3AFAC

The human nucleosome structure
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
108
structure length
108
Chain Sequence
RAKAKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords Histone H3.1
publication title Structural basis of instability of the nucleosome containing a testis-specific histone variant, human H3T
pubmed doi rcsb
source organism Homo sapiens
total genus 31
structure length 108
sequence length 108
chains with identical sequence G
ec nomenclature
pdb deposition date 2010-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3afaC00
3AV2D 3LZ0C 3WTPA 3MNND 1TZYD 4EO5B 3NQUA 4J8VB 1P34D 5CPKC 4WU8C 5AV6B 5AV5B 2CV5D 4XUJA 3X1VB 1P3KC 3B6FC 3UTAC 4KHAA 2F8NK 3X1UC 5B0ZB 3LELD 4KUDD 1M18C 3TU4C 5B32D 3AZNA 2F8NG 3KXBB 5B2IC 3AFAB 5AV5A 3W96B 3X1VA 3UTBD 4R8PD 1KX4C 1P3AB 1U35C 1P3PC 4Z5TC 5E5AC 3RELC 4ZUXB 1P3OD 5AVBB 1S32B 1BH9B 4E44A 3MGSA 1F66A 3REJB 2HIOC 3AZEC 3W97D 3MGQD 3B6GD 3REKD 1ULYA 5GT0B 1P34C 1P3AA 5GSUB 3WAAA 2FJ7A 1TAFB 2CV5C 5GXQB 5DNMA 3WTPD 3REJA 3C1BD 3LELC 2F8NB 4XUJD 5AVCB 3C1CB 5GSUA 3MGRA 1TAFA 3UTBC 4R8PC 3X1TB 3AZND 4Z66B 5B1LA 1BH8A 3LZ1A 1ID3B 3LZ0B 5AV5D 3REIC 3X1VD 5AVCA 3W97C 2PYOA 5CPKB 3AZJB 3B6GC 3R45B 2NZDA 3UTAB 3MGSD 1F66D 3X1UB 1HTAA 1HQ3C 3VH5T 1M18B 4ZBJC 3WTPC 3C1BC 1P3AD 5B0YA 3WAAD 4WU8A 4YS3C 2FJ7D 1P3MB 5CP6A 3R45A 5DNMD 1KX4B 1P3KA 3B6FA 4Z5TB 5E5AB 3REJD 3RELB 1M18A 3TU4A 4J8XC 3AZEB 3AZNC 3AZLA 3AV2B 3W99A 4DRBA 5GSUD 3MGRD 5B2IA 1P34B 1U35A 5B1LD 5AV9A 4JJNC 1P3PA 2CV5B 3AZMA 3LZ1D 3MGSC 1F66C 3X1SC 3WA9C 3AZEA 2HIOA 5B1MA 5AVCD 2PYOD 3LELB 2YFWB 4KUDB 3KWQA 3V9RB 1ZLAA 2CWEA 2NZDD 3WAAC 5JRGA 1EQZA 2FJ7C 5DNMC 4R8PB 3VH5A 5F99C 1B6WA 3UTBB 1N1JB 5B0YD 2YFWA 4WU8D 5CP6D 3REIB 4LD9C 3W97B 1P3KD 4Z2MG 3B6FD 3MGQB 4NE5A 3B6GB 3MGRC 3REKB 1M18D 4G91C 3TU4D 3AZLD 1HQ3B 3W99D 3LZ1C 5B2ID 3WTPB 3REIA 3C1BB 1U35D 5AV9D 1P3PD 4H9PA 3B6GA 3AZMD 2NZDC 4KHAB 4XZQA 3AZED 2HIOD 5B1MD 1HQ3A 3KWQD 1ZLAD 5GT3A 4J8XB 3AZNB 3MVDA 3AZHA 1P3GA 3C1BA 5B0YC 5JRGD 1EQZD 4YS3A 5CP6C 5FUGA 4JJNB 4M6BA 3MGSB 1F66B 2NQBA 3WA9B 4J8XA 3AYWA 3AZLC 4NE3A 1KX3A 3W99C 3AZFC 1F1EA 3WAAB 5AV9C 4JJNA 2FJ7B 3AZMC 4H9NA 1KX5A 5DNMB 3WA9A 3X1SA 3REID 5B1MC 5DNNA 3KWQC 4AWLC 1ZLAC 5B40C 3B0DB 4XZQD 4G92C 1JFIB 3MGRB 4J8WA 5JRGC 1HQ3D 1EQZC 5GT3D 3WTPE 3AN2C 5F99A 5B1LB 3MVDD 1BH8B 3AZHD 5CPJA 1P3GD 3LZ1B 1H3OA 4UUZA 4YS3D 1R4VA 4LD9A 2PYOB 3REHA 5JA4B 1JFIA 1AOIA 4WV4B 4H9OB 1WWSA 2NZDB 2NQBD 4J8XD 3AYWD 1KX3D 5BO0B 3O62C 4NE6A 5B0YB 4H9RA 5JA4A 4WU8B 4JJND 2IO5C 5CP6B 4HGAC 2AROC 4H9OA 5KDMA 1KX5D 1P3KB 4QLCC 3B6FB 4XZQC 3WA9D 3X1SD 5DNND 4H9QA 5BO0A 1P3FA 4WU9C 5GT3C 3TU4B 3AZLB 4J8UA 3MVDC 3AZHC 1P3GC 2L5AA 3W99B 4J8WD 5B2IB 5F99D 1U35B 5AV9B 1P3PB 5CPJD 3AZMB 2RVQC 3A6NA 2NQBC 2HIOB 5B1MB 3AYWC 1KX3C 4LD9D 3LJAC 3REHD 3KWQB 2BYKA 1AOID 2BYMA 1ZLAB 3AZFA 3KUYC 4G92B 3WKJA 1M19A 5JRGB 1EQZB 1KX5C 2JSSA 5B33C 3VH5W 5DNNC 3VH6T 5B40A 4CSRB 4J8WC 5BNXA 1P3FD 5B24A 3AN2A 4J8UD 4J8VC 5CPJC 3O62B 4YM6C 3MGPD 3REHC 5AY8A 4H9PB 1AOIC 2IO5B 4CSRA 4HGAB 2AROB 1BFMA 3AZKA 3A6ND 4QLCB 4XZQB 4KGCC 3KXBC 4WU9B 3O62A 5GT3B 3W96C 4ZBJB 3AZFD 3VH6W 3MVDB 3AZHB 1P3GB 1KU5A 3WKJD 1M19D 4YS3B 5B31A 2AROA 5FUGB 4QLCA 3UT9A 3AV1A 1P3FC 5G49A 4WU9A 2NQBB 5B40D 3VH6A 3AYWB 4J8UC 1KX3B 1P3IA 1P3BA 3W98A 5B24D 3MGPC 3KUYB 3AN2D 5BS7A 4H9SA 3KSYA 4H9NB 1KX5B 3A6NC 2YFVA 3X1SB 5DNNB 3LJAA 5AY8D 3AZKD 3KUYA 4Z66C 1P3LC 4CAYA 1M19C 3WKJC 4J8WB 5CHLB 1ID3C 3O62D 3B0CT 4NFTA 5B33A 5F99B 5B2JA 1M1AA 5CPJB 1Q9CA 3AZJC 1H3OB 4UUZB 4YM6B 5B31D 2AROD 5CPIA 4LD9B 3REHB 4QLCD 4WNNB 3UT9D 1AOIB 3AV1D 5B24C 4WU9D 4G91B 5AV8C 4KGCB 1P3ID 4J8VA 3AZGC 1P3BD 3W98D 5AV6A 1P3MC 4YM6A 4X23C 1WWIA 5AY8C 4H9RB 4WNNA 5B0ZA 3AZIC 5KDMB 2RVQD 3AZKC 4E45A 4H9QB 3B0CW 3AV2C 3LJAD 4KGCA 1P3FB 3KXBA 3AFAA 3MNNC 3W96A 1TZYC 4J8UB 3KUYD 2F8NH 4ZUXA 5AVBA 3MGPB 1S32A 5B31C 1BH9A 5B33D 5B2JD 1M1AD 3UT9C 4KUDC 3AV1C 3A6NB 5B32C 5GT0A 5CPID 4WZSB 1P3IC 2BYKB 1P3BC 2BYMB 3W98C 5GXQA 3MGPA 3AZFB 1P3LB 5BS7C 1M19B 3WKJB 3NQJB 4H9SC 4J8VD 1P3OC 5AV6D 2F8NA 4YM6D 3C1CA 2HUEC 3MGQC 5B0ZD 4AWLB 3REKC 5B40B 3X1TA 4Z66A 1P3LA 5B31G 4DRAA 3NQJA 5BNXB 4KGCD 3KXBD 5B24B 1ID3A 3LZ0A 5BNVB 3AFAD 3AN2B 3W96D 5AV8B 5B2JC 5B32G 1M1AC 3AZGB 5CPKA 3AZJA 4ZUXD 4XUJC 5AVBD 1S32D 4X23B 5CPIC 5C3IC 3UTAA 3X1UA 5AY8B 3AZIB 3AZKB 5BNVA 5GT0D 5AV8A 4EO5C 3AZGA 5AV6C 5AV5C 1P3MA 3MNNB 5GXQD 1TZYB 3X1VC 1KX4A 1A7WA 4X23A 4Z5TA 5E5AA 3RELA 5B0ZC 3AZIA 5B31B 5BT1D 2F8ND 3C1CD 3UT9B 3B0BA 3AV2A 3AV1B 1B67A 5G49B 5B32B 3AFAC 3MNNA 1TZYA 3X1TD 1P3AC 1P34A 4Z66D 1P3IB 1P3LD 1P3BB 3W98B 2CV5A 4ZUXC 5AVBC 1S32C 1ID3D 3LZ0D 3REJC 3LELA 1P3OB 5CPKD 4KUDA 3AZJD 3V9RA 5B32A 2YFVB 2LY8A 3B0DC 2HUEB 5GT0C 3UTAD 3X1UD 3LJAB 5GSUC 5GXQC 3UTBA 4R8PA 5B1LC 1N1JA 4CAYB 5AV8D 3AZGD 1P3OA 5BT1C 1P3MD 5B33B 5AVCC 5B2JB 3W97A 3C1CC 3NQUB 4X23D 1M1AB 1KX4D 2PYOC 3MGQA 4Z5TD 5E5AD 3RELD 4XUJB 3REKA 3AZID 5C3IB 5CPIB 3X1TC 4Z2MH
