3LELD

Structural insight into the sequence-dependence of nucleosome positioning
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
100
structure length
100
Chain Sequence
GKKRRKTRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords Histone H3.2
publication title Structural insight into the sequence dependence of nucleosome positioning
pubmed doi rcsb
source organism Xenopus laevis
total genus 35
structure length 100
sequence length 100
chains with identical sequence H, N, R
ec nomenclature
pdb deposition date 2010-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3lelD00
4KHAB 3UTAC 3WAAD 4AWLC 3RELC 5AVBC 4YM6C 1U35B 3V9RA 3VH5W 3AV1B 1P3OD 4H9OB 2F8NG 3A6NA 4EO5C 3WTPE 1EQZA 3MGPB 4CAYB 1P34A 5B31D 5AV9B 3W98B 3LZ1B 3UT9B 3W99A 3X1TD 3B0DB 1P3GA 3REIA 3AZKB 4WU8D 1ZLAC 2BYKA 3AZLC 1S32D 5BO0A 3REJD 3NQJB 5B40C 4QLCB 3VH6W 5AVCD 5F99D 4J8WD 1P3LB 4KUDC 2NZDC 4H9QB 3X1VB 4JJNB 5GT3B 3MVDD 5AV8B 1WWIA 4H9QA 5GXQD 3MGRB 5DNNB 3AZMB 5JRGA 2CV5D 3AN2A 4XUJB 3TU4C 1P3BA 4R8PC 1P3MA 2F8NK 2BYMB 3NQUA 5B2ID 4J8XD 3AZHD 1KX5C 1TZYC 5CPJC 4J8UC 5B0YD 5C3IC 2HIOC 4XZQB 5GSUC 3AFAB 3AV2C 3VH5A 3AZFA 4XZQA 4J8VD 3AZNC 2NQBA 3X1SD 4ZBJB 1HTAA 4LD9B 4H9SA 3AZGB 5CPKB 3W97C 2IO5B 5AV5A 5B33A 4WV4B 5BNVA 3LJAB 3KUYA 2F8NH 5B1MC 3WA9A 3AYWA 5B1LC 1P3AA 3MGQC 4H9RB 4WNNA 1M1AD 3WAAB 4X23D 3A6ND 2AROD 1EQZD 1P3IC 5B2JB 2YFWA 3REHA 4HGAB 4Z66C 3O62C 4YS3D 1P3OB 3W99D 5GT0A 5AY8B 1P3GD 5B31B 3REID 5FUGB 2PYOC 3X1TB 5JA4A 3MNNA 1HQ3C 1F66C 5B24A 3X1VC 4JJNC 2YFVB 5GT3C 4WU9A 4WU8B 2YFVA 1S32B 4WU8A 3REJB 2FJ7A 5DNNC 5CPIC 5AVCB 3X1UA 1P3PA 3LELC 5F99A 3KWQA 4J8WA 4XUJC 3B6FD 5E5AC 3MVDB 1N1JA 5JRGD 5GXQB 4CSRA 3C1BC 3UTBA 1AOIB 3UTAA 1P3BD 2CV5B 1P3MD 3RELA 4YM6A 3AZEC 4J8XB 1BH8B 3AZHB 1BH9B 5B32G 5B2IA 5DNMC 1BH9A 3AZFD 5B0YB 2NQBD 1ZLAA 3AZLA 5AV5D 1M19C 5B33D 4J8VB 5B40A 3X1SB 3KUYD 5BNXA 3WA9D 5B2JC 3AYWD 4KUDA 1P3AD 5BS7C 5AY8C 3VH6T 4Z2MG 3V9RB 3REHD 5B0ZC 3REKC 1M1AB 4KGCC 1ID3D 5GT0D 4X23B 3A6NB 1EQZB 3WKJB 1TAFA 1M1AA 1P34B 3LZ0D 3AZIC 4X23A 5BT1D 3KXBC 2AROA 3TU4A 4YS3B 3W99B 3C1CC 3MNND 1P3GB 4YS3A 3REIB 5B24D 4WU9D 4G91C 1TZYA 2BYKB 4Z5TC 5BO0B 2FJ7D 4J8UA 3B0BA 3KSYA 3X1UD 3AV2A 1P3PD 1AOIC 5CP6D 3KWQD 3AZNA 1KX3C 3B6GC 3W97A 3UTBD 2F8NA 3UTAD 5B1MA 3WTPC 5JRGB 3B6FA 5B1LA 3RELD 5AVBD 4YM6D 3MGQA 3AN2B 5B32C 4H9NA 1P3BB 1P3MB 1P3IA 3W96C 3NQUB 4H9PA 4G92B 1P3FC 4Z66A 3O62A 5AV6C 1P3KC 2PYOA 1KX4C 4ZUXC 1ZLAD 3MGSC 3AZLD 1HQ3A 3AZJC 3AZFB 1M18C 5B40D 3WKJC 2NQBB 3R45A 4Z2MH 4KUDD 5AV5B 2NZDD 5B33B 5BNVB 1U35C 3KUYB 5CPIA 3WA9B 3AV1C 3AYWB 1P34C 4E45A 3LELA 1P3AB 2RVQC 4E44A 3MGPC 4WNNB 5E5AA 5AV9C 3W98C 3LZ1C 3UT9C 3C1BA 3B0DC 2YFWB 3REHB 3TU4D 1ID3B 1R4VA 5GT0B 3AZKC 4R8PD 1ID3A 3LZ0B 3AZEA 1KX5D 1TZYD 3LZ0A 5B31G 4QLCC 5JA4B 3MNNB 5B24B 4WU9B 1P3LC 4J8UD 2HIOD 3B0CW 5DNMA 5AV8C 3AV2D 2FJ7B 3AZND 3MGRC 3X1UB 1P3PB 2JSSA 3AZMC 1B6WA 5CP6B 5KDMA 3AN2C 1M19A 3W97D 5F99B 3KWQB 4J8WB 2F8ND 5CP6A 1N1JB 5B1MD 4CSRB 5B1LD 3UTBB 2HUEB 3MGQD 5BS7A 1JFIA 3UTAB 4AWLB 3RELB 5AVBB 4YM6B 1P3ID 1KU5A 5B0ZA 4Z66D 5AVBA 3O62D 3REKA 4KGCA 4EO5B 4XZQC 3AFAC 3AZIA 1WWSA 3KXBA 2PYOD 4H9SC 5B2IB 4ZBJC 3VH5T 4LD9C 4UUZA 5AV5C 1HQ3D 1F66D 4NE3A 3AZGC 4JJND 3X1VD 5GT3D 2IO5C 5CPKC 1ZLAB 3AZLB 3LJAC 4Z5TA 5DNND 5B40B 5BNXB 5CPID 1ULYA 4KUDB 3LELD 3WAAC 2NZDB 5G49B 5CHLB 4XUJD 5E5AD 1KX3A 2NZDA 4HGAC 5G49A 1P3OC 3C1BD 1H3OA 5B31C 3WTPA 1TAFB 3X1TC 3AZED 2AROB 5B32A 3TU4B 4R8PB 4WU8C 1S32C 3W96A 1F1EA 4R8PA 1P3FA 3REJC 1KX5B 1TZYB 5AV6A 5DNMD 1KX5A 1P3KA 5CPJA 5AVCC 5F99C 4J8WC 4J8UB 1KX4A 5C3IB 4ZUXA 3MGSA 3MVDC 3AV2B 2HIOA 2HUEC 3AZJA 1M19D 5GSUA 5GXQC 3AZNB 1M18A 3WKJA 4KHAA 5B2JD 3W97B 2CV5C 2F8NB 1U35A 5B1MB 5AY8D 3AV1A 3B6FB 4H9OA 5B1LB 4WZSB 3MGPA 3MGQB 4CAYA 5B0ZD 5B2IC 5AV9A 4J8XC 4H9NB 3REKD 3AZHC 3W98A 3LZ1A 4KGCD 3UT9A 1P3IB 4H9PB 3AZID 3KXBD 4Z66B 3O62B 5B0YC 3C1CD 3AZKA 3NQJA 4J8VC 2PYOB 3X1SC 4QLCA 4Z5TD 1HQ3B 1F66B 1P3LA 4NE6A 3R45B 1F66A 3X1VA 4JJNA 5GT3A 5AV8A 1AOID 4DRAA 3MGRA 3B0CT 5DNNA 5CPIB 1KX3D 3B6GD 3AZMA 1M1AC 3LELB 4X23C 3A6NC 2AROC 1EQZC 5E5AB 4NFTA 3WTPD 4XUJA 4YS3C 3W99C 3C1BB 1P3GC 2BYMA 3REIC 5B32D 3AZEB 3W96D 2CWEA 1A7WA 1P3FD 5AV6D 1P3KD 5CPJD 3AFAA 1KX4D 4ZUXD 3MGSD 5DNMB 4LD9A 3AZJD 5GSUD 3AZGA 5CPKA 1M18D 3WKJD 3B6FC 3LJAA 5KDMB 1M19B 5JRGC 1U35D 4H9RA 3AV1D 1P34D 3WAAA 1P3BC 2RVQD 1P3MC 3MGPD 5B2JA 3VH6A 1JFIB 5AV9D 4G92C 3W98D 3LZ1D 1P3OA 3UT9D 4M6BA 5AY8A 5B0ZB 5B31A 3REKB 2L5AA 4KGCB 5FUGA 3AZKD 3X1TA 3AZIB 3KXBB 3AZFC 3C1CB 2NQBC 4QLCD 4UUZB 1S32A 3C1CA 1P3LD 4G91B 3REJA 5B33C 5AV8D 4Z5TB 3KUYC 3WA9C 5AVCA 3AYWC 4DRBA 1P3AC 3MGRD 3MVDA 3AZMD 3AN2D 5GXQA 1AOIA 3REHC 1KX3B 3B6GB 1ID3C 5GT0C 3B6GA 1H3OB 2CV5A 3LZ0C 1BFMA 1Q9CA 1B67A 5BT1C 3WTPB 3MNNC 5B24C 5B32B 4J8XA 1BH8A 3AZHA 4WU9C 4XZQD 3AFAD 3W96B 1P3FB 2FJ7C 5AV6B 5B0YA 2LY8A 4LD9D 1P3KB 5CPJB 3X1UC 1P3PC 3AZGD 5CPKD 5CP6C 4J8VA 1KX4B 4ZUXB 3KWQC 3X1SA 3MGSB 3LJAD 2HIOB 3AZJB 5GSUB 1M18B 4NE5A 3UTBC
