3AFAC

The human nucleosome structure
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
108
structure length
108
Chain Sequence
RAKAKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.1
publication title Structural basis of instability of the nucleosome containing a testis-specific histone variant, human H3T
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 31
structure length 108
sequence length 108
chains with identical sequence G
ec nomenclature
pdb deposition date 2010-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3afaC00
3MGPC 2NZDA 1HQ3B 4YM6B 1ZLAC 5GT0C 5CP6A 1M1AB 5B2IC 2BYKA 2HIOC 3KWQD 3W97C 5B2JC 3AZMA 3WA9D 1R4VA 4YS3D 2FJ7C 3AZJA 3B0CT 3LZ0B 5F99B 5AV6C 5GT3D 3MGRA 5AV9D 5CPID 3UT9D 3UTAA 1P3KC 1HQ3D 3O62D 1JFIB 5DNNC 3MVDA 3REKB 1F66C 1EQZB 3AFAB 3MNNC 3C1BA 1KX3B 5B32A 5B31G 2NQBB 4G92B 3MGSD 5CPKA 1B6WA 3LELA 2RVQD 2CV5A 4LD9B 3B6FD 4KHAB 5CHLB 5BS7C 5B40C 5B1LA 1P3AA 2AROA 1AOID 4J8WD 1U35B 4J8XD 3NQJB 3AZHC 3KUYB 2F8NH 5GT3A 2BYMB 1H3OA 3UT9A 1P3IA 2NZDC 1TZYB 1HQ3A 4YM6A 3AFAD 5CP6C 1M1AA 3RELC 5CPJB 5BT1C 3AZMC 3AZJC 3LZ1D 3R45B 3LZ0A 2IO5C 5F99A 5B0ZD 1U35D 3MGRC 3AZEC 3UTAC 4NFTA 3WTPB 1TZYD 1KX5B 5GXQD 5B33B 4ZBJC 4Z2MG 1JFIA 4WU9D 3B0DB 3UTBD 4EO5B 1P3PD 3TU4A 3AYWB 3MVDC 5CPJD 4UUZB 4R8PD 3REKA 1EQZA 3AFAA 3REID 1KX3A 2HIOA 2NQBA 5CPKC 2F8ND 5B1MB 4H9QB 2CV5C 1A7WA 1P3LB 4LD9A 3KSYA 4Z5TB 3WTPD 1P3MB 4KGCD 5KDMB 5B1LC 1P3AC 2AROC 1S32B 5E5AD 3NQJA 3AYWD 3KUYA 4M6BA 5GT3C 3X1SD 1P3IB 4G91C 2BYMA 3UT9C 1P3GB 1P3IC 5AY8B 1HQ3C 4YM6C 3C1CD 5GSUB 1P3BD 3KXBB 1M1AC 5DNNA 1ID3D 5B1MD 1F66A 5CPJA 4E45A 4Z5TD 3MNNA 5JA4B 4WNNB 4NE6A 5B24D 4WU8B 3KWQB 3R45A 3LZ0C 5F99C 5B31B 1Q9CA 2RVQC 3AN2D 3WA9B 4YS3B 3WTPA 2HUEB 5AV8D 5B33A 1KX5A 3KXBD 5AV9B 5CPIB 3AYWA 3REHD 4UUZA 3O62B 3REKC 1EQZC 3AZFD 3AFAC 3AZGB 4ZUXD 3RELA 4Z66D 1P34B 1KX3C 2NQBC 4G92C 3VH6W 4WU8D 4Z2MH 5B31D 5B1MA 3B6GB 4LD9C 1P3LA 5JRGB 4H9NB 4Z5TA 1P3MA 5KDMA 3MGSB 5G49B 2PYOB 1S32A 3KUYC 3AZEA 1M18B 3B6FB 3VH6A 1P3GA 1TZYC 5AY8A 3LJAD 1P3OD 1AOIB 4J8WB 5GSUA 4JJND 3KXBA 3AZGD 4J8XB 1P34D 1KX4D 5CPJC 1P3FD 3B6GD 5JRGD 3AV2B 5JA4A 4WNNA 3REJB 2PYOD 5AV5B 4DRAA 3KWQA 3WAAD 1F1EA 4NE3A 1M18D 3MGQD 3WA9A 3WTPC 4YS3A 3LZ1B 4XUJB 1KX5C 5B33C 5B0ZB 3B0DC 4XZQD 4EO5C 1B67A 5AV9A 3AYWC 4X23D 3AV1B 5CPIA 5B32G 5GXQB 3O62A 4WU9B 3AV2D 3REJD 3UTBB 1P3PB 1BFMA 5AV5D 1M19D 3X1VD 3AZLB 5B1MC 3B0BA 4R8PB 4J8VB 3WKJD 3B6GA 1P3LC 3REIB 5JRGA 4Z5TC 4QLCD 4KUDD 4H9NA 1P3MC 4XUJD 3MGSA 2F8NB 5G49A 2LY8A 1S32C 2PYOA 3W96B 3V9RB 3MGPD 3AV1D 1M18A 3B6FA 4KGCB 3VH5W 1P3GC 5BO0B 5GT0D 5AY8C 4H9PB 5GSUC 4J8WA 3KXBC 4HGAB 5E5AB 1AOIA 4J8XA 3X1SB 3W97D 5B2JD 3AZLD 4J8VD 3C1CB 1P3BB 2FJ7D 4E44A 3REJA 5AV6D 3VH5A 1ID3B 5AV5A 3KWQC 4WU8C 3W96D 5C3IB 5B31C 4KHAA 3WA9C 3X1UB 4YS3C 5B24B 2HUEC 4XUJA 3LZ1A 5B0ZA 1U35A 3NQUB 5B0YB 3AN2B 5AV9C 5CPIC 3AZKB 1TZYA 5AV8B 3O62C 5GXQA 4CSRB 4WU9A 4H9SA 3AZGC 2JSSA 3UTBA 1P3PA 1P34C 3REHB 3AZLA 4R8PA 4J8VA 3AZFB 3B6GC 5B40D 5JRGC 4H9OB 3X1UD 4ZUXB 3REIA 4Z66B 3MGSC 3AZHD 2F8NA 2PYOC 3MGRB 5AVCB 5B0YD 3W96A 2YFWB 3V9RA 1M18C 3B6FC 2NZDD 3AZKD 4KGCA 5BO0A 5CP6D 5DNMB 4J8UB 1BH8B 1AOIC 4J8WC 4H9PA 3A6NB 5E5AA 4J8XC 3X1SA 5BT1D 4CAYB 1P3OB 3AZMD 3LJAB 3C1BB 3C1CA 5B32B 4JJNB 1P3BA 3AZIB 3AV2C 3REJC 1KX4B 3LELB 5AV5C 4NE5A 3MGRD 1ID3A 5AVCD 1P3FB 3UTAD 4H9QA 3X1UA 5DNMD 4J8UD 3LZ1C 4XUJC 5B24A 3WAAB 5B0ZC 5FUGB 3MVDD 3A6ND 1U35C 3NQUA 5B0YA 2CWEA 3AN2A 3AV1C 3MGQB 3AZKA 5GXQC 5AV8A 3C1BD 5B32D 4CSRA 4WU9C 4AWLB 3AZID 4XZQB 4H9SC 2YFVB 5CPKD 3UTBC 3LELD 1P3PC 4X23B 2CV5D 3REHA 1ULYA 1KU5A 4R8PC 5AVBB 4J8VC 3AZLC 3AZNB 3AZFA 5B1LD 1P3AD 2AROD 3REIC 4H9OA 4H9RB 4ZUXA 4WZSB 4Z66A 1M19B 4WU8A 5B31A 3X1VB 5AVCA 3W96C 3W99B 3WKJB 1P3ID 2YFWA 3W98B 5BNVB 4YM6D 4QLCB 4KUDB 4KGCC 3WTPE 1M1AD 5DNMA 4J8UA 3X1TB 1BH8A 3TU4B 4HGAC 5E5AC 3A6NA 3MGPB 3X1SC 1ZLAB 5GT0B 3AZND 5AVBD 4CAYA 1P3OA 3LJAA 3C1CC 5B2IB 1P3BC 4JJNA 3AZGA 2HIOB 3AZIA 1P34A 3LZ0D 1KX4A 5F99D 3W97B 5B2JB 1ID3C 1N1JB 3W99D 3VH6T 5C3IC 1P3FA 3W98D 2FJ7B 3X1UC 5AV6B 5BNXB 3X1TD 5B24C 3TU4D 3WAAA 5FUGA 5B0YC 1P3KB 1ZLAD 3AN2C 3REKD 3MGQA 1EQZD 3AZKC 5AV8C 5B2ID 5DNNB 1KX3D 2HIOD 2NQBD 4XZQA 2YFVA 2L5AA 1WWIA 1F66B 4WV4B 4X23A 3REHC 4LD9D 3MNNB 3AZNA 5AVBA 3AZFC 4DRBA 3AV2A 4ZUXC 4H9RA 4Z66C 1BH9B 1M19A 3KUYD 1TAFB 3X1VA 5AVCC 1P3KD 3W99A 3WKJA 5B40B 3W98A 5BNVA 4QLCA 4KUDA 3AZHB 5DNND 5DNMC 4J8UC 3X1TA 3A6NC 1F66D 3MGPA 3AV1A 1WWSA 2NZDB 1ZLAA 5CP6B 5GT0A 3MNND 1P3OC 3LJAC 3C1BC 3RELB 5B32C 5B2IA 4JJNC 2BYKB 1HTAA 3AZIC 1KX4C 3W97A 3LELC 5B2JA 1N1JA 2F8NK 1P3FC 3AZMB 3B0CW 3AZJB 2FJ7A 1KX5D 5B33D 2IO5B 5AV6A 5BNXA 3AZEB 3WAAC 3UTAB 1P3KA 4ZBJB 3MGQC 3VH5T 3RELD 3MVDB 4AWLC 4XZQC 4X23C 1P3LD 3AZNC 2F8NG 5AVBC 3AZJD 1P3MD 5CPKB 1S32D 1M19C 1BH9A 2CV5B 3AZED 3X1VC 1TAFA 3WKJC 3W99C 1P3GD 3W98C 5BS7A 5B1LB 5B40A 2AROB 5AY8D 1P3AB 4QLCC 4KUDC 5GSUD 3AZHA 3X1TC 5GT3B 3TU4C 4G91B 1H3OB 3UT9B
