3LELD

Structural insight into the sequence-dependence of nucleosome positioning
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
100
structure length
100
Chain Sequence
GKKRRKTRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.2
publication title Structural insight into the sequence dependence of nucleosome positioning
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Structural protein/dna
total genus 35
structure length 100
sequence length 100
chains with identical sequence H, N, R
ec nomenclature
pdb deposition date 2010-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3lelD00
5B32G 5B1LD 3WTPC 3AN2C 3KWQB 4EO5B 2L5AA 5BO0A 1F66C 1ZLAB 2NQBC 2YFVB 3UTAD 3W98B 4YM6D 3LJAC 5E5AD 4J8WD 5AY8D 1P3AB 5CPJD 4H9PB 3B0CW 5B1LB 3AZLB 2YFWA 3MGSC 1M18C 4Z5TA 5GT3D 3MNNA 3UTAB 3TU4D 2F8NH 5B2IA 4YM6B 3AZID 3AZJA 5E5AB 4J8WB 5AY8B 4KUDA 1M19A 5B2JB 4H9RB 3B6GC 4CAYB 2AROC 5BS7C 5C3IC 4KGCA 5GT3B 4YS3C 3TU4B 5B31C 2FJ7C 5DNMB 1HQ3D 3VH6W 5GXQA 5BNVB 4NE3A 4G92C 2CV5C 2NZDD 3AZFC 5B31G 4M6BA 1P34D 4J8XA 1HQ3B 3REKD 3AZHA 5DNNC 1ID3D 4XZQC 3MGQA 2NZDB 1B6WA 3LZ1C 3C1BD 3X1TC 5B33B 1P34B 3MVDA 3O62D 3B6FC 3AZGD 3REKB 5AV5D 3LZ0A 1AOIC 1S32A 1ID3B 5B32D 3W97C 1KX3A 4JJNA 1P3MC 3C1BB 4ZBJB 1P3PD 3O62B 3NQUA 3WKJA 3W96C 3AZMD 3AZGB 4WNNA 4ZUXB 5AV5B 3C1CD 5B32B 4KUDC 1JFIA 5F99A 4CSRA 3WAAC 3AN2D 1M1AB 3NQJB 3X1SA 4R8PD 1F66D 1P3PB 4WU8D 3REID 3AZMB 5AV8B 5B24C 3VH5W 3C1CB 2CWEA 5GXQC 3AN2B 1F66B 4R8PB 3MGSD 1M18D 2NQBB 1R4VA 3REIB 3LJAB 5AVCA 1KX4C 5AV6A 1P3BD 3MGSB 1M18B 3AZHC 3B0DC 3REHD 3AV1A 5B31D 2FJ7D 2PYOA 3LELA 4HGAC 4DRBA 5BT1D 4G91C 5CPKA 3X1VA 4H9NA 2AROB 5B1MA 5C3IB 4J8UC 1BH9B 3REHB 2CV5D 5B31B 4LD9C 5G49A 2FJ7B 4X23C 3AZFD 4KHAB 1U35C 5B0YA 1P3ID 5CPIC 3W99A 3WKJC 5DNND 1P3OA 4Z66D 1P3GA 2CV5B 5JRGD 3X1TD 3LZ1D 3AZFB 3AYWD 5F99C 3B6FD 5BNXB 4H9SC 3KUYA 3X1SC 2BYKB 1P3KA 1EQZD 4H9QB 3MGPA 5CP6A 1AOID 3UTBC 5DNNB 2HIOA 3X1UC 4Z66B 3W97D 5B40A 3V9RB 1P3MD 3REJA 5JRGB 3LZ1B 4WV4B 3X1TB 3AYWB 4J8VD 3B6FB 3AZLD 3W96D 1EQZB 1AOIB 3A6NA 5AVBA 3W97B 1P3MB 3WA9C 3WAAD 4QLCA 5CHLB 1P3LC 4J8VB 5B2JD 4XUJA 3W96B 5GT0C 3AV2C 3RELC 5B24D 3AFAC 2PYOC 5DNMD 1TZYC 4KUDB 5B0ZA 3WAAB 2JSSA 5GSUA 5CPKC 3KXBA 3KWQA 5B24B 1BH8B 3KSYA 2YFVA 1KX4D 3W98A 1P3AA 3UT9C 4H9PA 3AZHD 5B1LA 1P3OC 4WU9D 1KX4B 3UTAA 1P3FC 2F8NG 5B33D 4YM6A 1WWSA 5E5AA 4J8WA 5CPJA 3R45B 1P3KC 5CP6C 4J8UD 3B0DB 3AZHB 4LD9D 4H9RA 4X23D 5KDMA 5B40C 3AZEC 3AZNA 3REJC 4WU9B 1U35D 5GT3A 3TU4A 5AV9C 5CPID 3AZIA 1KU5A 4G91B 4J8UB 4ZUXD 5BNVA 4LD9B 4X23B 1U35B 3VH6A 3MGRD 5CPIB 3X1SD 1M1AD 4XUJC 3UTBD 3AZKD 4WZSB 3X1UD 1HQ3A 4Z2MH 4Z5TC 3MNNC 5AV8D 5B2IC 3AZJC 5F99B 3WTPD 5B0ZC 3MGRB 1M19C 1KX5A 2NZDA 3X1SB 1P34A 2NQBD 3UTBB 2BYMB 3KXBC 3AZKB 3X1UB 3LJAD 4KGCC 4EO5C 3REKA 3WA9D 1ID3A 4G92B 1P3LD 2IO5C 3WTPB 5GT0D 3C1BA 3AV2D 3RELD 3AFAD 3O62A 1WWIA 3AZGA 1TZYD 2RVQC 3WA9B 5AV5A 1P3LB 5B32A 5CPJC 4UUZB 4H9OA 4J8XC 3VH6T 5GT0B 3B6GD 2AROD 3NQJA 3AV2B 3RELB 4YS3D 1P3PA 3AFAB 2F8ND 2HUEC 3MGQC 3AZMA 1TZYB 3AZNC 5GT3C 3TU4C 3UT9D 3C1CA 3AZIC 3MVDC 4H9NB 3B6GB 3AN2A 1F66A 4R8PA 3LZ0C 1TAFB 4YS3B 1S32C 2F8NB 4WU8A 1P3FD 3REIA 1KX3C 1H3OB 4JJNC 3UT9B 5CP6D 3AZED 4XZQD 3MGSA 1M18A 1BFMA 1P3FB 5AV9D 1KX5C 2NZDC 1N1JA 5CP6B 1P3BA 3AZEB 4XZQB 5B40B 5BS7A 1BH9A 3REHA 5AV9B 4NE6A 5B31A 2FJ7A 4KHAA 5JA4A 3C1BC 5BO0B 1HTAA 4Z5TD 3MNND 5B2ID 3AZJD 4KUDD 5AVCC 3VH5T 5AV6C 4E44A 1M19D 2CV5A 3AZFA 3KXBD 2YFWB 1P3IA 4KGCD 5BNXA 4Z5TB 3MNNB 4H9QA 3AV1C 5B2IB 3AZJB 4Z66A 4AWLC 5FUGA 3V9RA 3LELC 1M19B 5GXQD 5JRGA 3LZ1A 3X1TA 3AYWA 3KXBB 3X1VC 1Q9CA 3B6FA 3B0BA 5B1MC 4KGCB 2RVQD 4R8PC 1EQZA 1ZLAA 4WU8C 1AOIA 3REIC 2IO5B 3W97A 1P3MA 4J8XD 5B0YC 5GXQB 3W99C 4J8VA 3W96A 3MGQD 3AZND 3AZLA 1P3GC 5CPJB 5AY8A 3MVDD 4J8XB 1ULYA 3KUYC 3WAAA 3MGPC 1P3BC 3LZ0D 5B2JA 1S32D 2HIOC 2HUEB 5KDMB 3MGQB 3AZNB 1KX3D 4CAYA 4JJND 3REHC 5B24A 1BH8A 4HGAB 3AZIB 5DNMA 3MVDB 3WKJD 5BT1C 3LZ0B 1S32B 3A6NC 5AVBC 1KX3B 4JJNB 5F99D 1KX5D 4QLCC 1KX4A 3NQUB 3WKJB 3R45A 4WNNB 1P3IC 4NFTA 4Z66C 1JFIB 4CSRB 1KX5B 4WU9A 5JRGC 5GSUC 3B0CT 5B33A 3AYWC 1EQZC 5AVCD 3KWQC 1ZLAC 4J8UA 5AV6D 4LD9A 3W98C 4X23A 2LY8A 1P3AC 1U35A 1F1EA 5CPIA 4J8VC 5B1LC 3AV1D 3AZLC 2PYOD 4Z2MG 5AVCB 3LELD 5AV6B 4ZUXA 3UTAC 4YM6C 5E5AC 4J8WC 5AY8C 4H9OB 3WTPE 5CPKD 3X1VD 3MGRA 5B1MD 2F8NK 4H9SA 1M1AA 5B2JC 3AV1B 3UTBA 2BYMA 3AZKA 3X1UA 2PYOB 4AWLB 3LELB 5AV8A 5B0YD 5DNMC 3W99D 3WTPA 5CPKB 3X1VB 1P3OD 5B1MB 1P3GD 3VH5A 4WU8B 2NQBA 5G49B 1A7WA 3LJAA 1B67A 5B0YB 3WA9A 3KUYD 1P3KD 3W99B 3MGPD 1P3LA 1P3OB 4UUZA 2HIOD 1HQ3C 1P3GB 5GT0A 5B40D 3REJD 3AV2A 4DRAA 3RELA 3AFAA 1TZYA 4WU9C 1N1JB 3KUYB 1P3KB 5B33C 3MGPB 1P3BB 1P34C 3A6ND 2HIOB 5AVBD 3B6GA 3REKC 2AROA 3REJB 1TAFA 4QLCD 4YS3A 1ID3C 2F8NA 5JA4B 1H3OA 4XUJD 3UT9A 4ZBJC 3A6NB 5AVBB 3O62C 3AZGC 5B0ZD 4ZUXC 5AV5C 4QLCB 5GSUD 1P3FA 5B32C 4XUJB 3MGRC 4NE5A 1P3IB 1M1AC 3KWQD 1ZLAD 2BYKA 1P3PC 3AZKC 3AZMC 5DNNA 3W98D 3AZEA 4XZQA 5FUGB 1P3AD 5B0ZB 5AV8C 3C1CC 5GSUB 5AV9A 4E45A