chains in the Genus database with same CATH superfamily
4KHAB 3UTAC 3WAAD 4AWLC 3RELC 5AVBC 4YM6C 1U35B 3V9RA 3VH5W 3AV1B 1P3OD 4H9OB 2F8NG 3A6NA 4EO5C 3WTPE 1EQZA 3MGPB 4CAYB 1P34A 5B31D 5AV9B 3W98B 3LZ1B 3UT9B 3W99A 3X1TD 3B0DB 1PZRA 1P3GA 3REIA 2Y2JA 3AZKB 4WU8D 1ZLAC 2BYKA 3AZLC 1S32D 5BO0A 3REJD 3NQJB 5B40C 4QLCB 3VH6W 5AVCD 5F99D 4J8WD 1P3LB 4KUDC 2NZDC 4H9QB 3X1VB 4JJNB 5GT3B 3MVDD 5AV8B 1WWIA 4H9QA 5GXQD 2Y2GA 2Y2PA 3MGRB 5DNNB 3AZMB 5JRGA 2CV5D 3AN2A 4XUJB 3TU4C 2F2AC 1P3BA 4R8PC 1P3MA 2F8NK 2BYMB 3NQUA 5B2ID 4J8XD 3AZHD 1KX5C 1TZYC 5CPJC 1W2EA 4J8UC 5B0YD 5C3IC 2HIOC 4XZQB 5GSUC 3AFAB 3AV2C 2XD1A 3VH5A 3AZFA 4XZQA 4J8VD 3AZNC 2NQBA 3X1SD 4ZBJB 1HTAA 4LD9B 2Y2MA 4H9SA 3AZGB 5CPKB 2Y2QA 2IO5B 5AV5A 5B33A 3W97C 4WV4B 5BNVA 3EPJA 3LJAB 3KUYA 2F8NH 5B1MC 3WA9A 3AYWA 5B1LC 1P3AA 2VQRA 3MGQC 4H9RB 4WNNA 1M1AD 3WAAB 4X23D 3A6ND 2AROD 1EQZD 1P3IC 5B2JB 2YFWA 3REHA 2Y2HA 4HGAB 4Z66C 2Y2IA 4YS3D 3O62C 1P3OB 3W99D 5GT0A 5AY8B 3H0MC 1P3GD 5B31B 3REID 5FUGB 2PYOC 3X1TB 5JA4A 3MNNA 1HQ3C 3A1IA 1F66C 5B24A 3X1VC 4JJNC 2YFVB 5GT3C 4WU9A 4WU8B 2YFVA 1S32B 4WU8A 3REJB 2FJ7A 5DNNC 5CPIC 5AVCB 3X1UA 1P3PA 3LELC 5F99A 3KWQA 4J8WA 4XUJC 3B6FD 5E5AC 3MVDB 1N1JA 2G5IC 5JRGD 5GXQB 4CSRA 3C1BC 3UTBA 1AOIB 3UTAA 1P3BD 2CV5B 1P3MD 3RELA 4YM6A 3AZEC 4J8XB 1BH8B 3AZHB 1BH9B 2RIQA 5B32G 5DNMC 5B2IA 2ZY5A 1BH9A 3AZFD 5B0YB 2NQBD 1ZLAA 3AZLA 5AV5D 1M19C 5B33D 4J8VB 5B40A 3X1SB 3KUYD 5BNXA 3WA9D 5B2JC 3AYWD 4KUDA 1P3AD 5BS7C 5AY8C 3VH6T 4Z2MG 3V9RB 3REHD 5B0ZC 3REKC 1M1AB 4KGCC 1ID3D 5GT0D 4X23B 3A6NB 1EQZB 3WKJB 1TAFA 2ZM5A 1M1AA 1P34B 3LZ0D 3AZIC 4X23A 5BT1D 3KXBC 2AROA 3TU4A 4YS3B 3W99B 3C1CC 3MNND 1P3GB 4YS3A 3REIB 5B24D 4WU9D 4G91C 1TZYA 2BYKB 4Z5TC 5BO0B 2FJ7D 4J8UA 3B0BA 3KSYA 3X1UD 3AV2A 1P3PD 1AOIC 5CP6D 2XD5A 3A1KA 3KWQD 3AZNA 1KX3C 3B6GC 3W97A 3UTBD 2F8NA 3UTAD 2BG1A 5B1MA 3WTPC 3F6TA 5JRGB 3B6FA 5B1LA 3RELD 5AVBD 4YM6D 3MGQA 3AN2B 5B32C 4H9NA 1P3BB 1P3MB 1P3IA 3W96C 3NQUB 4H9PA 4G92B 1P3FC 4Z66A 3O62A 5AV6C 2Y2OA 1P3KC 2PYOA 1KX4C 4ZUXC 1ZLAD 3MGSC 3AZLD 1HQ3A 3AZJC 2ZY4A 3AZFB 1M18C 5B40D 3WKJC 2NQBB 3R45A 4Z2MH 4KUDD 5AV5B 2NZDD 5B33B 5BNVB 1U35C 3KUYB 5CPIA 3WA9B 3AV1C 3AYWB 1P34C 4E45A 3LELA 1P3AB 2RVQC 2Y2LA 4E44A 3MGPC 4WNNB 5E5AA 5AV9C 3W98C 3LZ1C 3UT9C 3C1BA 3B0DC 2YFWB 3REHB 3TU4D 1ID3B 1R4VA 5GT0B 3AZKC 4R8PD 4UPKA 1ID3A 3LZ0B 3AZEA 1KX5D 1TZYD 3LZ0A 5B31G 4QLCC 5JA4B 3MNNB 5B24B 4WU9B 1P3LC 4J8UD 4WJ3C 2HIOD 3B0CW 5DNMA 5AV8C 3AV2D 2FJ7B 3AZND 3MGRC 3X1UB 1P3PB 2JSSA 3AZMC 1B6WA 5CP6B 5KDMA 3AN2C 1M19A 3W97D 5F99B 3KWQB 4J8WB 2F8ND 5CP6A 1N1JB 5B1MD 2Y2KA 4CSRB 5B1LD 3UTBB 2HUEB 3MGQD 5BS7A 1JFIA 3UTAB 4AWLB 3RELB 5AVBB 2DQNC 4YM6B 1P3ID 1KU5A 5B0ZA 4Z66D 5AVBA 3O62D 3REKA 4KGCA 3FDDA 4EO5B 4XZQC 3AFAC 3AZIA 1WWSA 3KXBA 2PYOD 4H9SC 5B2IB 4ZBJC 3VH5T 4LD9C 4UUZA 5AV5C 1HQ3D 1F66D 4NE3A 3AZGC 4JJND 3X1VD 5GT3D 2IO5C 5CPKC 1ZLAB 3AZLB 3LJAC 4Z5TA 5DNND 3EPLA 5B40B 5BNXB 5CPID 1ULYA 4KUDB 3LELD 3WAAC 2NZDB 2W8SA 5G49B 5CHLB 4XUJD 5E5AD 1KX3A 3IP4C 2NZDA 4HGAC 5G49A 1P3OC 3C1BD 1H3OA 5B31C 3WTPA 1TAFB 3X1TC 3AZED 2ZY3A 2AROB 5B32A 3TU4B 3EPHA 4R8PB 4WU8C 1S32C 3W96A 1F1EA 4R8PA 1P3FA 3REJC 1KX5B 1TZYB 5AV6A 5DNMD 1KX5A 1P3KA 5CPJA 5AVCC 5F99C 4J8WC 2UWXA 4J8UB 1KX4A 5C3IB 2JE5A 4ZUXA 3MGSA 3MVDC 3AV2B 2HIOA 2HUEC 3AZJA 1M19D 5GSUA 5GXQC 3AZNB 1M18A 3WKJA 4KHAA 2Y2NA 5B2JD 3W97B 2CV5C 2F8NB 1U35A 5B1MB 5AY8D 3AV1A 3B6FB 4H9OA 5B1LB 4WZSB 3MGPA 3MGQB 4CAYA 5B0ZD 5B2IC 5AV9A 4J8XC 4H9NB 3REKD 3AZHC 3W98A 3LZ1A 4KGCD 3UT9A 1P3IB 3P5JB 4H9PB 3AZID 3KXBD 4Z66B 3O62B 5B0YC 3C1CD 3AZKA 3NQJA 4J8VC 2PYOB 3X1SC 4QLCA 4Z5TD 1HQ3B 1F66B 1P3LA 4NE6A 3R45B 1F66A 3X1VA 4JJNA 5GT3A 5AV8A 1AOID 1T3UA 3H0LC 4DRAA 3MGRA 3B0CT 5DNNA 5CPIB 1KX3D 3B6GD 3AZMA 1M1AC 3LELB 4X23C 3A6NC 2AROC 1EQZC 5E5AB 4NFTA 3WTPD 4XUJA 4YS3C 3W99C 3C1BB 1P3GC 2BYMA 3REIC 5B32D 