chains in the Genus database with same CATH superfamily
3MGPC 2NZDA 1HQ3B 4YM6B 1ZLAC 2JCHA 5GT0C 5CP6A 1M1AB 5B2IC 2BYKA 2HIOC 3KWQD 2W8SA 3W97C 5B2JC 3F6TA 3AZMA 3WA9D 1R4VA 4YS3D 2FJ7C 3AZJA 1Z2CB 3B0CT 3LZ0B 5F99B 5AV6C 5GT3D 3MGRA 5AV9D 5CPID 3UT9D 3UTAA 1P3KC 1HQ3D 3O62D 3EPHA 1JFIB 2Y2QA 3EG5B 5DNNC 3MVDA 2Y2OA 3REKB 1F66C 1EQZB 3AFAB 3MNNC 3C1BA 1KX3B 5B32A 5B31G 2NQBB 4G92B 3MGSD 5CPKA 1B6WA 3LELA 2RVQD 2CV5A 4LD9B 3B6FD 4KHAB 5CHLB 5BS7C 5B40C 5B1LA 1P3AA 2AROA 1AOID 4J8WD 1U35B 4J8XD 3NQJB 3AZHC 3KUYB 2F8NH 5GT3A 2BYMB 1H3OA 3UT9A 1P3IA 2NZDC 1TZYB 1HQ3A 4YM6A 3AFAD 1T3UA 5CP6C 1M1AA 3RELC 5CPJB 5BT1C 3AZMC 3AZJC 3LZ1D 3R45B 3LZ0A 2IO5C 5F99A 5B0ZD 1U35D 3MGRC 3AZEC 3UTAC 4NFTA 3WTPB 1TZYD 1KX5B 5GXQD 5B33B 4ZBJC 4Z2MG 1JFIA 4WU9D 3B0DB 3UTBD 4EO5B 1P3PD 3TU4A 3AYWB 3MVDC 5CPJD 4UUZB 4R8PD 3REKA 1EQZA 3AFAA 3REID 1KX3A 2HIOA 2NQBA 5CPKC 2F8ND 5B1MB 4H9QB 2CV5C 1A7WA 1P3LB 4LD9A 3KSYA 4Z5TB 3WTPD 1P3MB 4KGCD 5KDMB 5B1LC 1P3AC 2AROC 1S32B 3A1IA 4UPKA 5E5AD 3NQJA 3AYWD 1W2EA 3KUYA 4M6BA 5GT3C 3X1SD 1P3IB 4G91C 2BYMA 3UT9C 1P3GB 1P3IC 5AY8B 2Y2HA 1HQ3C 4YM6C 3C1CD 5GSUB 1P3BD 3KXBB 1M1AC 5DNNA 1ID3D 5B1MD 1F66A 5CPJA 4E45A 4Z5TD 3MNNA 5JA4B 4WNNB 4NE6A 5B24D 4WU8B 3KWQB 3R45A 3LZ0C 5F99C 5B31B 1Q9CA 2RVQC 3AN2D 3WA9B 4YS3B 3WTPA 2HUEB 5AV8D 5B33A 1KX5A 3KXBD 5AV9B 5CPIB 3AYWA 3REHD 4UUZA 3O62B 3REKC 1EQZC 3AZFD 3AFAC 3AZGB 4ZUXD 3RELA 4Z66D 1P34B 1KX3C 2NQBC 4G92C 3VH6W 4WU8D 4Z2MH 5B31D 5B1MA 3B6GB 3IP4C 4LD9C 1P3LA 5JRGB 4H9NB 4Z5TA 1P3MA 5KDMA 3MGSB 5G49B 2PYOB 1S32A 3KUYC 3AZEA 1M18B 3B6FB 3VH6A 1P3GA 1TZYC 5AY8A 3LJAD 1P3OD 1AOIB 4J8WB 5GSUA 4JJND 3KXBA 3AZGD 4J8XB 1P34D 1KX4D 5CPJC 1P3FD 3H0LC 3B6GD 5JRGD 3AV2B 5JA4A 4WNNA 3REJB 2PYOD 5AV5B 4DRAA 3KWQA 2XD1A 3H0MC 1F1EA 3WAAD 4NE3A 1M18D 3MGQD 3WA9A 2Y2PA 3WTPC 4YS3A 3LZ1B 4XUJB 1KX5C 5B33C 5B0ZB 3B0DC 4XZQD 4EO5C 1B67A 5AV9A 3AYWC 4X23D 3AV1B 5CPIA 5B32G 5GXQB 3O62A 2J8PA 4WU9B 3AV2D 3REJD 3UTBB 1P3PB 1BFMA 5AV5D 1M19D 3X1VD 3AZLB 5B1MC 3B0BA 4R8PB 4J8VB 3WKJD 3B6GA 1P3LC 3REIB 5JRGA 2ZY4A 4Z5TC 4QLCD 4H9NA 1P3MC 4KUDD 4XUJD 3MGSA 2F8NB 5G49A 2LY8A 3EPJA 1S32C 2PYOA 3W96B 3V9RB 2Y2NA 3MGPD 3AV1D 1M18A 3B6FA 4KGCB 3VH5W 1P3GC 5BO0B 5GT0D 2G5HC 5AY8C 4H9PB 5GSUC 4J8WA 3KXBC 4HGAB 5E5AB 1AOIA 4J8XA 2Y2GA 3X1SB 3W97D 5B2JD 1PZRA 2Y2IA 3AZLD 4J8VD 3C1CB 1P3BB 2FJ7D 4E44A 3REJA 5AV6D 3VH5A 1ID3B 5AV5A 3KWQC 4WU8C 3W96D 5C3IB 5B31C 4KHAA 3WA9C 3X1UB 4YS3C 5B24B 2HUEC 4XUJA 3LZ1A 5B0ZA 1U35A 3NQUB 5B0YB 3AN2B 5AV9C 5CPIC 2ZY3A 3AZKB 1TZYA 5AV8B 3O62C 5GXQA 4CSRB 4WU9A 4H9SA 3AZGC 2JSSA 2JE5A 3UTBA 1P3PA 1P34C 3REHB 3AZLA 4R8PA 4J8VA 3AZFB 3B6GC 3KFUG 5B40D 5JRGC 4H9OB 3X1UD 4ZUXB 3REIA 4Z66B 3MGSC 3AZHD 2F8NA 2PYOC 3MGRB 5AVCB 5B0YD 3W96A 2YFWB 3V9RA 1M18C 3B6FC 2NZDD 3A1KA 3AZKD 4KGCA 5BO0A 5CP6D 5DNMB 4J8UB 1BH8B 2ZM5A 1AOIC 4J8WC 4H9PA 3A6NB 5E5AA 4J8XC 2XD5A 3X1SA 5BT1D 4CAYB 1P3OB 3AZMD 3LJAB 3C1BB 3C1CA 5B32B 4JJNB 1P3BA 3AZIB 3AV2C 3REJC 1KX4B 3LELB 5AV5C 4NE5A 3MGRD 1ID3A 5AVCD 1P3FB 3AL0C 3UTAD 4H9QA 3EPKA 3X1UA 5DNMD 3P5JB 4J8UD 3LZ1C 4XUJC 5B24A 3WAAB 5B0ZC 5FUGB 3MVDD 3A6ND 1U35C 3NQUA 5B0YA 2ZY2A 2CWEA 3AN2A 3AV1C 3MGQB 3AZKA 3EPLA 5GXQC 5AV8A 3C1BD 5B32D 4CSRA 4WU9C 4AWLB 3AZID 4XZQB 4H9SC 2YFVB 5CPKD 3UTBC 3LELD 1P3PC 4X23B 2CV5D 2F2AC 3REHA 1ULYA 1KU5A 4R8PC 5AVBB 4J8VC 3AZLC 3AZNB 3AZFA 5B1LD 1P3AD 2AROD 3REIC 4H9OA 4H9RB 4ZUXA 4WZSB 4Z66A 2ZY5A 1M19B 4WJ3C 4WU8A 5B31A 3X1VB 5AVCA 3W96C 3W99B 3WKJB 1P3ID 2YFWA 3W98B 5BNVB 4YM6D 4QLCB 4KUDB 4KGCC 3WTPE 2Y2LA 5DNMA 4J8UA 3X1TB 1M1AD 1BH8A 3TU4B 4HGAC 5E5AC 3A6NA 3MGPB 3X1SC 1ZLAB 5GT0B 3AZND 5AVBD 4CAYA 1P3OA 2DF4C 3LJAA 3C1CC 5B2IB 1P3BC 4JJNA 3AZGA 2HIOB 3AZIA 1P34A 3LZ0D 1KX4A 5F99D 3W97B 5B2JB 1ID3C 1N1JB 3W99D 3VH6T 5C3IC 1P3FA 3W98D 2FJ7B 3X1UC 5AV6B 5BNXB 3X1TD 5B24C 3TU4D 3WAAA 5FUGA 5B0YC 1P3KB 1ZLAD 3AN2C 3REKD 3MGQA 1EQZD 2RIQA 