chains in the Genus database with same CATH superfamily
5B32G 5B1LD 3WTPC 3AN2C 2DQNC 3KWQB 2Y2JA 2L5AA 4EO5B 5BO0A 1F66C 2Y2IA 2YFVB 1ZLAB 2NQBC 3UTAD 3W98B 4YM6D 3LJAC 5E5AD 4J8WD 5AY8D 1P3AB 5CPJD 4H9PB 3B0CW 5B1LB 2FFFB 3AZLB 2YFWA 3MGSC 1M18C 4Z5TA 5GT3D 3MNNA 3UTAB 3TU4D 2F8NH 5B2IA 4YM6B 3AZID 3AZJA 5E5AB 4J8WB 5AY8B 4KUDA 1M19A 5B2JB 4H9RB 2DF4C 3B6GC 4CAYB 2AROC 5BS7C 5C3IC 4KGCA 5GT3B 4YS3C 3TU4B 2Y2HA 5B31C 2FJ7C 5DNMB 1HQ3D 3VH6W 5GXQA 5BNVB 3EPLA 4NE3A 4G92C 2CV5C 2NZDD 2ZY5A 5B31G 2Y2MA 3AZFC 4M6BA 1P34D 4J8XA 1HQ3B 3REKD 3F6TA 3AZHA 5DNNC 1ID3D 3H0LC 4XZQC 3MGQA 2NZDB 1B6WA 3LZ1C 3C1BD 3X1TC 5B33B 1P34B 3MVDA 3O62D 3B6FC 3AZGD 3REKB 5AV5D 3LZ0A 1AOIC 1S32A 1ID3B 5B32D 3W97C 1KX3A 4JJNA 1P3MC 3C1BB 4ZBJB 1P3PD 3O62B 3NQUA 3WKJA 3W96C 3AZMD 3AZGB 4WNNA 4ZUXB 5AV5B 3C1CD 2G5HC 5B32B 3EG5B 4KUDC 1JFIA 5F99A 4CSRA 2JCHA 3WAAC 3AN2D 1M1AB 3NQJB 3X1SA 4R8PD 1F66D 1P3PB 4WU8D 3REID 3AZMB 5AV8B 5B24C 3VH5W 3C1CB 2CWEA 5GXQC 3AN2B 1F66B 4R8PB 3MGSD 1M18D 2NQBB 1R4VA 3REIB 3LJAB 5AVCA 1KX4C 5AV6A 1P3BD 1PZRA 3P5JB 3MGSB 1M18B 3AZHC 3B0DC 3REHD 3AV1A 5B31D 2FJ7D 2PYOA 3LELA 4HGAC 4DRBA 5BT1D 4G91C 5CPKA 3X1VA 2BG1A 4H9NA 2AROB 5B1MA 5C3IB 4J8UC 1BH9B 3REHB 2CV5D 5B31B 2G5IC 5G49A 2FJ7B 4X23C 3AZFD 4LD9C 4KHAB 1U35C 5B0YA 1P3ID 2Y2PA 5CPIC 3W99A 3WKJC 5DNND 1P3OA 4Z66D 2Y2KA 1P3GA 2CV5B 5JRGD 3X1TD 3LZ1D 3AZFB 3AYWD 5F99C 3B6FD 5BNXB 4H9SC 3KUYA 3X1SC 2BYKB 1P3KA 1EQZD 4H9QB 3MGPA 5CP6A 1AOID 3UTBC 5DNNB 2HIOA 3X1UC 4Z66B 1Z2CB 3W97D 5B40A 3V9RB 1P3MD 3REJA 5JRGB 2RIQA 4WV4B 3LZ1B 3X1TB 3AYWB 4J8VD 3B6FB 3AZLD 3W96D 1EQZB 1AOIB 3A6NA 5AVBA 3W97B 3IP4C 1P3MB 3WA9C 3WAAD 4QLCA 5CHLB 1P3LC 4J8VB 5B2JD 4XUJA 3W96B 5GT0C 3AV2C 3RELC 5B24D 3AFAC 2PYOC 5DNMD 1TZYC 4KUDB 5B0ZA 3WAAB 2JSSA 5GSUA 5CPKC 3KXBA 3KWQA 5B24B 1BH8B 3KSYA 2YFVA 1KX4D 2Y2QA 3W98A 1P3AA 3UT9C 4H9PA 3AZHD 5B1LA 1P3OC 2VQRA 4WU9D 1KX4B 1W2EA 2ZM5A 3UTAA 1P3FC 2F8NG 5B33D 4YM6A 1WWSA 5E5AA 4J8WA 5CPJA 3R45B 1P3KC 5CP6C 4J8UD 3B0DB 3AZHB 4LD9D 4H9RA 4X23D 5KDMA 5B40C 3AZEC 3AZNA 3REJC 4WU9B 1U35D 5GT3A 3TU4A 5AV9C 2ZY2A 3AZIA 5CPID 3A1IA 1KU5A 4G91B 4J8UB 4ZUXD 5BNVA 4LD9B 4X23B 1U35B 3VH6A 2JE5A 3MGRD 5CPIB 3X1SD 1M1AD 4XUJC 3UTBD 3AZKD 4WZSB 3X1UD 1HQ3A 4Z2MH 4Z5TC 3MNNC 5AV8D 5B2IC 3AZJC 5F99B 3WTPD 5B0ZC 3MGRB 1M19C 1KX5A 2NZDA 3X1SB 1P34A 2NQBD 3UTBB 2BYMB 3KXBC 3AZKB 3X1UB 3LJAD 4KGCC 4EO5C 3REKA 3WA9D 1ID3A 4G92B 1P3LD 2IO5C 3A1KA 2XD5A 3WTPB 2J8PA 2ZY3A 3AL0C 5GT0D 3C1BA 3AV2D 3RELD 3AFAD 3O62A 1WWIA 3AZGA 1TZYD 2RVQC 3WA9B 5AV5A 1P3LB 5B32A 5CPJC 4UUZB 4H9OA 4J8XC 3VH6T 5GT0B 3B6GD 2AROD 3NQJA 3AV2B 3RELB 4YS3D 1P3PA 3AFAB 2F8ND 2HUEC 3MGQC 3AZMA 1TZYB 3AZNC 5GT3C 1T3UA 3TU4C 3UT9D 3C1CA 3AZIC 2W8SA 3MVDC 4H9NB 3B6GB 3AN2A 1F66A 4R8PA 3LZ0C 1TAFB 4YS3B 1S32C 2F8NB 4WU8A 3EPHA 1P3FD 3REIA 1KX3C 1H3OB 4JJNC 3UT9B 5CP6D 3AZED 4XZQD 3MGSA 1M18A 1BFMA 1P3FB 5AV9D 1KX5C 2NZDC 1N1JA 5CP6B 1P3BA 3AZEB 4XZQB 5B40B 5BS7A 1BH9A 3REHA 5AV9B 4NE6A 5B31A 2FJ7A 3FDDA 4KHAA 5JA4A 3C1BC 5BO0B 1HTAA 4Z5TD 3MNND 5B2ID 3AZJD 4KUDD 5AVCC 3EPJA 3VH5T 5AV6C 4E44A 1M19D 2CV5A 3AZFA 3KXBD 2YFWB 1P3IA 4KGCD 5BNXA 3KFUG 4Z5TB 3MNNB 4H9QA 3AV1C 4WJ3C 5B2IB 3AZJB 4Z66A 4AWLC 5FUGA 3V9RA 3LELC 1M19B 5GXQD 5JRGA 3LZ1A 3X1TA 3AYWA 3KXBB 3X1VC 1Q9CA 3B6FA 3B0BA 5B1MC 4KGCB 2RVQD 4R8PC 1EQZA 2UWXA 1ZLAA 4WU8C 1AOIA 3REIC 2IO5B 3W97A 1P3MA 4J8XD 5B0YC 5GXQB 3W99C 4J8VA 3W96A 3MGQD 3AZND 3AZLA 1P3GC 5CPJB 5AY8A 3MVDD 4J8XB 1ULYA 3KUYC 3WAAA 3MGPC 1P3BC 3LZ0D 5B2JA 1S32D 2HIOC 2HUEB 5KDMB 3MGQB 3AZNB 1KX3D 4CAYA 4JJND 2Y2GA 3REHC 5B24A 1BH8A 4HGAB 3AZIB 5DNMA 3MVDB 2Y2NA 3WKJD 5BT1C 3LZ0B 1S32B 3A6NC 5AVBC 1KX3B 4JJNB 5F99D 2Y2OA 1KX5D 2F2AC 4QLCC 1KX4A 3NQUB 3WKJB 3R45A 4WNNB 1P3IC 3H0MC 4NFTA 4Z66C 1JFIB 4CSRB 1KX5B 4WU9A 5JRGC 5GSUC 3B0CT 5B33A 3AYWC 1EQZC 5AVCD 3KWQC 1ZLAC 4J8UA 