5DNMA

Nucleosome core particle containing adducts of ruthenium(ii)-toluene pta complex
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
97
structure length
97
Chain Sequence
b'PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGER'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.2
publication title Allosteric cross-talk in chromatin can mediate drug-drug synergy
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Structural protein/dna
total genus 32
structure length 97
sequence length 97
chains with identical sequence E
ec nomenclature
pdb deposition date 2015-09-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5dnmA00
5B2IC 5JA4A 5BNVB 5B1MA 3AZKC 3W96A 3WTPA 3R45B 3LELC 5GSUA 4XZQA 5CPJA 3B6FC 5AV9D 3AZMC 5BS7A 1P3PC 3X1SB 1R4VA 3AN2D 4Z66B 3AZHB 1JFIB 4NE5A 5CPKA 1P3FB 1HQ3C 5GT3A 3AZLA 3UTAB 1S32C 3MGRC 5CPIA 5B0YC 5B2JD 3B6GB 3W97A 4J8VD 3AV2B 5B31D 3V9RA 1N1JB 1P3OB 3AN2B 1M19D 5GXQA 4J8UB 4WV4B 3WA9B 4ZUXA 4WZSB 3UT9C 3AZND 1P3LB 4R8PA 3LZ1C 1M18D 4EO5C 2RVQD 5B2JB 5AV6C 4ZBJC 2YFVA 3C1BC 4J8VB 1ZLAC 4KGCB 5AY8C 3W99A 2AROD 4J8XC 4XUJB 4Z5TD 3AZGC 5B33C 2F8NA 3MGPB 5DNMB 5AVCD 1P3KC 5B40A 1KX3D 1EQZC 3TU4A 1HTAA 1F66D 5GT3C 3AZMB 3KWQC 3C1CC 3REID 4WU8D 5CPIC 1KX4C 1HQ3B 5F99A 5JRGC 3MGQA 4CAYB 3MGRB 4JJND 4E45A 2F8NK 3WKJC 4KHAB 1P3AC 5DNNC 3WTPD 4H9SC 1M1AC 3KSYA 3O62A 1KX3B 1ID3C 3KXBA 1AOIA 2PYOC 5GSUD 5CPJD 4ZUXC 3MGSA 1P34D 1P3BA 2F8NG 2NQBC 4WU8B 3RELC 5CPKD 3UT9B 3B0DC 3AZLD 5AV9A 5KDMA 4ZBJB 5AV8C 1ZLAB 5JA4B 3W97D 3AYWD 5B1MB 3WTPB 3W96B 3AZEC 5B40C 5GSUB 4XZQB 3MVDC 5CPJB 1P3GC 3X1VD 5AVBC 5GT3B 5E5AD 1Q9CA 5B31A 4R8PD 5F99C 3AZLB 4X23A 3MGQC 5CPIB 1KX5D 1M19A 3AZHC 3AZNA 3V9RB 3W99D 4H9QA 2CV5D 4KUDA 3MGSC 2F8ND 5GXQB 3UTAC 1P3MA 4ZUXB 3AV2C 4R8PB 3WAAD 2AROA 4Z5TA 3X1TD 5AV9C 1P3OC 4WU9D 5AVCA 2YFVB 3AN2C 5B31G 3B0DB 5G49A 3W99B 1F66A 3REIA 4NE3A 3AZJA 2F8NB 5B2JC 5B40B 1AOID 3KXBD 4J8VC 3TU4B 4KGCC 4JJNA 1P3BD 4XUJC 4UUZA 5BO0A 1WWIA 1BH9A 5AVBB 3MGPC 4NE6A 5DNMC 5F99B 3LJAA 3MGQB 3AZNC 3MNNA 1P34A 1M18C 2RVQC 3UTBD 5BT1D 1TZYA 1AOIB 3O62B 3B0BA 3AFAD 3MGSB 1P3BB 5B1LD 3LZ0D 3AYWA 5B24A 5AVCC 1KX3C 4X23D 2IO5B 4LD9D 5AV5D 5AV9B 5KDMB 3REIC 4WU8C 2NZDA 3NQJA 3X1VA 5E5AA 1F1EA 4KUDD 1KX5A 1P3MD 1U35A 5B32D 5B1MC 3WTPC 3W96C 2FJ7D 5B31B 4YM6D 