3AZKC 5AV8C 5B2ID 5DNNB 1KX3D 2HIOD 2NQBD 2DQNC 4XZQA 2YFVA 2L5AA 1WWIA 1F66B 4WV4B 4X23A 3REHC 4LD9D 3FDDA 3MNNB 3AZNA 5AVBA 3AZFC 4DRBA 3AV2A 2Y2MA 4ZUXC 4H9RA 4Z66C 1BH9B 1M19A 3KUYD 1TAFB 3X1VA 5AVCC 1P3KD 3W99A 3WKJA 5B40B 3W98A 5BNVA 4QLCA 4KUDA 3AZHB 5DNND 5DNMC 4J8UC 3X1TA 2UWXA 2Y2JA 3A6NC 1F66D 3MGPA 3AV1A 1WWSA 2NZDB 1ZLAA 2BG1A 2VQRA 5CP6B 5GT0A 3MNND 1P3OC 3LJAC 3C1BC 3RELB 5B32C 5B2IA 4JJNC 2BYKB 1HTAA 3AZIC 1KX4C 3W97A 3LELC 5B2JA 1N1JA 2F8NK 1P3FC 3AZMB 3B0CW 4DQYB 3AZJB 2FJ7A 1KX5D 5B33D 2IO5B 5AV6A 5BNXA 3AZEB 3WAAC 3UTAB 1P3KA 4ZBJB 3MGQC 2G5IC 3VH5T 3RELD 3MVDB 4AWLC 4XZQC 2FFFB 4X23C 1P3LD 3AZNC 2F8NG 5AVBC 3AZJD 1P3MD 5CPKB 1S32D 2Y2KA 1M19C 1BH9A 2CV5B 3AZED 3X1VC 1TAFA 3WKJC 3W99C 1P3GD 3W98C 5BS7A 5B1LB 5B40A 2AROB 5AY8D 1P3AB 4QLCC 4KUDC 5GSUD 3AZHA 3X1TC 5GT3B 3H0RC 3TU4C 4G91B 1H3OB 3UT9B
chains in the Genus database with same CATH topology
3MGPC 2NZDA 1HQ3B 4YM6B 1ZLAC 2JCHA 5GT0C 5CP6A 1M1AB 5B2IC 2BYKA 2HIOC 3KWQD 2W8SA 3W97C 5B2JC 3F6TA 3AZMA 3WA9D 1R4VA 4YS3D 2FJ7C 3AZJA 1Z2CB 3B0CT 3LZ0B 5F99B 5AV6C 5GT3D 3MGRA 5AV9D 5CPID 3UT9D 3UTAA 1P3KC 1HQ3D 3O62D 3EPHA 1JFIB 2Y2QA 3EG5B 5DNNC 3MVDA 2Y2OA 3REKB 1F66C 1EQZB 3AFAB 3MNNC 3C1BA 1KX3B 5B32A 5B31G 2NQBB 4G92B 3MGSD 5CPKA 1B6WA 3LELA 2RVQD 2CV5A 4LD9B 3B6FD 4KHAB 5CHLB 5BS7C 5B40C 5B1LA 1P3AA 2AROA 1AOID 4J8WD 1U35B 4J8XD 3NQJB 3AZHC 3KUYB 2F8NH 5GT3A 2BYMB 1H3OA 3UT9A 1P3IA 2NZDC 1TZYB 1HQ3A 4YM6A 3AFAD 1T3UA 5CP6C 1M1AA 3RELC 5CPJB 5BT1C 3AZMC 3AZJC 3LZ1D 3R45B 3LZ0A 2IO5C 5F99A 5B0ZD 1U35D 3MGRC 3AZEC 3UTAC 4NFTA 3WTPB 1TZYD 1KX5B 5GXQD 5B33B 4ZBJC 4Z2MG 1JFIA 4WU9D 3B0DB 3UTBD 4EO5B 1P3PD 3TU4A 3AYWB 3MVDC 5CPJD 4UUZB 4R8PD 3REKA 1EQZA 3AFAA 3REID 1KX3A 2HIOA 2NQBA 5CPKC 2F8ND 5B1MB 4H9QB 2CV5C 1A7WA 1P3LB 4LD9A 3KSYA 4Z5TB 3WTPD 1P3MB 4KGCD 5KDMB 5B1LC 1P3AC 2AROC 1S32B 3A1IA 4UPKA 5E5AD 3NQJA 3AYWD 1W2EA 3KUYA 4M6BA 5GT3C 3X1SD 1P3IB 4G91C 2BYMA 3UT9C 1P3GB 1P3IC 5AY8B 2Y2HA 1HQ3C 4YM6C 3C1CD 5GSUB 1P3BD 3KXBB 1M1AC 5DNNA 1ID3D 5B1MD 1F66A 5CPJA 4E45A 4Z5TD 3MNNA 5JA4B 4WNNB 4NE6A 5B24D 4WU8B 3KWQB 3R45A 3LZ0C 5F99C 5B31B 1Q9CA 2RVQC 3AN2D 3WA9B 4YS3B 3WTPA 2HUEB 5AV8D 5B33A 1KX5A 3KXBD 5AV9B 5CPIB 3AYWA 3REHD 4UUZA 3O62B 3REKC 1EQZC 3AZFD 3AFAC 3AZGB 4ZUXD 3RELA 4Z66D 1P34B 1KX3C 2NQBC 4G92C 3VH6W 4WU8D 4Z2MH 5B31D 5B1MA 3B6GB 3IP4C 4LD9C 1P3LA 5JRGB 4H9NB 4Z5TA 1P3MA 5KDMA 3MGSB 5G49B 2PYOB 1S32A 3KUYC 3AZEA 1M18B 3B6FB 3VH6A 1P3GA 1TZYC 5AY8A 3LJAD 1P3OD 1AOIB 4J8WB 5GSUA 4JJND 3KXBA 3AZGD 4J8XB 1P34D 1KX4D 5CPJC 1P3FD 3H0LC 3B6GD 5JRGD 3AV2B 5JA4A 4WNNA 3REJB 2PYOD 5AV5B 4DRAA 3KWQA 2XD1A 3H0MC 1F1EA 3WAAD 4NE3A 1M18D 3MGQD 3WA9A 2Y2PA 3WTPC 4YS3A 3LZ1B 4XUJB 1KX5C 5B33C 5B0ZB 3B0DC 4XZQD 4EO5C 1B67A 5AV9A 3AYWC 4X23D 3AV1B 5CPIA 5B32G 5GXQB 3O62A 2J8PA 4WU9B 3AV2D 3REJD 3UTBB 1P3PB 1BFMA 5AV5D 1M19D 3X1VD 3AZLB 5B1MC 3B0BA 4R8PB 4J8VB 3WKJD 3B6GA 1P3LC 3REIB 5JRGA 2ZY4A 4Z5TC 4QLCD 4H9NA 1P3MC 4KUDD 4XUJD 3MGSA 2F8NB 5G49A 2LY8A 3EPJA 1S32C 2PYOA 3W96B 3V9RB 2Y2NA 3MGPD 3AV1D 1M18A 3B6FA 4KGCB 3VH5W 1P3GC 5BO0B 5GT0D 2G5HC 5AY8C 4H9PB 5GSUC 4J8WA 3KXBC 4HGAB 5E5AB 1AOIA 4J8XA 2Y2GA 3X1SB 3W97D 5B2JD 1PZRA 2Y2IA 3AZLD 4J8VD 3C1CB 1P3BB 2FJ7D 4E44A 3REJA 5AV6D 3VH5A 1ID3B 5AV5A 3KWQC 4WU8C 3W96D 5C3IB 5B31C 4KHAA 3WA9C 3X1UB 4YS3C 5B24B 2HUEC 4XUJA 3LZ1A 5B0ZA 1U35A 3NQUB 5B0YB 3AN2B 5AV9C 5CPIC 2ZY3A 3AZKB 1TZYA 5AV8B 3O62C 5GXQA 4CSRB 4WU9A 4H9SA 3AZGC 2JSSA 2JE5A 3UTBA 1P3PA 1P34C 3REHB 3AZLA 4R8PA 4J8VA 3AZFB 3B6GC 3KFUG 5B40D 5JRGC 4H9OB 3X1UD 4ZUXB 3REIA 4Z66B 3MGSC 3AZHD 2F8NA 2PYOC 3MGRB 5AVCB 5B0YD 3W96A 2YFWB 3V9RA 1M18C 3B6FC 2NZDD 3A1KA 3AZKD 4KGCA 5BO0A 5CP6D 5DNMB 4J8UB 1BH8B 2ZM5A 1AOIC 4J8WC 4H9PA 3A6NB 5E5AA 4J8XC 2XD5A 3X1SA 5BT1D 4CAYB 1P3OB 3AZMD 3LJAB 3C1BB 3C1CA 5B32B 4JJNB 1P3BA 3AZIB 3AV2C 3REJC 1KX4B 3LELB 5AV5C 4NE5A 3MGRD 1ID3A 5AVCD 1P3FB 3AL0C 3UTAD 4H9QA 3EPKA 3X1UA 5DNMD 3P5JB 4J8UD 3LZ1C 4XUJC 5B24A 3WAAB 5B0ZC 5FUGB 3MVDD 3A6ND 1U35C 3NQUA 5B0YA 2ZY2A 2CWEA 3AN2A 3AV1C 3MGQB 3AZKA 3EPLA 5GXQC 5AV8A 3C1BD 5B32D 4CSRA 4WU9C 4AWLB 3AZID 4XZQB 4H9SC 2YFVB 5CPKD 3UTBC 3LELD 1P3PC 4X23B 2CV5D 2F2AC 3REHA 1ULYA 1KU5A 4R8PC 5AVBB 4J8VC 3AZLC 3AZNB 3AZFA 5B1LD 1P3AD 2AROD 3REIC 4H9OA 4H9RB 4ZUXA 4WZSB 4Z66A 2ZY5A 1M19B 4WJ3C 4WU8A 5B31A 3X1VB 5AVCA 3W96C 3W99B 3WKJB 1P3ID 2YFWA 3W98B 5BNVB 4YM6D 4QLCB 4KUDB 4KGCC 3WTPE 2Y2LA 5DNMA 