5AV6D 4LD9A 3W98C 4X23A 2LY8A 1P3AC 1U35A 1F1EA 2ZY4A 5CPIA 4J8VC 5B1LC 3AV1D 3AZLC 2PYOD 4Z2MG 5AVCB 3LELD 5AV6B 4ZUXA 3UTAC 4YM6C 5E5AC 4J8WC 5AY8C 4H9OB 3WTPE 5CPKD 3X1VD 2XD1A 3MGRA 5B1MD 2F8NK 4H9SA 2Y2LA 1M1AA 5B2JC 3AV1B 3UTBA 2BYMA 3AZKA 3X1UA 2PYOB 4AWLB 3LELB 5AV8A 5B0YD 3EPKA 5DNMC 3W99D 3WTPA 5CPKB 3X1VB 1P3OD 5B1MB 4UPKA 4DQYB 3VH5A 1P3GD 4WU8B 2NQBA 5G49B 1A7WA 3LJAA 1B67A 5B0YB 3WA9A 3KUYD 1P3KD 3W99B 3MGPD 1P3LA 1P3OB 4UUZA 2HIOD 1HQ3C 1P3GB 5GT0A 5B40D 3REJD 3AV2A 4DRAA 3RELA 3AFAA 1TZYA 4WU9C 1N1JB 3KUYB 1P3KB 5B33C 3MGPB 1P3BB 1P34C 3A6ND 2HIOB 5AVBD 3B6GA 3REKC 2AROA 3REJB 1TAFA 4QLCD 4YS3A 1ID3C 2F8NA 5JA4B 1H3OA 4XUJD 3UT9A 4ZBJC 3A6NB 5AVBB 3O62C 3AZGC 5B0ZD 4ZUXC 5AV5C 4QLCB 3H0RC 5GSUD 1P3FA 5B32C 4XUJB 3MGRC 4NE5A 1P3IB 1M1AC 3KWQD 1ZLAD 2BYKA 1P3PC 3AZKC 3AZMC 5DNNA 3W98D 3AZEA 4XZQA 5FUGB 1P3AD 5B0ZB 5AV8C 3C1CC 5GSUB 5AV9A 4E45A
chains in the Genus database with same CATH topology
5B32G 5B1LD 3WTPC 3AN2C 2DQNC 3KWQB 2Y2JA 2L5AA 4EO5B 5BO0A 1F66C 2Y2IA 2YFVB 1ZLAB 2NQBC 3UTAD 3W98B 4YM6D 3LJAC 5E5AD 4J8WD 5AY8D 1P3AB 5CPJD 4H9PB 3B0CW 5B1LB 2FFFB 3AZLB 2YFWA 3MGSC 1M18C 4Z5TA 5GT3D 3MNNA 3UTAB 3TU4D 2F8NH 5B2IA 4YM6B 3AZID 3AZJA 5E5AB 4J8WB 5AY8B 4KUDA 1M19A 5B2JB 4H9RB 2DF4C 3B6GC 4CAYB 2AROC 5BS7C 5C3IC 4KGCA 5GT3B 4YS3C 3TU4B 2Y2HA 5B31C 2FJ7C 5DNMB 1HQ3D 3VH6W 5GXQA 5BNVB 3EPLA 4NE3A 4G92C 2CV5C 2NZDD 2ZY5A 5B31G 2Y2MA 3AZFC 4M6BA 1P34D 4J8XA 1HQ3B 3REKD 3F6TA 3AZHA 5DNNC 1ID3D 3H0LC 4XZQC 3MGQA 2NZDB 1B6WA 3LZ1C 3C1BD 3X1TC 5B33B 1P34B 3MVDA 3O62D 3B6FC 3AZGD 3REKB 5AV5D 3LZ0A 1AOIC 1S32A 1ID3B 5B32D 3W97C 1KX3A 4JJNA 1P3MC 3C1BB 4ZBJB 1P3PD 3O62B 3NQUA 3WKJA 3W96C 3AZMD 3AZGB 4WNNA 4ZUXB 5AV5B 3C1CD 2G5HC 5B32B 3EG5B 4KUDC 1JFIA 5F99A 4CSRA 2JCHA 3WAAC 3AN2D 1M1AB 3NQJB 3X1SA 4R8PD 1F66D 1P3PB 4WU8D 3REID 3AZMB 5AV8B 5B24C 3VH5W 3C1CB 2CWEA 5GXQC 3AN2B 1F66B 4R8PB 3MGSD 1M18D 2NQBB 1R4VA 3REIB 3LJAB 5AVCA 1KX4C 5AV6A 1P3BD 1PZRA 3P5JB 3MGSB 1M18B 3AZHC 3B0DC 3REHD 3AV1A 5B31D 2FJ7D 2PYOA 3LELA 4HGAC 4DRBA 5BT1D 4G91C 5CPKA 3X1VA 2BG1A 4H9NA 2AROB 5B1MA 5C3IB 4J8UC 1BH9B 3REHB 2CV5D 5B31B 2G5IC 5G49A 2FJ7B 4X23C 3AZFD 4LD9C 4KHAB 1U35C 5B0YA 1P3ID 2Y2PA 5CPIC 3W99A 3WKJC 5DNND 1P3OA 4Z66D 2Y2KA 1P3GA 2CV5B 5JRGD 3X1TD 3LZ1D 3AZFB 3AYWD 5F99C 3B6FD 5BNXB 4H9SC 3KUYA 3X1SC 2BYKB 1P3KA 1EQZD 4H9QB 3MGPA 5CP6A 1AOID 3UTBC 5DNNB 2HIOA 3X1UC 4Z66B 1Z2CB 3W97D 5B40A 3V9RB 1P3MD 3REJA 5JRGB 2RIQA 4WV4B 3LZ1B 3X1TB 3AYWB 4J8VD 3B6FB 3AZLD 3W96D 1EQZB 1AOIB 3A6NA 5AVBA 3W97B 3IP4C 1P3MB 3WA9C 3WAAD 4QLCA 5CHLB 1P3LC 4J8VB 5B2JD 4XUJA 3W96B 5GT0C 3AV2C 3RELC 5B24D 3AFAC 2PYOC 5DNMD 1TZYC 4KUDB 5B0ZA 3WAAB 2JSSA 5GSUA 5CPKC 3KXBA 3KWQA 5B24B 1BH8B 3KSYA 2YFVA 1KX4D 2Y2QA 3W98A 1P3AA 3UT9C 4H9PA 3AZHD 5B1LA 1P3OC 2VQRA 4WU9D 1KX4B 1W2EA 2ZM5A 3UTAA 1P3FC 2F8NG 5B33D 4YM6A 1WWSA 5E5AA 4J8WA 5CPJA 3R45B 1P3KC 5CP6C 4J8UD 3B0DB 3AZHB 4LD9D 4H9RA 4X23D 5KDMA 5B40C 3AZEC 3AZNA 3REJC 4WU9B 1U35D 5GT3A 3TU4A 5AV9C 2ZY2A 3AZIA 5CPID 3A1IA 1KU5A 4G91B 4J8UB 4ZUXD 5BNVA 4LD9B 4X23B 1U35B 3VH6A 2JE5A 3MGRD 5CPIB 3X1SD 1M1AD 4XUJC 3UTBD 3AZKD 4WZSB 3X1UD 1HQ3A 4Z2MH 4Z5TC 3MNNC 5AV8D 5B2IC 3AZJC 5F99B 3WTPD 5B0ZC 3MGRB 1M19C 1KX5A 2NZDA 3X1SB 1P34A 2NQBD 3UTBB 2BYMB 3KXBC 3AZKB 3X1UB 3LJAD 4KGCC 4EO5C 3REKA 3WA9D 1ID3A 4G92B 1P3LD 2IO5C 3A1KA 2XD5A 3WTPB 2J8PA 2ZY3A 3AL0C 5GT0D 3C1BA 3AV2D 3RELD 3AFAD 3O62A 1WWIA 3AZGA 1TZYD 2RVQC 3WA9B 5AV5A 1P3LB 5B32A 5CPJC 4UUZB 4H9OA 4J8XC 3VH6T 5GT0B 3B6GD 2AROD 3NQJA 3AV2B 3RELB 4YS3D 1P3PA 3AFAB 2F8ND 2HUEC 3MGQC 3AZMA 1TZYB 3AZNC 5GT3C 1T3UA 3TU4C 3UT9D 3C1CA 3AZIC 2W8SA 3MVDC 4H9NB 3B6GB 3AN2A 1F66A 4R8PA 3LZ0C 1TAFB 4YS3B 1S32C 2F8NB 4WU8A 3EPHA 1P3FD 3REIA 1KX3C 1H3OB 4JJNC 3UT9B 5CP6D 3AZED 4XZQD 3MGSA 1M18A 1BFMA 1P3FB 5AV9D 1KX5C 2NZDC 1N1JA 5CP6B 1P3BA 3AZEB 4XZQB 5B40B 5BS7A 1BH9A 3REHA 5AV9B 4NE6A 5B31A 2FJ7A 3FDDA 4KHAA 5JA4A 3C1BC 5BO0B 1HTAA 4Z5TD 3MNND 5B2ID 3AZJD 4KUDD 5AVCC 3EPJA 3VH5T 5AV6C 4E44A 1M19D 2CV5A 3AZFA 3KXBD 2YFWB 1P3IA 4KGCD 5BNXA 3KFUG 4Z5TB 3MNNB 4H9QA 3AV1C 4WJ3C 5B2IB 3AZJB 4Z66A 4AWLC 5FUGA 3V9RA 3LELC 1M19B 5GXQD 5JRGA 3LZ1A 3X1TA 3AYWA 3KXBB 3X1VC 1Q9CA 3B6FA 3B0BA 5B1MC 4KGCB 2RVQD 4R8PC 1EQZA 2UWXA 1ZLAA 4WU8C 1AOIA 3REIC 2IO5B 3W97A 1P3MA 4J8XD 5B0YC 5GXQB 3W99C 4J8VA 3W96A 3MGQD 3AZND 3AZLA 1P3GC 5CPJB 5AY8A 3MVDD 4J8XB 1ULYA 3KUYC 3WAAA 3MGPC 1P3BC 3LZ0D 5B2JA 1S32D 