chains in the Genus database with same CATH superfamily
3AV2D 3LZ0C 3WTPA 3MNND 1TZYD 4EO5B 3NQUA 2Y2IA 4J8VB 5CPKC 4WU8C 1P34D 5AV6B 5AV5B 2CV5D 4XUJA 3X1VB 1P3KC 3B6FC 3UTAC 4KHAA 2F8NK 3X1UC 5B0ZB 3LELD 2PYOC 4KUDD 1M18C 3F6TA 2Y2OA 3TU4C 5B32D 3AZNA 2F8NG 3KXBB 5B2IC 3AFAB 5AV5A 3W96B 3X1VA 3UTBD 4R8PD 1KX4C 1P3AB 1U35C 1P3PC 4Z5TC 5E5AC 3RELC 4ZUXB 1P3OD 5AVBB 1S32B 1BH9B 4E44A 3MGSA 1F66A 3REJB 2HIOC 3AZEC 3W97D 3MGQD 2Y2KA 3B6GD 3REKD 1ULYA 5GT0B 1P34C 1P3AA 5GSUB 3WAAA 2FJ7A 1TAFB 2CV5C 5GXQB 3FDDA 5DNMA 2Y2PA 3WTPD 2ZY4A 3REJA 3C1BD 3LELC 2F8NB 4XUJD 5AVCB 3C1CB 2ZM5A 5GSUA 3MGRA 1TAFA 3UTBC 4R8PC 3X1TB 3AZND 4Z66B 5B1LA 1BH8A 3LZ1A 1ID3B 3LZ0B 5AV5D 3REIC 3X1VD 5AVCA 3W97C 2PYOA 5CPKB 3AZJB 3B6GC 3R45B 2NZDA 3UTAB 3MGSD 1F66D 3X1UB 1HTAA 1HQ3C 3VH5T 4DQYB 1M18B 4ZBJC 3WTPC 3C1BC 1P3AD 5B0YA 3WAAD 4WU8A 4YS3C 2FJ7D 1P3MB 5CP6A 3R45A 5DNMD 1KX4B 1P3KA 3B6FA 4Z5TB 5E5AB 3REJD 3RELB 1M18A 3TU4A 4J8XC 3AZEB 3AZNC 3AZLA 3AV2B 3W99A 3IP4C 4DRBA 5GSUD 5B2IA 3MGRD 2Y2NA 1P34B 1U35A 5B1LD 5AV9A 4JJNC 1P3PA 2CV5B 3AZMA 3LZ1D 3MGSC 1F66C 3X1SC 3WA9C 3AZEA 2HIOA 5B1MA 5AVCD 2PYOD 3LELB 2YFWB 4KUDB 3KWQA 3V9RB 1ZLAA 2CWEA 2NZDD 2VQRA 3WAAC 5JRGA 1EQZA 2FJ7C 1Z2CB 5DNMC 4R8PB 3VH5A 1B6WA 5F99C 3UTBB 1N1JB 5B0YD 2YFWA 4WU8D 5CP6D 3REIB 4LD9C 3W97B 1P3KD 4Z2MG 3B6FD 3MGQB 4NE5A 3B6GB 3MGRC 3REKB 1M18D 4G91C 3TU4D 3AZLD 1HQ3B 3W99D 3LZ1C 3A1IA 5B2ID 3WTPB 3REIA 3C1BB 3P5JB 1U35D 5AV9D 1P3PD 2UWXA 4H9PA 3B6GA 3AZMD 2DQNC 2NZDC 3A1KA 4KHAB 4XZQA 3AZED 2HIOD 5B1MD 1HQ3A 3KWQD 1ZLAD 2J8PA 5GT3A 4J8XB 3AZNB 3MVDA 3AZHA 1P3GA 3C1BA 5B0YC 5JRGD 1EQZD 4YS3A 5CP6C 5FUGA 4JJNB 4M6BA 3AL0C 3MGSB 1F66B 2NQBA 3WA9B 4J8XA 3AYWA 3AZLC 4NE3A 1KX3A 3W99C 3AZFC 1F1EA 3EPLA 3WAAB 5AV9C 4JJNA 2FJ7B 3AZMC 4H9NA 1KX5A 5DNMB 3WA9A 3X1SA 3REID 5B1MC 5DNNA 3KWQC 4AWLC 2Y2QA 1ZLAC 5B40C 3B0DB 4XZQD 4G92C 1JFIB 3MGRB 4J8WA 5JRGC 1HQ3D 1EQZC 5GT3D 3WTPE 3AN2C 5F99A 5B1LB 3MVDD 1BH8B 3AZHD 5CPJA 1P3GD 3LZ1B 1H3OA 4UUZA 4YS3D 1R4VA 4LD9A 2PYOB 3REHA 5JA4B 1JFIA 1AOIA 4WV4B 4H9OB 1WWSA 2NZDB 2NQBD 4J8XD 3AYWD 1KX3D 5BO0B 3O62C 2F2AC 4NE6A 5B0YB 4H9RA 5JA4A 4WU8B 4JJND 2IO5C 5CP6B 4HGAC 2AROC 4H9OA 5KDMA 1KX5D 1P3KB 4QLCC 3B6FB 4XZQC 3WA9D 3X1SD 5DNND 4H9QA 5BO0A 1P3FA 4WU9C 2BG1A 5GT3C 3TU4B 3AZLB 4J8UA 3MVDC 3AZHC 1P3GC 2L5AA 3W99B 4J8WD 5B2IB 5F99D 1U35B 3EG5B 5AV9B 1P3PB 5CPJD 3AZMB 2RVQC 3A6NA 2NQBC 2HIOB 5B1MB 3AYWC 1KX3C 4LD9D 3LJAC 3REHD 3KWQB 2BYKA 1AOID 2BYMA 1ZLAB 3AZFA 3KUYC 4G92B 3WKJA 1M19A 5JRGB 1EQZB 1KX5C 2JSSA 5B33C 3VH5W 5DNNC 3VH6T 5B40A 4CSRB 4J8WC 5BNXA 1P3FD 5B24A 3AN2A 4J8UD 3EPKA 2Y2MA 4J8VC 5CPJC 3O62B 4YM6C 3MGPD 3REHC 5AY8A 4H9PB 1AOIC 2IO5B 4CSRA 4HGAB 2AROB 1BFMA 3AZKA 3A6ND 4QLCB 4XZQB 4KGCC 3KXBC 4WU9B 3O62A 5GT3B 3W96C 4ZBJB 3AZFD 3VH6W 3MVDB 3AZHB 1P3GB 1KU5A 3WKJD 1M19D 4YS3B 5B31A 2AROA 5FUGB 4QLCA 3UT9A 3AV1A 1P3FC 5G49A 4WU9A 2NQBB 5B40D 3VH6A 3AYWB 4J8UC 1KX3B 1P3IA 2W8SA 1P3BA 3W98A 5B24D 3MGPC 3KUYB 3AN2D 4WJ3C 5BS7A 4H9SA 3KSYA 2G5IC 4H9NB 1KX5B 3A6NC 2XD1A 2ZY3A 2YFVA 3X1SB 5DNNB 3LJAA 5AY8D 3AZKD 3KUYA 4Z66C 1P3LC 4CAYA 1M19C 3WKJC 4J8WB 5CHLB 1ID3C 3O62D 3B0CT 4NFTA 4UPKA 5B33A 5F99B 5B2JA 1M1AA 5CPJB 1Q9CA 3AZJC 1H3OB 4UUZB 4YM6B 5B31D 2AROD 5CPIA 4LD9B 3REHB 4QLCD 4WNNB 3UT9D 1AOIB 1W2EA 3AV1D 5B24C 4WU9D 4G91B 5AV8C 4KGCB 1P3ID 4J8VA 3AZGC 1P3BD 3W98D 5AV6A 1P3MC 4YM6A 4X23C 1WWIA 5AY8C 4H9RB 4WNNA 5B0ZA 3AZIC 5KDMB 2RVQD 3AZKC 4E45A 4H9QB 3B0CW 3AV2C 3LJAD 4KGCA 1P3FB 3KXBA 3AFAA 3MNNC 3W96A 1TZYC 4J8UB 3KUYD 2F8NH 4ZUXA 5AVBA 3MGPB 1S32A 5B31C 1BH9A 5B33D 5B2JD 1M1AD 3UT9C 4KUDC 3AV1C 3A6NB 5B32C 5GT0A 5CPID 4WZSB 1P3IC 3EPHA 1PZRA 2BYKB 1P3BC 2BYMB 3W98C 5GXQA 3MGPA 3AZFB 1P3LB 5BS7C 1M19B 3WKJB 3NQJB 4H9SC 4J8VD 1P3OC 3H0MC 5AV6D 2F8NA 4YM6D 3C1CA 2Y2GA 2HUEC 3MGQC 2Y2HA 2G5HC 2FFFB 5B0ZD 4AWLB 3REKC 5B40B 3X1TA 4Z66A 1P3LA 5B31G 3KFUG 