5B24B

The crystal structure of the nucleosome containing cyclobutane pyrimidine dimer
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
78
structure length
78
Chain Sequence
b'NIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.1
publication title Crystal structure of the nucleosome containing ultraviolet light-induced cyclobutane pyrimidine dimer
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 24
structure length 78
sequence length 78
chains with identical sequence F
ec nomenclature
pdb deposition date 2015-12-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5b24B00
1KX5A 1M18C 3W99B 1P3ID 4ZUXB 5GT0D 2HIOC 4CAYB 3X1TC 4J8WC 4NE3A 3W96C 5JRGB 5B31A 2HUEB 1P3PB 5AV9A 1P3AA 1KX3D 3W98C 3MGPD 1P34B 4J8XC 1U35A 3WTPD 3AZIA 3LJAD 3B6GA 4ZBJC 3WKJB 3O62D 3AZFD 3MGSA 3C1CB 2CV5C 2NZDB 1HQ3A 5CPIA 2FJ7A 3X1UB 3WAAB 1P3LA 3UT9C 3KSYA 3MVDC 3LZ1A 5GSUB 4AWLC 2YFWA 3MNNC 3RELA 4J8VA 3W97B 5AV5B 5B24D 5B40B 3TU4C 3AZEA 5B0ZA 1ULYA 2NQBB 4XZQB 5B32D 4WU9B 2PYOC 1ID3A 3AV1A 4QLCB 5E5AA 1P3FA 4R8PD 2IO5C 3MGQA 5AV6A 3REHA 4WU8C 3NQUA 3REJD 3VH6W 5B31C 4KUDD 4KGCD 5AV9C 1KX4D 3WA9B 4JJND 1U35C 3AZIC 3B6GC 3V9RB 1M1AB 5AY8A 4J8UB 5AVCA 5B2IA 1P3GB 3A6NA 3LZ0B 5DNMB 4LD9A 4Z5TA 1F66A 1AOIA 3AZLA 1HQ3C 4H9PA 5CPIC 3KWQD 5B2JA 1P3OC 3MGRA 1P3LC 4X23C 1P3BD 3W99A 2BYMB 3LZ1C 1TZYC 3RELC 4J8VC 4ZUXD 4UUZB 3AZEC 5JRGD 5BNXA 3LJAB 1P34A 1P3PD 1ID3C 3AV1C 3O62B 5E5AC 5F99B 3AZMC 3AZFB 1P3FC 5AV6C 5BT1C 3C1CA 5CP6A 3KUYD 1JFIA 3WKJD 2NZDA 5GXQB 5B33A 5G49B 3REKB 4YM6B 4H9OB 5JA4A 5AV8B 3X1UD 4KHAB 3VH6A 1ZLAD 3WAAD 5B24B 3W97A 3AZHB 5FUGB 5CPKC 5GSUD 5B2IC 3X1SB 2F8NH 3A6NC 4E45A 2NQBA 4XZQA 5AV5D 4LD9C 1F66C 4WU9A 5B40D 1M19C 3AZLC 3AZGD 4QLCA 5B2JC 5B0YB 3MGRC 4EO5B 4H9RB 3REJB 3UTAC 4KUDB 4KGCB 4CSRA 3AFAB 2HUEC 3AV2B 2F8NK 4JJNB 3WA9A 3REIB 3AZJA 4G92C 2HIOD 1P3MA 1M1AA 4J8UA 3X1TD 3WA9D 3W96D 3B6FB 5C3IC 3KXBC 3LZ0A 5DNMA 3X1VB 5CP6C 3KWQB 1P3GD 2RVQD 4YS3C 1BH8A 1P3BB 5CHLB 4J8XD 5GT0A 5B33C 2F8NG 3WTPE 2CV5D 5GT3B 3W97C 3UTBB 5BNVB 1KX3A 4UUZA 3MGPA 3AZKB 3VH6T 3WTPA 4XZQC 3LJAA 2AROD 1KU5A 3UT9D 1B67A 5B1MD 1S32B 3O62A 3AZFA 3MNND 5CPJC 1B6WA 3KUYB 4HGAB 5F99D 3AZNB 5AVBD 5G49A 2YFVB 5B1LC 1ZLAB 1P3KC 4H9OA 5GXQD 4G91C 3AZJC 3AYWC 3REKD 4KHAA 4YM6D 5B24A 3AN2C 5DNND 1P3MC 1M1AC 5AV8D 1BH9B 5B32A 3AZHD 3C1BD 3AZGB 3X1SD 4R8PA 4H9QB 1P3IC 5GT0C 1KX5C 1WWIA 3REJA 4H9RA 4NE5A 4KUDA 4KGCA 5B0YD 3R45B 5BO0B 2F8ND 4Z66B 1KX3C 1KX4A 1M18B 3MGPC 4JJNA 3AFAD 3WTPC 1P3AC 1P3OD 3AV2D 2HIOB 4X23D 3X1TB 3LELD 3W96B 1TZYD 3AZFC 3REID 3W98B 3MGSC 3B6FD 3KWQA 4J8XB 1P3BA 3X1VD 4ZBJB 2FJ7C 2BYKB 2CV5B 3AZMD 4ZUXA 4CAYA 5KDMB 5BT1D 5JRGA 1P3PA 2AROB 5GT3D 5B32C 3UT9B 3UTBD 3MVDB 5B0ZC 5B1MB 4AWLB 3MNNB 4R8PC 3AZKD 1EQZD 4NE6A 3B0CT 3KUYA 3REJC 3WKJA 1S32D 1H3OB 5AVBB 3MGQC 5CPKD 1HTAA 4KGCC 3REHC 2PYOB 1N1JB 1KX4C 4H9SA 3AZND 1M19D 3X1UA 2IO5B 1ZLAA 3WAAA 5DNNB 4WU8B 1BFMA 5GSUA 3UTAD 5B31B 5AV5A 1BH9A 5AY8C 5AV9B 5AVCC 3C1BB 5B40A 3AZGA 4Z5TC 1U35B 3AZIB 1AOIC 4H9QA 3B6GB 3W99C 4ZUXC 2F8NB 3KXBD 5BO0A 4XUJD 4Z2MH 5JRGC 5CPIB 1P3OB 1P3PC 4YS3D 4X23B 1P3LB 4Z66D 3LELB 2HIOA 1M18D 3X1TA 1TZYB 2YFWB 3W96A 1P34C 3RELB 3B0CW 4H9NB 5B31G 3V9RA 4J8WD 4WNNB 1P3GA 3AZEB 3WKJC 3C1CC 4J8XA 1ID3B 4NFTA 3AV1B 3W98D 2NZDC 5E5AB 3AZMB 1P3FB 3X1UC 4E44A 3WAAC 2CV5A 5AV6B 2BYMA 5KDMA 3NQUB 5GSUC 4WZSB 5AV5C 2AROA 3UT9A 5B40C 5B1MA 2JSSA 5B1LD 2NQBC 1EQZB 1P3KD 3MNNA 4WU9C 3AYWD 3MVDD 5BS7A 4Z2MG 3AN2D 4QLCC 5F99A 5B2IB 5CPKB 1H3OA 5AVBA 4LD9B 1F66B 3TU4D 3AZLB 1M19B 4H9PB 5GXQA 5B2JB 3MGRB 3REKA 2PYOD 2L5AA 4YM6A 5DNNA 4WU8A 3UTAB 1KX5D 3WA9C 5AV8A 3B0DB 3AZHA 5FUGA 4WU8D 4J8UC 3C1BA 4M6BA 3X1SA 1P3GC 2RVQC 5B31D 5BNXB 3LZ0C 5DNMC 5AV9D 1P3AD 4G92B 1U35D 5C3IB 5B0YA 3KXBB 3AZID 1Q9CA 3B6GD 2F8NA 5CP6B 4XUJB 4WV4B 1JFIB 3VH5A 4YS3B 3MGSD 3AFAA 5B33B 1P3OA 3AV2A 2AROC 2CWEA 4X23A 3LELA 1HQ3D 5JA4B 5B1MC 1F1EA 5CPID 1TZYA 3LJAC 2FJ7D 3REIA 1P3LD 4J8WB 4H9NA 3LZ1D 5BS7C 4WNNA 5F99C 3O62C 3B6FA 3RELD 4J8VD 5AVBC 3X1VA 3NQJB 3AZED 5B0ZD 5GXQC 3AZMA 5CPJB 3REKC 1ID3D 4YM6C 3AV1D 5DNNC 5E5AD 1P3FD 1TAFB 4CSRB 5AV8C 3MGQD 5GT3A 5B24C 5AV6D 3AZHC 3UTBA 3REHD 5BNVA 3C1BC 5B1LB 3X1SC 1P3KB 3AZKA 4G91B 3AYWB 3AZJB 1EQZA 3AN2B 1P3MB 1S32A 5CPKA 5B0YC 3TU4B 5AY8D 4EO5C 5AVCD 5B2ID 3AZNA 3A6ND 1M19A 4KUDC 1BH8B 3AFAC 1P3IB 5GT0B 4LD9D 4Z5TD 3AV2C 1F66D 1KX5B 1AOID 1A7WA 2YFVA 4JJNC 3LELC 3AZLD 3UTAA 3VH5T 5B2JD 3MGRD 3W99D 3REIC 1KX3B 3MGPB 3B6FC 3WTPB 1P3AB 3X1VC 3KWQC 1P3BC 1P34D 3KXBA 2LY8A 4XUJA 3MGSB 3R45A 4YS3A 5GT3C 3C1CD 3UTBC 5CP6D 4Z66A 1HQ3B 1M18A 2FJ7B 2NZDD 3AZKC 5B33D 1EQZC 3LZ1B 4DRBA 4J8WA 4J8VB 1S32C 5B32B 3W97D 3KUYC 4HGAC 5B0ZB 3W98A 3NQJA 3AZNC 4R8PB 4DRAA 2NQBD 4XZQD 4WU9D 5CPJA 4H9SC 3VH5W 3B0BA 1WWSA 2BYKA 1ZLAC 1R4VA 3MGQB 4QLCD 1TAFA 5CPJD 3REHB 3B0DC 1KX4B 5B1LA 1P3KA 3AYWA 3MVDA 3AZGC 3AN2A 3AZJD 5AY8B 5AVCB 5B32G 3A6NB 3TU4A 4J8UD 1P3MD 4XUJC 1M1AD 4Z5TB 3LZ0D 5DNMD 1AOIB 1P3IA 2PYOA 4Z66C 1N1JA
