;  1AOI B;  3MGQ D;  3MVD C;  5BNX B;  3WTP D;  5AVB C;  4J8V D;  4LD9 C;  5GSU B;  1BH8 A;  4YM6 A;  2HUE B;  4XUJ B; 
#chains in the Genus database with same CATH topology
 3C1B C;  5B31 B;  4NE6 A;  3TU4 B;  1S32 A;  1P3A D;  5GXQ D;  1F66 D;  1KX3 D;  3KXB C;  5B0Y B;  2BYM A;  1M18 C;  5G49 A;  5AV9 A;  5B32 A;  5GT0 C;  3MVD B;  3AYW D;  2CV5 C;  2FJ7 A;  5CP6 C;  4QLC D;  5AVB B;  1KX5 D;  4NE5 A;  1N1J A;  4LD9 B;  1EQZ D;  3VH5 T;  3C1B B;  3W99 D;  4WU9 C;  1P3M D;  5JRG C;  3MGS D;  4CSR A;  4KGC D;  3KXB B;  1M18 B;  3O62 D;  5AV5 D;  2Y2J A;  5BS7 C;  1AOI D;  5GT0 B;  1P3F C;  3AZJ C;  2CV5 B;  3KUY A;  4ZUX C;  1P3B C;  3UTB C;  1S32 C;  3LJA C;  3X1U A;  3NQJ A;  1P3L A;  4WU9 B;  5JRG B;  5B31 D;  3WA9 A;  2NZD B;  5B1L B;  1TZY D;  3MGQ A;  3WTP A;  4UUZ A;  2PYO C;  1P3F B;  4J8V A;  1TAF A;  3AZJ B;  5B2I A;  4ZUX B;  4KHA A;  1BH8 B;  5CPI C;  4EO5 C;  4YM6 B;  1P3B B;  4H9O B;  3V9R A;  5AVB D;  5GXQ A;  1P3A A;  1S32 B;  4Z2M H;  1F66 A;  5B31 G;  3C1B D;  1KX3 A;  1F1E A;  2YFV B;  4KUD C;  5AV9 B;  3AYW A;  3LZ0 C;  3KXB D;  3KUY C;  2Y2Q A;  2LY8 A;  2PYO B;  4QLC A;  1KX5 A;  5GT0 D;  3P5J B;  1EQZ A;  3X1V C;  2CV5 D;  1N1J B;  4Z2M G;  5CPI B;  5CP6 D;  4EO5 B;  3W99 A;  4AWL C;  3MGS A;  3A6N C;  1JFI A;  3NQU A;  2CWE A;  3AZM C;  4KGC A;  4WU9 D;  5JRG D;  3O62 A;  5AV5 A;  4KUD B;  1AOI A;  4G92 C;  2HIO C;  1U35 C;  5BNX A;  3LZ0 B;  3KUY B;  5B33 C;  1P3F D;  3R45 B;  3AZJ D;  5JA4 A;  5GXQ C;  4ZUX D;  4AWL B;  5JA4 B;  5B31 A;  3AZK C;  3A6N B;  3X1T C;  4HGA B;  1P3B D;  3UTB D;  1KX3 C;  4XZQ C;  2UWX A;  3LJA D;  3AZE C;  3AZM B;  3AV1 C;  4G92 B;  3WTP B;  4UUZ B;  4J8V B;  5BT1 C;  4KHA B;  2PYO D;  2ZY2 A;  5AVB A;  1P3M C;  3B0B A;  5GXQ B;  2Y2O A;  3C1B A;  5CPI D;  4H9S C;  1W2E A;  3AZK B;  3X1T B;  1KX3 B;  3AZL C;  4XZQ B;  3AZE B;  2BYK A;  3O62 C;  3MGR C;  3X1S C;  3WAA C;  3KXB A;  3C1C C;  3AV1 B;  4KUD D;  1P3K C;  5GT0 A;  2CV5 A;  3LZ0 D;  5CP6 A;  4H9Q A;  3W99 B;  1P3M B;  3W96 