2CV5A 5GSUC 4XZQC 5CPJC 2HIOD 3REKD 1M19B 5BS7C 3AZNB 5CPKC 3X1UD 3REJD 3WAAA 4H9RA 1M18B 4Z2MH 3AZLC 3X1TA 5B0ZA 3AZJD 3B6FD 4WU9A 2BYKA 5CP6A 3W97C 1H3OA 2AROB 4Z5TB 3AZFD 3AV1A 3B0CT 5AVCB 5GXQC 3LJAD 3VH6W 1F66B 3MNND 4R8PC 3REIB 3AZJB 3A6NA 1KX5C 4J8WA 1TZYD 1B6WA 3REHA 2HUEB 3W99C 4JJNB 2CV5C 3VH5W 3LZ1D 4UUZB 5BO0B 2BYMA 3UTBA 1BH9B 5B24D 5AV6D 3AFAA 5GT0D 3TU4C 1P34B 5AY8D 4J8XD 2NZDD 5B1LA 3LZ0A 3AZGD 4WU9C 5CPKB 4H9PA 5B33D 4QLCD 4LD9A 5AV5A 1P3ID 3W98A 3KUYD 3C1CD 4M6BA 3AYWB 1U35D 3W97B 1N1JA 5B24B 4G92C 1AOIC 3O62C 3KXBC 5JRGD 3WA9A 1P3BC 5BNXA 2NZDB 3WKJD 3NQJB 5B32A 3X1VB 4YS3D 5E5AB 3AZIA 2FJ7A 1M1AD 4YM6A 5B0ZD 2IO5C 2HIOA 4E44A 3REKA 1KX5B 2NQBD 1U35B 5CP6D 5B2IA 3AZKA 3X1UA 3REJA 2CV5B 3LELA 3AFAC 3AV1D 3B6FA 1P3PA 5B1LC 5AV8D 3LZ0C 2CWEA 3VH6A 3WAAB 4H9RB 5B31C 3X1TB 3AZFA 5B0ZB 4X23C 4H9OA 4LD9C 5AV5C 4H9NA 3A6ND 4CAYA 4WU9B 5B32G 4J8WD 1S32A 5CP6B 1M19C 5B0YA 2F8NH 1H3OB 3REHD 4KHAA 2YFWA 3VH5A 4KUDC 4G92B 3NQUA 1P3MC 1BH8A 3KXBB 4AWLB 5B32C 3X1SD 4Z66D 2FJ7C 4YM6C 1P3FD 2AROC 3LZ1A 4Z5TC 3A6NB 4J8WB 3REKC 3REHB 5AV6A 3B6GD 3C1BA 1KU5A 5GT0A 3X1UC 3REJC 3AV2D 1F66C 1B67A 5AY8A 3UTBB 2BYMB 4J8XA 3W98D 3AZJC 3AZGA 1P3OD 5B33A 1P3KA 4QLCA 4J8UD 3AFAB 3WA9D 1EQZA 2HUEC 4JJNC 3AZFC 1P3IA 1P3LD 3KWQA 5B1LB 3LZ0B 3KUYA 3C1CA 5FUGA 4H9PB 4CSRA 3AZID 1KX4A 3LJAC 4X23B 4LD9B 5JRGA 5AV5B 1WWSA 4KGCD 3MNNC 1P34C 4HGAB 3VH6T 3W98B 4XUJD 3WKJA 5B2ID 1TZYC 4YS3A 1P3AA 5DNNA 3AZKD 4H9QB 4H9SA 5DNMD 1TAFA 3MGPD 1M1AA 1ID3A 3LELD 2PYOA 4KUDB 1A7WA 5BNXB 1P3MB 2NQBA 4WNNA 3AZMD 1P3PD 5B32B 3VH5T 3AYWC 3AZIB 5B24C 3RELA 2FJ7B 4YM6B 1HQ3D 5GT0C 2HIOB 5C3IC 3REKB 1S32D 3MGRD 4G91C 5B0YD 2NZDC 5G49B 5AV8A 5B2IB 3AZKB 3X1VC 3X1UB 3REJB 3AZEA 5E5AC 4QLCC 3LELB 3MVDA 3B6FB 1P3IC 4DRAA 3KUYC 1P3PB 1U35C 1P3GA 2JSSA 5BNVA 5AVBA 3UT9D 3AZFB 4H9OB 4H9NB 3R45A 1S32B 5B0YB 3LJAB 3X1SA 3C1BD 1ZLAD 4YS3C 3MNNB 4Z66A 5B1MD 3AZHA 2YFWB 3WAAC 1JFIA 1P3FA 3X1TC 5B0ZC 4XZQD 3NQUB 1TZYB 3WTPE 1BH8B 3UTAA 5CP6C 1P3KD 3B6GA 1EQZD 3AV2A 5GT3D 3LZ1B 4EO5B 3AV1C 3KWQD 1P3OA 5AV6B 5CPID 1KX4D 3AN2A 3C1BB 1BFMA 4J8UA 4AWLC 5GT0B 5C3IB 5AY8B 4J8XB 3B0CW 4G91B 1P3LA 3AZGB 3A6NC 5B33B 4J8WC 1P3AD 1P3KB 5DNND 5B2JA 5GXQD 4QLCB 3REHC 2PYOD 1ID3D 4J8VA 1EQZB 4KGCA 4ZUXD 1P3IB 3KWQB 3KUYB 3C1CB 3UTBC 5BT1C 