chains in the Genus database with same CATH superfamily
1KX5A 1M18C 3W99B 3A1IA 1P3ID 4ZUXB 5GT0D 2HIOC 4CAYB 3X1TC 4J8WC 4NE3A 3W96C 5JRGB 5B31A 2HUEB 2Y2QA 1P3PB 5AV9A 1P3AA 1KX3D 3W98C 3MGPD 2FFFB 1P34B 4J8XC 1U35A 3WTPD 3AZIA 3LJAD 3B6GA 4ZBJC 3WKJB 3O62D 3AZFD 3MGSA 3C1CB 2CV5C 2NZDB 1HQ3A 5CPIA 2FJ7A 3X1UB 3WAAB 1P3LA 3UT9C 3KSYA 3MVDC 3LZ1A 5GSUB 4AWLC 2YFWA 3MNNC 3RELA 4J8VA 3W97B 3EPKA 2Y2JA 5AV5B 5B24D 5B40B 3TU4C 3AZEA 5B0ZA 1ULYA 2NQBB 4XZQB 2DQNC 5B32D 4WU9B 2PYOC 1ID3A 3AV1A 4QLCB 5E5AA 1P3FA 4R8PD 2IO5C 3MGQA 5AV6A 3REHA 4WU8C 3NQUA 3REJD 3VH6W 5B31C 4KUDD 4KGCD 5AV9C 1KX4D 3WA9B 2ZY2A 4JJND 1U35C 3AZIC 3B6GC 3V9RB 1M1AB 5AY8A 4J8UB 5AVCA 5B2IA 1P3GB 3A6NA 3LZ0B 5DNMB 4LD9A 4Z5TA 1F66A 1AOIA 3AZLA 1HQ3C 3P5JB 4H9PA 5CPIC 3KWQD 3IP4C 5B2JA 1P3OC 3MGRA 1P3LC 4X23C 1P3BD 3W99A 2BYMB 3LZ1C 1TZYC 3RELC 4J8VC 4ZUXD 4UUZB 3AZEC 5JRGD 5BNXA 3LJAB 1P34A 1P3PD 1ID3C 3AV1C 3O62B 5E5AC 5F99B 3AZMC 3AZFB 1P3FC 3EPHA 5AV6C 5BT1C 3C1CA 5CP6A 3KUYD 1JFIA 3WKJD 2NZDA 5GXQB 2JCHA 5G49B 5B33A 3REKB 4YM6B 4H9OB 5JA4A 5AV8B 3X1UD 4KHAB 3VH6A 1ZLAD 3WAAD 5B24B 3W97A 3AZHB 5FUGB 5CPKC 5GSUD 5B2IC 3X1SB 2F8NH 3A6NC 4E45A 2NQBA 5AV5D 4XZQA 4LD9C 1F66C 4WU9A 5B40D 1M19C 3AZLC 3AZGD 4QLCA 5B2JC 5B0YB 3MGRC 2JE5A 4EO5B 2Y2NA 4H9RB 3REJB 3UTAC 4KUDB 4KGCB 1T3UA 4CSRA 3AFAB 2HUEC 3AV2B 2F8NK 4JJNB 3WA9A 3A1KA 3REIB 3AZJA 2W8SA 2DF4C 4G92C 2HIOD 1P3MA 1M1AA 4J8UA 3X1TD 3WA9D 3W96D 3B6FB 2Y2IA 5C3IC 3KXBC 3LZ0A 5DNMA 3X1VB 5CP6C 3KWQB 1P3GD 2Y2PA 2RVQD 4YS3C 1BH8A 1P3BB 5CHLB 4J8XD 5GT0A 5B33C 2F8NG 3WTPE 2CV5D 5GT3B 3W97C 3UTBB 5BNVB 1KX3A 4UUZA 3MGPA 3EG5B 3AZKB 3VH6T 3WTPA 4XZQC 3LJAA 2AROD 1KU5A 3UT9D 1B67A 5B1MD 1S32B 3O62A 3AZFA 3MNND 5CPJC 1B6WA 3KUYB 1PZRA 4HGAB 5F99D 3AZNB 3AL0C 5AVBD 2Y2KA 5G49A 2YFVB 5B1LC 1ZLAB 1P3KC 4H9OA 5GXQD 4DQYB 4G91C 3AZJC 3AYWC 3REKD 4KHAA 4YM6D 5B24A 3AN2C 5DNND 1P3MC 1M1AC 5AV8D 1BH9B 5B32A 3AZHD 3C1BD 3AZGB 3X1SD 4R8PA 4H9QB 1P3IC 5GT0C 1KX5C 1WWIA 3REJA 4H9RA 4NE5A 4KUDA 4KGCA 5B0YD 3R45B 5BO0B 2F8ND 4Z66B 1KX3C 1KX4A 2VQRA 1M18B 3MGPC 4JJNA 3AFAD 3WTPC 1P3AC 1P3OD 3AV2D 2HIOB 4X23D 3X1TB 3LELD 3W96B 1TZYD 3AZFC 3REID 3W98B 3MGSC 3B6FD 3KWQA 4J8XB 1P3BA 3X1VD 4ZBJB 2FJ7C 2BYKB 2CV5B 3AZMD 4ZUXA 4CAYA 5KDMB 5BT1D 5JRGA 1P3PA 3H0LC 2AROB 5GT3D 5B32C 3UT9B 3UTBD 3MVDB 5B0ZC 5B1MB 4AWLB 3MNNB 4R8PC 3AZKD 1EQZD 2RIQA 4NE6A 3B0CT 3KUYA 3REJC 3WKJA 1S32D 1H3OB 5AVBB 3MGQC 5CPKD 1HTAA 2Y2LA 4KGCC 3REHC 2PYOB 1N1JB 1KX4C 4H9SA 3AZND 1M19D 3X1UA 2IO5B 1ZLAA 3WAAA 5DNNB 4WU8B 3H0RC 1BFMA 5GSUA 3UTAD 5B31B 5AV5A 1BH9A 5AY8C 5AV9B 5AVCC 3C1BB 5B40A 3AZGA 4Z5TC 1U35B 3AZIB 1AOIC 4H9QA 3B6GB 3W99C 1W2EA 4ZUXC 2F8NB 3KXBD 5BO0A 4XUJD 4Z2MH 3EPJA 5JRGC 5CPIB 1P3OB 1P3PC 4YS3D 4X23B 1P3LB 4Z66D 3LELB 2HIOA 1M18D 3X1TA 1TZYB 2YFWB 3W96A 1P34C 3RELB 3B0CW 4H9NB 5B31G 3V9RA 4J8WD 4WNNB 1P3GA 3AZEB 3WKJC 3C1CC 4J8XA 3KFUG 1ID3B 4NFTA 3AV1B 3W98D 2NZDC 5E5AB 3AZMB 1P3FB 3X1UC 4E44A 3WAAC 3EPLA 2CV5A 5AV6B 2BYMA 5KDMA 3NQUB 5GSUC 4WZSB 2ZY3A 5AV5C 2AROA 3UT9A 2ZM5A 5B40C 5B1MA 2JSSA 5B1LD 2NQBC 1EQZB 1P3KD 3MNNA 4WU9C 2J8PA 3AYWD 3MVDD 5BS7A 4Z2MG 3AN2D 4QLCC 5F99A 5B2IB 5CPKB 2G5IC 1H3OA 5AVBA 2ZY5A 4LD9B 1F66B 3TU4D 3AZLB 1M19B 4H9PB 5GXQA 5B2JB 3MGRB 3REKA 2PYOD 2L5AA 3F6TA 4YM6A 5DNNA 4WU8A 3UTAB 1KX5D 3WA9C 5AV8A 3B0DB 2Y2HA 3AZHA 5FUGA 4WU8D 4J8UC 3C1BA 4M6BA 3X1SA 1P3GC 2RVQC 5B31D 5BNXB 3LZ0C 5DNMC 5AV9D 1P3AD 4G92B 3FDDA 1U35D 5C3IB 5B0YA 3KXBB 3AZID 1Q9CA 3B6GD 2F8NA 5CP6B 4XUJB 4WV4B 1JFIB 3VH5A 4YS3B 3MGSD 3AFAA 1Z2CB 5B33B 1P3OA 3AV2A 2AROC 2CWEA 4X23A 3LELA 1HQ3D 5JA4B 5B1MC 1F1EA 5CPID 1TZYA 3LJAC 2FJ7D 3REIA 1P3LD 4J8WB 2F2AC 4H9NA 3LZ1D 5BS7C 4WNNA 5F99C 3O62C 3B6FA 3RELD 4J8VD 5AVBC 3X1VA 3NQJB 3AZED 5B0ZD 5GXQC 3AZMA 5CPJB 3REKC 1ID3D 4YM6C 3AV1D 5DNNC 5E5AD 1P3FD 1TAFB 4CSRB 5AV8C 3MGQD 5GT3A 5B24C 5AV6D 3AZHC 