4J8UA 3X1TB 1M1AD 1BH8A 3TU4B 4HGAC 5E5AC 3A6NA 3MGPB 3X1SC 1ZLAB 5GT0B 3AZND 5AVBD 4CAYA 1P3OA 2DF4C 3LJAA 3C1CC 5B2IB 1P3BC 4JJNA 3AZGA 2HIOB 3AZIA 1P34A 3LZ0D 1KX4A 5F99D 3W97B 5B2JB 1ID3C 1N1JB 3W99D 3VH6T 5C3IC 1P3FA 3W98D 2FJ7B 3X1UC 5AV6B 5BNXB 3X1TD 5B24C 3TU4D 3WAAA 5FUGA 5B0YC 1P3KB 1ZLAD 3AN2C 3REKD 3MGQA 1EQZD 2RIQA 3AZKC 5AV8C 5B2ID 5DNNB 1KX3D 2HIOD 2NQBD 2DQNC 4XZQA 2YFVA 2L5AA 1WWIA 1F66B 4WV4B 4X23A 3REHC 4LD9D 3FDDA 3MNNB 3AZNA 5AVBA 3AZFC 4DRBA 3AV2A 2Y2MA 4ZUXC 4H9RA 4Z66C 1BH9B 1M19A 3KUYD 1TAFB 3X1VA 5AVCC 1P3KD 3W99A 3WKJA 5B40B 3W98A 5BNVA 4QLCA 4KUDA 3AZHB 5DNND 5DNMC 4J8UC 3X1TA 2UWXA 2Y2JA 3A6NC 1F66D 3MGPA 3AV1A 1WWSA 2NZDB 1ZLAA 2BG1A 2VQRA 5CP6B 5GT0A 3MNND 1P3OC 3LJAC 3C1BC 3RELB 5B32C 5B2IA 4JJNC 2BYKB 1HTAA 3AZIC 1KX4C 3W97A 3LELC 5B2JA 1N1JA 2F8NK 1P3FC 3AZMB 3B0CW 4DQYB 3AZJB 2FJ7A 1KX5D 5B33D 2IO5B 5AV6A 5BNXA 3AZEB 3WAAC 3UTAB 1P3KA 4ZBJB 3MGQC 2G5IC 3VH5T 3RELD 3MVDB 4AWLC 4XZQC 2FFFB 4X23C 1P3LD 3AZNC 2F8NG 5AVBC 3AZJD 1P3MD 5CPKB 1S32D 2Y2KA 1M19C 1BH9A 2CV5B 3AZED 3X1VC 1TAFA 3WKJC 3W99C 1P3GD 3W98C 5BS7A 5B1LB 5B40A 2AROB 5AY8D 1P3AB 4QLCC 4KUDC 5GSUD 3AZHA 3X1TC 5GT3B 3H0RC 3TU4C 4G91B 1H3OB 3UT9B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MGP C;  2NZD A;  1HQ3 B;  4YM6 B;  1ZLA C;  5GT0 C;  5CP6 A;  1M1A B;  5B2I C;  2BYK A;  2HIO C;  3KWQ D;  3W97 C;  5B2J C;  3AZM A;  3WA9 D;  1R4V A;  4YS3 D;  2FJ7 C;  3AZJ A;  3B0C T;  3LZ0 B;  5F99 B;  5AV6 C;  5GT3 D;  3MGR A;  5AV9 D;  5CPI D;  3UT9 D;  3UTA A;  1P3K C;  1HQ3 D;  3O62 D;  1JFI B;  5DNN C;  3MVD A;  3REK B;  1F66 C;  1EQZ B;  3AFA B;  3MNN C;  3C1B A;  1KX3 B;  5B32 A;  5B31 G;  2NQB B;  4G92 B;  3MGS D;  5CPK A;  1B6W A;  3LEL A;  2RVQ D;  2CV5 A;  4LD9 B;  3B6F D;  4KHA B;  5CHL B;  5BS7 C;  5B40 C;  5B1L A;  1P3A A;  2ARO A;  1AOI D;  4J8W D;  1U35 B;  4J8X D;  3NQJ B;  3AZH C;  3KUY B;  2F8N H;  5GT3 A;  2BYM B;  1H3O A;  3UT9 A;  1P3I A;  2NZD C;  1TZY B;  1HQ3 A;  4YM6 A;  3AFA D;  5CP6 C;  1M1A A;  3REL C;  5CPJ B;  5BT1 C;  3AZM C;  3AZJ C;  3LZ1 D;  3R45 B;  3LZ0 A;  2IO5 C;  5F99 A;  5B0Z D;  1U35 D;  3MGR C;  3AZE C;  3UTA C;  4NFT A;  3WTP B;  1TZY D;  1KX5 B;  5GXQ D;  5B33 B;  4ZBJ C;  4Z2M G;  1JFI A;  4WU9 D;  3B0D B;  3UTB D;  4EO5 B;  1P3P D;  3TU4 A;  3AYW B;  3MVD C;  5CPJ D;  4UUZ B;  4R8P D;  3REK A;  1EQZ A;  3AFA A;  3REI D;  1KX3 A;  2HIO A;  2NQB A;  5CPK C;  2F8N D;  5B1M B;  4H9Q B;  2CV5 C;  1A7W A;  1P3L B;  4LD9 A;  3KSY A;  4Z5T B;  3WTP D;  1P3M B;  4KGC D;  5KDM B;  5B1L C;  1P3A C;  2ARO C;  1S32 B;  5E5A D;  3NQJ A;  3AYW D;  3KUY A;  4M6B A;  5GT3 C;  3X1S D;  1P3I B;  4G91 C;  2BYM A;  3UT9 C;  1P3G B;  1P3I C;  5AY8 B;  1HQ3 C;  4YM6 C;  3C1C D;  5GSU B;  1P3B D;  3KXB B;  1M1A C;  5DNN A;  1ID3 D;  5B1M D;  1F66 A;  5CPJ A;  4E45 A;  4Z5T D;  3MNN A;  5JA4 B;  4WNN B;  4NE6 A;  5B24 D;  4WU8 B;  3KWQ B;  3R45 A;  3LZ0 C;  5F99 C;  5B31 B;  1Q9C A;  2RVQ C;  3AN2 D;  3WA9 B;  4YS3 B;  3WTP A;  2HUE B;  5AV8 D;  5B33 A;  1KX5 A;  3KXB D;  5AV9 B;  5CPI B;  3AYW A;  3REH D;  4UUZ A;  3O62 B;  3REK C;  1EQZ C;  3AZF D;  3AFA C;  3AZG B;  4ZUX D;  3REL A;  4Z66 D;  1P34 B;  1KX3 C;  2NQB C;  4G92 C;  3VH6 W;  4WU8 D;  4Z2M H;  5B31 D;  5B1M A;  3B6G B;  4LD9 C;  1P3L A;  5JRG B;  4H9N B;  4Z5T A;  1P3M A;  5KDM A;  3MGS B;  5G49 B;  2PYO B;  1S32 A;  3KUY C;  3AZE A;  1M18 B;  3B6F B;  3VH6 A;  1P3G A;  1TZY C;  5AY8 A;  3LJA D;  1P3O D;  1AOI B;  4J8W B;  5GSU A;  4JJN D;  3KXB A;  3AZG D;  4J8X B;  1P34 D;  1KX4 D;  5CPJ C;  1P3F D;  3B6G D;  5JRG D;  3AV2 B;  5JA4 A;  4WNN A;  3REJ B;  2PYO D;  5AV5 B;  4DRA A;  3KWQ A;  3WAA D;  1F1E A;  4NE3 A;  1M18 D;  3MGQ D;  3WA9 A;  3WTP C;  4YS3 A;  3LZ1 B;  4XUJ B;  1KX5 C;  5B33 C;  5B0Z B;  3B0D C;  4XZQ D;  4EO5 C;  1B67 A;  5AV9 A;  3AYW C;  4X23 D;  3AV1 B;  5CPI A;  5B32 G;  5GXQ B;  3O62 A;  4WU9 B;  3AV2 D;  3REJ D;  3UTB B;  1P3P B;  1BFM A;  5AV5 D;  1M19 D;  3X1V D;  3AZL B;  5B1M C;  3B0B A;  4R8P B;  4J8V B;  3WKJ D;  3B6G A;  1P3L C;  3REI B;  5JRG A;  4Z5T C;  4QLC D;  4KUD D;  4H9N A;  1P3M C;  4XUJ D;  3MGS A;  2F8N B;  5G49 A;  2LY8 A;  1S32 C;  2PYO A;  3W96 B;  3V9R B;  3MGP D;  3AV1 D;  1M18 A;  3B6F A;  4KGC B;  3VH5 W;  1P3G C;  5BO0 B;  5GT0 D;  5AY8 C;  4H9P B;  5GSU C;  4J8W A;  3KXB C;  4HGA B;  5E5A B;  1AOI A;  4J8X A;  3X1S B;  3W97 