4DRAA 3NQJA 5BNXB 4KGCD 3KXBD 5B24B 1ID3A 3LZ0A 5BNVB 3AFAD 3AN2B 2JCHA 5AV8B 3W96D 5B2JC 5B32G 1M1AC 3AZGB 5CPKA 3H0RC 3AZJA 4ZUXD 4XUJC 2JE5A 5AVBD 1S32D 4X23B 5CPIC 5C3IC 3UTAA 3X1UA 5AY8B 3AZIB 3AZKB 3EPJA 5BNVA 5GT0D 5AV8A 4EO5C 3AZGA 5AV6C 5AV5C 1P3MA 3MNNB 5GXQD 1TZYB 3X1VC 1KX4A 1A7WA 4X23A 4Z5TA 5E5AA 3RELA 5B0ZC 3AZIA 5B31B 5BT1D 2F8ND 3C1CD 3UT9B 3B0BA 3AV2A 3AV1B 2Y2JA 1B67A 2ZY5A 5G49B 5B32B 3AFAC 3MNNA 1TZYA 3X1TD 1P3AC 1P34A 4Z66D 1P3IB 1P3LD 1P3BB 3W98B 2CV5A 4ZUXC 5AVBC 1S32C 1ID3D 3LZ0D 2RIQA 2XD5A 3REJC 3LELA 1P3OB 5CPKD 4KUDA 3AZJD 3V9RA 3H0LC 5B32A 2YFVB 2LY8A 3B0DC 2HUEB 5GT0C 3UTAD 3X1UD 3LJAB 5GSUC 2Y2LA 5GXQC 3UTBA 4R8PA 5B1LC 1N1JA 4CAYB 5AV8D 3AZGD 1P3OA 5BT1C 1P3MD 5B33B 2ZY2A 5AVCC 5B2JB 3W97A 3C1CC 3NQUB 4X23D 1M1AB 1KX4D 1T3UA 3MGQA 4Z5TD 5E5AD 3RELD 4XUJB 3REKA 3AZID 5C3IB 5CPIB 2DF4C 3X1TC 4Z2MH
chains in the Genus database with same CATH topology
3AV2D 3LZ0C 3WTPA 3MNND 1TZYD 4EO5B 3NQUA 2Y2IA 4J8VB 5CPKC 4WU8C 1P34D 5AV6B 5AV5B 2CV5D 4XUJA 3X1VB 1P3KC 3B6FC 3UTAC 4KHAA 2F8NK 3X1UC 5B0ZB 3LELD 2PYOC 4KUDD 1M18C 3F6TA 2Y2OA 3TU4C 5B32D 3AZNA 2F8NG 3KXBB 5B2IC 3AFAB 5AV5A 3W96B 3X1VA 3UTBD 4R8PD 1KX4C 1P3AB 1U35C 1P3PC 4Z5TC 5E5AC 3RELC 4ZUXB 1P3OD 5AVBB 1S32B 1BH9B 4E44A 3MGSA 1F66A 3REJB 2HIOC 3AZEC 3W97D 3MGQD 2Y2KA 3B6GD 3REKD 1ULYA 5GT0B 1P34C 1P3AA 5GSUB 3WAAA 2FJ7A 1TAFB 2CV5C 5GXQB 3FDDA 5DNMA 2Y2PA 3WTPD 2ZY4A 3REJA 3C1BD 3LELC 2F8NB 4XUJD 5AVCB 3C1CB 2ZM5A 5GSUA 3MGRA 1TAFA 3UTBC 4R8PC 3X1TB 3AZND 4Z66B 5B1LA 1BH8A 3LZ1A 1ID3B 3LZ0B 5AV5D 3REIC 3X1VD 5AVCA 3W97C 2PYOA 5CPKB 3AZJB 3B6GC 3R45B 2NZDA 3UTAB 3MGSD 1F66D 3X1UB 1HTAA 1HQ3C 3VH5T 4DQYB 1M18B 4ZBJC 3WTPC 3C1BC 1P3AD 5B0YA 3WAAD 4WU8A 4YS3C 2FJ7D 1P3MB 5CP6A 3R45A 5DNMD 1KX4B 1P3KA 3B6FA 4Z5TB 5E5AB 3REJD 3RELB 1M18A 3TU4A 4J8XC 3AZEB 3AZNC 3AZLA 3AV2B 3W99A 3IP4C 4DRBA 5GSUD 5B2IA 3MGRD 2Y2NA 1P34B 1U35A 5B1LD 5AV9A 4JJNC 1P3PA 2CV5B 3AZMA 3LZ1D 3MGSC 1F66C 3X1SC 3WA9C 3AZEA 2HIOA 5B1MA 5AVCD 2PYOD 3LELB 2YFWB 4KUDB 3KWQA 3V9RB 1ZLAA 2CWEA 2NZDD 2VQRA 3WAAC 5JRGA 1EQZA 2FJ7C 1Z2CB 5DNMC 4R8PB 3VH5A 1B6WA 5F99C 3UTBB 1N1JB 5B0YD 2YFWA 4WU8D 5CP6D 3REIB 4LD9C 3W97B 1P3KD 4Z2MG 3B6FD 3MGQB 4NE5A 3B6GB 3MGRC 3REKB 1M18D 4G91C 3TU4D 3AZLD 1HQ3B 3W99D 3LZ1C 3A1IA 5B2ID 3WTPB 3REIA 3C1BB 3P5JB 1U35D 5AV9D 1P3PD 2UWXA 4H9PA 3B6GA 3AZMD 2DQNC 2NZDC 3A1KA 4KHAB 4XZQA 3AZED 2HIOD 5B1MD 1HQ3A 3KWQD 1ZLAD 2J8PA 5GT3A 4J8XB 3AZNB 3MVDA 3AZHA 1P3GA 3C1BA 5B0YC 5JRGD 1EQZD 4YS3A 5CP6C 5FUGA 4JJNB 4M6BA 3AL0C 3MGSB 1F66B 2NQBA 3WA9B 4J8XA 3AYWA 3AZLC 4NE3A 1KX3A 3W99C 3AZFC 1F1EA 3EPLA 3WAAB 5AV9C 4JJNA 2FJ7B 3AZMC 4H9NA 1KX5A 5DNMB 3WA9A 3X1SA 3REID 5B1MC 5DNNA 3KWQC 4AWLC 2Y2QA 1ZLAC 5B40C 3B0DB 4XZQD 4G92C 1JFIB 3MGRB 4J8WA 5JRGC 1HQ3D 1EQZC 5GT3D 3WTPE 3AN2C 5F99A 5B1LB 3MVDD 1BH8B 3AZHD 5CPJA 1P3GD 3LZ1B 1H3OA 4UUZA 4YS3D 1R4VA 4LD9A 2PYOB 3REHA 5JA4B 1JFIA 1AOIA 4WV4B 4H9OB 1WWSA 2NZDB 2NQBD 4J8XD 3AYWD 1KX3D 5BO0B 3O62C 2F2AC 4NE6A 5B0YB 4H9RA 5JA4A 4WU8B 4JJND 2IO5C 5CP6B 4HGAC 2AROC 4H9OA 5KDMA 1KX5D 1P3KB 4QLCC 3B6FB 4XZQC 3WA9D 3X1SD 5DNND 4H9QA 5BO0A 1P3FA 4WU9C 2BG1A 5GT3C 3TU4B 3AZLB 4J8UA 3MVDC 3AZHC 1P3GC 2L5AA 3W99B 4J8WD 5B2IB 5F99D 1U35B 3EG5B 5AV9B 1P3PB 5CPJD 3AZMB 2RVQC 3A6NA 2NQBC 2HIOB 5B1MB 3AYWC 1KX3C 4LD9D 3LJAC 3REHD 3KWQB 2BYKA 1AOID 2BYMA 1ZLAB 3AZFA 3KUYC 4G92B 3WKJA 1M19A 5JRGB 1EQZB 1KX5C 2JSSA 5B33C 3VH5W 5DNNC 3VH6T 5B40A 4CSRB 4J8WC 5BNXA 1P3FD 5B24A 3AN2A 4J8UD 3EPKA 2Y2MA 4J8VC 5CPJC 3O62B 4YM6C 3MGPD 3REHC 5AY8A 4H9PB 1AOIC 2IO5B 4CSRA 4HGAB 2AROB 1BFMA 3AZKA 3A6ND 4QLCB 4XZQB 4KGCC 3KXBC 4WU9B 3O62A 5GT3B 3W96C 4ZBJB 3AZFD 3VH6W 3MVDB 3AZHB 1P3GB 1KU5A 3WKJD 1M19D 4YS3B 5B31A 2AROA 5FUGB 4QLCA 3UT9A 3AV1A 1P3FC 5G49A 4WU9A 2NQBB 5B40D 3VH6A 3AYWB 4J8UC 1KX3B 1P3IA 2W8SA 1P3BA 3W98A 5B24D 3MGPC 3KUYB 3AN2D 4WJ3C 5BS7A 4H9SA 3KSYA 2G5IC 4H9NB 1KX5B 3A6NC 2XD1A 2ZY3A 2YFVA 3X1SB 5DNNB 3LJAA 5AY8D 3AZKD 3KUYA 4Z66C 1P3LC 4CAYA 1M19C 3WKJC 4J8WB 5CHLB 1ID3C 3O62D 3B0CT 4NFTA 4UPKA 5B33A 5F99B 5B2JA 1M1AA 5CPJB 1Q9CA 3AZJC 1H3OB 4UUZB 4YM6B 5B31D 2AROD 5CPIA 4LD9B 3REHB 4QLCD 4WNNB 3UT9D 1AOIB 1W2EA 3AV1D 5B24C 4WU9D 4G91B 5AV8C 4KGCB 1P3ID 4J8VA 3AZGC 1P3BD 3W98D 5AV6A 1P3MC 4YM6A 4X23C 1WWIA 5AY8C 4H9RB 4WNNA 5B0ZA 3AZIC 5KDMB 2RVQD 3AZKC 4E45A 4H9QB 3B0CW 3AV2C 3LJAD 4KGCA 1P3FB 3KXBA 3AFAA 3MNNC 3W96A 1TZYC 4J8UB 3KUYD 2F8NH 4ZUXA 