3UTBA 3REHD 5BNVA 3C1BC 5B1LB 3X1SC 4WJ3C 1P3KB 3AZKA 4G91B 3AYWB 3AZJB 1EQZA 3AN2B 1P3MB 1S32A 5CPKA 5B0YC 3TU4B 5AY8D 4EO5C 5AVCD 4UPKA 2Y2OA 5B2ID 3AZNA 3A6ND 1M19A 4KUDC 1BH8B 3AFAC 1P3IB 5GT0B 4LD9D 4Z5TD 3AV2C 1F66D 2Y2GA 1KX5B 1AOID 1A7WA 2YFVA 4JJNC 3LELC 3AZLD 3UTAA 2UWXA 3VH5T 5B2JD 3MGRD 3W99D 3REIC 1KX3B 2BG1A 3MGPB 3B6FC 3WTPB 1P3AB 3X1VC 3KWQC 1P3BC 2G5HC 1P34D 3KXBA 2LY8A 4XUJA 3MGSB 2ZY4A 3R45A 4YS3A 5GT3C 3C1CD 3UTBC 5CP6D 4Z66A 1HQ3B 1M18A 2FJ7B 2NZDD 3AZKC 5B33D 1EQZC 3LZ1B 4DRBA 2XD5A 4J8WA 4J8VB 1S32C 5B32B 3W97D 3KUYC 4HGAC 5B0ZB 3W98A 3NQJA 3AZNC 4R8PB 4DRAA 2NQBD 4XZQD 3H0MC 4WU9D 5CPJA 4H9SC 3VH5W 3B0BA 1WWSA 2BYKA 1ZLAC 1R4VA 3MGQB 4QLCD 1TAFA 5CPJD 3REHB 3B0DC 1KX4B 5B1LA 1P3KA 2Y2MA 3AYWA 3MVDA 3AZGC 3AN2A 3AZJD 5AY8B 5AVCB 5B32G 2XD1A 3A6NB 3TU4A 4J8UD 1P3MD 4XUJC 1M1AD 4Z5TB 3LZ0D 5DNMD 1AOIB 1P3IA 2PYOA 4Z66C 1N1JA
chains in the Genus database with same CATH topology
1KX5A 1M18C 3W99B 3A1IA 1P3ID 4ZUXB 5GT0D 2HIOC 4CAYB 3X1TC 4J8WC 4NE3A 3W96C 5JRGB 5B31A 2HUEB 2Y2QA 1P3PB 5AV9A 1P3AA 1KX3D 3W98C 3MGPD 2FFFB 1P34B 4J8XC 1U35A 3WTPD 3AZIA 3LJAD 3B6GA 4ZBJC 3WKJB 3O62D 3AZFD 3MGSA 3C1CB 2CV5C 2NZDB 1HQ3A 5CPIA 2FJ7A 3X1UB 3WAAB 1P3LA 3UT9C 3KSYA 3MVDC 3LZ1A 5GSUB 4AWLC 2YFWA 3MNNC 3RELA 4J8VA 3W97B 3EPKA 2Y2JA 5AV5B 5B24D 5B40B 3TU4C 3AZEA 5B0ZA 1ULYA 2NQBB 4XZQB 2DQNC 5B32D 4WU9B 2PYOC 1ID3A 3AV1A 4QLCB 5E5AA 1P3FA 4R8PD 2IO5C 3MGQA 5AV6A 3REHA 4WU8C 3NQUA 3REJD 3VH6W 5B31C 4KUDD 4KGCD 5AV9C 1KX4D 3WA9B 2ZY2A 4JJND 1U35C 3AZIC 3B6GC 3V9RB 1M1AB 5AY8A 4J8UB 5AVCA 5B2IA 1P3GB 3A6NA 3LZ0B 5DNMB 4LD9A 4Z5TA 1F66A 1AOIA 3AZLA 1HQ3C 3P5JB 4H9PA 5CPIC 3KWQD 3IP4C 5B2JA 1P3OC 3MGRA 1P3LC 4X23C 1P3BD 3W99A 2BYMB 3LZ1C 1TZYC 3RELC 4J8VC 4ZUXD 4UUZB 3AZEC 5JRGD 5BNXA 3LJAB 1P34A 1P3PD 1ID3C 3AV1C 3O62B 5E5AC 5F99B 3AZMC 3AZFB 1P3FC 3EPHA 5AV6C 5BT1C 3C1CA 5CP6A 3KUYD 1JFIA 3WKJD 2NZDA 5GXQB 2JCHA 5G49B 5B33A 3REKB 4YM6B 4H9OB 5JA4A 5AV8B 3X1UD 4KHAB 3VH6A 1ZLAD 3WAAD 5B24B 3W97A 3AZHB 5FUGB 5CPKC 5GSUD 5B2IC 3X1SB 2F8NH 3A6NC 4E45A 2NQBA 5AV5D 4XZQA 4LD9C 1F66C 4WU9A 5B40D 1M19C 3AZLC 3AZGD 4QLCA 5B2JC 5B0YB 3MGRC 2JE5A 4EO5B 2Y2NA 4H9RB 3REJB 3UTAC 4KUDB 4KGCB 1T3UA 4CSRA 3AFAB 2HUEC 3AV2B 2F8NK 4JJNB 3WA9A 3A1KA 3REIB 3AZJA 2W8SA 2DF4C 4G92C 2HIOD 1P3MA 1M1AA 4J8UA 3X1TD 3WA9D 3W96D 3B6FB 2Y2IA 5C3IC 3KXBC 3LZ0A 5DNMA 3X1VB 5CP6C 3KWQB 1P3GD 2Y2PA 2RVQD 4YS3C 1BH8A 1P3BB 5CHLB 4J8XD 5GT0A 5B33C 2F8NG 3WTPE 2CV5D 5GT3B 3W97C 3UTBB 5BNVB 1KX3A 4UUZA 3MGPA 3EG5B 3AZKB 3VH6T 3WTPA 4XZQC 3LJAA 2AROD 1KU5A 3UT9D 1B67A 5B1MD 1S32B 3O62A 3AZFA 3MNND 5CPJC 1B6WA 3KUYB 1PZRA 4HGAB 5F99D 3AZNB 3AL0C 5AVBD 2Y2KA 5G49A 2YFVB 5B1LC 1ZLAB 1P3KC 4H9OA 5GXQD 4DQYB 4G91C 3AZJC 3AYWC 3REKD 4KHAA 4YM6D 5B24A 3AN2C 5DNND 1P3MC 1M1AC 5AV8D 1BH9B 5B32A 3AZHD 3C1BD 3AZGB 3X1SD 4R8PA 4H9QB 1P3IC 5GT0C 1KX5C 1WWIA 3REJA 4H9RA 4NE5A 4KUDA 4KGCA 5B0YD 3R45B 5BO0B 2F8ND 4Z66B 1KX3C 1KX4A 2VQRA 1M18B 3MGPC 4JJNA 3AFAD 3WTPC 1P3AC 1P3OD 3AV2D 2HIOB 4X23D 3X1TB 3LELD 3W96B 1TZYD 3AZFC 3REID 3W98B 3MGSC 3B6FD 3KWQA 4J8XB 1P3BA 3X1VD 4ZBJB 2FJ7C 2BYKB 2CV5B 3AZMD 4ZUXA 4CAYA 5KDMB 5BT1D 5JRGA 1P3PA 3H0LC 2AROB 5GT3D 5B32C 3UT9B 3UTBD 3MVDB 5B0ZC 5B1MB 4AWLB 3MNNB 4R8PC 3AZKD 1EQZD 2RIQA 4NE6A 3B0CT 3KUYA 3REJC 3WKJA 1S32D 1H3OB 5AVBB 3MGQC 5CPKD 1HTAA 2Y2LA 4KGCC 3REHC 2PYOB 1N1JB 1KX4C 4H9SA 3AZND 1M19D 3X1UA 2IO5B 1ZLAA 3WAAA 5DNNB 4WU8B 3H0RC 1BFMA 5GSUA 3UTAD 5B31B 5AV5A 1BH9A 5AY8C 5AV9B 5AVCC 3C1BB 5B40A 3AZGA 4Z5TC 1U35B 3AZIB 1AOIC 4H9QA 3B6GB 3W99C 1W2EA 4ZUXC 2F8NB 3KXBD 5BO0A 4XUJD 4Z2MH 3EPJA 5JRGC 5CPIB 1P3OB 1P3PC 4YS3D 4X23B 1P3LB 4Z66D 3LELB 2HIOA 1M18D 3X1TA 1TZYB 2YFWB 3W96A 1P34C 3RELB 3B0CW 4H9NB 5B31G 3V9RA 4J8WD 4WNNB 1P3GA 3AZEB 3WKJC 3C1CC 4J8XA 3KFUG 1ID3B 4NFTA 3AV1B 3W98D 2NZDC 5E5AB 3AZMB 1P3FB 3X1UC 4E44A 3WAAC 3EPLA 2CV5A 5AV6B 2BYMA 5KDMA 3NQUB 5GSUC 4WZSB 2ZY3A 5AV5C 2AROA 3UT9A 2ZM5A 5B40C 5B1MA 2JSSA 5B1LD 2NQBC 1EQZB 1P3KD 3MNNA 4WU9C 2J8PA 3AYWD 3MVDD 5BS7A 4Z2MG 3AN2D 4QLCC 5F99A 5B2IB 5CPKB 2G5IC 1H3OA 5AVBA 2ZY5A 4LD9B 1F66B 3TU4D 3AZLB 1M19B 4H9PB 5GXQA 5B2JB 3MGRB 3REKA 2PYOD 2L5AA 3F6TA 4YM6A 5DNNA 4WU8A 3UTAB 1KX5D 3WA9C 5AV8A 3B0DB 2Y2HA 3AZHA 5FUGA 4WU8D 4J8UC 3C1BA 4M6BA 3X1SA 1P3GC 2RVQC 5B31D 5BNXB 3LZ0C 5DNMC 5AV9D 1P3AD 4G92B 3FDDA 1U35D 5C3IB 5B0YA 3KXBB 3AZID 1Q9CA 3B6GD 2F8NA 5CP6B 4XUJB 4WV4B 1JFIB 3VH5A 4YS3B 