3AZEB 3W96D 2CWEA 1A7WA 1P3FD 5AV6D 1P3KD 3EG5B 5CPJD 3AFAA 1KX4D 4ZUXD 3MGSD 5DNMB 4LD9A 3AZJD 3KFUG 5GSUD 3AZGA 5CPKA 1M18D 3WKJD 2J8PA 3B6FC 3LJAA 5KDMB 1M19B 5JRGC 1U35D 4H9RA 3AV1D 1P34D 3WAAA 1P3BC 2RVQD 1P3MC 3MGPD 5B2JA 3VH6A 1JFIB 5AV9D 4G92C 3W98D 3LZ1D 1P3OA 3UT9D 4M6BA 5AY8A 5B0ZB 5B31A 3REKB 2L5AA 4KGCB 2ZY2A 5FUGA 3AZKD 3X1TA 3AZIB 3KXBB 3AZFC 2DF4C 3C1CB 2NQBC 4QLCD 4UUZB 1S32A 3C1CA 2FFFB 1P3LD 4G91B 3REJA 5B33C 4DQYB 5AV8D 4Z5TB 3KUYC 3WA9C 5AVCA 3AL0C 3AYWC 4DRBA 1P3AC 3MGRD 3MVDA 3AZMD 3AN2D 5GXQA 1AOIA 3H0RC 3REHC 1KX3B 3B6GB 1ID3C 5GT0C 3B6GA 1H3OB 2CV5A 3LZ0C 1BFMA 1Q9CA 1B67A 5BT1C 1Z2CB 3WTPB 3MNNC 5B24C 5B32B 4J8XA 1BH8A 3AZHA 4WU9C 2G5HC 4XZQD 3AFAD 3W96B 1P3FB 2FJ7C 5AV6B 5B0YA 2JCHA 2LY8A 4LD9D 1P3KB 5CPJB 3X1UC 1P3PC 3AZGD 5CPKD 5CP6C 4J8VA 1KX4B 4ZUXB 3KWQC 3X1SA 3MGSB 3EPKA 3LJAD 2HIOB 3AZJB 5GSUB 1M18B 4NE5A 3UTBC
chains in the Genus database with same CATH topology
4KHAB 3UTAC 3WAAD 4AWLC 3RELC 5AVBC 4YM6C 1U35B 3V9RA 3VH5W 3AV1B 1P3OD 4H9OB 2F8NG 3A6NA 4EO5C 3WTPE 1EQZA 3MGPB 4CAYB 1P34A 5B31D 5AV9B 3W98B 3LZ1B 3UT9B 3W99A 3X1TD 3B0DB 1PZRA 1P3GA 3REIA 2Y2JA 3AZKB 4WU8D 1ZLAC 2BYKA 3AZLC 1S32D 5BO0A 3REJD 3NQJB 5B40C 4QLCB 3VH6W 5AVCD 5F99D 4J8WD 1P3LB 4KUDC 2NZDC 4H9QB 3X1VB 4JJNB 5GT3B 3MVDD 5AV8B 1WWIA 4H9QA 5GXQD 2Y2GA 2Y2PA 3MGRB 5DNNB 3AZMB 5JRGA 2CV5D 3AN2A 4XUJB 3TU4C 2F2AC 1P3BA 4R8PC 1P3MA 2F8NK 2BYMB 3NQUA 5B2ID 4J8XD 3AZHD 1KX5C 1TZYC 5CPJC 1W2EA 4J8UC 5B0YD 5C3IC 2HIOC 4XZQB 5GSUC 3AFAB 3AV2C 2XD1A 3VH5A 3AZFA 4XZQA 4J8VD 3AZNC 2NQBA 3X1SD 4ZBJB 1HTAA 4LD9B 2Y2MA 4H9SA 3AZGB 5CPKB 2Y2QA 2IO5B 5AV5A 5B33A 3W97C 4WV4B 5BNVA 3EPJA 3LJAB 3KUYA 2F8NH 5B1MC 3WA9A 3AYWA 5B1LC 1P3AA 2VQRA 3MGQC 4H9RB 4WNNA 1M1AD 3WAAB 4X23D 3A6ND 2AROD 1EQZD 1P3IC 5B2JB 2YFWA 3REHA 2Y2HA 4HGAB 4Z66C 2Y2IA 4YS3D 3O62C 1P3OB 3W99D 5GT0A 5AY8B 3H0MC 1P3GD 5B31B 3REID 5FUGB 2PYOC 3X1TB 5JA4A 3MNNA 1HQ3C 3A1IA 1F66C 5B24A 3X1VC 4JJNC 2YFVB 5GT3C 4WU9A 4WU8B 2YFVA 1S32B 4WU8A 3REJB 2FJ7A 5DNNC 5CPIC 5AVCB 3X1UA 1P3PA 3LELC 5F99A 3KWQA 4J8WA 4XUJC 3B6FD 5E5AC 3MVDB 1N1JA 2G5IC 5JRGD 5GXQB 4CSRA 3C1BC 3UTBA 1AOIB 3UTAA 1P3BD 2CV5B 1P3MD 3RELA 4YM6A 3AZEC 4J8XB 1BH8B 3AZHB 1BH9B 2RIQA 5B32G 5DNMC 5B2IA 2ZY5A 1BH9A 3AZFD 5B0YB 2NQBD 1ZLAA 3AZLA 5AV5D 1M19C 5B33D 4J8VB 5B40A 3X1SB 3KUYD 5BNXA 3WA9D 5B2JC 3AYWD 4KUDA 1P3AD 5BS7C 5AY8C 3VH6T 4Z2MG 3V9RB 3REHD 5B0ZC 3REKC 1M1AB 4KGCC 1ID3D 5GT0D 4X23B 3A6NB 1EQZB 3WKJB 1TAFA 2ZM5A 1M1AA 1P34B 3LZ0D 3AZIC 4X23A 5BT1D 3KXBC 2AROA 3TU4A 4YS3B 3W99B 3C1CC 3MNND 1P3GB 4YS3A 3REIB 5B24D 4WU9D 4G91C 1TZYA 2BYKB 4Z5TC 5BO0B 2FJ7D 4J8UA 3B0BA 3KSYA 3X1UD 3AV2A 1P3PD 1AOIC 5CP6D 2XD5A 3A1KA 3KWQD 3AZNA 1KX3C 3B6GC 3W97A 3UTBD 2F8NA 3UTAD 2BG1A 5B1MA 3WTPC 3F6TA 5JRGB 3B6FA 5B1LA 3RELD 5AVBD 4YM6D 3MGQA 3AN2B 5B32C 4H9NA 1P3BB 1P3MB 1P3IA 3W96C 3NQUB 4H9PA 4G92B 1P3FC 4Z66A 3O62A 5AV6C 2Y2OA 1P3KC 2PYOA 1KX4C 4ZUXC 1ZLAD 3MGSC 3AZLD 1HQ3A 3AZJC 2ZY4A 3AZFB 1M18C 5B40D 3WKJC 2NQBB 3R45A 4Z2MH 4KUDD 5AV5B 2NZDD 5B33B 5BNVB 1U35C 3KUYB 5CPIA 3WA9B 3AV1C 3AYWB 1P34C 4E45A 3LELA 1P3AB 2RVQC 2Y2LA 4E44A 3MGPC 4WNNB 5E5AA 5AV9C 3W98C 3LZ1C 3UT9C 3C1BA 3B0DC 2YFWB 3REHB 3TU4D 1ID3B 1R4VA 5GT0B 3AZKC 4R8PD 4UPKA 1ID3A 3LZ0B 3AZEA 1KX5D 1TZYD 3LZ0A 5B31G 4QLCC 5JA4B 3MNNB 5B24B 4WU9B 1P3LC 4J8UD 4WJ3C 2HIOD 3B0CW 5DNMA 5AV8C 3AV2D 2FJ7B 3AZND 3MGRC 3X1UB 1P3PB 2JSSA 3AZMC 1B6WA 5CP6B 5KDMA 3AN2C 1M19A 3W97D 5F99B 3KWQB 4J8WB 2F8ND 5CP6A 1N1JB 5B1MD 2Y2KA 4CSRB 5B1LD 3UTBB 2HUEB 3MGQD 5BS7A 1JFIA 3UTAB 4AWLB 3RELB 5AVBB 2DQNC 4YM6B 1P3ID 1KU5A 5B0ZA 4Z66D 5AVBA 3O62D 3REKA 4KGCA 3FDDA 4EO5B 4XZQC 3AFAC 3AZIA 1WWSA 3KXBA 2PYOD 4H9SC 5B2IB 4ZBJC 3VH5T 4LD9C 4UUZA 5AV5C 1HQ3D 1F66D 4NE3A 3AZGC 4JJND 3X1VD 5GT3D 2IO5C 5CPKC 1ZLAB 3AZLB 3LJAC 4Z5TA 5DNND 3EPLA 5B40B 5BNXB 5CPID 1ULYA 4KUDB 3LELD 3WAAC 2NZDB 2W8SA 5G49B 5CHLB 4XUJD 5E5AD 1KX3A 3IP4C 2NZDA 4HGAC 5G49A 1P3OC 3C1BD 1H3OA 5B31C 3WTPA 1TAFB 3X1TC 3AZED 2ZY3A 2AROB 5B32A 3TU4B 3EPHA 4R8PB 4WU8C 1S32C 3W96A 1F1EA 4R8PA 1P3FA 3REJC 1KX5B 1TZYB 5AV6A 5DNMD 1KX5A 1P3KA 5CPJA 5AVCC 5F99C 4J8WC 2UWXA 4J8UB 1KX4A 5C3IB 2JE5A 4ZUXA 3MGSA 3MVDC 3AV2B 2HIOA 2HUEC 3AZJA 1M19D 5GSUA 5GXQC 3AZNB 1M18A 3WKJA 4KHAA 2Y2NA 5B2JD 3W97B 2CV5C 2F8NB 1U35A 5B1MB 5AY8D 3AV1A 3B6FB 4H9OA 5B1LB 4WZSB 3MGPA 3MGQB 4CAYA 5B0ZD 5B2IC 5AV9A 4J8XC 4H9NB 3REKD 3AZHC 3W98A 3LZ1A 4KGCD 3UT9A 