D;  5B2J D;  3AZL D;  4J8V D;  3C1C B;  1P3B B;  2FJ7 D;  4E44 A;  3REJ A;  5AV6 D;  3VH5 A;  1ID3 B;  5AV5 A;  3KWQ C;  4WU8 C;  3W96 D;  5C3I B;  5B31 C;  4KHA A;  3WA9 C;  3X1U B;  4YS3 C;  5B24 B;  2HUE C;  4XUJ A;  3LZ1 A;  5B0Z A;  1U35 A;  3NQU B;  5B0Y B;  3AN2 B;  5AV9 C;  5CPI C;  3AZK B;  1TZY A;  5AV8 B;  3O62 C;  5GXQ A;  4CSR B;  4WU9 A;  4H9S A;  3AZG C;  2JSS A;  3UTB A;  1P3P A;  1P34 C;  3REH B;  3AZL A;  4R8P A;  4J8V A;  3AZF B;  3B6G C;  5B40 D;  5JRG C;  4H9O B;  3X1U D;  4ZUX B;  3REI A;  4Z66 B;  3MGS C;  3AZH D;  2F8N A;  2PYO C;  3MGR B;  5AVC B;  5B0Y D;  3W96 A;  2YFW B;  3V9R A;  1M18 C;  3B6F C;  2NZD D;  3AZK D;  4KGC A;  5BO0 A;  5CP6 D;  5DNM B;  4J8U B;  1BH8 B;  1AOI C;  4J8W C;  4H9P A;  3A6N B;  5E5A A;  4J8X C;  3X1S A;  5BT1 D;  4CAY B;  1P3O B;  3AZM D;  3LJA B;  3C1B B;  3C1C A;  5B32 B;  4JJN B;  1P3B A;  3AZI B;  3AV2 C;  3REJ C;  1KX4 B;  3LEL B;  5AV5 C;  4NE5 A;  3MGR D;  1ID3 A;  5AVC D;  1P3F B;  3UTA D;  4H9Q A;  3X1U A;  5DNM D;  4J8U D;  3LZ1 C;  4XUJ C;  5B24 A;  3WAA B;  5B0Z C;  5FUG B;  3MVD D;  3A6N D;  1U35 C;  3NQU A;  5B0Y A;  2CWE A;  3AN2 A;  3AV1 C;  3MGQ B;  3AZK A;  5GXQ C;  5AV8 A;  3C1B D;  5B32 D;  4CSR A;  4WU9 C;  4AWL B;  3AZI D;  4XZQ B;  4H9S C;  2YFV B;  5CPK D;  3UTB C;  3LEL D;  1P3P C;  4X23 B;  2CV5 D;  3REH A;  1ULY A;  1KU5 A;  4R8P C;  5AVB B;  4J8V C;  3AZL C;  3AZN B;  3AZF A;  5B1L D;  1P3A D;  2ARO D;  3REI C;  4H9O A;  4H9R B;  4ZUX A;  4WZS B;  4Z66 A;  1M19 B;  4WU8 A;  5B31 A;  3X1V B;  5AVC A;  3W96 C;  3W99 B;  3WKJ B;  1P3I D;  2YFW A;  3W98 B;  5BNV B;  4YM6 D;  4QLC B;  4KUD B;  4KGC C;  3WTP E;  1M1A D;  5DNM A;  4J8U A;  3X1T B;  1BH8 A;  3TU4 B;  4HGA C;  5E5A C;  3A6N A;  3MGP B;  3X1S C;  1ZLA B;  5GT0 B;  3AZN D;  5AVB D;  4CAY A;  1P3O A;  3LJA A;  3C1C C;  5B2I B;  1P3B C;  4JJN A;  3AZG A;  2HIO B;  3AZI A;  1P34 A;  3LZ0 D;  1KX4 A;  5F99 D;  3W97 B;  5B2J B;  1ID3 C;  1N1J B;  3W99 D;  3VH6 T;  5C3I C;  1P3F A;  3W98 D;  2FJ7 B;  3X1U C;  5AV6 B;  5BNX B;  3X1T D;  5B24 C;  3TU4 D;  3WAA A;  5FUG A;  5B0Y C;  1P3K B;  1ZLA D;  3AN2 C;  3REK D;  3MGQ A;  1EQZ D;  3AZK C;  5AV8 C;  5B2I D;  5DNN B;  1KX3 D;  2HIO D;  2NQB D;  4XZQ A;  2YFV A;  2L5A A;  1WWI A;  1F66 B;  4WV4 B;  4X23 A;  3REH C;  4LD9 D;  3MNN B;  3AZN A;  5AVB A;  3AZF C;  4DRB A;  3AV2 A;  4ZUX C;  4H9R A;  4Z66 C;  1BH9 B;  1M19 A;  3KUY D;  1TAF B;  3X1V A;  5AVC C;  1P3K D;  3W99 A;  3WKJ A;  5B40 B;  3W98 A;  5BNV A;  4QLC A;  4KUD A;  3AZH B;  5DNN D;  5DNM C;  4J8U C;  3X1T A;  3A6N C;  1F66 D;  3MGP A;  3AV1 A;  1WWS A;  2NZD B;  1ZLA A;  5CP6 B;  5GT0 A;  3MNN D;  1P3O C;  3LJA C;  3C1B C;  3REL B;  5B32 C;  5B2I A;  4JJN C;  2BYK B;  1HTA A;  3AZI C;  1KX4 C;  3W97 A;  3LEL C;  5B2J A;  1N1J A;  2F8N K;  1P3F C;  3AZM B;  3B0C W;  3AZJ B;  2FJ7 A;  1KX5 D;  5B33 D;  2IO5 B;  5AV6 A;  5BNX A;  3AZE B;  3WAA C;  3UTA B;  1P3K A;  4ZBJ B;  3MGQ C;  3VH5 T;  3REL D;  3MVD B;  4AWL C;  4XZQ C;  4X23 C;  1P3L D;  3AZN C;  2F8N G;  5AVB C;  3AZJ D;  1P3M D;  5CPK B;  1S32 D;  1M19 C;  1BH9 A;  2CV5 B;  3AZE D;  3X1V C;  1TAF A;  3WKJ C;  3W99 C;  1P3G D;  3W98 C;  5BS7 A;  5B1L B;  5B40 A;  2ARO B;  5AY8 D;  1P3A B;  4QLC C;  4KUD C;  5GSU D;  3AZH A;  3X1T C;  5GT3 B;  3TU4 C;  4G91 B;  1H3O B;  3UT9 B; 
#chains in the Genus database with same CATH topology
 3MGP C;  2NZD A;  1HQ3 B;  4YM6 B;  1ZLA C;  2JCH A;  5GT0 C;  5CP6 A;  1M1A B;  5B2I C;  2BYK A;  2HIO C;  3KWQ D;  2W8S A;  3W97 C;  5B2J C;  3F6T A;  3AZM A;  3WA9 D;  1R4V A;  4YS3 D;  2FJ7 C;  3AZJ A;  1Z2C B;  3B0C T;  3LZ0 B;  5F99 B;  5AV6 C;  5GT3 D;  3MGR A;  5AV9 D;  5CPI D;  3UT9 D;  3UTA A;  1P3K C;  1HQ3 D;  3O62 D;  3EPH A;  1JFI B;  2Y2Q A;  3EG5 B;  5DNN C;  3MVD A;  2Y2O A;  3REK B;  1F66 C;  1EQZ B;  3AFA B;  3MNN C;  3C1B A;  1KX3 B;  5B32 A;  5B31 G;  2NQB B;  4G92 B;  3MGS D;  5CPK A;  1B6W A;  3LEL A;  2RVQ D;  2CV5 A;  4LD9 B;  3B6F D;  4KHA B;  5CHL B;  5BS7 C;  5B40 C;  5B1L A;  1P3A A;  2ARO A;  1AOI D;  4J8W D;  1U35 B;  4J8X D;  3NQJ B;  3AZH C;  3KUY B;  2F8N H;  5GT3 A;  2BYM B;  1H3O A;  3UT9 A;  1P3I A;  2NZD C;  1TZY B;  1HQ3 A;  4YM6 A;  3AFA D;  1T3U A;  5CP6 C;  1M1A A;  3REL C;  5CPJ B;  5BT1 C;  3AZM C;  3AZJ C;  3LZ1 D;  3R45 B;  3LZ0 A;  2IO5 C;  5F99 A;  5B0Z D;  1U35 D;  3MGR