3MGSD 3AFAA 1Z2CB 5B33B 1P3OA 3AV2A 2AROC 2CWEA 4X23A 3LELA 1HQ3D 5JA4B 5B1MC 1F1EA 5CPID 1TZYA 3LJAC 2FJ7D 3REIA 1P3LD 4J8WB 2F2AC 4H9NA 3LZ1D 5BS7C 4WNNA 5F99C 3O62C 3B6FA 3RELD 4J8VD 5AVBC 3X1VA 3NQJB 3AZED 5B0ZD 5GXQC 3AZMA 5CPJB 3REKC 1ID3D 4YM6C 3AV1D 5DNNC 5E5AD 1P3FD 1TAFB 4CSRB 5AV8C 3MGQD 5GT3A 5B24C 5AV6D 3AZHC 3UTBA 3REHD 5BNVA 3C1BC 5B1LB 3X1SC 4WJ3C 1P3KB 3AZKA 4G91B 3AYWB 3AZJB 1EQZA 3AN2B 1P3MB 1S32A 5CPKA 5B0YC 3TU4B 5AY8D 4EO5C 5AVCD 4UPKA 2Y2OA 5B2ID 3AZNA 3A6ND 1M19A 4KUDC 1BH8B 3AFAC 1P3IB 5GT0B 4LD9D 4Z5TD 3AV2C 1F66D 2Y2GA 1KX5B 1AOID 1A7WA 2YFVA 4JJNC 3LELC 3AZLD 3UTAA 2UWXA 3VH5T 5B2JD 3MGRD 3W99D 3REIC 1KX3B 2BG1A 3MGPB 3B6FC 3WTPB 1P3AB 3X1VC 3KWQC 1P3BC 2G5HC 1P34D 3KXBA 2LY8A 4XUJA 3MGSB 2ZY4A 3R45A 4YS3A 5GT3C 3C1CD 3UTBC 5CP6D 4Z66A 1HQ3B 1M18A 2FJ7B 2NZDD 3AZKC 5B33D 1EQZC 3LZ1B 4DRBA 2XD5A 4J8WA 4J8VB 1S32C 5B32B 3W97D 3KUYC 4HGAC 5B0ZB 3W98A 3NQJA 3AZNC 4R8PB 4DRAA 2NQBD 4XZQD 3H0MC 4WU9D 5CPJA 4H9SC 3VH5W 3B0BA 1WWSA 2BYKA 1ZLAC 1R4VA 3MGQB 4QLCD 1TAFA 5CPJD 3REHB 3B0DC 1KX4B 5B1LA 1P3KA 2Y2MA 3AYWA 3MVDA 3AZGC 3AN2A 3AZJD 5AY8B 5AVCB 5B32G 2XD1A 3A6NB 3TU4A 4J8UD 1P3MD 4XUJC 1M1AD 4Z5TB 3LZ0D 5DNMD 1AOIB 1P3IA 2PYOA 4Z66C 1N1JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KX5 A;  1M18 C;  3W99 B;  1P3I D;  4ZUX B;  5GT0 D;  2HIO C;  4CAY B;  3X1T C;  4J8W C;  4NE3 A;  3W96 C;  5JRG B;  5B31 A;  2HUE B;  1P3P B;  5AV9 A;  1P3A A;  1KX3 D;  3W98 C;  3MGP D;  1P34 B;  4J8X C;  1U35 A;  3WTP D;  3AZI A;  3LJA D;  3B6G A;  4ZBJ C;  3WKJ B;  3O62 D;  3AZF D;  3MGS A;  3C1C B;  2CV5 C;  2NZD B;  1HQ3 A;  5CPI A;  2FJ7 A;  3X1U B;  3WAA B;  1P3L A;  3UT9 C;  3KSY A;  3MVD C;  3LZ1 A;  5GSU B;  4AWL C;  2YFW A;  3MNN C;  3REL A;  4J8V A;  3W97 B;  5AV5 B;  5B24 D;  5B40 B;  3TU4 C;  3AZE A;  5B0Z A;  1ULY A;  2NQB B;  4XZQ B;  5B32 D;  4WU9 B;  2PYO C;  1ID3 A;  3AV1 A;  4QLC B;  5E5A A;  1P3F A;  4R8P D;  2IO5 C;  3MGQ A;  5AV6 A;  3REH A;  4WU8 C;  3NQU A;  3REJ D;  3VH6 W;  5B31 C;  4KUD D;  4KGC D;  5AV9 C;  1KX4 D;  3WA9 B;  4JJN D;  1U35 C;  3AZI C;  3B6G C;  3V9R B;  1M1A B;  5AY8 A;  4J8U B;  5AVC A;  5B2I A;  1P3G B;  3A6N A;  3LZ0 B;  5DNM B;  4LD9 A;  4Z5T A;  1F66 A;  1AOI A;  3AZL A;  1HQ3 C;  4H9P A;  5CPI C;  3KWQ D;  5B2J A;  1P3O C;  3MGR A;  1P3L C;  4X23 C;  1P3B D;  3W99 A;  2BYM B;  3LZ1 C;  1TZY C;  3REL C;  4J8V C;  4ZUX D;  4UUZ B;  3AZE C;  5JRG D;  5BNX A;  3LJA B;  1P34 A;  1P3P D;  1ID3 C;  3AV1 C;  3O62 B;  5E5A C;  5F99 B;  3AZM C;  3AZF B;  1P3F C;  5AV6 C;  5BT1 C;  3C1C A;  5CP6 A;  3KUY D;  1JFI A;  3WKJ D;  2NZD A;  5GXQ B;  5B33 A;  5G49 B;  3REK B;  4YM6 B;  4H9O B;  5JA4 A;  5AV8 B;  3X1U D;  4KHA B;  3VH6 A;  1ZLA D;  3WAA D;  5B24 B;  3W97 A;  3AZH B;  5FUG B;  5CPK C;  5GSU D;  5B2I C;  3X1S B;  2F8N H;  3A6N C;  4E45 A;  2NQB A;  4XZQ A;  5AV5 D;  4LD9 C;  1F66 C;  4WU9 A;  5B40 D;  1M19 C;  3AZL C;  3AZG D;  4QLC A;  5B2J C;  5B0Y B;  3MGR C;  4EO5 B;  4H9R B;  3REJ B;  3UTA C;  4KUD B;  4KGC B;  4CSR A;  3AFA B;  2HUE C;  3AV2 B;  2F8N K;  4JJN B;  3WA9 A;  3REI B;  3AZJ A;  4G92 C;  2HIO D;  1P3M A;  1M1A A;  4J8U A;  3X1T D;  3WA9 D;  3W96 D;  3B6F B;  5C3I C;  3KXB C;  3LZ0 A;  5DNM A;  3X1V B;  5CP6 C;  3KWQ B;  1P3G D;  2RVQ D;  4YS3 C;  1BH8 A;  1P3B B;  5CHL B;  4J8X D;  5GT0 A;  5B33 C;  2F8N G;  3WTP E;  2CV5 D;  5GT3 B;  3W97 C;  3UTB B;  5BNV B;  1KX3 A;  4UUZ A;  3MGP A;  3AZK B;  3VH6 T;  3WTP A;  4XZQ C;  3LJA A;  2ARO D;  1KU5 A;  3UT9 D;  1B67 A;  5B1M D;  1S32 B;  3O62 A;  3AZF A;  3MNN D;  5CPJ C;  1B6W A;  3KUY B;  4HGA B;  5F99 D;  3AZN B;  5AVB D;  5G49 A;  2YFV B;  5B1L C;  1ZLA B;  1P3K C;  4H9O A;  5GXQ D;  4G91 C;  3AZJ C;  3AYW C;  3REK D;  4KHA A;  4YM6 D;  5B24 A;  3AN2 C;  5DNN D;  1P3M C;  1M1A C;  5AV8 D;  1BH9 B;  5B32 A;  3AZH D;  3C1B D;  3AZG B;  3X1S D;  4R8P A;  4H9Q B;  1P3I C;  5GT0 C;  1KX5 C;  1WWI A;  3REJ A;  4H9R A;  4NE5 A;  4KUD A;  4KGC A;  5B0Y D;  3R45 B;  5BO0 B;  2F8N D;  4Z66 B;  1KX3 C;  1KX4 A;  1M18 B;  3MGP C;  4JJN A;  3AFA D;  3WTP C;  1P3A C;  1P3O D;  3AV2 D;  2HIO B;  4X23 D;  3X1T B;  3LEL D;  3W96 B;  1TZY D;  3AZF C;  3REI D;  3W98 B;  3MGS C;  3B6F D;  3KWQ A;  4J8X B;  1P3B A;  3X1V D;  4ZBJ B;  2FJ7 C;  2BYK B;  2CV5 B;  3AZM D;  4ZUX A;  4CAY A;  5KDM B;  5BT1 D;  5JRG A;  1P3P A;  2ARO B;  5GT3 D;  5B32 C;  