2HIOC 2HUEB 5KDMB 3MGQB 3AZNB 1KX3D 4CAYA 4JJND 2Y2GA 3REHC 5B24A 1BH8A 4HGAB 3AZIB 5DNMA 3MVDB 2Y2NA 3WKJD 5BT1C 3LZ0B 1S32B 3A6NC 5AVBC 1KX3B 4JJNB 5F99D 2Y2OA 1KX5D 2F2AC 4QLCC 1KX4A 3NQUB 3WKJB 3R45A 4WNNB 1P3IC 3H0MC 4NFTA 4Z66C 1JFIB 4CSRB 1KX5B 4WU9A 5JRGC 5GSUC 3B0CT 5B33A 3AYWC 1EQZC 5AVCD 3KWQC 1ZLAC 4J8UA 5AV6D 4LD9A 3W98C 4X23A 2LY8A 1P3AC 1U35A 1F1EA 2ZY4A 5CPIA 4J8VC 5B1LC 3AV1D 3AZLC 2PYOD 4Z2MG 5AVCB 3LELD 5AV6B 4ZUXA 3UTAC 4YM6C 5E5AC 4J8WC 5AY8C 4H9OB 3WTPE 5CPKD 3X1VD 2XD1A 3MGRA 5B1MD 2F8NK 4H9SA 2Y2LA 1M1AA 5B2JC 3AV1B 3UTBA 2BYMA 3AZKA 3X1UA 2PYOB 4AWLB 3LELB 5AV8A 5B0YD 3EPKA 5DNMC 3W99D 3WTPA 5CPKB 3X1VB 1P3OD 5B1MB 4UPKA 4DQYB 3VH5A 1P3GD 4WU8B 2NQBA 5G49B 1A7WA 3LJAA 1B67A 5B0YB 3WA9A 3KUYD 1P3KD 3W99B 3MGPD 1P3LA 1P3OB 4UUZA 2HIOD 1HQ3C 1P3GB 5GT0A 5B40D 3REJD 3AV2A 4DRAA 3RELA 3AFAA 1TZYA 4WU9C 1N1JB 3KUYB 1P3KB 5B33C 3MGPB 1P3BB 1P34C 3A6ND 2HIOB 5AVBD 3B6GA 3REKC 2AROA 3REJB 1TAFA 4QLCD 4YS3A 1ID3C 2F8NA 5JA4B 1H3OA 4XUJD 3UT9A 4ZBJC 3A6NB 5AVBB 3O62C 3AZGC 5B0ZD 4ZUXC 5AV5C 4QLCB 3H0RC 5GSUD 1P3FA 5B32C 4XUJB 3MGRC 4NE5A 1P3IB 1M1AC 3KWQD 1ZLAD 2BYKA 1P3PC 3AZKC 3AZMC 5DNNA 3W98D 3AZEA 4XZQA 5FUGB 1P3AD 5B0ZB 5AV8C 3C1CC 5GSUB 5AV9A 4E45A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5B32 G;  5B1L D;  3WTP C;  3AN2 C;  3KWQ B;  4EO5 B;  2L5A A;  5BO0 A;  1F66 C;  1ZLA B;  2NQB C;  2YFV B;  3UTA D;  3W98 B;  4YM6 D;  3LJA C;  5E5A D;  4J8W D;  5AY8 D;  1P3A B;  5CPJ D;  4H9P B;  3B0C W;  5B1L B;  3AZL B;  2YFW A;  3MGS C;  1M18 C;  4Z5T A;  5GT3 D;  3MNN A;  3UTA B;  3TU4 D;  2F8N H;  5B2I A;  4YM6 B;  3AZI D;  3AZJ A;  5E5A B;  4J8W B;  5AY8 B;  4KUD A;  1M19 A;  5B2J B;  4H9R B;  3B6G C;  4CAY B;  2ARO C;  5BS7 C;  5C3I C;  4KGC A;  5GT3 B;  4YS3 C;  3TU4 B;  5B31 C;  2FJ7 C;  5DNM B;  1HQ3 D;  3VH6 W;  5GXQ A;  5BNV B;  4NE3 A;  4G92 C;  2CV5 C;  2NZD D;  3AZF C;  5B31 G;  4M6B A;  1P34 D;  4J8X A;  1HQ3 B;  3REK D;  3AZH A;  5DNN C;  1ID3 D;  4XZQ C;  3MGQ A;  2NZD B;  1B6W A;  3LZ1 C;  3C1B D;  3X1T C;  5B33 B;  1P34 B;  3MVD A;  3O62 D;  3B6F C;  3AZG D;  3REK B;  5AV5 D;  3LZ0 A;  1AOI C;  1S32 A;  1ID3 B;  5B32 D;  3W97 C;  1KX3 A;  4JJN A;  1P3M C;  3C1B B;  4ZBJ B;  1P3P D;  3O62 B;  3NQU A;  3WKJ A;  3W96 C;  3AZM D;  3AZG B;  4WNN A;  4ZUX B;  5AV5 B;  3C1C D;  5B32 B;  4KUD C;  1JFI A;  5F99 A;  4CSR A;  3WAA C;  3AN2 D;  1M1A B;  3NQJ B;  3X1S A;  4R8P D;  1F66 D;  1P3P B;  4WU8 D;  3REI D;  3AZM B;  5AV8 B;  5B24 C;  3VH5 W;  3C1C B;  2CWE A;  5GXQ C;  3AN2 B;  1F66 B;  4R8P B;  3MGS D;  1M18 D;  2NQB B;  1R4V A;  3REI B;  3LJA B;  5AVC A;  1KX4 C;  5AV6 A;  1P3B D;  3MGS B;  1M18 B;  3AZH C;  3B0D C;  3REH D;  3AV1 A;  5B31 D;  2FJ7 D;  2PYO A;  3LEL A;  4HGA C;  4DRB A;  5BT1 D;  4G91 C;  5CPK A;  3X1V A;  4H9N A;  2ARO B;  5B1M A;  5C3I B;  4J8U C;  1BH9 B;  3REH B;  2CV5 D;  5B31 B;  4LD9 C;  5G49 A;  2FJ7 B;  4X23 C;  3AZF D;  4KHA B;  1U35 C;  5B0Y A;  1P3I D;  5CPI C;  3W99 A;  3WKJ C;  5DNN D;  1P3O A;  4Z66 D;  1P3G A;  2CV5 B;  5JRG D;  3X1T D;  3LZ1 D;  3AZF B;  3AYW D;  5F99 C;  3B6F D;  5BNX B;  4H9S C;  3KUY A;  3X1S C;  2BYK B;  1P3K A;  1EQZ D;  4H9Q B;  3MGP A;  5CP6 A;  1AOI D;  3UTB C;  5DNN B;  2HIO A;  3X1U C;  4Z66 B;  3W97 D;  5B40 A;  3V9R B;  1P3M D;  3REJ A;  5JRG B;  3LZ1 B;  4WV4 B;  3X1T B;  3AYW B;  4J8V D;  3B6F B;  3AZL D;  3W96 D;  1EQZ B;  1AOI B;  3A6N A;  5AVB A;  3W97 B;  1P3M B;  3WA9 C;  3WAA D;  4QLC A;  5CHL B;  1P3L C;  4J8V B;  5B2J D;  4XUJ A;  3W96 B;  5GT0 C;  3AV2 C;  3REL C;  5B24 D;  3AFA C;  2PYO C;  5DNM D;  1TZY C;  4KUD B;  5B0Z A;  3WAA B;  2JSS A;  5GSU A;  5CPK C;  3KXB A;  3KWQ A;  5B24 B;  1BH8 B;  3KSY A;  2YFV A;  1KX4 D;  3W98 A;  1P3A A;  3UT9 C;  4H9P A;  3AZH D;  5B1L A;  1P3O C;  4WU9 D;  1KX4 B;  3UTA A;  1P3F C;  2F8N G;  5B33 D;  4YM6 A;  1WWS A;  5E5A A;  4J8W A;  5CPJ A;  3R45 B;  1P3K C;  5CP6 C;  4J8U D;  3B0D B;  3AZH B;  4LD9 D;  4H9R A;  4X23 D;  5KDM A;  5B40 C;  3AZE C;  3AZN A;  3REJ C;  4WU9 B;  1U35 D;  5GT3 A;  3TU4 A;  5AV9 C;  5CPI D;  3AZI A;  1KU5 A;  4G91 B;  4J8U B;  4ZUX D;  5BNV A;  4LD9 B;  4X23 B;  1U35 B;  3VH6 A;  3MGR D;  5CPI B;  3X1S D;  1M1A D;  4XUJ C;  3UTB D;  3AZK D;  4WZS B;  3X1U D;  1HQ3 A;  4Z2M H;  4Z5T C;  3MNN C;  5AV8 D;  5B2I C;  3AZJ C;  5F99 B;  3WTP D;  5B0Z C;  3MGR B;  1M19 C;  1KX5 A;  2NZD