5AVBA 3MGPB 1S32A 5B31C 1BH9A 5B33D 5B2JD 1M1AD 3UT9C 4KUDC 3AV1C 3A6NB 5B32C 5GT0A 5CPID 4WZSB 1P3IC 3EPHA 1PZRA 2BYKB 1P3BC 2BYMB 3W98C 5GXQA 3MGPA 3AZFB 1P3LB 5BS7C 1M19B 3WKJB 3NQJB 4H9SC 4J8VD 1P3OC 3H0MC 5AV6D 2F8NA 4YM6D 3C1CA 2Y2GA 2HUEC 3MGQC 2Y2HA 2G5HC 2FFFB 5B0ZD 4AWLB 3REKC 5B40B 3X1TA 4Z66A 1P3LA 5B31G 3KFUG 4DRAA 3NQJA 5BNXB 4KGCD 3KXBD 5B24B 1ID3A 3LZ0A 5BNVB 3AFAD 3AN2B 2JCHA 5AV8B 3W96D 5B2JC 5B32G 1M1AC 3AZGB 5CPKA 3H0RC 3AZJA 4ZUXD 4XUJC 2JE5A 5AVBD 1S32D 4X23B 5CPIC 5C3IC 3UTAA 3X1UA 5AY8B 3AZIB 3AZKB 3EPJA 5BNVA 5GT0D 5AV8A 4EO5C 3AZGA 5AV6C 5AV5C 1P3MA 3MNNB 5GXQD 1TZYB 3X1VC 1KX4A 1A7WA 4X23A 4Z5TA 5E5AA 3RELA 5B0ZC 3AZIA 5B31B 5BT1D 2F8ND 3C1CD 3UT9B 3B0BA 3AV2A 3AV1B 2Y2JA 1B67A 2ZY5A 5G49B 5B32B 3AFAC 3MNNA 1TZYA 3X1TD 1P3AC 1P34A 4Z66D 1P3IB 1P3LD 1P3BB 3W98B 2CV5A 4ZUXC 5AVBC 1S32C 1ID3D 3LZ0D 2RIQA 2XD5A 3REJC 3LELA 1P3OB 5CPKD 4KUDA 3AZJD 3V9RA 3H0LC 5B32A 2YFVB 2LY8A 3B0DC 2HUEB 5GT0C 3UTAD 3X1UD 3LJAB 5GSUC 2Y2LA 5GXQC 3UTBA 4R8PA 5B1LC 1N1JA 4CAYB 5AV8D 3AZGD 1P3OA 5BT1C 1P3MD 5B33B 2ZY2A 5AVCC 5B2JB 3W97A 3C1CC 3NQUB 4X23D 1M1AB 1KX4D 1T3UA 3MGQA 4Z5TD 5E5AD 3RELD 4XUJB 3REKA 3AZID 5C3IB 5CPIB 2DF4C 3X1TC 4Z2MH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AV2 D;  3LZ0 C;  3WTP A;  3MNN D;  1TZY D;  4EO5 B;  3NQU A;  4J8V B;  1P34 D;  5CPK C;  4WU8 C;  5AV6 B;  5AV5 B;  2CV5 D;  4XUJ A;  3X1V B;  1P3K C;  3B6F C;  3UTA C;  4KHA A;  2F8N K;  3X1U C;  5B0Z B;  3LEL D;  4KUD D;  1M18 C;  3TU4 C;  5B32 D;  3AZN A;  2F8N G;  3KXB B;  5B2I C;  3AFA B;  5AV5 A;  3W96 B;  3X1V A;  3UTB D;  4R8P D;  1KX4 C;  1P3A B;  1U35 C;  1P3P C;  4Z5T C;  5E5A C;  3REL C;  4ZUX B;  1P3O D;  5AVB B;  1S32 B;  1BH9 B;  4E44 A;  3MGS A;  1F66 A;  3REJ B;  2HIO C;  3AZE C;  3W97 D;  3MGQ D;  3B6G D;  3REK D;  1ULY A;  5GT0 B;  1P34 C;  1P3A A;  5GSU B;  3WAA A;  2FJ7 A;  1TAF B;  2CV5 C;  5GXQ B;  5DNM A;  3WTP D;  3REJ A;  3C1B D;  3LEL C;  2F8N B;  4XUJ D;  5AVC B;  3C1C B;  5GSU A;  3MGR A;  1TAF A;  3UTB C;  4R8P C;  3X1T B;  3AZN D;  4Z66 B;  5B1L A;  1BH8 A;  3LZ1 A;  1ID3 B;  3LZ0 B;  5AV5 D;  3REI C;  3X1V D;  5AVC A;  3W97 C;  2PYO A;  5CPK B;  3AZJ B;  3B6G C;  3R45 B;  2NZD A;  3UTA B;  3MGS D;  1F66 D;  3X1U B;  1HTA A;  1HQ3 C;  3VH5 T;  1M18 B;  4ZBJ C;  3WTP C;  3C1B C;  1P3A D;  5B0Y A;  3WAA D;  4WU8 A;  4YS3 C;  2FJ7 D;  1P3M B;  5CP6 A;  3R45 A;  5DNM D;  1KX4 B;  1P3K A;  3B6F A;  4Z5T B;  5E5A B;  3REJ D;  3REL B;  1M18 A;  3TU4 A;  4J8X C;  3AZE B;  3AZN C;  3AZL A;  3AV2 B;  3W99 A;  4DRB A;  5GSU D;  3MGR D;  5B2I A;  1P34 B;  1U35 A;  5B1L D;  5AV9 A;  4JJN C;  1P3P A;  2CV5 B;  3AZM A;  3LZ1 D;  3MGS C;  1F66 C;  3X1S C;  3WA9 C;  3AZE A;  2HIO A;  5B1M A;  5AVC D;  2PYO D;  3LEL B;  2YFW B;  4KUD B;  3KWQ A;  3V9R B;  1ZLA A;  2CWE A;  2NZD D;  3WAA C;  5JRG A;  1EQZ A;  2FJ7 C;  5DNM C;  4R8P B;  3VH5 A;  5F99 C;  1B6W A;  3UTB B;  1N1J B;  5B0Y D;  2YFW A;  4WU8 D;  5CP6 D;  3REI B;  4LD9 C;  3W97 B;  1P3K D;  4Z2M G;  3B6F D;  3MGQ B;  4NE5 A;  3B6G B;  3MGR C;  3REK B;  1M18 D;  4G91 C;  3TU4 D;  3AZL D;  1HQ3 B;  3W99 D;  3LZ1 C;  5B2I D;  3WTP B;  3REI A;  3C1B B;  1U35 D;  5AV9 D;  1P3P D;  4H9P A;  3B6G A;  3AZM D;  2NZD C;  4KHA B;  4XZQ A;  3AZE D;  2HIO D;  5B1M D;  1HQ3 A;  3KWQ D;  1ZLA D;  5GT3 A;  4J8X B;  3AZN B;  3MVD A;  3AZH A;  1P3G A;  3C1B A;  5B0Y C;  5JRG D;  1EQZ D;  4YS3 A;  5CP6 C;  5FUG A;  4JJN B;  4M6B A;  3MGS B;  1F66 B;  2NQB A;  3WA9 B;  4J8X A;  3AYW A;  3AZL C;  4NE3 A;  1KX3 A;  3W99 C;  3AZF C;  1F1E A;  3WAA B;  5AV9 C;  4JJN A;  2FJ7 B;  3AZM C;  4H9N A;  1KX5 A;  5DNM B;  3WA9 A;  3X1S A;  3REI D;  5B1M C;  5DNN A;  3KWQ C;  4AWL C;  1ZLA C;  5B40 C;  3B0D B;  4XZQ D;  4G92 C;  1JFI B;  3MGR B;  4J8W A;  5JRG C;  1HQ3 D;  1EQZ C;  5GT3 D;  3WTP E;  3AN2 C;  5F99 A;  5B1L B;  3MVD D;  1BH8 B;  3AZH D;  5CPJ A;  1P3G D;  3LZ1 B;  1H3O A;  4UUZ A;  4YS3 D;  1R4V A;  4LD9 A;  2PYO B;  3REH A;  5JA4 B;  1JFI A;  1AOI A;  4WV4 B;  4H9O B;  1WWS A;  2NZD B;  2NQB D;  4J8X D;  3AYW D;  1KX3 D;  5BO0 B;  3O62 C;  4NE6 A;  5B0Y B;  4H9R A;  5JA4 A;  4WU8 B;  4JJN D;  2IO5 C;  5CP6 B;  4HGA C;  2ARO C;  4H9O A;  5KDM A;  1KX5 D;  1P3K B;  4QLC C;  3B6F B;  4XZQ C;  3WA9 D;  3X1S D;  5DNN D;  4H9Q A;  5BO0 A;  1P3F A;  4WU9 C;  5GT3 C;  3TU4 B;  3AZL B;  4J8U A;  3MVD C;  3AZH