C;  3AZE C;  3UTA C;  4NFT A;  3WTP B;  1TZY D;  1KX5 B;  5GXQ D;  5B33 B;  4ZBJ C;  4Z2M G;  1JFI A;  4WU9 D;  3B0D B;  3UTB D;  4EO5 B;  1P3P D;  3TU4 A;  3AYW B;  3MVD C;  5CPJ D;  4UUZ B;  4R8P D;  3REK A;  1EQZ A;  3AFA A;  3REI D;  1KX3 A;  2HIO A;  2NQB A;  5CPK C;  2F8N D;  5B1M B;  4H9Q B;  2CV5 C;  1A7W A;  1P3L B;  4LD9 A;  3KSY A;  4Z5T B;  3WTP D;  1P3M B;  4KGC D;  5KDM B;  5B1L C;  1P3A C;  2ARO C;  1S32 B;  3A1I A;  4UPK A;  5E5A D;  3NQJ A;  3AYW D;  1W2E A;  3KUY A;  4M6B A;  5GT3 C;  3X1S D;  1P3I B;  4G91 C;  2BYM A;  3UT9 C;  1P3G B;  1P3I C;  5AY8 B;  2Y2H A;  1HQ3 C;  4YM6 C;  3C1C D;  5GSU B;  1P3B D;  3KXB B;  1M1A C;  5DNN A;  1ID3 D;  5B1M D;  1F66 A;  5CPJ A;  4E45 A;  4Z5T D;  3MNN A;  5JA4 B;  4WNN B;  4NE6 A;  5B24 D;  4WU8 B;  3KWQ B;  3R45 A;  3LZ0 C;  5F99 C;  5B31 B;  1Q9C A;  2RVQ C;  3AN2 D;  3WA9 B;  4YS3 B;  3WTP A;  2HUE B;  5AV8 D;  5B33 A;  1KX5 A;  3KXB D;  5AV9 B;  5CPI B;  3AYW A;  3REH D;  4UUZ A;  3O62 B;  3REK C;  1EQZ C;  3AZF D;  3AFA C;  3AZG B;  4ZUX D;  3REL A;  4Z66 D;  1P34 B;  1KX3 C;  2NQB C;  4G92 C;  3VH6 W;  4WU8 D;  4Z2M H;  5B31 D;  5B1M A;  3B6G B;  3IP4 C;  4LD9 C;  1P3L A;  5JRG B;  4H9N B;  4Z5T A;  1P3M A;  5KDM A;  3MGS B;  5G49 B;  2PYO B;  1S32 A;  3KUY C;  3AZE A;  1M18 B;  3B6F B;  3VH6 A;  1P3G A;  1TZY C;  5AY8 A;  3LJA D;  1P3O D;  1AOI B;  4J8W B;  5GSU A;  4JJN D;  3KXB A;  3AZG D;  4J8X B;  1P34 D;  1KX4 D;  5CPJ C;  1P3F D;  3H0L C;  3B6G D;  5JRG D;  3AV2 B;  5JA4 A;  4WNN A;  3REJ B;  2PYO D;  5AV5 B;  4DRA A;  3KWQ A;  2XD1 A;  3H0M C;  1F1E A;  3WAA D;  4NE3 A;  1M18 D;  3MGQ D;  3WA9 A;  2Y2P A;  3WTP C;  4YS3 A;  3LZ1 B;  4XUJ B;  1KX5 C;  5B33 C;  5B0Z B;  3B0D C;  4XZQ D;  4EO5 C;  1B67 A;  5AV9 A;  3AYW C;  4X23 D;  3AV1 B;  5CPI A;  5B32 G;  5GXQ B;  3O62 A;  2J8P A;  4WU9 B;  3AV2 D;  3REJ D;  3UTB B;  1P3P B;  1BFM A;  5AV5 D;  1M19 D;  3X1V D;  3AZL B;  5B1M C;  3B0B A;  4R8P B;  4J8V B;  3WKJ D;  3B6G A;  1P3L C;  3REI B;  5JRG A;  2ZY4 A;  4Z5T C;  4QLC D;  4H9N A;  1P3M C;  4KUD D;  4XUJ D;  3MGS A;  2F8N B;  5G49 A;  2LY8 A;  3EPJ A;  1S32 C;  2PYO A;  3W96 B;  3V9R B;  2Y2N A;  3MGP D;  3AV1 D;  1M18 A;  3B6F A;  4KGC B;  3VH5 W;  1P3G C;  5BO0 B;  5GT0 D;  2G5H C;  5AY8 C;  4H9P B;  5GSU C;  4J8W A;  3KXB C;  4HGA B;  5E5A B;  1AOI A;  4J8X A;  2Y2G A;  3X1S B;  3W97 D;  5B2J D;  1PZR A;  2Y2I A;  3AZL D;  4J8V D;  3C1C B;  1P3B B;  2FJ7 D;  4E44 A;  3REJ A;  5AV6 D;  3VH5 A;  1ID3 B;  5AV5 A;  3KWQ C;  4WU8 C;  3W96 D;  5C3I B;  5B31 C;  4KHA A;  3WA9 C;  3X1U B;  4YS3 C;  5B24 B;  2HUE C;  4XUJ A;  3LZ1 A;  5B0Z A;  1U35 A;  3NQU B;  5B0Y B;  3AN2 B;  5AV9 C;  5CPI C;  2ZY3 A;  3AZK B;  1TZY A;  5AV8 B;  3O62 C;  5GXQ A;  4CSR B;  4WU9 A;  4H9S A;  3AZG C;  2JSS A;  2JE5 A;  3UTB A;  1P3P A;  1P34 C;  3REH B;  3AZL A;  4R8P A;  4J8V A;  3AZF B;  3B6G C;  3KFU G;  5B40 D;  5JRG C;  4H9O B;  3X1U D;  4ZUX B;  3REI A;  4Z66 B;  3MGS C;  3AZH D;  2F8N A;  2PYO C;  3MGR B;  5AVC B;  5B0Y D;  3W96 A;  2YFW B;  3V9R A;  1M18 C;  3B6F C;  2NZD D;  3A1K A;  3AZK D;  4KGC A;  5BO0 A;  5CP6 D;  5DNM B;  4J8U B;  1BH8 B;  2ZM5 A;  1AOI C;  4J8W C;  4H9P A;  3A6N B;  5E5A A;  4J8X C;  2XD5 A;  3X1S A;  5BT1 D;  4CAY B;  1P3O B;  3AZM D;  3LJA B;  3C1B B;  3C1C A;  5B32 B;  4JJN B;  1P3B A;  3AZI B;  3AV2 C;  3REJ C;  1KX4 B;  3LEL B;  5AV5 C;  4NE5 A;  3MGR D;  1ID3 A;  5AVC D;  1P3F B;  3AL0 C;  3UTA D;  4H9Q A;  3EPK A;  3X1U A;  5DNM D;  3P5J B;  4J8U D;  3LZ1 C;  4XUJ C;  5B24 A;  3WAA B;  5B0Z C;  5FUG B;  3MVD D;  3A6N D;  1U35 C;  3NQU A;  5B0Y A;  2ZY2 A;  2CWE A;  3AN2 A;  3AV1 C;  3MGQ B;  3AZK A;  3EPL A;  5GXQ C;  5AV8 A;  3C1B D;  5B32 D;  4CSR A;  4WU9 C;  4AWL B;  3AZI D;  4XZQ B;  4H9S C;  2YFV B;  5CPK D;  3UTB C;  3LEL D;  1P3P C;  4X23 B;  2CV5 D;  2F2A C;  3REH A;  1ULY A;  1KU5 A;  4R8P C;  5AVB B;  4J8V C;  3AZL C;  3AZN B;  3AZF A;  5B1L D;  1P3A D;  2ARO D;  3REI C;  4H9O A;  4H9R B;  4ZUX A;  4WZS B;  4Z66 A;  2ZY5 A;  1M19 B;  4WJ3 C;  4WU8 A;  5B31 A;  3X1V B;  5AVC A;  3W96 C;  3W99 B;  3WKJ B;  1P3I D;  2YFW A;  3W98 B;  5BNV B;  4YM6 D;  4QLC B;  4KUD B;  4KGC C;  3WTP E;  2Y2L A;  5DNM A;  4J8U A;  3X1T B;  1M1A D;  1BH8 A;  3TU4 B;  4HGA C;  5E5A C;  3A6N A;  3MGP B;  3X1S C;  1ZLA B;  5GT0 B;  3AZN D;  5AVB D;  4CAY A;  1P3O A;  