3UT9 B;  3UTB D;  3MVD B;  5B0Z C;  5B1M B;  4AWL B;  3MNN B;  4R8P C;  3AZK D;  1EQZ D;  4NE6 A;  3B0C T;  3KUY A;  3REJ C;  3WKJ A;  1S32 D;  1H3O B;  5AVB B;  3MGQ C;  5CPK D;  1HTA A;  4KGC C;  3REH C;  2PYO B;  1N1J B;  1KX4 C;  4H9S A;  3AZN D;  1M19 D;  3X1U A;  2IO5 B;  1ZLA A;  3WAA A;  5DNN B;  4WU8 B;  1BFM A;  5GSU A;  3UTA D;  5B31 B;  5AV5 A;  1BH9 A;  5AY8 C;  5AV9 B;  5AVC C;  3C1B B;  5B40 A;  3AZG A;  4Z5T C;  1U35 B;  3AZI B;  1AOI C;  4H9Q A;  3B6G B;  3W99 C;  4ZUX C;  2F8N B;  3KXB D;  5BO0 A;  4XUJ D;  4Z2M H;  5JRG C;  5CPI B;  1P3O B;  1P3P C;  4YS3 D;  4X23 B;  1P3L B;  4Z66 D;  3LEL B;  2HIO A;  1M18 D;  3X1T A;  1TZY B;  2YFW B;  3W96 A;  1P34 C;  3REL B;  3B0C W;  4H9N B;  5B31 G;  3V9R A;  4J8W D;  4WNN B;  1P3G A;  3AZE B;  3WKJ C;  3C1C C;  4J8X A;  1ID3 B;  4NFT A;  3AV1 B;  3W98 D;  2NZD C;  5E5A B;  3AZM B;  1P3F B;  3X1U C;  4E44 A;  3WAA C;  2CV5 A;  5AV6 B;  2BYM A;  5KDM A;  3NQU B;  5GSU C;  4WZS B;  5AV5 C;  2ARO A;  3UT9 A;  5B40 C;  5B1M A;  2JSS A;  5B1L D;  2NQB C;  1EQZ B;  1P3K D;  3MNN A;  4WU9 C;  3AYW D;  3MVD D;  5BS7 A;  4Z2M G;  3AN2 D;  4QLC C;  5F99 A;  5B2I B;  5CPK B;  1H3O A;  5AVB A;  4LD9 B;  1F66 B;  3TU4 D;  3AZL B;  1M19 B;  4H9P B;  5GXQ A;  5B2J B;  3MGR B;  3REK A;  2PYO D;  2L5A A;  4YM6 A;  5DNN A;  4WU8 A;  3UTA B;  1KX5 D;  3WA9 C;  5AV8 A;  3B0D B;  3AZH A;  5FUG A;  4WU8 D;  4J8U C;  3C1B A;  4M6B A;  3X1S A;  1P3G C;  2RVQ C;  5B31 D;  5BNX B;  3LZ0 C;  5DNM C;  5AV9 D;  1P3A D;  4G92 B;  1U35 D;  5C3I B;  5B0Y A;  3KXB B;  3AZI D;  1Q9C A;  3B6G D;  2F8N A;  5CP6 B;  4XUJ B;  4WV4 B;  1JFI B;  3VH5 A;  4YS3 B;  3MGS D;  3AFA A;  5B33 B;  1P3O A;  3AV2 A;  2ARO C;  2CWE A;  4X23 A;  3LEL A;  1HQ3 D;  5JA4 B;  5B1M C;  1F1E A;  5CPI D;  1TZY A;  3LJA C;  2FJ7 D;  3REI A;  1P3L D;  4J8W B;  4H9N A;  3LZ1 D;  5BS7 C;  4WNN A;  5F99 C;  3O62 C;  3B6F A;  3REL D;  4J8V D;  5AVB C;  3X1V A;  3NQJ B;  3AZE D;  5B0Z D;  5GXQ C;  3AZM A;  5CPJ B;  3REK C;  1ID3 D;  4YM6 C;  3AV1 D;  5DNN C;  5E5A D;  1P3F D;  1TAF B;  4CSR B;  5AV8 C;  3MGQ D;  5GT3 A;  5B24 C;  5AV6 D;  3AZH C;  3UTB A;  3REH D;  5BNV A;  3C1B C;  5B1L B;  3X1S C;  1P3K B;  3AZK A;  4G91 B;  3AYW B;  3AZJ B;  1EQZ A;  3AN2 B;  1P3M B;  1S32 A;  5CPK A;  5B0Y C;  3TU4 B;  5AY8 D;  4EO5 C;  5AVC D;  5B2I D;  3AZN A;  3A6N D;  1M19 A;  4KUD C;  1BH8 B;  3AFA C;  1P3I B;  5GT0 B;  4LD9 D;  4Z5T D;  3AV2 C;  1F66 D;  1KX5 B;  1AOI D;  1A7W A;  2YFV A;  4JJN C;  3LEL C;  3AZL D;  3UTA A;  3VH5 T;  5B2J D;  3MGR D;  3W99 D;  3REI C;  1KX3 B;  3MGP B;  3B6F C;  3WTP B;  1P3A B;  3X1V C;  3KWQ C;  1P3B C;  1P34 D;  3KXB A;  2LY8 A;  4XUJ A;  3MGS B;  3R45 A;  4YS3 A;  5GT3 C;  3C1C D;  3UTB C;  5CP6 D;  4Z66 A;  1HQ3 B;  1M18 A;  2FJ7 B;  2NZD D;  3AZK C;  5B33 D;  1EQZ C;  3LZ1 B;  4DRB A;  4J8W A;  4J8V B;  1S32 C;  5B32 B;  3W97 D;  3KUY C;  4HGA C;  5B0Z B;  3W98 A;  3NQJ A;  3AZN C;  4R8P B;  4DRA A;  2NQB D;  4XZQ D;  4WU9 D;  5CPJ A;  4H9S C;  3VH5 W;  3B0B A;  1WWS A;  2BYK A;  1ZLA C;  1R4V A;  3MGQ B;  4QLC D;  1TAF A;  5CPJ D;  3REH B;  3B0D C;  1KX4 B;  5B1L A;  1P3K A;  3AYW A;  3MVD A;  3AZG C;  3AN2 A;  3AZJ D;  5AY8 B;  5AVC B;  5B32 G;  3A6N B;  3TU4 A;  4J8U D;  1P3M D;  4XUJ C;  1M1A D;  4Z5T B;  3LZ0 D;  5DNM D;  1AOI B;  1P3I A;  2PYO A;  4Z66 C;  1N1J A; 
#chains in the Genus database with same CATH topology
 1KX5 A;  1M18 C;  3W99 B;  3A1I A;  1P3I D;  4ZUX B;  5GT0 D;  2HIO C;  4CAY B;  3X1T C;  4J8W C;  4NE3 A;  3W96 C;  5JRG B;  5B31 A;  2HUE B;  2Y2Q A;  1P3P B;  5AV9 A;  1P3A A;  1KX3 D;  3W98 C;  3MGP D;  2FFF B;  1P34 B;  4J8X C;  1U35 A;  3WTP D;  3AZI A;  3LJA D;  3B6G A;  4ZBJ C;  3WKJ B;  3O62 D;  3AZF D;  3MGS A;  3C1C B;  2CV5 C;  2NZD B;  1HQ3 A;  5CPI A;  2FJ7 A;  3X1U B;  3WAA B;  1P3L A;  3UT9 C;  3KSY A;  3MVD C;  3LZ1 A;  5GSU B;  4AWL C;  2YFW A;  3MNN C;  3REL A;  4J8V A;  3W97 B;  3EPK A;  2Y2J A;  5AV5 B;  5B24 D;  5B40 B;  3TU4 C;  3AZE A;  5B0Z A;  1ULY A;  2NQB B;  4XZQ B;  2DQN C;  5B32 D;  4WU9 B;  2PYO C;  1ID3 A;  3AV1 A;  4QLC B;  5E5A A;  1P3F A;  4R8P D;  2IO5 C;  3MGQ A;  5AV6 A;  3REH A;  4WU8 C;  3NQU A;  3REJ D;  3VH6 W;  5B31 C;  4KUD D;  4KGC D;  5AV9 C;  1KX4 D;  3WA9 B;  2ZY2 A;  4JJN D;  1U35 C;  3AZI C;  3B6G C;  3V9R B;  1M1A B;  5AY8 A;  4J8U B;  5AVC A;  5B2I A;  