C;  1P3G C;  2L5A A;  3W99 B;  4J8W D;  5B2I B;  5F99 D;  1U35 B;  5AV9 B;  1P3P B;  5CPJ D;  3AZM B;  2RVQ C;  3A6N A;  2NQB C;  2HIO B;  5B1M B;  3AYW C;  1KX3 C;  4LD9 D;  3LJA C;  3REH D;  3KWQ B;  2BYK A;  1AOI D;  2BYM A;  1ZLA B;  3AZF A;  3KUY C;  4G92 B;  3WKJ A;  1M19 A;  5JRG B;  1EQZ B;  1KX5 C;  2JSS A;  5B33 C;  3VH5 W;  5DNN C;  3VH6 T;  5B40 A;  4CSR B;  4J8W C;  5BNX A;  1P3F D;  5B24 A;  3AN2 A;  4J8U D;  4J8V C;  5CPJ C;  3O62 B;  4YM6 C;  3MGP D;  3REH C;  5AY8 A;  4H9P B;  1AOI C;  2IO5 B;  4CSR A;  4HGA B;  2ARO B;  1BFM A;  3AZK A;  3A6N D;  4QLC B;  4XZQ B;  4KGC C;  3KXB C;  4WU9 B;  3O62 A;  5GT3 B;  3W96 C;  4ZBJ B;  3AZF D;  3VH6 W;  3MVD B;  3AZH B;  1P3G B;  1KU5 A;  3WKJ D;  1M19 D;  4YS3 B;  5B31 A;  2ARO A;  5FUG B;  4QLC A;  3UT9 A;  3AV1 A;  1P3F C;  5G49 A;  4WU9 A;  2NQB B;  5B40 D;  3VH6 A;  3AYW B;  4J8U C;  1KX3 B;  1P3I A;  1P3B A;  3W98 A;  5B24 D;  3MGP C;  3KUY B;  3AN2 D;  5BS7 A;  4H9S A;  3KSY A;  4H9N B;  1KX5 B;  3A6N C;  2YFV A;  3X1S B;  5DNN B;  3LJA A;  5AY8 D;  3AZK D;  3KUY A;  4Z66 C;  1P3L C;  4CAY A;  1M19 C;  3WKJ C;  4J8W B;  5CHL B;  1ID3 C;  3O62 D;  3B0C T;  4NFT A;  5B33 A;  5F99 B;  5B2J A;  1M1A A;  5CPJ B;  1Q9C A;  3AZJ C;  1H3O B;  4UUZ B;  4YM6 B;  5B31 D;  2ARO D;  5CPI A;  4LD9 B;  3REH B;  4QLC D;  4WNN B;  3UT9 D;  1AOI B;  3AV1 D;  5B24 C;  4WU9 D;  4G91 B;  5AV8 C;  4KGC B;  1P3I D;  4J8V A;  3AZG C;  1P3B D;  3W98 D;  5AV6 A;  1P3M C;  4YM6 A;  4X23 C;  1WWI A;  5AY8 C;  4H9R B;  4WNN A;  5B0Z A;  3AZI C;  5KDM B;  2RVQ D;  3AZK C;  4E45 A;  4H9Q B;  3B0C W;  3AV2 C;  3LJA D;  4KGC A;  1P3F B;  3KXB A;  3AFA A;  3MNN C;  3W96 A;  1TZY C;  4J8U B;  3KUY D;  2F8N H;  4ZUX A;  5AVB A;  3MGP B;  1S32 A;  5B31 C;  1BH9 A;  5B33 D;  5B2J D;  1M1A D;  3UT9 C;  4KUD C;  3AV1 C;  3A6N B;  5B32 C;  5GT0 A;  5CPI D;  4WZS B;  1P3I C;  2BYK B;  1P3B C;  2BYM B;  3W98 C;  5GXQ A;  3MGP A;  3AZF B;  1P3L B;  5BS7 C;  1M19 B;  3WKJ B;  3NQJ B;  4H9S C;  4J8V D;  1P3O C;  5AV6 D;  2F8N A;  4YM6 D;  3C1C A;  2HUE C;  3MGQ C;  5B0Z D;  4AWL B;  3REK C;  5B40 B;  3X1T A;  4Z66 A;  1P3L A;  5B31 G;  4DRA A;  3NQJ A;  5BNX B;  4KGC D;  3KXB D;  5B24 B;  1ID3 A;  3LZ0 A;  5BNV B;  3AFA D;  3AN2 B;  3W96 D;  5AV8 B;  5B2J C;  5B32 G;  1M1A C;  3AZG B;  5CPK A;  3AZJ A;  4ZUX D;  4XUJ C;  5AVB D;  1S32 D;  4X23 B;  5CPI C;  5C3I C;  3UTA A;  3X1U A;  5AY8 B;  3AZI B;  3AZK B;  5BNV A;  5GT0 D;  5AV8 A;  4EO5 C;  3AZG A;  5AV6 C;  5AV5 C;  1P3M A;  3MNN B;  5GXQ D;  1TZY B;  3X1V C;  1KX4 A;  1A7W A;  4X23 A;  4Z5T A;  5E5A A;  3REL A;  5B0Z C;  3AZI A;  5B31 B;  5BT1 D;  2F8N D;  3C1C D;  3UT9 B;  3B0B A;  3AV2 A;  3AV1 B;  1B67 A;  5G49 B;  5B32 B;  3AFA C;  3MNN A;  1TZY A;  3X1T D;  1P3A C;  1P34 A;  4Z66 D;  1P3I B;  1P3L D;  1P3B B;  3W98 B;  2CV5 A;  4ZUX C;  5AVB C;  1S32 C;  1ID3 D;  3LZ0 D;  3REJ C;  3LEL A;  1P3O B;  5CPK D;  4KUD A;  3AZJ D;  3V9R A;  5B32 A;  2YFV B;  2LY8 A;  3B0D C;  2HUE B;  5GT0 C;  3UTA D;  3X1U D;  3LJA B;  5GSU C;  5GXQ C;  3UTB A;  4R8P A;  5B1L C;  1N1J A;  4CAY B;  5AV8 D;  3AZG D;  1P3O A;  5BT1 C;  1P3M D;  5B33 B;  5AVC C;  5B2J B;  3W97 A;  3C1C C;  3NQU B;  4X23 D;  1M1A B;  1KX4 D;  2PYO C;  3MGQ A;  4Z5T D;  5E5A D;  3REL D;  4XUJ B;  3REK A;  3AZI D;  5C3I B;  5CPI B;  3X1T C;  4Z2M H; 
#chains in the Genus database with same CATH topology
 3AV2 D;  3LZ0 C;  3WTP A;  3MNN D;  1TZY D;  4EO5 B;  3NQU A;  2Y2I A;  4J8V B;  5CPK C;  4WU8 C;  1P34 D;  5AV6 B;  5AV5 B;  2CV5 D;  4XUJ A;  3X1V B;  1P3K C;  3B6F C;  3UTA C;  4KHA A;  2F8N K;  3X1U C;  5B0Z B;  3LEL D;  2PYO C;  4KUD D;  1M18 C;  3F6T A;  2Y2O A;  3TU4 C;  5B32 D;  3AZN A;  2F8N G;  3KXB B;  5B2I C;  3AFA B;  5AV5 A;  3W96 B;  3X1V A;  3UTB D;  4R8P D;  1KX4 C;  1P3A B;  1U35 C;  1P3P C;  4Z5T C;  5E5A C;  3REL C;  4ZUX B;  1P3O D;  5AVB B;  1S32 B;  1BH9 B;  4E44 A;  3MGS A;  1F66 A;  3REJ B;  2HIO C;  3AZE C;  3W97 D;  3MGQ D;  2Y2K A;  3B6G D;  3REK D;  1ULY A;  5GT0 B;  1P34 C;  1P3A A;  5GSU B;  3WAA A;  2FJ7 A;  1TAF B;  2CV5 C;  5GXQ B;  3FDD A;  5DNM A;  2Y2P A;  3WTP D;  2ZY4 A;  3REJ A;  3C1B D;  3LEL C;  2F8N B;  4XUJ D;  5AVC B;  3C1C B;  2ZM5 A;  5GSU A;  3MGR A;  1TAF A;  3UTB C;  4R8P C;  3X1T B;  3AZN D;  4Z66 B;  5B1L A;  1BH8 A;  3LZ1 A;  1ID3 B;  3LZ0 B;  5AV5 D;  3REI C;  