A;  3X1S B;  1P34 A;  2NQB D;  3UTB B;  2BYM B;  3KXB C;  3AZK B;  3X1U B;  3LJA D;  4KGC C;  4EO5 C;  3REK A;  3WA9 D;  1ID3 A;  4G92 B;  1P3L D;  2IO5 C;  3WTP B;  5GT0 D;  3C1B A;  3AV2 D;  3REL D;  3AFA D;  3O62 A;  1WWI A;  3AZG A;  1TZY D;  2RVQ C;  3WA9 B;  5AV5 A;  1P3L B;  5B32 A;  5CPJ C;  4UUZ B;  4H9O A;  4J8X C;  3VH6 T;  5GT0 B;  3B6G D;  2ARO D;  3NQJ A;  3AV2 B;  3REL B;  4YS3 D;  1P3P A;  3AFA B;  2F8N D;  2HUE C;  3MGQ C;  3AZM A;  1TZY B;  3AZN C;  5GT3 C;  3TU4 C;  3UT9 D;  3C1C A;  3AZI C;  3MVD C;  4H9N B;  3B6G B;  3AN2 A;  1F66 A;  4R8P A;  3LZ0 C;  1TAF B;  4YS3 B;  1S32 C;  2F8N B;  4WU8 A;  1P3F D;  3REI A;  1KX3 C;  1H3O B;  4JJN C;  3UT9 B;  5CP6 D;  3AZE D;  4XZQ D;  3MGS A;  1M18 A;  1BFM A;  1P3F B;  5AV9 D;  1KX5 C;  2NZD C;  1N1J A;  5CP6 B;  1P3B A;  3AZE B;  4XZQ B;  5B40 B;  5BS7 A;  1BH9 A;  3REH A;  5AV9 B;  4NE6 A;  5B31 A;  2FJ7 A;  4KHA A;  5JA4 A;  3C1B C;  5BO0 B;  1HTA A;  4Z5T D;  3MNN D;  5B2I D;  3AZJ D;  4KUD D;  5AVC C;  3VH5 T;  5AV6 C;  4E44 A;  1M19 D;  2CV5 A;  3AZF A;  3KXB D;  2YFW B;  1P3I A;  4KGC D;  5BNX A;  4Z5T B;  3MNN B;  4H9Q A;  3AV1 C;  5B2I B;  3AZJ B;  4Z66 A;  4AWL C;  5FUG A;  3V9R A;  3LEL C;  1M19 B;  5GXQ D;  5JRG A;  3LZ1 A;  3X1T A;  3AYW A;  3KXB B;  3X1V C;  1Q9C A;  3B6F A;  3B0B A;  5B1M C;  4KGC B;  2RVQ D;  4R8P C;  1EQZ A;  1ZLA A;  4WU8 C;  1AOI A;  3REI C;  2IO5 B;  3W97 A;  1P3M A;  4J8X D;  5B0Y C;  5GXQ B;  3W99 C;  4J8V A;  3W96 A;  3MGQ D;  3AZN D;  3AZL A;  1P3G C;  5CPJ B;  5AY8 A;  3MVD D;  4J8X B;  1ULY A;  3KUY C;  3WAA A;  3MGP C;  1P3B C;  3LZ0 D;  5B2J A;  1S32 D;  2HIO C;  2HUE B;  5KDM B;  3MGQ B;  3AZN B;  1KX3 D;  4CAY A;  4JJN D;  3REH C;  5B24 A;  1BH8 A;  4HGA B;  3AZI B;  5DNM A;  3MVD B;  3WKJ D;  5BT1 C;  3LZ0 B;  1S32 B;  3A6N C;  5AVB C;  1KX3 B;  4JJN B;  5F99 D;  1KX5 D;  4QLC C;  1KX4 A;  3NQU B;  3WKJ B;  3R45 A;  4WNN B;  1P3I C;  4NFT A;  4Z66 C;  1JFI B;  4CSR B;  1KX5 B;  4WU9 A;  5JRG C;  5GSU C;  3B0C T;  5B33 A;  3AYW C;  1EQZ C;  5AVC D;  3KWQ C;  1ZLA C;  4J8U A;  5AV6 D;  4LD9 A;  3W98 C;  4X23 A;  2LY8 A;  1P3A C;  1U35 A;  1F1E A;  5CPI A;  4J8V C;  5B1L C;  3AV1 D;  3AZL C;  2PYO D;  4Z2M G;  5AVC B;  3LEL D;  5AV6 B;  4ZUX A;  3UTA C;  4YM6 C;  5E5A C;  4J8W C;  5AY8 C;  4H9O B;  3WTP E;  5CPK D;  3X1V D;  3MGR A;  5B1M D;  2F8N K;  4H9S A;  1M1A A;  5B2J C;  3AV1 B;  3UTB A;  2BYM A;  3AZK A;  3X1U A;  2PYO B;  4AWL B;  3LEL B;  5AV8 A;  5B0Y D;  5DNM C;  3W99 D;  3WTP A;  5CPK B;  3X1V B;  1P3O D;  5B1M B;  1P3G D;  3VH5 A;  4WU8 B;  2NQB A;  5G49 B;  1A7W A;  3LJA A;  1B67 A;  5B0Y B;  3WA9 A;  3KUY D;  1P3K D;  3W99 B;  3MGP D;  1P3L A;  1P3O B;  4UUZ A;  2HIO D;  1HQ3 C;  1P3G B;  5GT0 A;  5B40 D;  3REJ D;  3AV2 A;  4DRA A;  3REL A;  3AFA A;  1TZY A;  4WU9 C;  1N1J B;  3KUY B;  1P3K B;  5B33 C;  3MGP B;  1P3B B;  1P34 C;  3A6N D;  2HIO B;  5AVB D;  3B6G A;  3REK C;  2ARO A;  3REJ B;  1TAF A;  4QLC D;  4YS3 A;  1ID3 C;  2F8N A;  5JA4 B;  1H3O A;  4XUJ D;  3UT9 A;  4ZBJ C;  3A6N B;  5AVB B;  3O62 C;  3AZG C;  5B0Z D;  4ZUX C;  5AV5 C;  4QLC B;  5GSU D;  1P3F A;  5B32 C;  4XUJ B;  3MGR C;  4NE5 A;  1P3I B;  1M1A C;  3KWQ D;  1ZLA D;  2BYK A;  1P3P C;  3AZK C;  3AZM C;  5DNN A;  3W98 D;  3AZE A;  4XZQ A;  5FUG B;  1P3A D;  5B0Z B;  5AV8 C;  3C1C C;  5GSU B;  5AV9 A;  4E45 A; 
#chains in the Genus database with same CATH topology
 5B32 G;  5B1L D;  3WTP C;  3AN2 C;  2DQN C;  3KWQ B;  2Y2J A;  2L5A A;  4EO5 B;  5BO0 A;  1F66 C;  2Y2I A;  2YFV B;  1ZLA B;  2NQB C;  3UTA D;  3W98 B;  4YM6 D;  3LJA C;  5E5A D;  4J8W D;  5AY8 D;  1P3A B;  5CPJ D;  4H9P B;  3B0C W;  5B1L B;  2FFF B;  3AZL B;  2YFW A;  3MGS C;  1M18 C;  4Z5T A;  5GT3 D;  3MNN A;  3UTA B;  3TU4 D;  2F8N H;  5B2I A;  4YM6 B;  3AZI D;  3AZJ A;  5E5A B;  4J8W B;  5AY8 B;  4KUD A;  1M19 A;  5B2J B;  4H9R B;  2DF4 C;  3B6G C;  4CAY B;  2ARO C;  5BS7 C;  5C3I C;  4KGC A;  5GT3 B;  4YS3 C;  3TU4 B;  2Y2H A;  5B31 C;  2FJ7 C;  5DNM B;  1HQ3 D;  3VH6 W;  5GXQ A;  5BNV B;  3EPL A;  4NE3 A;  4G92 C;  2CV5 C;  2NZD D;  2ZY5 A;  5B31 G;  2Y2M A;  3AZF C;  4M6B A;  1P34 D;  4J8X A;  1HQ3 B;  3REK D;  3F6T A;  3AZH A;  5DNN C;  1ID3 D;  3H0L C;  4XZQ C;  3MGQ A;  2NZD B;  1B6W A;  3LZ1 C;  3C1B D;  3X1T C;  5B33 B;  1P34 B;  3MVD A;  3O62 D;  3B6F C;  3AZG D;  3REK B;  5AV5 D;  3LZ0 