D;  1A7W A;  3B6G D;  3X1V D;  3AZI C;  3NQU B;  1TZY C;  2BG1 A;  4WU9 A;  1B67 A;  5JRG A;  3UTA C;  4KGC B;  3A6N D;  3WKJ C;  3O62 B;  5AV5 B;  3EPJ A;  3X1S B;  5B2J C;  3REJ C;  4J8X C;  2NQB C;  3REI C;  5C3I C;  2Y2P A;  5BS7 A;  1P3K B;  1P3F A;  3AZJ A;  3H0L C;  2HIO D;  1U35 D;  3REH C;  1KU5 A;  3VH5 A;  4ZUX A;  4Z66 D;  5B33 D;  1P3B A;  3KFU G;  4H9O A;  3UTB A;  3LJA A;  3AZI B;  4NE3 A;  4ZBJ C;  1TZY B;  3UTA B;  3AZK D;  1BFM A;  3X1T D;  2YFV A;  4J8W C;  3WKJ B;  4XZQ D;  3AZE D;  2Y2I A;  3REJ B;  4WJ3 C;  4J8X B;  2NQB B;  2PYO A;  3AV1 D;  2G5H C;  3REH B;  3AN2 D;  5BT1 D;  3AFA C;  5CPI A;  5AY8 C;  1ZLA C;  3B0D C;  4ZBJ B;  2BYK B;  3AZL D;  4KUD A;  4X23 C;  3MGR D;  3X1S D;  3A1I A;  3LZ0 A;  3WAA D;  3C1C D;  5B40 C;  5CP6 B;  1P3K D;  3W96 A;  3R45 A;  4H9Q B;  3B6G A;  3X1V A;  3AFA B;  3AZH C;  4DQY B;  1ZLA B;  5FUG A;  5BNV B;  3A6N A;  3KSY A;  3B0D B;  3AZI D;  3AZM A;  3UTA D;  3MGP C;  3WKJ D;  4YS3 C;  3VH5 W;  3W98 C;  4X23 B;  2HIO A;  1U35 A;  5B2J D;  3REJ D;  5B40 B;  1P34 C;  5B33 A;  4J8X D;  3REI D;  2NQB D;  3REH D;  3UTB B;  3AZH B;  3LJA B;  1M1A D;  3AZK A;  3AV2 C;  3X1T A;  2FFF B;  5B1M C;  4XZQ A;  3AZE A;  3F6T A;  3REK C;  4WV4 B;  1WWS A;  3MGP B;  3LEL C;  4J8W D;  3AV1 A;  1P3I D;  4YS3 B;  3B6F D;  3W98 B;  3AN2 A;  3W96 C;  3B6G C;  2ZY3 A;  4Z5T D;  2ARO C;  3MNN D;  3LZ1 C;  1Z2C B;  1P3M A;  2ZY5 A;  3AFA D;  4H9S A;  3REL C;  5AY8 D;  3AV2 B;  3AZL A;  1ZLA D;  3REK B;  3MGR A;  3X1S A;  3WAA A;  3C1C A;  3LEL B;  3FDD A;  5AV8 C;  4Z66 C;  5CPK D;  1P3K A;  2Y2M A;  4X23 D;  3KWQ C;  3W96 B;  1HTA A;  5B24 C;  3B6G B;  5B40 D;  3X1V B;  2ARO B;  3LZ1 B;  5FUG B;  3AZI A;  5GT3 C;  5DNN D;  5E5A D;  3AZH D;  1TZY A;  3REL B;  1HQ3 D;  3UTA A;  3W97 C;  3WKJ A;  2VQR A;  3AZN C;  5B2J A;  3REJ A;  2HIO B;  1U35 B;  2F8N D;  4J8X A;  3AN2 C;  3REI A;  2NQB A;  3MGP D;  5AV8 B;  4Z66 B;  5B33 B;  4YS3 D;  3W98 D;  4J8U C;  3REH A;  5B0Z D;  5B24 B;  5KDM B;  1P34 D;  