3X1V D;  5AVC A;  3W97 C;  2PYO A;  5CPK B;  3AZJ B;  3B6G C;  3R45 B;  2NZD A;  3UTA B;  3MGS D;  1F66 D;  3X1U B;  1HTA A;  1HQ3 C;  3VH5 T;  4DQY B;  1M18 B;  4ZBJ C;  3WTP C;  3C1B C;  1P3A D;  5B0Y A;  3WAA D;  4WU8 A;  4YS3 C;  2FJ7 D;  1P3M B;  5CP6 A;  3R45 A;  5DNM D;  1KX4 B;  1P3K A;  3B6F A;  4Z5T B;  5E5A B;  3REJ D;  3REL B;  1M18 A;  3TU4 A;  4J8X C;  3AZE B;  3AZN C;  3AZL A;  3AV2 B;  3W99 A;  3IP4 C;  4DRB A;  5GSU D;  5B2I A;  3MGR D;  2Y2N A;  1P34 B;  1U35 A;  5B1L D;  5AV9 A;  4JJN C;  1P3P A;  2CV5 B;  3AZM A;  3LZ1 D;  3MGS C;  1F66 C;  3X1S C;  3WA9 C;  3AZE A;  2HIO A;  5B1M A;  5AVC D;  2PYO D;  3LEL B;  2YFW B;  4KUD B;  3KWQ A;  3V9R B;  1ZLA A;  2CWE A;  2NZD D;  2VQR A;  3WAA C;  5JRG A;  1EQZ A;  2FJ7 C;  1Z2C B;  5DNM C;  4R8P B;  3VH5 A;  1B6W A;  5F99 C;  3UTB B;  1N1J B;  5B0Y D;  2YFW A;  4WU8 D;  5CP6 D;  3REI B;  4LD9 C;  3W97 B;  1P3K D;  4Z2M G;  3B6F D;  3MGQ B;  4NE5 A;  3B6G B;  3MGR C;  3REK B;  1M18 D;  4G91 C;  3TU4 D;  3AZL D;  1HQ3 B;  3W99 D;  3LZ1 C;  3A1I A;  5B2I D;  3WTP B;  3REI A;  3C1B B;  3P5J B;  1U35 D;  5AV9 D;  1P3P D;  2UWX A;  4H9P A;  3B6G A;  3AZM D;  2DQN C;  2NZD C;  3A1K A;  4KHA B;  4XZQ A;  3AZE D;  2HIO D;  5B1M D;  1HQ3 A;  3KWQ D;  1ZLA D;  2J8P A;  5GT3 A;  4J8X B;  3AZN B;  3MVD A;  3AZH A;  1P3G A;  3C1B A;  5B0Y C;  5JRG D;  1EQZ D;  4YS3 A;  5CP6 C;  5FUG A;  4JJN B;  4M6B A;  3AL0 C;  3MGS B;  1F66 B;  2NQB A;  3WA9 B;  4J8X A;  3AYW A;  3AZL C;  4NE3 A;  1KX3 A;  3W99 C;  3AZF C;  1F1E A;  3EPL A;  3WAA B;  5AV9 C;  4JJN A;  2FJ7 B;  3AZM C;  4H9N A;  1KX5 A;  5DNM B;  3WA9 A;  3X1S A;  3REI D;  5B1M C;  5DNN A;  3KWQ C;  4AWL C;  2Y2Q A;  1ZLA C;  5B40 C;  3B0D B;  4XZQ D;  4G92 C;  1JFI B;  3MGR B;  4J8W A;  5JRG C;  1HQ3 D;  1EQZ C;  5GT3 D;  3WTP E;  3AN2 C;  5F99 A;  5B1L B;  3MVD D;  1BH8 B;  3AZH D;  5CPJ A;  1P3G D;  3LZ1 B;  1H3O A;  4UUZ A;  4YS3 D;  1R4V A;  4LD9 A;  2PYO B;  3REH A;  5JA4 B;  1JFI A;  1AOI A;  4WV4 B;  4H9O B;  1WWS A;  2NZD B;  2NQB D;  4J8X D;  3AYW D;  1KX3 D;  5BO0 B;  3O62 C;  2F2A C;  4NE6 A;  5B0Y B;  4H9R A;  5JA4 A;  4WU8 B;  4JJN D;  2IO5 C;  5CP6 B;  4HGA C;  2ARO C;  4H9O A;  5KDM A;  1KX5 D;  1P3K B;  4QLC C;  3B6F B;  4XZQ C;  3WA9 D;  3X1S D;  5DNN D;  4H9Q A;  5BO0 A;  1P3F A;  4WU9 C;  2BG1 A;  5GT3 C;  3TU4 B;  3AZL B;  4J8U A;  3MVD C;  3AZH C;  1P3G C;  2L5A A;  3W99 B;  4J8W D;  5B2I B;  5F99 D;  1U35 B;  3EG5 B;  5AV9 B;  1P3P B;  5CPJ D;  3AZM B;  2RVQ C;  3A6N A;  2NQB C;  2HIO B;  5B1M B;  3AYW C;  1KX3 C;  4LD9 D;  3LJA C;  3REH D;  3KWQ B;  2BYK A;  1AOI D;  2BYM A;  1ZLA B;  3AZF A;  3KUY C;  4G92 B;  3WKJ A;  1M19 A;  5JRG B;  1EQZ B;  1KX5 C;  2JSS A;  5B33 C;  3VH5 W;  5DNN C;  3VH6 T;  5B40 A;  4CSR B;  4J8W C;  5BNX A;  1P3F D;  5B24 A;  3AN2 A;  4J8U D;  3EPK A;  2Y2M A;  4J8V C;  5CPJ C;  3O62 B;  4YM6 C;  3MGP D;  3REH C;  5AY8 A;  4H9P B;  1AOI C;  2IO5 B;  4CSR A;  4HGA B;  2ARO B;  1BFM A;  3AZK A;  3A6N D;  4QLC B;  4XZQ B;  4KGC C;  3KXB C;  4WU9 B;  3O62 A;  5GT3 B;  3W96 C;  4ZBJ B;  3AZF D;  3VH6 W;  3MVD B;  3AZH B;  1P3G B;  1KU5 A;  3WKJ D;  1M19 D;  4YS3 B;  5B31 A;  2ARO A;  5FUG B;  4QLC A;  3UT9 A;  3AV1 A;  1P3F C;  5G49 A;  4WU9 A;  2NQB B;  5B40 D;  3VH6 A;  3AYW B;  4J8U C;  1KX3 B;  1P3I A;  2W8S A;  1P3B A;  3W98 A;  5B24 D;  3MGP C;  3KUY B;  3AN2 D;  4WJ3 C;  5BS7 A;  4H9S A;  3KSY A;  2G5I C;  4H9N B;  1KX5 B;  3A6N C;  2XD1 A;  2ZY3 A;  2YFV A;  3X1S B;  5DNN B;  3LJA A;  5AY8 D;  3AZK D;  3KUY A;  4Z66 C;  1P3L C;  4CAY A;  1M19 C;  3WKJ C;  4J8W B;  5CHL B;  1ID3 C;  3O62 D;  3B0C T;  4NFT A;  4UPK A;  5B33 A;  5F99 B;  5B2J A;  1M1A A;  5CPJ B;  1Q9C A;  3AZJ C;  1H3O B;  4UUZ B;  4YM6 B;  5B31 D;  2ARO D;  5CPI A;  4LD9 B;  3REH B;  4QLC D;  4WNN B;  3UT9 D;  1AOI B;  1W2E A;  3AV1 D;  5B24 C;  4WU9 D;  4G91 B;  5AV8 C;  4KGC B;  1P3I D;  4J8V A;  3AZG C;  1P3B D;  3W98 D;  5AV6 A;  1P3M C;  4YM6 A;  4X23 C;  1WWI A;  5AY8 C;  4H9R B;  4WNN A;  5B0Z A;  3AZI C;  5KDM B;  2RVQ D;  3AZK C;  4E45 A;  4H9Q B;  3B0C W;  3AV2 C;  3LJA D;  4KGC A;  1P3F B;  3KXB A;  3AFA A;  3MNN C;  3W96 A;  1TZY C;  4J8U B;  3KUY D;  2F8N H;  4ZUX A;  5AVB A;  3MGP B;  1S32 A;  5B31 C;  1BH9 A;  5B33 D;  5B2J D;  1M1A D;  3UT9 C;  4KUD C;  3AV1 C;  3A6N B;  5B32 C;  5GT0 A;  5CPI D;  4WZS B;  1P3I