2DF4 C;  3LJA A;  3C1C C;  5B2I B;  1P3B C;  4JJN A;  3AZG A;  2HIO B;  3AZI A;  1P34 A;  3LZ0 D;  1KX4 A;  5F99 D;  3W97 B;  5B2J B;  1ID3 C;  1N1J B;  3W99 D;  3VH6 T;  5C3I C;  1P3F A;  3W98 D;  2FJ7 B;  3X1U C;  5AV6 B;  5BNX B;  3X1T D;  5B24 C;  3TU4 D;  3WAA A;  5FUG A;  5B0Y C;  1P3K B;  1ZLA D;  3AN2 C;  3REK D;  3MGQ A;  1EQZ D;  2RIQ A;  3AZK C;  5AV8 C;  5B2I D;  5DNN B;  1KX3 D;  2HIO D;  2NQB D;  2DQN C;  4XZQ A;  2YFV A;  2L5A A;  1WWI A;  1F66 B;  4WV4 B;  4X23 A;  3REH C;  4LD9 D;  3FDD A;  3MNN B;  3AZN A;  5AVB A;  3AZF C;  4DRB A;  3AV2 A;  2Y2M A;  4ZUX C;  4H9R A;  4Z66 C;  1BH9 B;  1M19 A;  3KUY D;  1TAF B;  3X1V A;  5AVC C;  1P3K D;  3W99 A;  3WKJ A;  5B40 B;  3W98 A;  5BNV A;  4QLC A;  4KUD A;  3AZH B;  5DNN D;  5DNM C;  4J8U C;  3X1T A;  2UWX A;  2Y2J A;  3A6N C;  1F66 D;  3MGP A;  3AV1 A;  1WWS A;  2NZD B;  1ZLA A;  2BG1 A;  2VQR A;  5CP6 B;  5GT0 A;  3MNN D;  1P3O C;  3LJA C;  3C1B C;  3REL B;  5B32 C;  5B2I A;  4JJN C;  2BYK B;  1HTA A;  3AZI C;  1KX4 C;  3W97 A;  3LEL C;  5B2J A;  1N1J A;  2F8N K;  1P3F C;  3AZM B;  3B0C W;  4DQY B;  3AZJ B;  2FJ7 A;  1KX5 D;  5B33 D;  2IO5 B;  5AV6 A;  5BNX A;  3AZE B;  3WAA C;  3UTA B;  1P3K A;  4ZBJ B;  3MGQ C;  2G5I C;  3VH5 T;  3REL D;  3MVD B;  4AWL C;  4XZQ C;  2FFF B;  4X23 C;  1P3L D;  3AZN C;  2F8N G;  5AVB C;  3AZJ D;  1P3M D;  5CPK B;  1S32 D;  2Y2K A;  1M19 C;  1BH9 A;  2CV5 B;  3AZE D;  3X1V C;  1TAF A;  3WKJ C;  3W99 C;  1P3G D;  3W98 C;  5BS7 A;  5B1L B;  5B40 A;  2ARO B;  5AY8 D;  1P3A B;  4QLC C;  4KUD C;  5GSU D;  3AZH A;  3X1T C;  5GT3 B;  3H0R C;  3TU4 C;  4G91 B;  1H3O B;  3UT9 B; 
#chains in the Genus database with same CATH homology
 3MGP C;  2NZD A;  1HQ3 B;  4YM6 B;  1ZLA C;  2JCH A;  5GT0 C;  5CP6 A;  1M1A B;  5B2I C;  2BYK A;  2HIO C;  3KWQ D;  2W8S A;  3W97 C;  5B2J C;  3F6T A;  3AZM A;  3WA9 D;  1R4V A;  4YS3 D;  2FJ7 C;  3AZJ A;  1Z2C B;  3B0C T;  3LZ0 B;  5F99 B;  5AV6 C;  5GT3 D;  3MGR A;  5AV9 D;  5CPI D;  3UT9 D;  3UTA A;  1P3K C;  1HQ3 D;  3O62 D;  3EPH A;  1JFI B;  2Y2Q A;  3EG5 B;  5DNN C;  3MVD A;  2Y2O A;  3REK B;  1F66 C;  1EQZ B;  3AFA B;  3MNN C;  3C1B A;  1KX3 B;  5B32 A;  5B31 G;  2NQB B;  4G92 B;  3MGS D;  5CPK A;  1B6W A;  3LEL A;  2RVQ D;  2CV5 A;  4LD9 B;  3B6F D;  4KHA B;  5CHL B;  5BS7 C;  5B40 C;  5B1L A;  1P3A A;  2ARO A;  1AOI D;  4J8W D;  1U35 B;  4J8X D;  3NQJ B;  3AZH C;  3KUY B;  2F8N H;  5GT3 A;  2BYM B;  1H3O A;  3UT9 A;  1P3I A;  2NZD C;  1TZY B;  1HQ3 A;  4YM6 A;  3AFA D;  1T3U A;  5CP6 C;  1M1A A;  3REL C;  5CPJ B;  5BT1 C;  3AZM C;  3AZJ C;  3LZ1 D;  3R45 B;  3LZ0 A;  2IO5 C;  5F99 A;  5B0Z D;  1U35 D;  3MGR C;  3AZE C;  3UTA C;  4NFT A;  3WTP B;  1TZY D;  1KX5 B;  5GXQ D;  5B33 B;  4ZBJ C;  4Z2M G;  1JFI A;  4WU9 D;  3B0D B;  3UTB D;  4EO5 B;  1P3P D;  3TU4 A;  3AYW B;  3MVD C;  5CPJ D;  4UUZ B;  4R8P D;  3REK A;  1EQZ A;  3AFA A;  3REI D;  1KX3 A;  2HIO A;  2NQB A;  5CPK C;  2F8N D;  5B1M B;  4H9Q B;  2CV5 C;  1A7W A;  1P3L B;  4LD9 A;  3KSY A;  4Z5T B;  3WTP D;  1P3M B;  4KGC D;  5KDM B;  5B1L C;  1P3A C;  2ARO C;  1S32 B;  3A1I A;  4UPK A;  5E5A D;  3NQJ A;  3AYW D;  1W2E A;  3KUY A;  4M6B A;  5GT3 C;  3X1S D;  1P3I B;  4G91 C;  2BYM A;  3UT9 C;  1P3G B;  1P3I C;  5AY8 B;  2Y2H A;  1HQ3 C;  4YM6 C;  3C1C D;  5GSU B;  1P3B D;  3KXB B;  1M1A C;  5DNN A;  1ID3 D;  5B1M D;  1F66 A;  5CPJ A;  4E45 A;  4Z5T D;  3MNN A;  5JA4 B;  4WNN B;  4NE6 A;  5B24 D;  4WU8 B;  3KWQ B;  3R45 A;  3LZ0 C;  5F99 C;  5B31 B;  1Q9C A;  2RVQ C;  3AN2 D;  3WA9 B;  4YS3 B;  3WTP A;  2HUE B;  5AV8 D;  5B33 A;  1KX5 A;  3KXB D;  5AV9 B;  5CPI B;  3AYW A;  3REH D;  4UUZ A;  3O62 B;  3REK C;  1EQZ C;  3AZF D;  3AFA C;  3AZG B;  4ZUX D;  3REL A;  4Z66 D;  1P34 B;  1KX3 C;  2NQB C;  4G92 C;  3VH6 W;  4WU8 D;  4Z2M H;  5B31 D;  5B1M A;  3B6G B;  3IP4 C;  4LD9 C;  1P3L A;  5JRG B;  4H9N B;  4Z5T A;  1P3M A;  5KDM A;  3MGS B;  5G49 B;  2PYO B;  1S32 A;  3KUY C;  3AZE A;  1M18 B;  3B6F B;  3VH6 A;  1P3G A;  1TZY C;  5AY8 A;  3LJA D;  1P3O D;  1AOI B;  4J8W B;  5GSU A;  4JJN D;  3KXB A;  3AZG D;  4J8X B;  1P34 D;  1KX4 D;  5CPJ C;  1P3F D;  3H0L C;  3B6G D;  5JRG D;  3AV2 B;  5JA4 A;  4WNN A;  3REJ B;  2PYO D;  5AV5 B;  4DRA A;  3KWQ A;  2XD1 A;  3H0M C;  1F1E A;  3WAA D;  4NE3 A;  1M18 D;  3MGQ D;  3WA9 A;  2Y2P A;  3WTP C;  4YS3 A;  3LZ1 B;  4XUJ B;  1KX5 C;  5B33 C;  5B0Z B;  3B0D C;  4XZQ D;  4EO5 C;  1B67 A;  5AV9 A;  3AYW C;  4X23 D;  3AV1 B;  5CPI A;  5B32 G;  5GXQ B;  3O62 A;  2J8P A;  4WU9 B;  3AV2 D;  3REJ D;  3UTB B;  1P3P B;  1BFM A;  5AV5 D;  1M19 D;  3X1V D;  3AZL B;  5B1M C;  3B0B A;  4R8P B;  4J8V B;  3WKJ D;  3B6G A;  1P3L C;  3REI B;  5JRG A;  2ZY4 A;  4Z5T C;  4QLC D;  4H9N A;  1P3M C;  4KUD D;  4XUJ D;  3MGS A;  2F8N B;  5G49 A;  2LY8 A;  3EPJ A;  1S32 C;  2PYO A;  3W96 B;  3V9R B;  2Y2N A;  3MGP D;  3AV1 D;  1M18 A;  3B6F A;  4KGC B;  3VH5 W;  1P3G C;  5BO0 B;  5GT0 D;  2G5H C;  5AY8 C;  4H9P B;  5GSU C;  4J8W A;  3KXB C;  4HGA B;  5E5A B;  1AOI A;  4J8X A;  2Y2G A;  3X1S B;  3W97 D;  5B2J D;  1PZR A;  2Y2I A;  3AZL D;  4J8V D;  3C1C B;  1P3B B;  2FJ7 D;  4E44 A;  3REJ A;  5AV6 D;  3VH5 A;  1ID3 B;  5AV5 A;  3KWQ C;  4WU8 C;  3W96 D;  5C3I B;  5B31 C;  4KHA A;  3WA9 C;  3X1U B;  4YS3 C;  5B24 B;  2HUE C;  4XUJ A;  3LZ1 A;  5B0Z A;  1U35 A;  3NQU B;  5B0Y B;  3AN2 B;  5AV9 C;  5CPI C;  2ZY3 A;  3AZK B;  1TZY A;  5AV8 B;  3O62 C;  5GXQ A;  4CSR B;  4WU9 A;  4H9S A;  3AZG C;  2JSS A;  2JE5 A;  3UTB A;  1P3P A;  1P34 C;  3REH B;  3AZL A;  4R8P A;  4J8V A;  3AZF B;  3B6G C;  3KFU G;  5B40 D;  5JRG C;  4H9O B;  3X1U D;  4ZUX B;  3REI A;  4Z66 B;  3MGS C;  3AZH D;  2F8N A;  2PYO C;  3MGR B;  5AVC B;  5B0Y D;  3W96 A;  2YFW B;  3V9R A;  1M18 C;  3B6F C;  2NZD D;  3A1K A;  3AZK D;  4KGC A;  5BO0 A;  5CP6 D;  5DNM B;  4J8U B;  1BH8 B;  2ZM5 A;  1AOI C;  4J8W C;  4H9P A;  3A6N B;  5E5A A;  4J8X C;  2XD5 A;  3X1S A;  5BT1 D;  4CAY B;  1P3O B;  3AZM D;  3LJA B;  3C1B B;  3C1C A;  5B32 B;  4JJN B;  1P3B A;  3AZI B;  3AV2 C;  3REJ C;  1KX4 B;  3LEL B;  5AV5 C;  4NE5 A;  3MGR D;  1ID3 A;  5AVC D;  1P3F B;  3AL0 C;  3UTA D;  4H9Q A;  3EPK A;  3X1U A;  5DNM D;  3P5J B;  4J8U D;  3LZ1 C;  4XUJ C;  5B24 A;  3WAA B;  5B0Z C;  5FUG B;  3MVD D;  3A6N D;  1U35 C;  3NQU A;  5B0Y A;  2ZY2 A;  2CWE A;  3AN2 A;  3AV1 C;  3MGQ B;  3AZK A;  3EPL A;  5GXQ C;  5AV8 A;  3C1B D;  5B32 D;  4CSR A;  4WU9 C;  4AWL B;  3AZI D;  4XZQ B;  4H9S C;  2YFV B;  5CPK D;  3UTB C;  3LEL D;  1P3P C;  4X23 B;  2CV5 D;  2F2A C;  3REH A;  1ULY A;  1KU5 A;  4R8P C;  5AVB B;  4J8V C;  3AZL C;  3AZN B;  3AZF A;  5B1L D;  1P3A D;  2ARO D;  3REI C;  4H9O A;  4H9R B;  4ZUX A;  4WZS B;  4Z66 A;  2ZY5 A;  1M19 B;  4WJ3 C;  4WU8 A;  5B31 A;  3X1V B;  5AVC A;  3W96 C;  3W99 B;  3WKJ B;  1P3I D;  2YFW A;  3W98 B;  5BNV B;  4YM6 D;  4QLC B;  4KUD B;  4KGC C;  3WTP E;  2Y2L A;  5DNM A;  4J8U A;  3X1T B;  1M1A D;  1BH8 A;  3TU4 B;  4HGA C;  5E5A C;  3A6N A;  3MGP B;  3X1S C;  1ZLA B;  5GT0 B;  3AZN D;  5AVB D;  4CAY A;  1P3O A;  2DF4 C;  3LJA A;  3C1C C;  5B2I B;  1P3B C;  4JJN A;  3AZG A;  2HIO B;  3AZI A;  1P34 A;  3LZ0 D;  1KX4 A;  5F99 D;  3W97 B;  5B2J B;  1ID3 C;  1N1J B;  3W99 D;  3VH6 T;  5C3I C;  1P3F A;  3W98 D;  2FJ7 B;  3X1U C;  5AV6 B;  5BNX B;  3X1T D;  5B24 C;  3TU4 D;  3WAA A;  5FUG A;  5B0Y C;  1P3K B;  1ZLA D;  3AN2 C;  3REK D;  3MGQ A;  1EQZ D;  2RIQ A;  3AZK C;  5AV8 C;  5B2I D;  5DNN B;  1KX3 D;  2HIO D;  2NQB D;  2DQN C;  4XZQ A;  2YFV A;  2L5A A;  1WWI A;  1F66 B;  4WV4 B;  4X23 A;  3REH C;  4LD9 D;  3FDD A;  3MNN B;  3AZN A;  5AVB A;  3AZF C;  4DRB A;  3AV2 A;  2Y2M A;  4ZUX C;  4H9R A;  4Z66 C;  1BH9 B;  1M19 A;  3KUY D;  1TAF B;  3X1V A;  5AVC C;  1P3K D;  3W99 A;  3WKJ A;  5B40 B;  3W98 A;  5BNV A;  4QLC A;  4KUD A;  3AZH B;  5DNN D;  5DNM C;  4J8U C;  3X1T A;  2UWX A;  2Y2J A;  3A6N C;  1F66 D;  3MGP A;  3AV1 A;  1WWS A;  2NZD B;  1ZLA A;  2BG1 A;  2VQR A;  5CP6 B;  5GT0 A;  3MNN D;  1P3O C;  3LJA C;  3C1B C;  3REL B;  5B32 C;  5B2I A;  4JJN C;  2BYK B;  1HTA A;  3AZI C;  1KX4 C;  3W97 A;  3LEL C;  5B2J A;  1N1J A;  2F8N K;  1P3F C;  3AZM B;  3B0C W;  4DQY B;  3AZJ B;  2FJ7 A;  1KX5 D;  5B33 D;  2IO5 B;  5AV6 A;  5BNX A;  3AZE B;  3WAA C;  3UTA B;  1P3K A;  4ZBJ B;  3MGQ C;  2G5I C;  3VH5 T;  3REL D;  3MVD B;  4AWL C;  4XZQ C;  2FFF B;  4X23 C;  1P3L D;  3AZN C;  2F8N G;  5AVB C;  3AZJ D;  1P3M D;  5CPK B;  1S32 D;  2Y2K A;  1M19 C;  1BH9 A;  2CV5 B;  3AZE D;  3X1V C;  1TAF A;  3WKJ C;  3W99 C;  1P3G D;  3W98 C;  5BS7 A;  5B1L B;  5B40 A;  2ARO B;  5AY8 D;  1P3A B;  4QLC C;  4KUD C;  5GSU D;  3AZH A;  3X1T C;  5GT3 B;  3H0R C;  3TU4 C;  4G91 B;  1H3O B;  3UT9 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...