1P3G B;  3A6N A;  3LZ0 B;  5DNM B;  4LD9 A;  4Z5T A;  1F66 A;  1AOI A;  3AZL A;  1HQ3 C;  3P5J B;  4H9P A;  5CPI C;  3KWQ D;  3IP4 C;  5B2J A;  1P3O C;  3MGR A;  1P3L C;  4X23 C;  1P3B D;  3W99 A;  2BYM B;  3LZ1 C;  1TZY C;  3REL C;  4J8V C;  4ZUX D;  4UUZ B;  3AZE C;  5JRG D;  5BNX A;  3LJA B;  1P34 A;  1P3P D;  1ID3 C;  3AV1 C;  3O62 B;  5E5A C;  5F99 B;  3AZM C;  3AZF B;  1P3F C;  3EPH A;  5AV6 C;  5BT1 C;  3C1C A;  5CP6 A;  3KUY D;  1JFI A;  3WKJ D;  2NZD A;  5GXQ B;  2JCH A;  5G49 B;  5B33 A;  3REK B;  4YM6 B;  4H9O B;  5JA4 A;  5AV8 B;  3X1U D;  4KHA B;  3VH6 A;  1ZLA D;  3WAA D;  5B24 B;  3W97 A;  3AZH B;  5FUG B;  5CPK C;  5GSU D;  5B2I C;  3X1S B;  2F8N H;  3A6N C;  4E45 A;  2NQB A;  5AV5 D;  4XZQ A;  4LD9 C;  1F66 C;  4WU9 A;  5B40 D;  1M19 C;  3AZL C;  3AZG D;  4QLC A;  5B2J C;  5B0Y B;  3MGR C;  2JE5 A;  4EO5 B;  2Y2N A;  4H9R B;  3REJ B;  3UTA C;  4KUD B;  4KGC B;  1T3U A;  4CSR A;  3AFA B;  2HUE C;  3AV2 B;  2F8N K;  4JJN B;  3WA9 A;  3A1K A;  3REI B;  3AZJ A;  2W8S A;  2DF4 C;  4G92 C;  2HIO D;  1P3M A;  1M1A A;  4J8U A;  3X1T D;  3WA9 D;  3W96 D;  3B6F B;  2Y2I A;  5C3I C;  3KXB C;  3LZ0 A;  5DNM A;  3X1V B;  5CP6 C;  3KWQ B;  1P3G D;  2Y2P A;  2RVQ D;  4YS3 C;  1BH8 A;  1P3B B;  5CHL B;  4J8X D;  5GT0 A;  5B33 C;  2F8N G;  3WTP E;  2CV5 D;  5GT3 B;  3W97 C;  3UTB B;  5BNV B;  1KX3 A;  4UUZ A;  3MGP A;  3EG5 B;  3AZK B;  3VH6 T;  3WTP A;  4XZQ C;  3LJA A;  2ARO D;  1KU5 A;  3UT9 D;  1B67 A;  5B1M D;  1S32 B;  3O62 A;  3AZF A;  3MNN D;  5CPJ C;  1B6W A;  3KUY B;  1PZR A;  4HGA B;  5F99 D;  3AZN B;  3AL0 C;  5AVB D;  2Y2K A;  5G49 A;  2YFV B;  5B1L C;  1ZLA B;  1P3K C;  4H9O A;  5GXQ D;  4DQY B;  4G91 C;  3AZJ C;  3AYW C;  3REK D;  4KHA A;  4YM6 D;  5B24 A;  3AN2 C;  5DNN D;  1P3M C;  1M1A C;  5AV8 D;  1BH9 B;  5B32 A;  3AZH D;  3C1B D;  3AZG B;  3X1S D;  4R8P A;  4H9Q B;  1P3I C;  5GT0 C;  1KX5 C;  1WWI A;  3REJ A;  4H9R A;  4NE5 A;  4KUD A;  4KGC A;  5B0Y D;  3R45 B;  5BO0 B;  2F8N D;  4Z66 B;  1KX3 C;  1KX4 A;  2VQR A;  1M18 B;  3MGP C;  4JJN A;  3AFA D;  3WTP C;  1P3A C;  1P3O D;  3AV2 D;  2HIO B;  4X23 D;  3X1T B;  3LEL D;  3W96 B;  1TZY D;  3AZF C;  3REI D;  3W98 B;  3MGS C;  3B6F D;  3KWQ A;  4J8X B;  1P3B A;  3X1V D;  4ZBJ B;  2FJ7 C;  2BYK B;  2CV5 B;  3AZM D;  4ZUX A;  4CAY A;  5KDM B;  5BT1 D;  5JRG A;  1P3P A;  3H0L C;  2ARO B;  5GT3 D;  5B32 C;  3UT9 B;  3UTB D;  3MVD B;  5B0Z C;  5B1M B;  4AWL B;  3MNN B;  4R8P C;  3AZK D;  1EQZ D;  2RIQ A;  4NE6 A;  3B0C T;  3KUY A;  3REJ C;  3WKJ A;  1S32 D;  1H3O B;  5AVB B;  3MGQ C;  5CPK D;  1HTA A;  2Y2L A;  4KGC C;  3REH C;  2PYO B;  1N1J B;  1KX4 C;  4H9S A;  3AZN D;  1M19 D;  3X1U A;  2IO5 B;  1ZLA A;  3WAA A;  5DNN B;  4WU8 B;  3H0R C;  1BFM A;  5GSU A;  3UTA D;  5B31 B;  5AV5 A;  1BH9 A;  5AY8 C;  5AV9 B;  5AVC C;  3C1B B;  5B40 A;  3AZG A;  4Z5T C;  1U35 B;  3AZI B;  1AOI C;  4H9Q A;  3B6G B;  3W99 C;  1W2E A;  4ZUX C;  2F8N B;  3KXB D;  5BO0 A;  4XUJ D;  4Z2M H;  3EPJ A;  5JRG C;  5CPI B;  1P3O B;  1P3P C;  4YS3 D;  4X23 B;  1P3L B;  4Z66 D;  3LEL B;  2HIO A;  1M18 D;  3X1T A;  1TZY B;  2YFW B;  3W96 A;  1P34 C;  3REL B;  3B0C W;  4H9N B;  5B31 G;  3V9R A;  4J8W D;  4WNN B;  1P3G A;  3AZE B;  3WKJ C;  3C1C C;  4J8X A;  3KFU G;  1ID3 B;  4NFT A;  3AV1 B;  3W98 D;  2NZD C;  5E5A B;  3AZM B;  1P3F B;  3X1U C;  4E44 A;  3WAA C;  3EPL A;  2CV5 A;  5AV6 B;  2BYM A;  5KDM A;  3NQU B;  5GSU C;  4WZS B;  2ZY3 A;  5AV5 C;  2ARO A;  3UT9 A;  2ZM5 A;  5B40 C;  5B1M A;  2JSS A;  5B1L D;  2NQB C;  1EQZ B;  1P3K D;  3MNN A;  4WU9 C;  2J8P A;  3AYW D;  3MVD D;  5BS7 A;  4Z2M G;  3AN2 D;  4QLC C;  5F99 A;  5B2I B;  5CPK B;  2G5I C;  1H3O A;  5AVB A;  2ZY5 A;  4LD9 B;  1F66 B;  3TU4 D;  3AZL B;  1M19 B;  4H9P B;  5GXQ A;  5B2J B;  3MGR B;  3REK A;  2PYO D;  2L5A A;  3F6T A;  4YM6 A;  5DNN A;  4WU8 A;  3UTA B;  1KX5 D;  3WA9 C;  5AV8 A;  3B0D B;  2Y2H A;  3AZH A;  5FUG A;  4WU8 D;  4J8U C;  3C1B A;  4M6B A;  3X1S A;  1P3G C;  2RVQ C;  5B31 D;  5BNX B;  3LZ0 C;  5DNM C;  5AV9 D;  1P3A D;  4G92 B;  3FDD A;  1U35 D;  5C3I B;  5B0Y A;  3KXB B;  3AZI D;  1Q9C A;  3B6G D;  2F8N A;  5CP6 B;  4XUJ B;  4WV4 B;  1JFI B;  3VH5 A;  4YS3 B;  3MGS D;  3AFA A;  1Z2C B;  5B33 B;  1P3O A;  3AV2 A;  2ARO C;  2CWE A;  4X23 A;  3LEL A;  1HQ3 D;  5JA4 B;  5B1M C;  1F1E A;  5CPI D;  1TZY A;  3LJA C;  2FJ7 D;  3REI A;  