5GT3 B;  3AV2 D;  4J8W A;  5B1M D;  3EPL A;  1P3I A;  3B6F A;  3AZN B;  3REK D;  3AZG C;  5CPJ C;  2F8N G;  3AN2 B;  2DQN C;  4Z5T A;  3MNN A;  3LEL D;  4J8U B;  3AFA A;  4H9N A;  2ARO D;  5BO0 A;  3LZ1 D;  5AY8 A;  3EPK A;  1ZLA A;  2RVQ C;  5BNV A;  3AZL B;  5AV6 C;  4E44 A;  4H9R B;  4WNN A;  3UT9 C;  1P3P C;  1KX4 C;  1M19 C;  3MGR B;  3REL D;  2RIQ A;  2W8S A;  3IP4 C;  3C1C B;  3WAA B;  5CPK A;  4X23 A;  3AZG B;  2JSS A;  5CPJ B;  5B40 A;  1P3O C;  5F99 C;  5AV8 D;  3AL0 C;  1M1A C;  3KWQ D;  5DNN A;  2IO5 C;  4M6B A;  5B24 D;  3AZH A;  5GSU C;  2HUE C;  5AV6 B;  5GT3 D;  3TU4 C;  3B6F C;  3UT9 B;  1P3I C;  1P3P B;  1P3G C;  4CAY A;  1M19 B;  1H3O B;  1KX4 B;  2F8N K;  2F8N A;  5B2J B;  3MGP A;  3W97 D;  1P3L D;  4Z5T C;  3REI B;  1T3U A;  5C3I B;  3MNN C;  2JCH A;  3AZN D;  4YS3 A;  1WWI A;  5B0Z A;  3W98 A;  1P34 A;  1P3O B;  5F99 B;  1M1A B;  3EG5 B;  4J8U D;  3AZF C;  2Y2N A;  2IO5 B;  5B2I D;  3AV2 A;  5B1M A;  1Q9C A;  4J8W B;  4WU8 C;  3B6F B;  3REK A;  1P3I B;  5CPK C;  1P3G B;  3LEL A;  4Z5T B;  3MNN B;  5CPJ D;  3A1K A;  4H9P A;  2Y2L A;  3AZG D;  2ARO A;  5DNN C;  3LZ1 A;  5E5A C;  4H9N B;  5BO0 B;  5DNM C;  1HQ3 C;  5AY8 B;  3AZF B;  1ULY A;  3WTP E;  4JJN C;  4WNN B;  3REL A;  2RVQ D;  4R8P C;  1BH9 A;  2Y2G A;  4WU8 B;  5AV6 D;  5AVC C;  5CPK B;  3UT9 D;  1P3P D;  1KX4 D;  1M19 D;  2NZD C;  5B1L C;  5B0Z C;  1ID3 C;  5AV8 A;  4Z66 A;  3KWQ A;  5B24 A;  5KDM A;  1P3O D;  5DNN B;  5E5A B;  5F99 D;  2DF4 C;  5DNM B;  1HQ3 B;  2Y2H A;  4YM6 C;  5GT3 A;  4WZS B;  4JJN B;  5GSU D;  3W97 A;  4CAY B;  4XUJ D;  4R8P B;  2F8N B;  3AZN A;  5AVC B;  3TU4 D;  1P3G D;  5B0Z B;  5AV9 C;  1ID3 B;  5B32 C;  1P34 B;  4G91 C;  5B0Y D;  4J8U A;  2FJ7 C;  3MVD D;  4UPK A;  3AZF D;  4E45 A;  5B1M B;  2XD5 A;  4H9R A;  2F2A C;  4LD9 D;  3H0M C;  2G5I C;  4WU8 D;  3AZG A;  5CPJ A;  2BYM B;  4H9P B;  5G49 B;  3EPH A;  5B32 B;  2L5A A;  4G91 B;  1M18 D;  3VH6 A;  4NFT A;  2YFW A;  3H0R C;  2FJ7 B;  5DNM D;  3X1U C;  1BH9 B;  5AV6 A;  1P3L C;  