1P3IB 3P5JB 4H9PB 3AZID 3KXBD 4Z66B 3O62B 5B0YC 3C1CD 3AZKA 3NQJA 4J8VC 2PYOB 3X1SC 4QLCA 4Z5TD 1HQ3B 1F66B 1P3LA 4NE6A 3R45B 1F66A 3X1VA 4JJNA 5GT3A 5AV8A 1AOID 1T3UA 3H0LC 4DRAA 3MGRA 3B0CT 5DNNA 5CPIB 1KX3D 3B6GD 3AZMA 1M1AC 3LELB 4X23C 3A6NC 2AROC 1EQZC 5E5AB 4NFTA 3WTPD 4XUJA 4YS3C 3W99C 3C1BB 1P3GC 2BYMA 3REIC 5B32D 3AZEB 3W96D 2CWEA 1A7WA 1P3FD 5AV6D 1P3KD 3EG5B 5CPJD 3AFAA 1KX4D 4ZUXD 3MGSD 5DNMB 4LD9A 3AZJD 3KFUG 5GSUD 3AZGA 5CPKA 1M18D 3WKJD 2J8PA 3B6FC 3LJAA 5KDMB 1M19B 5JRGC 1U35D 4H9RA 3AV1D 1P34D 3WAAA 1P3BC 2RVQD 1P3MC 3MGPD 5B2JA 3VH6A 1JFIB 5AV9D 4G92C 3W98D 3LZ1D 1P3OA 3UT9D 4M6BA 5AY8A 5B0ZB 5B31A 3REKB 2L5AA 4KGCB 2ZY2A 5FUGA 3AZKD 3X1TA 3AZIB 3KXBB 3AZFC 2DF4C 3C1CB 2NQBC 4QLCD 4UUZB 1S32A 3C1CA 2FFFB 1P3LD 4G91B 3REJA 5B33C 4DQYB 5AV8D 4Z5TB 3KUYC 3WA9C 5AVCA 3AL0C 3AYWC 4DRBA 1P3AC 3MGRD 3MVDA 3AZMD 3AN2D 5GXQA 1AOIA 3H0RC 3REHC 1KX3B 3B6GB 1ID3C 5GT0C 3B6GA 1H3OB 2CV5A 3LZ0C 1BFMA 1Q9CA 1B67A 5BT1C 1Z2CB 3WTPB 3MNNC 5B24C 5B32B 4J8XA 1BH8A 3AZHA 4WU9C 2G5HC 4XZQD 3AFAD 3W96B 1P3FB 2FJ7C 5AV6B 5B0YA 2JCHA 2LY8A 4LD9D 1P3KB 5CPJB 3X1UC 1P3PC 3AZGD 5CPKD 5CP6C 4J8VA 1KX4B 4ZUXB 3KWQC 3X1SA 3MGSB 3EPKA 3LJAD 2HIOB 3AZJB 5GSUB 1M18B 4NE5A 3UTBC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KHA B;  3UTA C;  3WAA D;  4AWL C;  3REL C;  5AVB C;  4YM6 C;  1U35 B;  3V9R A;  3VH5 W;  3AV1 B;  1P3O D;  4H9O B;  2F8N G;  3A6N A;  4EO5 C;  3WTP E;  1EQZ A;  3MGP B;  4CAY B;  1P34 A;  5B31 D;  5AV9 B;  3W98 B;  3LZ1 B;  3UT9 B;  3W99 A;  3X1T D;  3B0D B;  1P3G A;  3REI A;  3AZK B;  4WU8 D;  1ZLA C;  2BYK A;  3AZL C;  1S32 D;  5BO0 A;  3REJ D;  3NQJ B;  5B40 C;  4QLC B;  3VH6 W;  5AVC D;  5F99 D;  4J8W D;  1P3L B;  4KUD C;  2NZD C;  4H9Q B;  3X1V B;  4JJN B;  5GT3 B;  3MVD D;  5AV8 B;  1WWI A;  4H9Q A;  5GXQ D;  3MGR B;  5DNN B;  3AZM B;  5JRG A;  2CV5 D;  3AN2 A;  4XUJ B;  3TU4 C;  1P3B A;  4R8P C;  1P3M A;  2F8N K;  2BYM B;  3NQU A;  5B2I D;  4J8X D;  3AZH D;  1KX5 C;  1TZY C;  5CPJ C;  4J8U C;  5B0Y D;  5C3I C;  2HIO C;  4XZQ B;  5GSU C;  3AFA B;  3AV2 C;  3VH5 A;  3AZF A;  4XZQ A;  4J8V D;  3AZN C;  2NQB A;  3X1S D;  4ZBJ B;  1HTA A;  4LD9 B;  4H9S A;  3AZG B;  5CPK B;  3W97 C;  2IO5 B;  5AV5 A;  5B33 A;  4WV4 B;  5BNV A;  3LJA B;  3KUY A;  2F8N H;  5B1M C;  3WA9 A;  3AYW A;  5B1L C;  1P3A A;  3MGQ C;  4H9R B;  4WNN A;  1M1A D;  3WAA B;  4X23 D;  3A6N D;  2ARO D;  1EQZ D;  1P3I C;  5B2J B;  2YFW A;  3REH A;  4HGA B;  4Z66 C;  3O62 C;  4YS3 D;  1P3O B;  3W99 D;  5GT0 A;  5AY8 B;  1P3G D;  5B31 B;  3REI D;  5FUG B;  2PYO C;  3X1T B;  5JA4 A;  3MNN A;  1HQ3 C;  1F66 C;  5B24 A;  3X1V C;  4JJN C;  2YFV B;  5GT3 C;  4WU9 A;  4WU8 B;  2YFV A;  1S32 B;  4WU8 A;  3REJ B;  2FJ7 A;  5DNN C;  5CPI C;  5AVC B;  3X1U A;  1P3P A;  3LEL C;  5F99 A;  3KWQ A;  4J8W A;  4XUJ C;  3B6F D;  5E5A C;  3MVD B;  1N1J A;  5JRG D;  5GXQ B;  4CSR A;  3C1B C;  3UTB A;  1AOI B;  3UTA A;  1P3B D;  2CV5 B;  1P3M D;  3REL A;  4YM6 A;  3AZE C;  4J8X B;  1BH8 B;  3AZH B;  1BH9 B;  5B32 G;  5B2I A;  5DNM C;  1BH9 A;  3AZF D;  5B0Y B;  2NQB D;  1ZLA A;  3AZL A;  5AV5 D;  1M19 C;  5B33 D;  4J8V B;  5B40 A;  3X1S B;  3KUY D;  5BNX A;  3WA9 D;  5B2J C;  3AYW D;  4KUD A;  1P3A D;  5BS7 C;  5AY8 C;  3VH6 T;  4Z2M G;  3V9R B;  3REH D;  5B0Z C;  3REK C;  1M1A B;  4KGC C;  1ID3 D;  5GT0 D;  4X23 B;  3A6N B;  1EQZ B;  3WKJ B;  1TAF A;  1M1A A;  1P34 B;  3LZ0 D;  3AZI C;  4X23 A;  5BT1 D;  3KXB C;  2ARO A;  3TU4 A;  4YS3 B;  3W99 B;  3C1C C;  3MNN D;  1P3G B;  4YS3 A;  3REI B;  5B24 D;  4WU9 D;  4G91 C;  1TZY A;  2BYK B;  4Z5T C;  5BO0 B;  2FJ7 D;  4J8U A;  3B0B A;  3KSY A;  3X1U D;  3AV2 A;  1P3P D;  1AOI C;  5CP6 D;  3KWQ D;  3AZN A;  1KX3 C;  3B6G C;  3W97 A;  3UTB D;  2F8N A;  3UTA D;  5B1M A;  3WTP C;  5JRG B;  3B6F A;  5B1L A;  3REL D;  5AVB D;  4YM6 D;  3MGQ A;  3AN2 B;  5B32 C;  4H9N A;  1P3B B;  1P3M B;  1P3I A;  3W96 C;  3NQU B;  4H9P A;  4G92 B;  1P3F C;  4Z66 A;  3O62 A;  5AV6 C;  1P3K C;  2PYO A;  1KX4 C;  4ZUX C;  1ZLA D;  3MGS C;  3AZL D;  1HQ3 A;  3AZJ C;  3AZF B;  1M18 C;  5B40 D;  3WKJ C;  2NQB B;  3R45 A;  4Z2M H;  4KUD D;  5AV5 B;  2NZD D;  5B33 B;  5BNV B;  1U35 C;  3KUY B;  5CPI A;  3WA9 B;  3AV1 C;  3AYW B;  1P34 C;  4E45 A;  3LEL A;  1P3A B;  2RVQ C;  4E44 A;  3MGP C;  4WNN B;  5E5A A;  5AV9 C;  3W98 C;  3LZ1 C;  3UT9 C;  3C1B A;  3B0D C;  2YFW B;  3REH B;  