A;  1AOI C;  1S32 A;  1ID3 B;  5B32 D;  3W97 C;  1KX3 A;  4JJN A;  1P3M C;  3C1B B;  4ZBJ B;  1P3P D;  3O62 B;  3NQU A;  3WKJ A;  3W96 C;  3AZM D;  3AZG B;  4WNN A;  4ZUX B;  5AV5 B;  3C1C D;  2G5H C;  5B32 B;  3EG5 B;  4KUD C;  1JFI A;  5F99 A;  4CSR A;  2JCH A;  3WAA C;  3AN2 D;  1M1A B;  3NQJ B;  3X1S A;  4R8P D;  1F66 D;  1P3P B;  4WU8 D;  3REI D;  3AZM B;  5AV8 B;  5B24 C;  3VH5 W;  3C1C B;  2CWE A;  5GXQ C;  3AN2 B;  1F66 B;  4R8P B;  3MGS D;  1M18 D;  2NQB B;  1R4V A;  3REI B;  3LJA B;  5AVC A;  1KX4 C;  5AV6 A;  1P3B D;  1PZR A;  3P5J B;  3MGS B;  1M18 B;  3AZH C;  3B0D C;  3REH D;  3AV1 A;  5B31 D;  2FJ7 D;  2PYO A;  3LEL A;  4HGA C;  4DRB A;  5BT1 D;  4G91 C;  5CPK A;  3X1V A;  2BG1 A;  4H9N A;  2ARO B;  5B1M A;  5C3I B;  4J8U C;  1BH9 B;  3REH B;  2CV5 D;  5B31 B;  2G5I C;  5G49 A;  2FJ7 B;  4X23 C;  3AZF D;  4LD9 C;  4KHA B;  1U35 C;  5B0Y A;  1P3I D;  2Y2P A;  5CPI C;  3W99 A;  3WKJ C;  5DNN D;  1P3O A;  4Z66 D;  2Y2K A;  1P3G A;  2CV5 B;  5JRG D;  3X1T D;  3LZ1 D;  3AZF B;  3AYW D;  5F99 C;  3B6F D;  5BNX B;  4H9S C;  3KUY A;  3X1S C;  2BYK B;  1P3K A;  1EQZ D;  4H9Q B;  3MGP A;  5CP6 A;  1AOI D;  3UTB C;  5DNN B;  2HIO A;  3X1U C;  4Z66 B;  1Z2C B;  3W97 D;  5B40 A;  3V9R B;  1P3M D;  3REJ A;  5JRG B;  2RIQ A;  4WV4 B;  3LZ1 B;  3X1T B;  3AYW B;  4J8V D;  3B6F B;  3AZL D;  3W96 D;  1EQZ B;  1AOI B;  3A6N A;  5AVB A;  3W97 B;  3IP4 C;  1P3M B;  3WA9 C;  3WAA D;  4QLC A;  5CHL B;  1P3L C;  4J8V B;  5B2J D;  4XUJ A;  3W96 B;  5GT0 C;  3AV2 C;  3REL C;  5B24 D;  3AFA C;  2PYO C;  5DNM D;  1TZY C;  4KUD B;  5B0Z A;  3WAA B;  2JSS A;  5GSU A;  5CPK C;  3KXB A;  3KWQ A;  5B24 B;  1BH8 B;  3KSY A;  2YFV A;  1KX4 D;  2Y2Q A;  3W98 A;  1P3A A;  3UT9 C;  4H9P A;  3AZH D;  5B1L A;  1P3O C;  2VQR A;  4WU9 D;  1KX4 B;  1W2E A;  2ZM5 A;  3UTA A;  1P3F C;  2F8N G;  5B33 D;  4YM6 A;  1WWS A;  5E5A A;  4J8W A;  5CPJ A;  3R45 B;  1P3K C;  5CP6 C;  4J8U D;  3B0D B;  3AZH B;  4LD9 D;  4H9R A;  4X23 D;  5KDM A;  5B40 C;  3AZE C;  3AZN A;  3REJ C;  4WU9 B;  1U35 D;  5GT3 A;  3TU4 A;  5AV9 C;  2ZY2 A;  3AZI A;  5CPI D;  3A1I A;  1KU5 A;  4G91 B;  4J8U B;  4ZUX D;  5BNV A;  4LD9 B;  4X23 B;  1U35 B;  3VH6 A;  2JE5 A;  3MGR D;  5CPI B;  3X1S D;  1M1A D;  4XUJ C;  3UTB D;  3AZK D;  4WZS B;  3X1U D;  1HQ3 A;  4Z2M H;  4Z5T C;  3MNN C;  5AV8 D;  5B2I C;  3AZJ C;  5F99 B;  3WTP D;  5B0Z C;  3MGR B;  1M19 C;  1KX5 A;  2NZD A;  3X1S B;  1P34 A;  2NQB D;  3UTB B;  2BYM B;  3KXB C;  3AZK B;  3X1U B;  3LJA D;  4KGC C;  4EO5 C;  3REK A;  3WA9 D;  1ID3 A;  4G92 B;  1P3L D;  2IO5 C;  3A1K A;  2XD5 A;  3WTP B;  2J8P A;  2ZY3 A;  3AL0 C;  5GT0 D;  3C1B A;  3AV2 D;  3REL D;  3AFA D;  3O62 A;  1WWI A;  3AZG A;  1TZY D;  2RVQ C;  3WA9 B;  5AV5 A;  1P3L B;  5B32 A;  5CPJ C;  4UUZ B;  4H9O A;  4J8X C;  3VH6 T;  5GT0 B;  3B6G D;  2ARO D;  3NQJ A;  3AV2 B;  3REL B;  4YS3 D;  1P3P A;  3AFA B;  2F8N D;  2HUE C;  3MGQ C;  3AZM A;  1TZY B;  3AZN C;  5GT3 C;  1T3U A;  3TU4 C;  3UT9 D;  3C1C A;  3AZI C;  2W8S A;  3MVD C;  4H9N B;  3B6G B;  3AN2 A;  1F66 A;  4R8P A;  3LZ0 C;  1TAF B;  4YS3 B;  1S32 C;  2F8N B;  4WU8 A;  3EPH A;  1P3F D;  3REI A;  1KX3 C;  1H3O B;  4JJN C;  3UT9 B;  5CP6 D;  3AZE D;  4XZQ D;  3MGS A;  1M18 A;  1BFM A;  1P3F B;  5AV9 D;  1KX5 C;  2NZD C;  1N1J A;  5CP6 B;  1P3B A;  3AZE B;  4XZQ B;  5B40 B;  5BS7 A;  1BH9 A;  3REH A;  5AV9 B;  4NE6 A;  5B31 A;  2FJ7 A;  3FDD A;  4KHA A;  5JA4 A;  3C1B C;  5BO0 B;  1HTA A;  4Z5T D;  3MNN D;  5B2I D;  3AZJ D;  4KUD D;  5AVC C;  3EPJ A;  3VH5 T;  5AV6 C;  4E44 A;  1M19 D;  2CV5 A;  3AZF A;  3KXB D;  2YFW B;  1P3I A;  4KGC D;  5BNX A;  3KFU G;  4Z5T B;  3MNN B;  4H9Q A;  3AV1 C;  4WJ3 C;  5B2I B;  3AZJ B;  4Z66 A;  4AWL C;  5FUG A;  3V9R A;  3LEL C;  1M19 B;  5GXQ D;  5JRG A;  3LZ1 A;  3X1T A;  3AYW A;  3KXB B;  3X1V C;  1Q9C A;  3B6F A;  3B0B A;  5B1M C;  4KGC B;  2RVQ D;  4R8P C;  1EQZ A;  2UWX A;  1ZLA A;  4WU8 C;  1AOI A;  3REI C;  2IO5 B;  3W97 A;  1P3M A;  4J8X D;  5B0Y C;  5GXQ B;  3W99 C;  4J8V A;  3W96 A;  3MGQ D;  3AZN D;  3AZL A;  1P3G C;  5CPJ B;  5AY8 A;  3MVD D;  4J8X B;  1ULY A;  3KUY C;  3WAA A;  3MGP C;  1P3B C;  3LZ0 D;  5B2J A;  1S32 D;  2HIO C;  2HUE B;  5KDM B;  3MGQ B;  3AZN B;  1KX3 D;  4CAY A;  4JJN D;  2Y2G A;  3REH C;  5B24 A;  1BH8 A;  4HGA B;  3AZI B;  5DNM A;  3MVD B;  2Y2N A;  3WKJ D;  5BT1 C;  3LZ0 