C;  3EPH A;  1PZR A;  2BYK B;  1P3B C;  2BYM B;  3W98 C;  5GXQ A;  3MGP A;  3AZF B;  1P3L B;  5BS7 C;  1M19 B;  3WKJ B;  3NQJ B;  4H9S C;  4J8V D;  1P3O C;  3H0M C;  5AV6 D;  2F8N A;  4YM6 D;  3C1C A;  2Y2G A;  2HUE C;  3MGQ C;  2Y2H A;  2G5H C;  2FFF B;  5B0Z D;  4AWL B;  3REK C;  5B40 B;  3X1T A;  4Z66 A;  1P3L A;  5B31 G;  3KFU G;  4DRA A;  3NQJ A;  5BNX B;  4KGC D;  3KXB D;  5B24 B;  1ID3 A;  3LZ0 A;  5BNV B;  3AFA D;  3AN2 B;  2JCH A;  5AV8 B;  3W96 D;  5B2J C;  5B32 G;  1M1A C;  3AZG B;  5CPK A;  3H0R C;  3AZJ A;  4ZUX D;  4XUJ C;  2JE5 A;  5AVB D;  1S32 D;  4X23 B;  5CPI C;  5C3I C;  3UTA A;  3X1U A;  5AY8 B;  3AZI B;  3AZK B;  3EPJ A;  5BNV A;  5GT0 D;  5AV8 A;  4EO5 C;  3AZG A;  5AV6 C;  5AV5 C;  1P3M A;  3MNN B;  5GXQ D;  1TZY B;  3X1V C;  1KX4 A;  1A7W A;  4X23 A;  4Z5T A;  5E5A A;  3REL A;  5B0Z C;  3AZI A;  5B31 B;  5BT1 D;  2F8N D;  3C1C D;  3UT9 B;  3B0B A;  3AV2 A;  3AV1 B;  2Y2J A;  1B67 A;  2ZY5 A;  5G49 B;  5B32 B;  3AFA C;  3MNN A;  1TZY A;  3X1T D;  1P3A C;  1P34 A;  4Z66 D;  1P3I B;  1P3L D;  1P3B B;  3W98 B;  2CV5 A;  4ZUX C;  5AVB C;  1S32 C;  1ID3 D;  3LZ0 D;  2RIQ A;  2XD5 A;  3REJ C;  3LEL A;  1P3O B;  5CPK D;  4KUD A;  3AZJ D;  3V9R A;  3H0L C;  5B32 A;  2YFV B;  2LY8 A;  3B0D C;  2HUE B;  5GT0 C;  3UTA D;  3X1U D;  3LJA B;  5GSU C;  2Y2L A;  5GXQ C;  3UTB A;  4R8P A;  5B1L C;  1N1J A;  4CAY B;  5AV8 D;  3AZG D;  1P3O A;  5BT1 C;  1P3M D;  5B33 B;  2ZY2 A;  5AVC C;  5B2J B;  3W97 A;  3C1C C;  3NQU B;  4X23 D;  1M1A B;  1KX4 D;  1T3U A;  3MGQ A;  4Z5T D;  5E5A D;  3REL D;  4XUJ B;  3REK A;  3AZI D;  5C3I B;  5CPI B;  2DF4 C;  3X1T C;  4Z2M H; 
#chains in the Genus database with same CATH homology
 3AV2 D;  3LZ0 C;  3WTP A;  3MNN D;  1TZY D;  4EO5 B;  3NQU A;  2Y2I A;  4J8V B;  5CPK C;  4WU8 C;  1P34 D;  5AV6 B;  5AV5 B;  2CV5 D;  4XUJ A;  3X1V B;  1P3K C;  3B6F C;  3UTA C;  4KHA A;  2F8N K;  3X1U C;  5B0Z B;  3LEL D;  2PYO C;  4KUD D;  1M18 C;  3F6T A;  2Y2O A;  3TU4 C;  5B32 D;  3AZN A;  2F8N G;  3KXB B;  5B2I C;  3AFA B;  5AV5 A;  3W96 B;  3X1V A;  3UTB D;  4R8P D;  1KX4 C;  1P3A B;  1U35 C;  1P3P C;  4Z5T C;  5E5A C;  3REL C;  4ZUX B;  1P3O D;  5AVB B;  1S32 B;  1BH9 B;  4E44 A;  3MGS A;  1F66 A;  3REJ B;  2HIO C;  3AZE C;  3W97 D;  3MGQ D;  2Y2K A;  3B6G D;  3REK D;  1ULY A;  5GT0 B;  1P34 C;  1P3A A;  5GSU B;  3WAA A;  2FJ7 A;  1TAF B;  2CV5 C;  5GXQ B;  3FDD A;  5DNM A;  2Y2P A;  3WTP D;  2ZY4 A;  3REJ A;  3C1B D;  3LEL C;  2F8N B;  4XUJ D;  5AVC B;  3C1C B;  2ZM5 A;  5GSU A;  3MGR A;  1TAF A;  3UTB C;  4R8P C;  3X1T B;  3AZN D;  4Z66 B;  5B1L A;  1BH8 A;  3LZ1 A;  1ID3 B;  3LZ0 B;  5AV5 D;  3REI C;  3X1V D;  5AVC A;  3W97 C;  2PYO A;  5CPK B;  3AZJ B;  3B6G C;  3R45 B;  2NZD A;  3UTA B;  3MGS D;  1F66 D;  3X1U B;  1HTA A;  1HQ3 C;  3VH5 T;  4DQY B;  1M18 B;  4ZBJ C;  3WTP C;  3C1B C;  1P3A D;  5B0Y A;  3WAA D;  4WU8 A;  4YS3 C;  2FJ7 D;  1P3M B;  5CP6 A;  3R45 A;  5DNM D;  1KX4 B;  1P3K A;  3B6F A;  4Z5T B;  5E5A B;  3REJ D;  3REL B;  1M18 A;  3TU4 A;  4J8X C;  3AZE B;  3AZN C;  3AZL A;  3AV2 B;  3W99 A;  3IP4 C;  4DRB A;  5GSU D;  5B2I A;  3MGR D;  2Y2N A;  1P34 B;  1U35 A;  5B1L D;  5AV9 A;  4JJN C;  1P3P A;  2CV5 B;  3AZM A;  3LZ1 D;  3MGS C;  1F66 C;  3X1S C;  3WA9 C;  3AZE A;  2HIO A;  5B1M A;  5AVC D;  2PYO D;  3LEL B;  2YFW B;  4KUD B;  3KWQ A;  3V9R B;  1ZLA A;  2CWE A;  2NZD D;  2VQR A;  3WAA C;  5JRG A;  1EQZ A;  2FJ7 C;  1Z2C B;  5DNM C;  4R8P B;  3VH5 A;  1B6W A;  5F99 C;  3UTB B;  1N1J B;  5B0Y D;  2YFW A;  4WU8 D;  5CP6 D;  3REI B;  4LD9 C;  3W97 B;  1P3K D;  4Z2M G;  3B6F D;  3MGQ B;  4NE5 A;  3B6G B;  3MGR C;  3REK B;  1M18 D;  4G91 C;  3TU4 D;  3AZL D;  1HQ3 B;  3W99 D;  3LZ1 C;  3A1I A;  5B2I D;  3WTP B;  3REI A;  3C1B B;  3P5J B;  1U35 D;  5AV9 D;  1P3P D;  2UWX A;  4H9P A;  3B6G A;  3AZM D;  2DQN C;  2NZD C;  3A1K A;  4KHA B;  4XZQ A;  3AZE D;  2HIO D;  5B1M D;  1HQ3 A;  3KWQ D;  1ZLA D;  2J8P A;  5GT3 A;  4J8X B;  3AZN B;  3MVD A;  3AZH A;  1P3G A;  3C1B A;  5B0Y C;  5JRG D;  1EQZ D;  4YS3 A;  5CP6 C;  5FUG A;  4JJN B;  4M6B A;  3AL0 C;  3MGS B;  1F66 B;  2NQB A;  3WA9 B;  4J8X A;  3AYW A;  3AZL C;  4NE3 A;  1KX3 A;  3W99 C;  3AZF C;  1F1E A;  3EPL A;  3WAA B;  5AV9 C;  4JJN A;  2FJ7 B;  3AZM C;  4H9N A;  1KX5 A;  5DNM B;  3WA9 A;  3X1S A;  3REI D;  5B1M C;  5DNN A;  3KWQ C;  4AWL C;  2Y2Q A;  