3TU4 D;  1ID3 B;  1R4V A;  5GT0 B;  3AZK C;  4R8P D;  1ID3 A;  3LZ0 B;  3AZE A;  1KX5 D;  1TZY D;  3LZ0 A;  5B31 G;  4QLC C;  5JA4 B;  3MNN B;  5B24 B;  4WU9 B;  1P3L C;  4J8U D;  2HIO D;  3B0C W;  5DNM A;  5AV8 C;  3AV2 D;  2FJ7 B;  3AZN D;  3MGR C;  3X1U B;  1P3P B;  2JSS A;  3AZM C;  1B6W A;  5CP6 B;  5KDM A;  3AN2 C;  1M19 A;  3W97 D;  5F99 B;  3KWQ B;  4J8W B;  2F8N D;  5CP6 A;  1N1J B;  5B1M D;  4CSR B;  5B1L D;  3UTB B;  2HUE B;  3MGQ D;  5BS7 A;  1JFI A;  3UTA B;  4AWL B;  3REL B;  5AVB B;  4YM6 B;  1P3I D;  1KU5 A;  5B0Z A;  4Z66 D;  5AVB A;  3O62 D;  3REK A;  4KGC A;  4EO5 B;  4XZQ C;  3AFA C;  3AZI A;  1WWS A;  3KXB A;  2PYO D;  4H9S C;  5B2I B;  4ZBJ C;  3VH5 T;  4LD9 C;  4UUZ A;  5AV5 C;  1HQ3 D;  1F66 D;  4NE3 A;  3AZG C;  4JJN D;  3X1V D;  5GT3 D;  2IO5 C;  5CPK C;  1ZLA B;  3AZL B;  3LJA C;  4Z5T A;  5DNN D;  5B40 B;  5BNX B;  5CPI D;  1ULY A;  4KUD B;  3LEL D;  3WAA C;  2NZD B;  5G49 B;  5CHL B;  4XUJ D;  5E5A D;  1KX3 A;  2NZD A;  4HGA C;  5G49 A;  1P3O C;  3C1B D;  1H3O A;  5B31 C;  3WTP A;  1TAF B;  3X1T C;  3AZE D;  2ARO B;  5B32 A;  3TU4 B;  4R8P B;  4WU8 C;  1S32 C;  3W96 A;  1F1E A;  4R8P A;  1P3F A;  3REJ C;  1KX5 B;  1TZY B;  5AV6 A;  5DNM D;  1KX5 A;  1P3K A;  5CPJ A;  5AVC C;  5F99 C;  4J8W C;  4J8U B;  1KX4 A;  5C3I B;  4ZUX A;  3MGS A;  3MVD C;  3AV2 B;  2HIO A;  2HUE C;  3AZJ A;  1M19 D;  5GSU A;  5GXQ C;  3AZN B;  1M18 A;  3WKJ A;  4KHA A;  5B2J D;  3W97 B;  2CV5 C;  2F8N B;  1U35 A;  5B1M B;  5AY8 D;  3AV1 A;  3B6F B;  4H9O A;  5B1L B;  4WZS B;  3MGP A;  3MGQ B;  4CAY A;  5B0Z D;  5B2I C;  5AV9 A;  4J8X C;  4H9N B;  3REK D;  3AZH C;  3W98 A;  3LZ1 A;  4KGC D;  3UT9 A;  1P3I B;  4H9P B;  3AZI D;  3KXB D;  4Z66 B;  3O62 B;  5B0Y C;  3C1C D;  3AZK A;  3NQJ A;  4J8V C;  2PYO B;  3X1S C;  4QLC A;  4Z5T D;  1HQ3 B;  1F66 B;  1P3L A;  4NE6 A;  3R45 B;  1F66 A;  3X1V A;  4JJN A;  5GT3 A;  5AV8 A;  1AOI D;  4DRA A;  3MGR A;  3B0C T;  5DNN A;  5CPI B;  1KX3 D;  3B6G D;  3AZM A;  1M1A C;  3LEL B;  4X23 C;  3A6N C;  2ARO C;  1EQZ C;  5E5A B;  4NFT A;  3WTP D;  4XUJ A;  4YS3 C;  3W99 C;  3C1B B;  1P3G C;  2BYM A;  3REI C;  5B32 D;  3AZE B;  3W96 D;  2CWE A;  1A7W A;  1P3F D;  5AV6 D;  1P3K D;  5CPJ D;  3AFA A;  1KX4 D;  4ZUX D;  3MGS D;  5DNM B;  4LD9 A;  3AZJ D;  5GSU D;  3AZG A;  5CPK A;  1M18 D;  3WKJ D;  3B6F C;  3LJA A;  5KDM B;  1M19 B;  5JRG C;  1U35 D;  4H9R A;  3AV1 D;  1P34 D;  3WAA A;  1P3B C;  2RVQ D;  1P3M C;  3MGP D;  5B2J A;  3VH6 A;  1JFI B;  5AV9 D;  4G92 C;  3W98 D;  3LZ1 D;  1P3O A;  3UT9 D;  4M6B A;  5AY8 A;  5B0Z B;  5B31 A;  3REK B;  2L5A A;  4KGC B;  5FUG A;  3AZK D;  3X1T A;  3AZI B;  3KXB B;  3AZF C;  3C1C B;  2NQB C;  4QLC D;  4UUZ B;  1S32 A;  3C1C A;  1P3L D;  4G91 B;  3REJ A;  5B33 C;  5AV8 D;  4Z5T B;  3KUY C;  3WA9 C;  5AVC A;  3AYW C;  4DRB A;  1P3A C;  3MGR D;  3MVD A;  3AZM D;  3AN2 D;  5GXQ A;  1AOI A;  3REH C;  1KX3 B;  3B6G B;  1ID3 C;  5GT0 C;  3B6G A;  1H3O B;  2CV5 A;  3LZ0 C;  1BFM A;  1Q9C A;  1B67 A;  5BT1 C;  3WTP B;  3MNN C;  5B24 C;  5B32 B;  4J8X A;  1BH8 A;  3AZH A;  4WU9 C;  4XZQ D;  3AFA D;  3W96 B;  1P3F B;  2FJ7 C;  5AV6 B;  5B0Y A;  2LY8 A;  4LD9 D;  1P3K B;  5CPJ B;  3X1U C;  1P3P C;  3AZG D;  5CPK D;  5CP6 C;  4J8V A;  1KX4 B;  4ZUX B;  3KWQ C;  3X1S A;  3MGS B;  3LJA D;  2HIO B;  3AZJ B;  5GSU B;  1M18 B;  4NE5 A;  3UTB C; 
#chains in the Genus database with same CATH topology
 4KHA B;  3UTA C;  3WAA D;  4AWL C;  3REL C;  5AVB C;  4YM6 C;  1U35 B;  3V9R A;  3VH5 W;  3AV1 B;  1P3O D;  4H9O B;  2F8N G;  3A6N A;  4EO5 C;  3WTP E;  1EQZ A;  3MGP B;  4CAY B;  1P34 A;  5B31 D;  5AV9 B;  3W98 B;  3LZ1 B;  3UT9 B;  3W99 A;  3X1T D;  3B0D B;  1PZR A;  1P3G A;  3REI A;  2Y2J A;  3AZK B;  4WU8 D;  1ZLA C;  2BYK A;  3AZL C;  1S32 D;  5BO0 A;  3REJ D;  3NQJ B;  5B40 C;  4QLC B;  3VH6 W;  5AVC D;  5F99 D;  4J8W D;  1P3L B;  4KUD C;  2NZD C;  4H9Q B;  3X1V B;  4JJN B;  5GT3 B;  3MVD D;  5AV8 B;  1WWI A;  4H9Q A;  5GXQ D;  2Y2G A;  2Y2P A;  3MGR B;  5DNN B;  3AZM B;  5JRG A;  2CV5 D;  3AN2 A;  4XUJ B;  3TU4 C;  2F2A C;  1P3B A;  4R8P C;  1P3M A;  2F8N K;  2BYM B;  3NQU A;  5B2I D;  4J8X D;  3AZH D;  1KX5 C;  1TZY C;  5CPJ C;  1W2E A;  4J8U C;  5B0Y D;  5C3I C;  2HIO C;  4XZQ B;  5GSU C;  3AFA B;  3AV2 C;  2XD1 A;  3VH5 A;  3AZF A;  4XZQ A;  4J8V D;  3AZN C;  2NQB A;  3X1S D;  4ZBJ B;  1HTA A;  