1P3L D;  4J8W B;  2F2A C;  4H9N A;  3LZ1 D;  5BS7 C;  4WNN A;  5F99 C;  3O62 C;  3B6F A;  3REL D;  4J8V D;  5AVB C;  3X1V A;  3NQJ B;  3AZE D;  5B0Z D;  5GXQ C;  3AZM A;  5CPJ B;  3REK C;  1ID3 D;  4YM6 C;  3AV1 D;  5DNN C;  5E5A D;  1P3F D;  1TAF B;  4CSR B;  5AV8 C;  3MGQ D;  5GT3 A;  5B24 C;  5AV6 D;  3AZH C;  3UTB A;  3REH D;  5BNV A;  3C1B C;  5B1L B;  3X1S C;  4WJ3 C;  1P3K B;  3AZK A;  4G91 B;  3AYW B;  3AZJ B;  1EQZ A;  3AN2 B;  1P3M B;  1S32 A;  5CPK A;  5B0Y C;  3TU4 B;  5AY8 D;  4EO5 C;  5AVC D;  4UPK A;  2Y2O A;  5B2I D;  3AZN A;  3A6N D;  1M19 A;  4KUD C;  1BH8 B;  3AFA C;  1P3I B;  5GT0 B;  4LD9 D;  4Z5T D;  3AV2 C;  1F66 D;  2Y2G A;  1KX5 B;  1AOI D;  1A7W A;  2YFV A;  4JJN C;  3LEL C;  3AZL D;  3UTA A;  2UWX A;  3VH5 T;  5B2J D;  3MGR D;  3W99 D;  3REI C;  1KX3 B;  2BG1 A;  3MGP B;  3B6F C;  3WTP B;  1P3A B;  3X1V C;  3KWQ C;  1P3B C;  2G5H C;  1P34 D;  3KXB A;  2LY8 A;  4XUJ A;  3MGS B;  2ZY4 A;  3R45 A;  4YS3 A;  5GT3 C;  3C1C D;  3UTB C;  5CP6 D;  4Z66 A;  1HQ3 B;  1M18 A;  2FJ7 B;  2NZD D;  3AZK C;  5B33 D;  1EQZ C;  3LZ1 B;  4DRB A;  2XD5 A;  4J8W A;  4J8V B;  1S32 C;  5B32 B;  3W97 D;  3KUY C;  4HGA C;  5B0Z B;  3W98 A;  3NQJ A;  3AZN C;  4R8P B;  4DRA A;  2NQB D;  4XZQ D;  3H0M C;  4WU9 D;  5CPJ A;  4H9S C;  3VH5 W;  3B0B A;  1WWS A;  2BYK A;  1ZLA C;  1R4V A;  3MGQ B;  4QLC D;  1TAF A;  5CPJ D;  3REH B;  3B0D C;  1KX4 B;  5B1L A;  1P3K A;  2Y2M A;  3AYW A;  3MVD A;  3AZG C;  3AN2 A;  3AZJ D;  5AY8 B;  5AVC B;  5B32 G;  2XD1 A;  3A6N B;  3TU4 A;  4J8U D;  1P3M D;  4XUJ C;  1M1A D;  4Z5T B;  3LZ0 D;  5DNM D;  1AOI B;  1P3I A;  2PYO A;  4Z66 C;  1N1J A; 
#chains in the Genus database with same CATH homology
 1KX5 A;  1M18 C;  3W99 B;  3A1I A;  1P3I D;  4ZUX B;  5GT0 D;  2HIO C;  4CAY B;  3X1T C;  4J8W C;  4NE3 A;  3W96 C;  5JRG B;  5B31 A;  2HUE B;  2Y2Q A;  1P3P B;  5AV9 A;  1P3A A;  1KX3 D;  3W98 C;  3MGP D;  2FFF B;  1P34 B;  4J8X C;  1U35 A;  3WTP D;  3AZI A;  3LJA D;  3B6G A;  4ZBJ C;  3WKJ B;  3O62 D;  3AZF D;  3MGS A;  3C1C B;  2CV5 C;  2NZD B;  1HQ3 A;  5CPI A;  2FJ7 A;  3X1U B;  3WAA B;  1P3L A;  3UT9 C;  3KSY A;  3MVD C;  3LZ1 A;  5GSU B;  4AWL C;  2YFW A;  3MNN C;  3REL A;  4J8V A;  3W97 B;  3EPK A;  2Y2J A;  5AV5 B;  5B24 D;  5B40 B;  3TU4 C;  3AZE A;  5B0Z A;  1ULY A;  2NQB B;  4XZQ B;  2DQN C;  5B32 D;  4WU9 B;  2PYO C;  1ID3 A;  3AV1 A;  4QLC B;  5E5A A;  1P3F A;  4R8P D;  2IO5 C;  3MGQ A;  5AV6 A;  3REH A;  4WU8 C;  3NQU A;  3REJ D;  3VH6 W;  5B31 C;  4KUD D;  4KGC D;  5AV9 C;  1KX4 D;  3WA9 B;  2ZY2 A;  4JJN D;  1U35 C;  3AZI C;  3B6G C;  3V9R B;  1M1A B;  5AY8 A;  4J8U B;  5AVC A;  5B2I A;  1P3G B;  3A6N A;  3LZ0 B;  5DNM B;  4LD9 A;  4Z5T A;  1F66 A;  1AOI A;  3AZL A;  1HQ3 C;  3P5J B;  4H9P A;  5CPI C;  3KWQ D;  3IP4 C;  5B2J A;  1P3O C;  3MGR A;  1P3L C;  4X23 C;  1P3B D;  3W99 A;  2BYM B;  3LZ1 C;  1TZY C;  3REL C;  4J8V C;  4ZUX D;  4UUZ B;  3AZE C;  5JRG D;  5BNX A;  3LJA B;  1P34 A;  1P3P D;  1ID3 C;  3AV1 C;  3O62 B;  5E5A C;  5F99 B;  3AZM C;  3AZF B;  1P3F C;  3EPH A;  5AV6 C;  5BT1 C;  3C1C A;  5CP6 A;  3KUY D;  1JFI A;  3WKJ D;  2NZD A;  5GXQ B;  2JCH A;  5G49 B;  5B33 A;  3REK B;  4YM6 B;  4H9O B;  5JA4 A;  5AV8 B;  3X1U D;  4KHA B;  3VH6 A;  1ZLA D;  3WAA D;  5B24 B;  3W97 A;  3AZH B;  5FUG B;  5CPK C;  5GSU D;  5B2I C;  3X1S B;  2F8N H;  3A6N C;  4E45 A;  2NQB A;  5AV5 D;  4XZQ A;  4LD9 C;  1F66 C;  4WU9 A;  5B40 D;  1M19 C;  3AZL C;  3AZG D;  4QLC A;  5B2J C;  5B0Y B;  3MGR C;  2JE5 A;  4EO5 B;  2Y2N A;  4H9R B;  3REJ B;  3UTA C;  4KUD B;  4KGC B;  1T3U A;  4CSR A;  3AFA B;  2HUE C;  3AV2 B;  2F8N K;  4JJN B;  3WA9 A;  3A1K A;  3REI B;  3AZJ A;  2W8S A;  2DF4 C;  4G92 C;  2HIO D;  1P3M A;  1M1A A;  4J8U A;  3X1T D;  3WA9 D;  3W96 D;  3B6F B;  2Y2I A;  5C3I C;  3KXB C;  3LZ0 A;  5DNM A;  3X1V B;  5CP6 C;  3KWQ B;  1P3G D;  2Y2P A;  2RVQ D;  4YS3 C;  1BH8 A;  1P3B B;  5CHL B;  4J8X D;  5GT0 A;  5B33 C;  2F8N G;  3WTP E;  2CV5 D;  5GT3 B;  3W97 C;  3UTB B;  5BNV B;  1KX3 A;  4UUZ A;  3MGP A;  3EG5 B;  3AZK B;  3VH6 T;  3WTP A;  4XZQ C;  3LJA A;  2ARO D;  1KU5 A;  3UT9 D;  1B67 A;  5B1M D;  1S32 B;  3O62 A;  3AZF A;  3MNN D;  5CPJ C;  1B6W A;  3KUY B;  1PZR A;  4HGA B;  5F99 D;  3AZN B;  3AL0 C;  5AVB D;  2Y2K A;  5G49 A;  2YFV B;  5B1L C;  1ZLA B;  1P3K C;  4H9O A;  5GXQ D;  4DQY B;  4G91 C;  3AZJ C;  3AYW C;  3REK D;  4KHA A;  4YM6 D;  5B24 A;  3AN2 C;  5DNN D;  1P3M C;  1M1A C;  5AV8 D;  1BH9 B;  5B32 A;  3AZH D;  3C1B D;  3AZG B;  3X1S D;  4R8P A;  4H9Q B;  1P3I C;  5GT0 C;  1KX5 C;  1WWI A;  3REJ A;  4H9R A;  4NE5 A;  4KUD A;  4KGC A;  5B0Y D;  3R45 B;  5BO0 B;  2F8N D;  4Z66 B;  1KX3 C;  1KX4 A;  2VQR A;  1M18 B;  3MGP C;  4JJN A;  3AFA D;  3WTP C;  1P3A C;  1P3O D;  3AV2 D;  2HIO B;  4X23 D;  3X1T B;  3LEL D;  3W96 B;  1TZY D;  3AZF C;  3REI D;  3W98 B;  3MGS C;  3B6F D;  3KWQ A;  4J8X B;  1P3B A;  3X1V D;  4ZBJ B;  2FJ7 C;  2BYK B;  2CV5 B;  3AZM D;  4ZUX A;  4CAY A;  5KDM B;  5BT1 D;  5JRG A;  1P3P A;  3H0L C;  2ARO B;  5GT3 D;  5B32 C;  3UT9 B;  3UTB D;  3MVD B;  5B0Z C;  5B1M B;  4AWL B;  3MNN B;  4R8P C;  3AZK D;  1EQZ D;  2RIQ A;  4NE6 A;  3B0C T;  3KUY A;  3REJ C;  3WKJ A;  1S32 D;  1H3O B;  5AVB B;  3MGQ C;  5CPK D;  1HTA A;  2Y2L A;  4KGC C;  3REH C;  2PYO B;  1N1J B;  1KX4 C;  4H9S A;  3AZN D;  1M19 D;  3X1U A;  2IO5 B;  1ZLA A;  3WAA A;  5DNN B;  4WU8 B;  3H0R C;  1BFM A;  5GSU A;  3UTA D;  5B31 B;  5AV5 A;  1BH9 A;  5AY8 C;  5AV9 B;  5AVC C;  3C1B B;  5B40 A;  3AZG A;  4Z5T C;  1U35 B;  3AZI B;  1AOI C;  4H9Q A;  3B6G B;  3W99 C;  1W2E A;  4ZUX C;  2F8N B;  3KXB D;  5BO0 A;  4XUJ D;  4Z2M H;  3EPJ A;  5JRG C;  5CPI B;  1P3O B;  1P3P C;  4YS3 D;  4X23 B;  1P3L B;  4Z66 D;  3LEL B;  2HIO A;  1M18 D;  3X1T A;  1TZY B;  2YFW B;  3W96 A;  1P34 C;  3REL B;  3B0C W;  4H9N B;  5B31 G;  3V9R A;  4J8W D;  4WNN B;  1P3G A;  3AZE B;  3WKJ C;  3C1C C;  4J8X A;  3KFU G;  1ID3 B;  4NFT A;  3AV1 B;  3W98 D;  2NZD C;  5E5A B;  3AZM B;  1P3F B;  3X1U C;  4E44 A;  3WAA C;  3EPL A;  2CV5 A;  5AV6 B;  2BYM A;  5KDM A;  3NQU B;  5GSU C;  4WZS B;  2ZY3 A;  5AV5 C;  2ARO A;  3UT9 A;  2ZM5 A;  5B40 C;  5B1M A;  2JSS A;  5B1L D;  2NQB C;  1EQZ B;  1P3K D;  3MNN A;  4WU9 C;  2J8P A;  3AYW D;  3MVD D;  5BS7 A;  4Z2M G;  3AN2 D;  4QLC C;  5F99 A;  5B2I B;  5CPK B;  2G5I C;  1H3O A;  5AVB A;  2ZY5 A;  4LD9 B;  1F66 B;  3TU4 D;  3AZL B;  1M19 B;  4H9P B;  5GXQ A;  5B2J B;  3MGR B;  3REK A;  2PYO D;  2L5A A;  3F6T A;  4YM6 A;  5DNN A;  4WU8 A;  3UTA B;  1KX5 D;  3WA9 C;  5AV8 A;  3B0D B;  2Y2H A;  3AZH A;  5FUG A;  4WU8 D;  4J8U C;  3C1B A;  4M6B A;  3X1S A;  1P3G C;  2RVQ C;  5B31 D;  5BNX B;  3LZ0 C;  5DNM C;  5AV9 D;  1P3A D;  4G92 B;  3FDD A;  1U35 D;  5C3I B;  5B0Y A;  3KXB B;  3AZI D;  1Q9C A;  3B6G D;  2F8N A;  5CP6 B;  4XUJ B;  4WV4 B;  1JFI B;  3VH5 A;  4YS3 B;  3MGS D;  3AFA A;  1Z2C B;  5B33 B;  1P3O A;  3AV2 A;  2ARO C;  2CWE A;  4X23 A;  3LEL A;  1HQ3 D;  5JA4 B;  5B1M C;  1F1E A;  5CPI D;  1TZY A;  3LJA C;  2FJ7 D;  3REI A;  1P3L D;  4J8W B;  2F2A C;  4H9N A;  3LZ1 D;  5BS7 C;  4WNN A;  5F99 C;  3O62 C;  3B6F A;  3REL D;  4J8V D;  5AVB C;  3X1V A;  3NQJ B;  3AZE D;  5B0Z D;  5GXQ C;  3AZM A;  5CPJ B;  3REK C;  1ID3 D;  4YM6 C;  3AV1 D;  5DNN C;  5E5A D;  1P3F D;  1TAF B;  4CSR B;  5AV8 C;  3MGQ D;  5GT3 A;  5B24 C;  5AV6 D;  3AZH C;  3UTB A;  3REH D;  5BNV A;  3C1B C;  5B1L B;  3X1S C;  4WJ3 C;  1P3K B;  3AZK A;  4G91 B;  3AYW B;  3AZJ B;  1EQZ A;  3AN2 B;  1P3M B;  1S32 A;  5CPK A;  5B0Y C;  3TU4 B;  5AY8 D;  4EO5 C;  5AVC D;  4UPK A;  2Y2O A;  5B2I D;  3AZN A;  3A6N D;  1M19 A;  4KUD C;  1BH8 B;  3AFA C;  1P3I B;  5GT0 B;  4LD9 D;  4Z5T D;  3AV2 C;  1F66 D;  2Y2G A;  1KX5 B;  1AOI D;  1A7W A;  2YFV A;  4JJN C;  3LEL C;  3AZL D;  3UTA A;  2UWX A;  3VH5 T;  5B2J D;  3MGR D;  3W99 D;  3REI C;  1KX3 B;  2BG1 A;  3MGP B;  3B6F C;  3WTP B;  1P3A B;  3X1V C;  3KWQ C;  1P3B C;  2G5H C;  1P34 D;  3KXB A;  2LY8 A;  4XUJ A;  3MGS B;  2ZY4 A;  3R45 A;  4YS3 A;  5GT3 C;  3C1C D;  3UTB C;  5CP6 D;  4Z66 A;  1HQ3 B;  1M18 A;  2FJ7 B;  2NZD D;  3AZK C;  5B33 D;  1EQZ C;  3LZ1 B;  4DRB A;  2XD5 A;  4J8W A;  4J8V B;  1S32 C;  5B32 B;  3W97 D;  3KUY C;  4HGA C;  5B0Z B;  3W98 A;  3NQJ A;  3AZN C;  4R8P B;  4DRA A;  2NQB D;  4XZQ D;  3H0M C;  4WU9 D;  5CPJ A;  4H9S C;  3VH5 W;  3B0B A;  1WWS A;  2BYK A;  1ZLA C;  1R4V A;  3MGQ B;  4QLC D;  1TAF A;  5CPJ D;  3REH B;  3B0D C;  1KX4 B;  5B1L A;  1P3K A;  2Y2M A;  3AYW A;  3MVD A;  3AZG C;  3AN2 A;  3AZJ D;  5AY8 B;  5AVC B;  5B32 G;  2XD1 A;  3A6N B;  3TU4 A;  4J8U D;  1P3M D;  4XUJ C;  1M1A D;  4Z5T B;  3LZ0 D;  5DNM D;  1AOI B;  1P3I A;  2PYO A;  4Z66 C;  1N1J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...