4HGA C;  3UT9 A;  1P3P A;  1KX4 A;  1M19 A;  4JJN D;  1H3O A;  3WA9 C;  4R8P D;  3MGQ C;  4CSR B;  5AVC D;  2NZD D;  5B1L D;  3WTP C;  3KWQ B;  2F8N H;  1P3O A;  1ID3 D;  5F99 A;  4J8V C;  2XD1 A;  5B2I C;  1M1A A;  3B0C T;  4DRB A;  3VH6 T;  2JE5 A;  5GSU A;  1P3A C;  4XUJ A;  2Y2K A;  3X1U B;  1F66 C;  3NQJ B;  4YM6 D;  3W97 B;  3TU4 A;  4DRA A;  1P3L B;  1P3G A;  1S32 D;  3WA9 B;  3MGQ B;  5B0Y A;  3AYW C;  1B6W A;  2ZY4 A;  3MVD A;  4QLC C;  5AV9 D;  1R4V A;  5B32 D;  1KX5 C;  1TAF B;  5B2I B;  1EQZ C;  3AZF A;  2FJ7 D;  3W99 C;  4LD9 A;  3MGS C;  3V9R B;  1P3A B;  1F66 B;  4WU8 A;  4KGC C;  2J8P A;  5AV5 C;  3B0C W;  1AOI C;  3VH6 W;  1M18 A;  3AYW B;  5B32 G;  2ZM5 A;  4QLC B;  1KX5 B;  2YFW B;  5E5A A;  1EQZ B;  5DNM A;  1HQ3 A;  3KUY D;  5CHL B;  4XUJ C;  5B31 C;  3MGS B;  4JJN A;  1PZR A;  1JFI B;  4R8P A;  3X1U D;  5AVC A;  5B0Y C;  2NZD A;  5B1L A;  3WA9 D;  3AZM D;  1ID3 A;  1AOI B;  3MGQ D;  3MVD C;  5BNX B;  3WTP D;  5AVB C;  4J8V D;  4LD9 C;  5GSU B;  1BH8 A;  4YM6 A;  2HUE B;  4XUJ B; 
#chains in the Genus database with same CATH homology
 3C1B C;  5B31 B;  4NE6 A;  3TU4 B;  1S32 A;  1P3A D;  5GXQ D;  1F66 D;  1KX3 D;  3KXB C;  5B0Y B;  2BYM A;  1M18 C;  5G49 A;  5AV9 A;  5B32 A;  5GT0 C;  3MVD B;  3AYW D;  2CV5 C;  2FJ7 A;  5CP6 C;  4QLC D;  5AVB B;  1KX5 D;  4NE5 A;  1N1J A;  4LD9 B;  1EQZ D;  3VH5 T;  3C1B B;  3W99 D;  4WU9 C;  1P3M D;  5JRG C;  3MGS D;  4CSR A;  4KGC D;  3KXB B;  1M18 B;  3O62 D;  5AV5 D;  2Y2J A;  5BS7 C;  1AOI D;  5GT0 B;  1P3F C;  3AZJ C;  2CV5 B;  3KUY A;  4ZUX C;  1P3B C;  3UTB C;  1S32 C;  3LJA C;  3X1U A;  3NQJ A;  1P3L A;  4WU9 B;  5JRG B;  5B31 D;  3WA9 A;  2NZD B;  5B1L B;  1TZY D;  3MGQ A;  3WTP A;  4UUZ A;  2PYO C;  1P3F B;  4J8V A;  1TAF A;  3AZJ B;  5B2I A;  4ZUX B;  4KHA A;  1BH8 B;  5CPI C;  4EO5 C;  4YM6 B;  1P3B B;  4H9O B;  3V9R A;  5AVB D;  5GXQ A;  1P3A A;  1S32 B;  4Z2M H;  1F66 A;  5B31 G;  3C1B D;  1KX3 A;  1F1E A;  2YFV B;  4KUD C;  5AV9 B;  3AYW A;  3LZ0 C;  3KXB D;  3KUY