4LD9 B;  2Y2M A;  4H9S A;  3AZG B;  5CPK B;  2Y2Q A;  2IO5 B;  5AV5 A;  5B33 A;  3W97 C;  4WV4 B;  5BNV A;  3EPJ A;  3LJA B;  3KUY A;  2F8N H;  5B1M C;  3WA9 A;  3AYW A;  5B1L C;  1P3A A;  2VQR A;  3MGQ C;  4H9R B;  4WNN A;  1M1A D;  3WAA B;  4X23 D;  3A6N D;  2ARO D;  1EQZ D;  1P3I C;  5B2J B;  2YFW A;  3REH A;  2Y2H A;  4HGA B;  4Z66 C;  2Y2I A;  4YS3 D;  3O62 C;  1P3O B;  3W99 D;  5GT0 A;  5AY8 B;  3H0M C;  1P3G D;  5B31 B;  3REI D;  5FUG B;  2PYO C;  3X1T B;  5JA4 A;  3MNN A;  1HQ3 C;  3A1I A;  1F66 C;  5B24 A;  3X1V C;  4JJN C;  2YFV B;  5GT3 C;  4WU9 A;  4WU8 B;  2YFV A;  1S32 B;  4WU8 A;  3REJ B;  2FJ7 A;  5DNN C;  5CPI C;  5AVC B;  3X1U A;  1P3P A;  3LEL C;  5F99 A;  3KWQ A;  4J8W A;  4XUJ C;  3B6F D;  5E5A C;  3MVD B;  1N1J A;  2G5I C;  5JRG D;  5GXQ B;  4CSR A;  3C1B C;  3UTB A;  1AOI B;  3UTA A;  1P3B D;  2CV5 B;  1P3M D;  3REL A;  4YM6 A;  3AZE C;  4J8X B;  1BH8 B;  3AZH B;  1BH9 B;  2RIQ A;  5B32 G;  5DNM C;  5B2I A;  2ZY5 A;  1BH9 A;  3AZF D;  5B0Y B;  2NQB D;  1ZLA A;  3AZL A;  5AV5 D;  1M19 C;  5B33 D;  4J8V B;  5B40 A;  3X1S B;  3KUY D;  5BNX A;  3WA9 D;  5B2J C;  3AYW D;  4KUD A;  1P3A D;  5BS7 C;  5AY8 C;  3VH6 T;  4Z2M G;  3V9R B;  3REH D;  5B0Z C;  3REK C;  1M1A B;  4KGC C;  1ID3 D;  5GT0 D;  4X23 B;  3A6N B;  1EQZ B;  3WKJ B;  1TAF A;  2ZM5 A;  1M1A A;  1P34 B;  3LZ0 D;  3AZI C;  4X23 A;  5BT1 D;  3KXB C;  2ARO A;  3TU4 A;  4YS3 B;  3W99 B;  3C1C C;  3MNN D;  1P3G B;  4YS3 A;  3REI B;  5B24 D;  4WU9 D;  4G91 C;  1TZY A;  2BYK B;  4Z5T C;  5BO0 B;  2FJ7 D;  4J8U A;  3B0B A;  3KSY A;  3X1U D;  3AV2 A;  1P3P D;  1AOI C;  5CP6 D;  2XD5 A;  3A1K A;  3KWQ D;  3AZN A;  1KX3 C;  3B6G C;  3W97 A;  3UTB D;  2F8N A;  3UTA D;  2BG1 A;  5B1M A;  3WTP C;  3F6T A;  5JRG B;  3B6F A;  5B1L A;  3REL D;  5AVB D;  4YM6 D;  3MGQ A;  3AN2 B;  5B32 C;  4H9N A;  1P3B B;  1P3M B;  1P3I A;  3W96 C;  3NQU B;  4H9P A;  4G92 B;  1P3F C;  4Z66 A;  3O62 A;  5AV6 C;  2Y2O A;  1P3K C;  2PYO A;  1KX4 C;  4ZUX C;  1ZLA D;  3MGS C;  3AZL D;  1HQ3 A;  3AZJ C;  2ZY4 A;  3AZF B;  1M18 C;  5B40 D;  3WKJ C;  2NQB B;  3R45 A;  4Z2M H;  4KUD D;  5AV5 B;  2NZD D;  5B33 B;  5BNV B;  1U35 C;  3KUY B;  5CPI A;  3WA9 B;  3AV1 C;  3AYW B;  1P34 C;  4E45 A;  3LEL A;  1P3A B;  2RVQ C;  2Y2L A;  4E44 A;  3MGP C;  4WNN B;  5E5A A;  5AV9 C;  3W98 C;  3LZ1 C;  3UT9 C;  3C1B A;  3B0D C;  2YFW B;  3REH B;  3TU4 D;  1ID3 B;  1R4V A;  5GT0 B;  3AZK C;  4R8P D;  4UPK A;  1ID3 A;  3LZ0 B;  3AZE A;  1KX5 D;  1TZY D;  3LZ0 A;  5B31 G;  4QLC C;  5JA4 B;  3MNN B;  5B24 B;  4WU9 B;  1P3L C;  4J8U D;  4WJ3 C;  2HIO D;  3B0C W;  5DNM A;  5AV8 C;  3AV2 D;  2FJ7 B;  3AZN D;  3MGR C;  3X1U B;  1P3P B;  2JSS A;  3AZM C;  1B6W A;  5CP6 B;  5KDM A;  3AN2 C;  1M19 A;  3W97 D;  5F99 B;  3KWQ B;  4J8W B;  2F8N D;  5CP6 A;  1N1J B;  5B1M D;  2Y2K A;  4CSR B;  5B1L D;  3UTB B;  2HUE B;  3MGQ D;  5BS7 A;  1JFI A;  3UTA B;  4AWL B;  3REL B;  5AVB B;  2DQN C;  4YM6 B;  1P3I D;  1KU5 A;  5B0Z A;  4Z66 D;  5AVB A;  3O62 D;  3REK A;  4KGC A;  3FDD A;  4EO5 B;  4XZQ C;  3AFA C;  3AZI A;  1WWS A;  3KXB A;  2PYO D;  4H9S C;  5B2I B;  4ZBJ C;  3VH5 T;  4LD9 C;  4UUZ A;  5AV5 C;  1HQ3 D;  1F66 D;  4NE3 A;  3AZG C;  4JJN D;  3X1V D;  5GT3 D;  2IO5 C;  5CPK C;  1ZLA B;  3AZL B;  3LJA C;  4Z5T A;  5DNN D;  3EPL A;  5B40 B;  5BNX B;  5CPI D;  1ULY A;  4KUD B;  3LEL D;  3WAA C;  2NZD B;  2W8S A;  5G49 B;  5CHL B;  4XUJ D;  5E5A D;  1KX3 A;  3IP4 C;  2NZD A;  4HGA C;  5G49 A;  1P3O C;  3C1B D;  1H3O A;  5B31 C;  3WTP A;  1TAF B;  3X1T C;  3AZE D;  2ZY3 A;  2ARO B;  5B32 A;  3TU4 B;  3EPH A;  4R8P B;  4WU8 C;  1S32 C;  3W96 A;  1F1E A;  4R8P A;  1P3F A;  3REJ C;  1KX5 B;  1TZY B;  5AV6 A;  5DNM D;  1KX5 A;  1P3K A;  5CPJ A;  5AVC C;  5F99 C;  4J8W C;  2UWX A;  4J8U B;  1KX4 A;  5C3I B;  2JE5 A;  4ZUX A;  3MGS A;  3MVD C;  3AV2 B;  2HIO A;  2HUE C;  3AZJ A;  1M19 D;  5GSU A;  5GXQ C;  3AZN B;  1M18 A;  3WKJ A;  4KHA A;  2Y2N A;  5B2J D;  3W97 B;  2CV5 C;  2F8N B;  1U35 A;  5B1M B;  5AY8 D;  3AV1 A;  3B6F B;  4H9O A;  5B1L B;  4WZS B;  3MGP A;  3MGQ B;  4CAY A;  5B0Z D;  5B2I C;  5AV9 A;  4J8X C;  4H9N B;  3REK D;  3AZH C;  3W98 A;  3LZ1 A;  4KGC D;  3UT9 A;  1P3I B;  3P5J B;  4H9P B;  3AZI D;  3KXB D;  4Z66 B;  3O62 B;  5B0Y C;  3C1C D;  3AZK A;  3NQJ A;  4J8V C;  2PYO B;  3X1S C;  4QLC A;  4Z5T D;  1HQ3 B;  1F66 B;  1P3L A;  