B;  1S32 B;  3A6N C;  5AVB C;  1KX3 B;  4JJN B;  5F99 D;  2Y2O A;  1KX5 D;  2F2A C;  4QLC C;  1KX4 A;  3NQU B;  3WKJ B;  3R45 A;  4WNN B;  1P3I C;  3H0M C;  4NFT A;  4Z66 C;  1JFI B;  4CSR B;  1KX5 B;  4WU9 A;  5JRG C;  5GSU C;  3B0C T;  5B33 A;  3AYW C;  1EQZ C;  5AVC D;  3KWQ C;  1ZLA C;  4J8U A;  5AV6 D;  4LD9 A;  3W98 C;  4X23 A;  2LY8 A;  1P3A C;  1U35 A;  1F1E A;  2ZY4 A;  5CPI A;  4J8V C;  5B1L C;  3AV1 D;  3AZL C;  2PYO D;  4Z2M G;  5AVC B;  3LEL D;  5AV6 B;  4ZUX A;  3UTA C;  4YM6 C;  5E5A C;  4J8W C;  5AY8 C;  4H9O B;  3WTP E;  5CPK D;  3X1V D;  2XD1 A;  3MGR A;  5B1M D;  2F8N K;  4H9S A;  2Y2L A;  1M1A A;  5B2J C;  3AV1 B;  3UTB A;  2BYM A;  3AZK A;  3X1U A;  2PYO B;  4AWL B;  3LEL B;  5AV8 A;  5B0Y D;  3EPK A;  5DNM C;  3W99 D;  3WTP A;  5CPK B;  3X1V B;  1P3O D;  5B1M B;  4UPK A;  4DQY B;  3VH5 A;  1P3G D;  4WU8 B;  2NQB A;  5G49 B;  1A7W A;  3LJA A;  1B67 A;  5B0Y B;  3WA9 A;  3KUY D;  1P3K D;  3W99 B;  3MGP D;  1P3L A;  1P3O B;  4UUZ A;  2HIO D;  1HQ3 C;  1P3G B;  5GT0 A;  5B40 D;  3REJ D;  3AV2 A;  4DRA A;  3REL A;  3AFA A;  1TZY A;  4WU9 C;  1N1J B;  3KUY B;  1P3K B;  5B33 C;  3MGP B;  1P3B B;  1P34 C;  3A6N D;  2HIO B;  5AVB D;  3B6G A;  3REK C;  2ARO A;  3REJ B;  1TAF A;  4QLC D;  4YS3 A;  1ID3 C;  2F8N A;  5JA4 B;  1H3O A;  4XUJ D;  3UT9 A;  4ZBJ C;  3A6N B;  5AVB B;  3O62 C;  3AZG C;  5B0Z D;  4ZUX C;  5AV5 C;  4QLC B;  3H0R C;  5GSU D;  1P3F A;  5B32 C;  4XUJ B;  3MGR C;  4NE5 A;  1P3I B;  1M1A C;  3KWQ D;  1ZLA D;  2BYK A;  1P3P C;  3AZK C;  3AZM C;  5DNN A;  3W98 D;  3AZE A;  4XZQ A;  5FUG B;  1P3A D;  5B0Z B;  5AV8 C;  3C1C C;  5GSU B;  5AV9 A;  4E45 A; 
#chains in the Genus database with same CATH homology
 5B32 G;  5B1L D;  3WTP C;  3AN2 C;  2DQN C;  3KWQ B;  2Y2J A;  2L5A A;  4EO5 B;  5BO0 A;  1F66 C;  2Y2I A;  2YFV B;  1ZLA B;  2NQB C;  3UTA D;  3W98 B;  4YM6 D;  3LJA C;  5E5A D;  4J8W D;  5AY8 D;  1P3A B;  5CPJ D;  4H9P B;  3B0C W;  5B1L B;  2FFF B;  3AZL B;  2YFW A;  3MGS C;  1M18 C;  4Z5T A;  5GT3 D;  3MNN A;  3UTA B;  3TU4 D;  2F8N H;  5B2I A;  4YM6 B;  3AZI D;  3AZJ A;  5E5A B;  4J8W B;  5AY8 B;  4KUD A;  1M19 A;  5B2J B;  4H9R B;  2DF4 C;  3B6G C;  4CAY B;  2ARO C;  5BS7 C;  5C3I C;  4KGC A;  5GT3 B;  4YS3 C;  3TU4 B;  2Y2H A;  5B31 C;  2FJ7 C;  5DNM B;  1HQ3 D;  3VH6 W;  5GXQ A;  5BNV B;  3EPL A;  4NE3 A;  4G92 C;  2CV5 C;  2NZD D;  2ZY5 A;  5B31 G;  2Y2M A;  3AZF C;  4M6B A;  1P34 D;  4J8X A;  1HQ3 B;  3REK D;  3F6T A;  3AZH A;  5DNN C;  1ID3 D;  3H0L C;  4XZQ C;  3MGQ A;  2NZD B;  1B6W A;  3LZ1 C;  3C1B D;  3X1T C;  5B33 B;  1P34 B;  3MVD A;  3O62 D;  3B6F C;  3AZG D;  3REK B;  5AV5 D;  3LZ0 A;  1AOI C;  1S32 A;  1ID3 B;  5B32 D;  3W97 C;  1KX3 A;  4JJN A;  1P3M C;  3C1B B;  4ZBJ B;  1P3P D;  3O62 B;  3NQU A;  3WKJ A;  3W96 C;  3AZM D;  3AZG B;  4WNN A;  4ZUX B;  5AV5 B;  3C1C D;  2G5H C;  5B32 B;  3EG5 B;  4KUD C;  1JFI A;  5F99 A;  4CSR A;  2JCH A;  3WAA C;  3AN2 D;  1M1A B;  3NQJ B;  3X1S A;  4R8P D;  1F66 D;  1P3P B;  4WU8 D;  3REI D;  3AZM B;  5AV8 B;  5B24 C;  3VH5 W;  3C1C B;  2CWE A;  5GXQ C;  3AN2 B;  1F66 B;  4R8P B;  3MGS D;  1M18 D;  2NQB B;  1R4V A;  3REI B;  3LJA B;  5AVC A;  1KX4 C;  5AV6 A;  1P3B D;  1PZR A;  3P5J B;  3MGS B;  1M18 B;  3AZH C;  3B0D C;  3REH D;  3AV1 A;  5B31 D;  2FJ7 D;  2PYO A;  3LEL A;  4HGA C;  4DRB A;  5BT1 D;  4G91 C;  5CPK A;  3X1V A;  2BG1 A;  4H9N A;  2ARO B;  5B1M A;  5C3I B;  4J8U C;  1BH9 B;  3REH B;  2CV5 D;  5B31 B;  2G5I C;  5G49 A;  2FJ7 B;  4X23 C;  3AZF D;  4LD9 C;  4KHA B;  1U35 C;  5B0Y A;  1P3I D;  2Y2P A;  5CPI C;  3W99 A;  3WKJ C;  5DNN D;  1P3O A;  4Z66 D;  2Y2K A;  1P3G A;  2CV5 B;  5JRG D;  3X1T D;  3LZ1 D;  3AZF B;  3AYW D;  5F99 C;  3B6F D;  5BNX B;  4H9S C;  3KUY A;  3X1S C;  2BYK B;  1P3K A;  1EQZ D;  4H9Q B;  3MGP A;  5CP6 A;  1AOI D;  3UTB C;  5DNN B;  2HIO A;  3X1U C;  4Z66 B;  1Z2C B;  3W97 D;  5B40 A;  3V9R B;  1P3M D;  3REJ A;  5JRG B;  2RIQ A;  4WV4 B;  3LZ1 B;  3X1T B;  3AYW B;  4J8V D;  3B6F B;  3AZL D;  3W96 D;  1EQZ B;  1AOI B;  3A6N A;  5AVB A;  3W97 B;  3IP4 C;  1P3M B;  3WA9 C;  3WAA D;  4QLC A;  5CHL B;  1P3L C;  4J8V B;  5B2J D;  4XUJ A;  3W96 B;  5GT0 C;  3AV2 C;  3REL C;  5B24 D;  3AFA C;  2PYO C;  5DNM D;  1TZY C;  4KUD B;  5B0Z A;  3WAA B;  2JSS A;  5GSU A;  5CPK C;  3KXB A;  3KWQ A;  5B24 B;  1BH8 B;  3KSY A;  2YFV A;  1KX4 D;  2Y2Q