C;  2Y2Q A;  2LY8 A;  2PYO B;  4QLC A;  1KX5 A;  5GT0 D;  3P5J B;  1EQZ A;  3X1V C;  2CV5 D;  1N1J B;  4Z2M G;  5CPI B;  5CP6 D;  4EO5 B;  3W99 A;  4AWL C;  3MGS A;  3A6N C;  1JFI A;  3NQU A;  2CWE A;  3AZM C;  4KGC A;  4WU9 D;  5JRG D;  3O62 A;  5AV5 A;  4KUD B;  1AOI A;  4G92 C;  2HIO C;  1U35 C;  5BNX A;  3LZ0 B;  3KUY B;  5B33 C;  1P3F D;  3R45 B;  3AZJ D;  5JA4 A;  5GXQ C;  4ZUX D;  4AWL B;  5JA4 B;  5B31 A;  3AZK C;  3A6N B;  3X1T C;  4HGA B;  1P3B D;  3UTB D;  1KX3 C;  4XZQ C;  2UWX A;  3LJA D;  3AZE C;  3AZM B;  3AV1 C;  4G92 B;  3WTP B;  4UUZ B;  4J8V B;  5BT1 C;  4KHA B;  2PYO D;  2ZY2 A;  5AVB A;  1P3M C;  3B0B A;  5GXQ B;  2Y2O A;  3C1B A;  5CPI D;  4H9S C;  1W2E A;  3AZK B;  3X1T B;  1KX3 B;  3AZL C;  4XZQ B;  3AZE B;  2BYK A;  3O62 C;  3MGR C;  3X1S C;  3WAA C;  3KXB A;  3C1C C;  3AV1 B;  4KUD D;  1P3K C;  5GT0 A;  2CV5 A;  3LZ0 D;  5CP6 A;  4H9Q A;  3W99 B;  1P3M B;  3W96 D;  1A7W A;  3B6G D;  3X1V D;  3AZI C;  3NQU B;  1TZY C;  2BG1 A;  4WU9 A;  1B67 A;  5JRG A;  3UTA C;  4KGC B;  3A6N D;  3WKJ C;  3O62 B;  5AV5 B;  3EPJ A;  3X1S B;  5B2J C;  3REJ C;  4J8X C;  2NQB C;  3REI C;  5C3I C;  2Y2P A;  5BS7 A;  1P3K B;  1P3F A;  3AZJ A;  3H0L C;  2HIO D;  1U35 D;  3REH C;  1KU5 A;  3VH5 A;  4ZUX A;  4Z66 D;  5B33 D;  1P3B A;  3KFU G;  4H9O A;  3UTB A;  3LJA A;  3AZI B;  4NE3 A;  4ZBJ C;  1TZY B;  3UTA B;  3AZK D;  1BFM A;  3X1T D;  2YFV A;  4J8W C;  3WKJ B;  4XZQ D;  3AZE D;  2Y2I A;  3REJ B;  4WJ3 C;  4J8X B;  2NQB B;  2PYO A;  3AV1 D;  2G5H C;  3REH B;  3AN2 D;  5BT1 D;  3AFA C;  5CPI A;  5AY8 C;  1ZLA C;  3B0D C;  4ZBJ B;  2BYK B;  3AZL D;  4KUD A;  4X23 C;  3MGR D;  3X1S D;  3A1I A;  3LZ0 A;  3WAA D;  3C1C D;  5B40 C;  5CP6 B;  1P3K D;  3W96 A;  3R45 A;  4H9Q B;  3B6G A;  3X1V A;  3AFA B;  3AZH C;  4DQY B;  1ZLA B;  5FUG A;  5BNV B;  3A6N A;  3KSY A;  3B0D B;  3AZI D;  3AZM A;  3UTA D;  3MGP C;  3WKJ D;  4YS3 C;  3VH5 W;  3W98 C;  4X23 B;  2HIO A;  1U35 A;  5B2J D;  3REJ D;  5B40 B;  1P34 C;  5B33 A;  4J8X D;  3REI D;  