4NE6 A;  3R45 B;  1F66 A;  3X1V A;  4JJN A;  5GT3 A;  5AV8 A;  1AOI D;  1T3U A;  3H0L C;  4DRA A;  3MGR A;  3B0C T;  5DNN A;  5CPI B;  1KX3 D;  3B6G D;  3AZM A;  1M1A C;  3LEL B;  4X23 C;  3A6N C;  2ARO C;  1EQZ C;  5E5A B;  4NFT A;  3WTP D;  4XUJ A;  4YS3 C;  3W99 C;  3C1B B;  1P3G C;  2BYM A;  3REI C;  5B32 D;  3AZE B;  3W96 D;  2CWE A;  1A7W A;  1P3F D;  5AV6 D;  1P3K D;  3EG5 B;  5CPJ D;  3AFA A;  1KX4 D;  4ZUX D;  3MGS D;  5DNM B;  4LD9 A;  3AZJ D;  3KFU G;  5GSU D;  3AZG A;  5CPK A;  1M18 D;  3WKJ D;  2J8P A;  3B6F C;  3LJA A;  5KDM B;  1M19 B;  5JRG C;  1U35 D;  4H9R A;  3AV1 D;  1P34 D;  3WAA A;  1P3B C;  2RVQ D;  1P3M C;  3MGP D;  5B2J A;  3VH6 A;  1JFI B;  5AV9 D;  4G92 C;  3W98 D;  3LZ1 D;  1P3O A;  3UT9 D;  4M6B A;  5AY8 A;  5B0Z B;  5B31 A;  3REK B;  2L5A A;  4KGC B;  2ZY2 A;  5FUG A;  3AZK D;  3X1T A;  3AZI B;  3KXB B;  3AZF C;  2DF4 C;  3C1C B;  2NQB C;  4QLC D;  4UUZ B;  1S32 A;  3C1C A;  2FFF B;  1P3L D;  4G91 B;  3REJ A;  5B33 C;  4DQY B;  5AV8 D;  4Z5T B;  3KUY C;  3WA9 C;  5AVC A;  3AL0 C;  3AYW C;  4DRB A;  1P3A C;  3MGR D;  3MVD A;  3AZM D;  3AN2 D;  5GXQ A;  1AOI A;  3H0R C;  3REH C;  1KX3 B;  3B6G B;  1ID3 C;  5GT0 C;  3B6G A;  1H3O B;  2CV5 A;  3LZ0 C;  1BFM A;  1Q9C A;  1B67 A;  5BT1 C;  1Z2C B;  3WTP B;  3MNN C;  5B24 C;  5B32 B;  4J8X A;  1BH8 A;  3AZH A;  4WU9 C;  2G5H C;  4XZQ D;  3AFA D;  3W96 B;  1P3F B;  2FJ7 C;  5AV6 B;  5B0Y A;  2JCH A;  2LY8 A;  4LD9 D;  1P3K B;  5CPJ B;  3X1U C;  1P3P C;  3AZG D;  5CPK D;  5CP6 C;  4J8V A;  1KX4 B;  4ZUX B;  3KWQ C;  3X1S A;  3MGS B;  3EPK A;  3LJA D;  2HIO B;  3AZJ B;  5GSU B;  1M18 B;  4NE5 A;  3UTB C; 
#chains in the Genus database with same CATH homology
 4KHA B;  3UTA C;  3WAA D;  4AWL C;  3REL C;  5AVB C;  4YM6 C;  1U35 B;  3V9R A;  3VH5 W;  3AV1 B;  1P3O D;  4H9O B;  2F8N G;  3A6N A;  4EO5 C;  3WTP E;  1EQZ A;  3MGP B;  4CAY B;  1P34 A;  5B31 D;  5AV9 B;  3W98 B;  3LZ1 B;  3UT9 B;  3W99 A;  3X1T D;  3B0D B;  1PZR A;  1P3G A;  3REI A;  2Y2J A;  3AZK B;  4WU8 D;  1ZLA C;  2BYK A;  3AZL C;  1S32 D;  5BO0 A;  3REJ D;  3NQJ B;  5B40 C;  4QLC B;  3VH6 W;  5AVC D;  5F99 D;  4J8W D;  1P3L B;  4KUD C;  2NZD C;  4H9Q B;  3X1V B;  4JJN B;  5GT3 B;  3MVD D;  5AV8 B;  1WWI A;  4H9Q A;  5GXQ D;  2Y2G A;  2Y2P A;  3MGR B;  5DNN B;  3AZM B;  5JRG A;  2CV5 D;  3AN2 A;  4XUJ B;  3TU4 C;  2F2A C;  1P3B A;  4R8P C;  1P3M A;  2F8N K;  2BYM B;  3NQU A;  5B2I D;  4J8X D;  3AZH D;  1KX5 C;  1TZY C;  5CPJ C;  1W2E A;  4J8U C;  5B0Y D;  5C3I C;  2HIO C;  4XZQ B;  5GSU C;  3AFA B;  3AV2 C;  2XD1 A;  3VH5 A;  3AZF A;  4XZQ A;  4J8V D;  3AZN C;  2NQB A;  3X1S D;  4ZBJ B;  1HTA A;  4LD9 B;  2Y2M A;  4H9S A;  3AZG B;  5CPK B;  2Y2Q A;  2IO5 B;  5AV5 A;  5B33 A;  3W97 C;  4WV4 B;  5BNV A;  3EPJ A;  3LJA B;  3KUY A;  2F8N H;  5B1M C;  3WA9 A;  3AYW A;  5B1L C;  1P3A A;  2VQR A;  3MGQ C;  4H9R B;  4WNN A;  1M1A D;  3WAA B;  4X23 D;  3A6N D;  2ARO D;  1EQZ D;  1P3I C;  5B2J B;  2YFW A;  3REH A;  2Y2H A;  4HGA B;  4Z66 C;  2Y2I A;  4YS3 D;  3O62 C;  1P3O B;  3W99 D;  5GT0 A;  5AY8 B;  3H0M C;  1P3G D;  5B31 B;  3REI D;  5FUG B;  2PYO C;  3X1T B;  5JA4 A;  3MNN A;  1HQ3 C;  3A1I A;  1F66 C;  5B24 A;  3X1V C;  4JJN C;  2YFV B;  5GT3 C;  4WU9 A;  4WU8 B;  2YFV A;  1S32 B;  4WU8 A;  3REJ B;  2FJ7 A;  5DNN C;  5CPI C;  5AVC B;  3X1U A;  1P3P A;  3LEL C;  5F99 A;  3KWQ A;  4J8W A;  4XUJ C;  3B6F D;  5E5A C;  3MVD B;  1N1J A;  2G5I C;  5JRG D;  5GXQ B;  4CSR A;  3C1B C;  3UTB A;  1AOI B;  3UTA A;  1P3B D;  2CV5 B;  1P3M D;  3REL A;  4YM6 A;  3AZE C;  4J8X B;  1BH8 B;  3AZH B;  1BH9 B;  2RIQ A;  5B32 G;  5DNM C;  5B2I A;  2ZY5 A;  1BH9 A;  3AZF D;  5B0Y B;  2NQB D;  1ZLA A;  3AZL A;  5AV5 D;  1M19 C;  5B33 D;  4J8V B;  5B40 A;  3X1S B;  3KUY D;  5BNX A;  3WA9 D;  5B2J C;  3AYW D;  4KUD A;  1P3A D;  5BS7 C;  5AY8 C;  3VH6 T;  4Z2M G;  3V9R B;  3REH D;  5B0Z C;  3REK C;  1M1A B;  4KGC C;  1ID3 D;  5GT0 D;  4X23 B;  3A6N B;  1EQZ B;  3WKJ B;  1TAF A;  2ZM5 A;  1M1A A;  1P34 B;  3LZ0 D;  3AZI C;  4X23 A;  5BT1 D;  3KXB C;  2ARO A;  3TU4 A;  4YS3 B;  3W99 B;  3C1C C;  3MNN D;  1P3G B;  4YS3 A;  3REI B;  5B24 D;  4WU9 D;  4G91 C;  1TZY A;  2BYK B;  4Z5T C;  5BO0 B;  2FJ7 D;  4J8U A;  3B0B A;  3KSY A;  3X1U D;  3AV2 A;  1P3P D;  1AOI C;  5CP6 D;  2XD5 A;  3A1K A;  3KWQ D;  3AZN A;  1KX3 C;  3B6G C;  3W97 A;  3UTB D;  2F8N A;  