1ZLA C;  5B40 C;  3B0D B;  4XZQ D;  4G92 C;  1JFI B;  3MGR B;  4J8W A;  5JRG C;  1HQ3 D;  1EQZ C;  5GT3 D;  3WTP E;  3AN2 C;  5F99 A;  5B1L B;  3MVD D;  1BH8 B;  3AZH D;  5CPJ A;  1P3G D;  3LZ1 B;  1H3O A;  4UUZ A;  4YS3 D;  1R4V A;  4LD9 A;  2PYO B;  3REH A;  5JA4 B;  1JFI A;  1AOI A;  4WV4 B;  4H9O B;  1WWS A;  2NZD B;  2NQB D;  4J8X D;  3AYW D;  1KX3 D;  5BO0 B;  3O62 C;  2F2A C;  4NE6 A;  5B0Y B;  4H9R A;  5JA4 A;  4WU8 B;  4JJN D;  2IO5 C;  5CP6 B;  4HGA C;  2ARO C;  4H9O A;  5KDM A;  1KX5 D;  1P3K B;  4QLC C;  3B6F B;  4XZQ C;  3WA9 D;  3X1S D;  5DNN D;  4H9Q A;  5BO0 A;  1P3F A;  4WU9 C;  2BG1 A;  5GT3 C;  3TU4 B;  3AZL B;  4J8U A;  3MVD C;  3AZH C;  1P3G C;  2L5A A;  3W99 B;  4J8W D;  5B2I B;  5F99 D;  1U35 B;  3EG5 B;  5AV9 B;  1P3P B;  5CPJ D;  3AZM B;  2RVQ C;  3A6N A;  2NQB C;  2HIO B;  5B1M B;  3AYW C;  1KX3 C;  4LD9 D;  3LJA C;  3REH D;  3KWQ B;  2BYK A;  1AOI D;  2BYM A;  1ZLA B;  3AZF A;  3KUY C;  4G92 B;  3WKJ A;  1M19 A;  5JRG B;  1EQZ B;  1KX5 C;  2JSS A;  5B33 C;  3VH5 W;  5DNN C;  3VH6 T;  5B40 A;  4CSR B;  4J8W C;  5BNX A;  1P3F D;  5B24 A;  3AN2 A;  4J8U D;  3EPK A;  2Y2M A;  4J8V C;  5CPJ C;  3O62 B;  4YM6 C;  3MGP D;  3REH C;  5AY8 A;  4H9P B;  1AOI C;  2IO5 B;  4CSR A;  4HGA B;  2ARO B;  1BFM A;  3AZK A;  3A6N D;  4QLC B;  4XZQ B;  4KGC C;  3KXB C;  4WU9 B;  3O62 A;  5GT3 B;  3W96 C;  4ZBJ B;  3AZF D;  3VH6 W;  3MVD B;  3AZH B;  1P3G B;  1KU5 A;  3WKJ D;  1M19 D;  4YS3 B;  5B31 A;  2ARO A;  5FUG B;  4QLC A;  3UT9 A;  3AV1 A;  1P3F C;  5G49 A;  4WU9 A;  2NQB B;  5B40 D;  3VH6 A;  3AYW B;  4J8U C;  1KX3 B;  1P3I A;  2W8S A;  1P3B A;  3W98 A;  5B24 D;  3MGP C;  3KUY B;  3AN2 D;  4WJ3 C;  5BS7 A;  4H9S A;  3KSY A;  2G5I C;  4H9N B;  1KX5 B;  3A6N C;  2XD1 A;  2ZY3 A;  2YFV A;  3X1S B;  5DNN B;  3LJA A;  5AY8 D;  3AZK D;  3KUY A;  4Z66 C;  1P3L C;  4CAY A;  1M19 C;  3WKJ C;  4J8W B;  5CHL B;  1ID3 C;  3O62 D;  3B0C T;  4NFT A;  4UPK A;  5B33 A;  5F99 B;  5B2J A;  1M1A A;  5CPJ B;  1Q9C A;  3AZJ C;  1H3O B;  4UUZ B;  4YM6 B;  5B31 D;  2ARO D;  5CPI A;  4LD9 B;  3REH B;  4QLC D;  4WNN B;  3UT9 D;  1AOI B;  1W2E A;  3AV1 D;  5B24 C;  4WU9 D;  4G91 B;  5AV8 C;  4KGC B;  1P3I D;  4J8V A;  3AZG C;  1P3B D;  3W98 D;  5AV6 A;  1P3M C;  4YM6 A;  4X23 C;  1WWI A;  5AY8 C;  4H9R B;  4WNN A;  5B0Z A;  3AZI C;  5KDM B;  2RVQ D;  3AZK C;  4E45 A;  4H9Q B;  3B0C W;  3AV2 C;  3LJA D;  4KGC A;  1P3F B;  3KXB A;  3AFA A;  3MNN C;  3W96 A;  1TZY C;  4J8U B;  3KUY D;  2F8N H;  4ZUX A;  5AVB A;  3MGP B;  1S32 A;  5B31 C;  1BH9 A;  5B33 D;  5B2J D;  1M1A D;  3UT9 C;  4KUD C;  3AV1 C;  3A6N B;  5B32 C;  5GT0 A;  5CPI D;  4WZS B;  1P3I C;  3EPH A;  1PZR A;  2BYK B;  1P3B C;  2BYM B;  3W98 C;  5GXQ A;  3MGP A;  3AZF B;  1P3L B;  5BS7 C;  1M19 B;  3WKJ B;  3NQJ B;  4H9S C;  4J8V D;  1P3O C;  3H0M C;  5AV6 D;  2F8N A;  4YM6 D;  3C1C A;  2Y2G A;  2HUE C;  3MGQ C;  2Y2H A;  2G5H C;  2FFF B;  5B0Z D;  4AWL B;  3REK C;  5B40 B;  3X1T A;  4Z66 A;  1P3L A;  5B31 G;  3KFU G;  4DRA A;  3NQJ A;  5BNX B;  4KGC D;  3KXB D;  5B24 B;  1ID3 A;  3LZ0 A;  5BNV B;  3AFA D;  3AN2 B;  2JCH A;  5AV8 B;  3W96 D;  5B2J C;  5B32 G;  1M1A C;  3AZG B;  5CPK A;  3H0R C;  3AZJ A;  4ZUX D;  4XUJ C;  2JE5 A;  5AVB D;  1S32 D;  4X23 B;  5CPI C;  5C3I C;  3UTA A;  3X1U A;  5AY8 B;  3AZI B;  3AZK B;  3EPJ A;  5BNV A;  5GT0 D;  5AV8 A;  4EO5 C;  3AZG A;  5AV6 C;  5AV5 C;  1P3M A;  3MNN B;  5GXQ D;  1TZY B;  3X1V C;  1KX4 A;  1A7W A;  4X23 A;  4Z5T A;  5E5A A;  3REL A;  5B0Z C;  3AZI A;  5B31 B;  5BT1 D;  2F8N D;  3C1C D;  3UT9 B;  3B0B A;  3AV2 A;  3AV1 B;  2Y2J A;  1B67 A;  2ZY5 A;  5G49 B;  5B32 B;  3AFA C;  3MNN A;  1TZY A;  3X1T D;  1P3A C;  1P34 A;  4Z66 D;  1P3I B;  1P3L D;  1P3B B;  3W98 B;  2CV5 A;  4ZUX C;  5AVB C;  1S32 C;  1ID3 D;  3LZ0 D;  2RIQ A;  2XD5 A;  3REJ C;  3LEL A;  1P3O B;  5CPK D;  4KUD A;  3AZJ D;  3V9R A;  3H0L C;  5B32 A;  2YFV B;  2LY8 A;  3B0D C;  2HUE B;  5GT0 C;  3UTA D;  3X1U D;  3LJA B;  5GSU C;  2Y2L A;  5GXQ C;  3UTB A;  4R8P A;  5B1L C;  1N1J A;  4CAY B;  5AV8 D;  3AZG D;  1P3O A;  5BT1 C;  1P3M D;  5B33 B;  2ZY2 A;  5AVC C;  5B2J B;  3W97 A;  3C1C C;  3NQU B;  4X23 D;  1M1A B;  1KX4 D;  1T3U A;  3MGQ A;  4Z5T D;  5E5A D;  3REL D;  4XUJ B;  3REK A;  3AZI D;  5C3I B;  5CPI B;  2DF4 C;  3X1T C;  4Z2M H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...