2NQB D;  3REH D;  3UTB B;  3AZH B;  3LJA B;  1M1A D;  3AZK A;  3AV2 C;  3X1T A;  2FFF B;  5B1M C;  4XZQ A;  3AZE A;  3F6T A;  3REK C;  4WV4 B;  1WWS A;  3MGP B;  3LEL C;  4J8W D;  3AV1 A;  1P3I D;  4YS3 B;  3B6F D;  3W98 B;  3AN2 A;  3W96 C;  3B6G C;  2ZY3 A;  4Z5T D;  2ARO C;  3MNN D;  3LZ1 C;  1Z2C B;  1P3M A;  2ZY5 A;  3AFA D;  4H9S A;  3REL C;  5AY8 D;  3AV2 B;  3AZL A;  1ZLA D;  3REK B;  3MGR A;  3X1S A;  3WAA A;  3C1C A;  3LEL B;  3FDD A;  5AV8 C;  4Z66 C;  5CPK D;  1P3K A;  2Y2M A;  4X23 D;  3KWQ C;  3W96 B;  1HTA A;  5B24 C;  3B6G B;  5B40 D;  3X1V B;  2ARO B;  3LZ1 B;  5FUG B;  3AZI A;  5GT3 C;  5DNN D;  5E5A D;  3AZH D;  1TZY A;  3REL B;  1HQ3 D;  3UTA A;  3W97 C;  3WKJ A;  2VQR A;  3AZN C;  5B2J A;  3REJ A;  2HIO B;  1U35 B;  2F8N D;  4J8X A;  3AN2 C;  3REI A;  2NQB A;  3MGP D;  5AV8 B;  4Z66 B;  5B33 B;  4YS3 D;  3W98 D;  4J8U C;  3REH A;  5B0Z D;  5B24 B;  5KDM B;  1P34 D;  5GT3 B;  3AV2 D;  4J8W A;  5B1M D;  3EPL A;  1P3I A;  3B6F A;  3AZN B;  3REK D;  3AZG C;  5CPJ C;  2F8N G;  3AN2 B;  2DQN C;  4Z5T A;  3MNN A;  3LEL D;  4J8U B;  3AFA A;  4H9N A;  2ARO D;  5BO0 A;  3LZ1 D;  5AY8 A;  3EPK A;  1ZLA A;  2RVQ C;  5BNV A;  3AZL B;  5AV6 C;  4E44 A;  4H9R B;  4WNN A;  3UT9 C;  1P3P C;  1KX4 C;  1M19 C;  3MGR B;  3REL D;  2RIQ A;  2W8S A;  3IP4 C;  3C1C B;  3WAA B;  5CPK A;  4X23 A;  3AZG B;  2JSS A;  5CPJ B;  5B40 A;  1P3O C;  5F99 C;  5AV8 D;  3AL0 C;  1M1A C;  3KWQ D;  5DNN A;  2IO5 C;  4M6B A;  5B24 D;  3AZH A;  5GSU C;  2HUE C;  5AV6 B;  5GT3 D;  3TU4 C;  3B6F C;  3UT9 B;  1P3I C;  1P3P B;  1P3G C;  4CAY A;  1M19 B;  1H3O B;  1KX4 B;  2F8N K;  2F8N A;  5B2J B;  3MGP A;  3W97 D;  1P3L D;  4Z5T C;  3REI B;  1T3U A;  5C3I B;  3MNN C;  2JCH A;  3AZN D;  4YS3 A;  1WWI A;  5B0Z A;  3W98 A;  1P34 A;  1P3O B;  5F99 B;  1M1A B;  3EG5 B;  4J8U D;  3AZF C;  2Y2N A;  2IO5 B;  5B2I D;  3AV2 A;  5B1M A;  1Q9C A;  4J8W B;  4WU8 C;  3B6F B;  3REK A;  1P3I B;  5CPK C;  1P3G B;  3LEL A;  4Z5T B;  3MNN B;  5CPJ D;  3A1K A;  4H9P A;  2Y2L A;  