A;  3W98 A;  1P3A A;  3UT9 C;  4H9P A;  3AZH D;  5B1L A;  1P3O C;  2VQR A;  4WU9 D;  1KX4 B;  1W2E A;  2ZM5 A;  3UTA A;  1P3F C;  2F8N G;  5B33 D;  4YM6 A;  1WWS A;  5E5A A;  4J8W A;  5CPJ A;  3R45 B;  1P3K C;  5CP6 C;  4J8U D;  3B0D B;  3AZH B;  4LD9 D;  4H9R A;  4X23 D;  5KDM A;  5B40 C;  3AZE C;  3AZN A;  3REJ C;  4WU9 B;  1U35 D;  5GT3 A;  3TU4 A;  5AV9 C;  2ZY2 A;  3AZI A;  5CPI D;  3A1I A;  1KU5 A;  4G91 B;  4J8U B;  4ZUX D;  5BNV A;  4LD9 B;  4X23 B;  1U35 B;  3VH6 A;  2JE5 A;  3MGR D;  5CPI B;  3X1S D;  1M1A D;  4XUJ C;  3UTB D;  3AZK D;  4WZS B;  3X1U D;  1HQ3 A;  4Z2M H;  4Z5T C;  3MNN C;  5AV8 D;  5B2I C;  3AZJ C;  5F99 B;  3WTP D;  5B0Z C;  3MGR B;  1M19 C;  1KX5 A;  2NZD A;  3X1S B;  1P34 A;  2NQB D;  3UTB B;  2BYM B;  3KXB C;  3AZK B;  3X1U B;  3LJA D;  4KGC C;  4EO5 C;  3REK A;  3WA9 D;  1ID3 A;  4G92 B;  1P3L D;  2IO5 C;  3A1K A;  2XD5 A;  3WTP B;  2J8P A;  2ZY3 A;  3AL0 C;  5GT0 D;  3C1B A;  3AV2 D;  3REL D;  3AFA D;  3O62 A;  1WWI A;  3AZG A;  1TZY D;  2RVQ C;  3WA9 B;  5AV5 A;  1P3L B;  5B32 A;  5CPJ C;  4UUZ B;  4H9O A;  4J8X C;  3VH6 T;  5GT0 B;  3B6G D;  2ARO D;  3NQJ A;  3AV2 B;  3REL B;  4YS3 D;  1P3P A;  3AFA B;  2F8N D;  2HUE C;  3MGQ C;  3AZM A;  1TZY B;  3AZN C;  5GT3 C;  1T3U A;  3TU4 C;  3UT9 D;  3C1C A;  3AZI C;  2W8S A;  3MVD C;  4H9N B;  3B6G B;  3AN2 A;  1F66 A;  4R8P A;  3LZ0 C;  1TAF B;  4YS3 B;  1S32 C;  2F8N B;  4WU8 A;  3EPH A;  1P3F D;  3REI A;  1KX3 C;  1H3O B;  4JJN C;  3UT9 B;  5CP6 D;  3AZE D;  4XZQ D;  3MGS A;  1M18 A;  1BFM A;  1P3F B;  5AV9 D;  1KX5 C;  2NZD C;  1N1J A;  5CP6 B;  1P3B A;  3AZE B;  4XZQ B;  5B40 B;  5BS7 A;  1BH9 A;  3REH A;  5AV9 B;  4NE6 A;  5B31 A;  2FJ7 A;  3FDD A;  4KHA A;  5JA4 A;  3C1B C;  5BO0 B;  1HTA A;  4Z5T D;  3MNN D;  5B2I D;  3AZJ D;  4KUD D;  5AVC C;  3EPJ A;  3VH5 T;  5AV6 C;  4E44 A;  1M19 D;  2CV5 A;  3AZF A;  3KXB D;  2YFW B;  1P3I A;  4KGC D;  5BNX A;  3KFU G;  4Z5T B;  3MNN B;  4H9Q A;  3AV1 C;  4WJ3 C;  5B2I B;  3AZJ B;  4Z66 A;  4AWL C;  5FUG A;  3V9R A;  3LEL C;  1M19 B;  5GXQ D;  5JRG A;  3LZ1 A;  3X1T A;  3AYW A;  3KXB B;  3X1V C;  1Q9C A;  3B6F A;  3B0B A;  5B1M C;  4KGC B;  2RVQ D;  4R8P C;  1EQZ A;  2UWX A;  1ZLA A;  4WU8 C;  1AOI A;  3REI C;  2IO5 B;  3W97 A;  1P3M A;  4J8X D;  5B0Y C;  5GXQ B;  3W99 C;  4J8V A;  3W96 A;  3MGQ D;  3AZN D;  3AZL A;  1P3G C;  5CPJ B;  5AY8 A;  3MVD D;  4J8X B;  1ULY A;  3KUY C;  3WAA A;  3MGP C;  1P3B C;  3LZ0 D;  5B2J A;  1S32 D;  2HIO C;  2HUE B;  5KDM B;  3MGQ B;  3AZN B;  1KX3 D;  4CAY A;  4JJN D;  2Y2G A;  3REH C;  5B24 A;  1BH8 A;  4HGA B;  3AZI B;  5DNM A;  3MVD B;  2Y2N A;  3WKJ D;  5BT1 C;  3LZ0 B;  1S32 B;  3A6N C;  5AVB C;  1KX3 B;  4JJN B;  5F99 D;  2Y2O A;  1KX5 D;  2F2A C;  4QLC C;  1KX4 A;  3NQU B;  3WKJ B;  3R45 A;  4WNN B;  1P3I C;  3H0M C;  4NFT A;  4Z66 C;  1JFI B;  4CSR B;  1KX5 B;  4WU9 A;  5JRG C;  5GSU C;  3B0C T;  5B33 A;  3AYW C;  1EQZ C;  5AVC D;  3KWQ C;  1ZLA C;  4J8U A;  5AV6 D;  4LD9 A;  3W98 C;  4X23 A;  2LY8 A;  1P3A C;  1U35 A;  1F1E A;  2ZY4 A;  5CPI A;  4J8V C;  5B1L C;  3AV1 D;  3AZL C;  2PYO D;  4Z2M G;  5AVC B;  3LEL D;  5AV6 B;  4ZUX A;  3UTA C;  4YM6 C;  5E5A C;  4J8W C;  5AY8 C;  4H9O B;  3WTP E;  5CPK D;  3X1V D;  2XD1 A;  3MGR A;  5B1M D;  2F8N K;  4H9S A;  2Y2L A;  1M1A A;  5B2J C;  3AV1 B;  3UTB A;  2BYM A;  3AZK A;  3X1U A;  2PYO B;  4AWL B;  3LEL B;  5AV8 A;  5B0Y D;  3EPK A;  5DNM C;  3W99 D;  3WTP A;  5CPK B;  3X1V B;  1P3O D;  5B1M B;  4UPK A;  4DQY B;  3VH5 A;  1P3G D;  4WU8 B;  2NQB A;  5G49 B;  1A7W A;  3LJA A;  1B67 A;  5B0Y B;  3WA9 A;  3KUY D;  1P3K D;  3W99 B;  3MGP D;  1P3L A;  1P3O B;  4UUZ A;  2HIO D;  1HQ3 C;  1P3G B;  5GT0 A;  5B40 D;  3REJ D;  3AV2 A;  4DRA A;  3REL A;  3AFA A;  1TZY A;  4WU9 C;  1N1J B;  3KUY B;  1P3K B;  5B33 C;  3MGP B;  1P3B B;  1P34 C;  3A6N D;  2HIO B;  5AVB D;  3B6G A;  3REK C;  2ARO A;  3REJ B;  1TAF A;  4QLC D;  4YS3 A;  1ID3 C;  2F8N A;  5JA4 B;  1H3O A;  4XUJ D;  3UT9 A;  4ZBJ C;  3A6N B;  5AVB B;  3O62 C;  3AZG C;  5B0Z D;  4ZUX C;  5AV5 C;  4QLC B;  3H0R C;  5GSU D;  1P3F A;  5B32 C;  4XUJ B;  3MGR C;  4NE5 A;  1P3I B;  1M1A C;  3KWQ D;  1ZLA D;  2BYK A;  1P3P C;  3AZK C;  3AZM C;  5DNN A;  3W98 D;  3AZE A;  4XZQ A;  5FUG B;  1P3A D;  5B0Z B;  5AV8 C;  3C1C C;  5GSU B;  5AV9 A;  4E45 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...