3UTA D;  2BG1 A;  5B1M A;  3WTP C;  3F6T A;  5JRG B;  3B6F A;  5B1L A;  3REL D;  5AVB D;  4YM6 D;  3MGQ A;  3AN2 B;  5B32 C;  4H9N A;  1P3B B;  1P3M B;  1P3I A;  3W96 C;  3NQU B;  4H9P A;  4G92 B;  1P3F C;  4Z66 A;  3O62 A;  5AV6 C;  2Y2O A;  1P3K C;  2PYO A;  1KX4 C;  4ZUX C;  1ZLA D;  3MGS C;  3AZL D;  1HQ3 A;  3AZJ C;  2ZY4 A;  3AZF B;  1M18 C;  5B40 D;  3WKJ C;  2NQB B;  3R45 A;  4Z2M H;  4KUD D;  5AV5 B;  2NZD D;  5B33 B;  5BNV B;  1U35 C;  3KUY B;  5CPI A;  3WA9 B;  3AV1 C;  3AYW B;  1P34 C;  4E45 A;  3LEL A;  1P3A B;  2RVQ C;  2Y2L A;  4E44 A;  3MGP C;  4WNN B;  5E5A A;  5AV9 C;  3W98 C;  3LZ1 C;  3UT9 C;  3C1B A;  3B0D C;  2YFW B;  3REH B;  3TU4 D;  1ID3 B;  1R4V A;  5GT0 B;  3AZK C;  4R8P D;  4UPK A;  1ID3 A;  3LZ0 B;  3AZE A;  1KX5 D;  1TZY D;  3LZ0 A;  5B31 G;  4QLC C;  5JA4 B;  3MNN B;  5B24 B;  4WU9 B;  1P3L C;  4J8U D;  4WJ3 C;  2HIO D;  3B0C W;  5DNM A;  5AV8 C;  3AV2 D;  2FJ7 B;  3AZN D;  3MGR C;  3X1U B;  1P3P B;  2JSS A;  3AZM C;  1B6W A;  5CP6 B;  5KDM A;  3AN2 C;  1M19 A;  3W97 D;  5F99 B;  3KWQ B;  4J8W B;  2F8N D;  5CP6 A;  1N1J B;  5B1M D;  2Y2K A;  4CSR B;  5B1L D;  3UTB B;  2HUE B;  3MGQ D;  5BS7 A;  1JFI A;  3UTA B;  4AWL B;  3REL B;  5AVB B;  2DQN C;  4YM6 B;  1P3I D;  1KU5 A;  5B0Z A;  4Z66 D;  5AVB A;  3O62 D;  3REK A;  4KGC A;  3FDD A;  4EO5 B;  4XZQ C;  3AFA C;  3AZI A;  1WWS A;  3KXB A;  2PYO D;  4H9S C;  5B2I B;  4ZBJ C;  3VH5 T;  4LD9 C;  4UUZ A;  5AV5 C;  1HQ3 D;  1F66 D;  4NE3 A;  3AZG C;  4JJN D;  3X1V D;  5GT3 D;  2IO5 C;  5CPK C;  1ZLA B;  3AZL B;  3LJA C;  4Z5T A;  5DNN D;  3EPL A;  5B40 B;  5BNX B;  5CPI D;  1ULY A;  4KUD B;  3LEL D;  3WAA C;  2NZD B;  2W8S A;  5G49 B;  5CHL B;  4XUJ D;  5E5A D;  1KX3 A;  3IP4 C;  2NZD A;  4HGA C;  5G49 A;  1P3O C;  3C1B D;  1H3O A;  5B31 C;  3WTP A;  1TAF B;  3X1T C;  3AZE D;  2ZY3 A;  2ARO B;  5B32 A;  3TU4 B;  3EPH A;  4R8P B;  4WU8 C;  1S32 C;  3W96 A;  1F1E A;  4R8P A;  1P3F A;  3REJ C;  1KX5 B;  1TZY B;  5AV6 A;  5DNM D;  1KX5 A;  1P3K A;  5CPJ A;  5AVC C;  5F99 C;  4J8W C;  2UWX A;  4J8U B;  1KX4 A;  5C3I B;  2JE5 A;  4ZUX A;  3MGS A;  3MVD C;  3AV2 B;  2HIO A;  2HUE C;  3AZJ A;  1M19 D;  5GSU A;  5GXQ C;  3AZN B;  1M18 A;  3WKJ A;  4KHA A;  2Y2N A;  5B2J D;  3W97 B;  2CV5 C;  2F8N B;  1U35 A;  5B1M B;  5AY8 D;  3AV1 A;  3B6F B;  4H9O A;  5B1L B;  4WZS B;  3MGP A;  3MGQ B;  4CAY A;  5B0Z D;  5B2I C;  5AV9 A;  4J8X C;  4H9N B;  3REK D;  3AZH C;  3W98 A;  3LZ1 A;  4KGC D;  3UT9 A;  1P3I B;  3P5J B;  4H9P B;  3AZI D;  3KXB D;  4Z66 B;  3O62 B;  5B0Y C;  3C1C D;  3AZK A;  3NQJ A;  4J8V C;  2PYO B;  3X1S C;  4QLC A;  4Z5T D;  1HQ3 B;  1F66 B;  1P3L A;  4NE6 A;  3R45 B;  1F66 A;  3X1V A;  4JJN A;  5GT3 A;  5AV8 A;  1AOI D;  1T3U A;  3H0L C;  4DRA A;  3MGR A;  3B0C T;  5DNN A;  5CPI B;  1KX3 D;  3B6G D;  3AZM A;  1M1A C;  3LEL B;  4X23 C;  3A6N C;  2ARO C;  1EQZ C;  5E5A B;  4NFT A;  3WTP D;  4XUJ A;  4YS3 C;  3W99 C;  3C1B B;  1P3G C;  2BYM A;  3REI C;  5B32 D;  3AZE B;  3W96 D;  2CWE A;  1A7W A;  1P3F D;  5AV6 D;  1P3K D;  3EG5 B;  5CPJ D;  3AFA A;  1KX4 D;  4ZUX D;  3MGS D;  5DNM B;  4LD9 A;  3AZJ D;  3KFU G;  5GSU D;  3AZG A;  5CPK A;  1M18 D;  3WKJ D;  2J8P A;  3B6F C;  3LJA A;  5KDM B;  1M19 B;  5JRG C;  1U35 D;  4H9R A;  3AV1 D;  1P34 D;  3WAA A;  1P3B C;  2RVQ D;  1P3M C;  3MGP D;  5B2J A;  3VH6 A;  1JFI B;  5AV9 D;  4G92 C;  3W98 D;  3LZ1 D;  1P3O A;  3UT9 D;  4M6B A;  5AY8 A;  5B0Z B;  5B31 A;  3REK B;  2L5A A;  4KGC B;  2ZY2 A;  5FUG A;  3AZK D;  3X1T A;  3AZI B;  3KXB B;  3AZF C;  2DF4 C;  3C1C B;  2NQB C;  4QLC D;  4UUZ B;  1S32 A;  3C1C A;  2FFF B;  1P3L D;  4G91 B;  3REJ A;  5B33 C;  4DQY B;  5AV8 D;  4Z5T B;  3KUY C;  3WA9 C;  5AVC A;  3AL0 C;  3AYW C;  4DRB A;  1P3A C;  3MGR D;  3MVD A;  3AZM D;  3AN2 D;  5GXQ A;  1AOI A;  3H0R C;  3REH C;  1KX3 B;  3B6G B;  1ID3 C;  5GT0 C;  3B6G A;  1H3O B;  2CV5 A;  3LZ0 C;  1BFM A;  1Q9C A;  1B67 A;  5BT1 C;  1Z2C B;  3WTP B;  3MNN C;  5B24 C;  5B32 B;  4J8X A;  1BH8 A;  3AZH A;  4WU9 C;  2G5H C;  4XZQ D;  3AFA D;  3W96 B;  1P3F B;  2FJ7 C;  5AV6 B;  5B0Y A;  2JCH A;  2LY8 A;  4LD9 D;  1P3K B;  5CPJ B;  3X1U C;  1P3P C;  3AZG D;  5CPK D;  5CP6 C;  4J8V A;  1KX4 B;  4ZUX B;  3KWQ C;  3X1S A;  3MGS B;  3EPK A;  3LJA D;  2HIO B;  3AZJ B;  5GSU B;  1M18 B;  4NE5 A;  3UTB C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...