3AZG D;  2ARO A;  5DNN C;  3LZ1 A;  5E5A C;  4H9N B;  5BO0 B;  5DNM C;  1HQ3 C;  5AY8 B;  3AZF B;  1ULY A;  3WTP E;  4JJN C;  4WNN B;  3REL A;  2RVQ D;  4R8P C;  1BH9 A;  2Y2G A;  4WU8 B;  5AV6 D;  5AVC C;  5CPK B;  3UT9 D;  1P3P D;  1KX4 D;  1M19 D;  2NZD C;  5B1L C;  5B0Z C;  1ID3 C;  5AV8 A;  4Z66 A;  3KWQ A;  5B24 A;  5KDM A;  1P3O D;  5DNN B;  5E5A B;  5F99 D;  2DF4 C;  5DNM B;  1HQ3 B;  2Y2H A;  4YM6 C;  5GT3 A;  4WZS B;  4JJN B;  5GSU D;  3W97 A;  4CAY B;  4XUJ D;  4R8P B;  2F8N B;  3AZN A;  5AVC B;  3TU4 D;  1P3G D;  5B0Z B;  5AV9 C;  1ID3 B;  5B32 C;  1P34 B;  4G91 C;  5B0Y D;  4J8U A;  2FJ7 C;  3MVD D;  4UPK A;  3AZF D;  4E45 A;  5B1M B;  2XD5 A;  4H9R A;  2F2A C;  4LD9 D;  3H0M C;  2G5I C;  4WU8 D;  3AZG A;  5CPJ A;  2BYM B;  4H9P B;  5G49 B;  3EPH A;  5B32 B;  2L5A A;  4G91 B;  1M18 D;  3VH6 A;  4NFT A;  2YFW A;  3H0R C;  2FJ7 B;  5DNM D;  3X1U C;  1BH9 B;  5AV6 A;  1P3L C;  4HGA C;  3UT9 A;  1P3P A;  1KX4 A;  1M19 A;  4JJN D;  1H3O A;  3WA9 C;  4R8P D;  3MGQ C;  4CSR B;  5AVC D;  2NZD D;  5B1L D;  3WTP C;  3KWQ B;  2F8N H;  1P3O A;  1ID3 D;  5F99 A;  4J8V C;  2XD1 A;  5B2I C;  1M1A A;  3B0C T;  4DRB A;  3VH6 T;  2JE5 A;  5GSU A;  1P3A C;  4XUJ A;  2Y2K A;  3X1U B;  1F66 C;  3NQJ B;  4YM6 D;  3W97 B;  3TU4 A;  4DRA A;  1P3L B;  1P3G A;  1S32 D;  3WA9 B;  3MGQ B;  5B0Y A;  3AYW C;  1B6W A;  2ZY4 A;  3MVD A;  4QLC C;  5AV9 D;  1R4V A;  5B32 D;  1KX5 C;  1TAF B;  5B2I B;  1EQZ C;  3AZF A;  2FJ7 D;  3W99 C;  4LD9 A;  3MGS C;  3V9R B;  1P3A B;  1F66 B;  4WU8 A;  4KGC C;  2J8P A;  5AV5 C;  3B0C W;  1AOI C;  3VH6 W;  1M18 A;  3AYW B;  5B32 G;  2ZM5 A;  4QLC B;  1KX5 B;  2YFW B;  5E5A A;  1EQZ B;  5DNM A;  1HQ3 A;  3KUY D;  5CHL B;  4XUJ C;  5B31 C;  3MGS B;  4JJN A;  1PZR A;  1JFI B;  4R8P A;  3X1U D;  5AVC A;  5B0Y C;  2NZD A;  5B1L A;  3WA9 D;  3AZM D;  1ID3 A;  1AOI B;  3MGQ D;  3MVD C;  5BNX B;  3WTP D;  5AVB C;  4J8V D;  4LD9 C;  5GSU B;  1BH8 A;  4YM6 A;  2HUE B;  4XUJ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...