5FUGB 4XUJA 4CSRB 4DRBA 1KX4B 3W96D 3RELD 3MGPA 5DNMA 5JRGB 3X1SC 4Z66C 1P3FC 1M18A 3AZMA 3WKJB 1P3AB 4YS3B 5DNNB 1TAFB 1M1AB 3AZED 2PYOB 1ID3B 5B40D 3B6GC 1HQ3A 5CHLB 3MVDD 2LY8A 3TU4D 2BYKB 2NQBB 4HGAC 4WNNB 3MGRA 3W98C 1P3GD 3RELB 5AVBD 2L5AA 4Z2MG 4J8UC 1KX3A 3AV1B 5F99D 3MGQD 4NFTA 1ULYA 3WA9C 1P3LC 5AV8B 4WU8A 3AZEB 3AZIC 3AZHD 3O62D 3UT9A 3MVDB 3MGSD 2HIOC 3UTAD 1P3GB 1ZLAA
chains in the Genus database with same CATH superfamily
5B2IC 5JA4A 5BNVB 5B1MA 3AZKC 3W96A 3WTPA 2Y2PA 3R45B 3LELC 5GSUA 4XZQA 5CPJA 3B6FC 2G5IC 5AV9D 3AZMC 5BS7A 1P3PC 3X1SB 1R4VA 3AN2D 4Z66B 3AZHB 1JFIB 4NE5A 5CPKA 1P3FB 3AL0C 3F6TA 1HQ3C 5GT3A 3AZLA 3UTAB 1S32C 3MGRC 5CPIA 5B0YC 5B2JD 3B6GB 3W97A 4J8VD 3AV2B 5B31D 3V9RA 1N1JB 1P3OB 3AN2B 1M19D 5GXQA 4J8UB 4WV4B 3WA9B 4ZUXA 4WZSB 3UT9C 3AZND 1P3LB 4R8PA 3LZ1C 1M18D 4EO5C 2RVQD 5B2JB 5AV6C 4ZBJC 2YFVA 3C1BC 4J8VB 1ZLAC 4KGCB 3EG5B 5AY8C 3W99A 2AROD 4J8XC 4XUJB 4Z5TD 3AZGC 5B33C 2F8NA 3MGPB 5DNMB 2DF4C 5AVCD 1P3KC 5B40A 1KX3D 2Y2NA 1EQZC 3TU4A 1HTAA 1F66D 5GT3C 3AZMB 3KWQC 3C1CC 3REID 4WU8D 2ZY4A 5CPIC 1KX4C 1HQ3B 5F99A 3A1IA 5JRGC 3MGQA 4CAYB 2XD1A 3MGRB 4JJND 4E45A 2F8NK 3WKJC 4KHAB 1P3AC 5DNNC 3WTPD 4H9SC 1M1AC 3KSYA 3O62A 1KX3B 1ID3C 3KXBA 1AOIA 2PYOC 5GSUD 5CPJD 4ZUXC 3H0MC 1W2EA 3MGSA 1P34D 1P3BA 2F8NG 2NQBC 4WU8B 3A1KA 3RELC 5CPKD 3UT9B 3B0DC 3AZLD 5AV9A 3H0RC 4ZBJB 5KDMA 5AV8C 1ZLAB 5JA4B 3W97D 3AYWD 5B1MB 3WTPB 4DQYB 3W96B 3AZEC 5B40C 5GSUB 4XZQB 3MVDC 5CPJB 3IP4C 1P3GC 3X1VD 5AVBC 5GT3B 5E5AD 1Q9CA 5B31A 4R8PD 5F99C 3AZLB 4X23A 2Y2LA 3MGQC 5CPIB 1KX5D 1M19A 3AZHC 3AZNA 3V9RB 3W99D 4H9QA 2CV5D 4KUDA 3MGSC 2ZM5A 2F8ND 5GXQB 3UTAC 1P3MA 4ZUXB 3AV2C 4R8PB 3WAAD 2AROA 4Z5TA 3X1TD 5AV9C 1P3OC 4WU9D 5AVCA 2YFVB 3AN2C 5B31G 3B0DB 5G49A 3W99B 2RIQA 1F66A 3REIA 4NE3A 3AZJA 2F8NB 5B2JC 5B40B 1AOID 3KXBD 4J8VC 3TU4B 3EPJA 4KGCC 4JJNA 1P3BD 4XUJC 4UUZA 5BO0A 1WWIA 1BH9A 5AVBB 3MGPC 4NE6A 5DNMC 5F99B 3LJAA 3MGQB 2ZY5A 3AZNC 3MNNA 3FDDA 1P34A 1M18C 2RVQC 2Y2HA 3UTBD 5BT1D 3EPHA 1TZYA 1AOIB 3O62B 3B0BA 3AFAD 3MGSB 1P3BB 5B1LD 3LZ0D 3AYWA 5B24A 5AVCC 1KX3C 4X23D 2IO5B 4LD9D 5AV5D 5AV9B 5KDMB 3REIC 4WU8C 2NZDA 3NQJA 3X1VA 2UWXA 5E5AA 1F1EA 4KUDD 1KX5A 1P3MD 1U35A 5B32D 5B1MC 3W96C 3WTPC 2FJ7D 5B31B 4YM6D 2CV5A 2JCHA 5GSUC 4XZQC 5CPJC 2HIOD 3REKD 1M19B 2W8SA 5BS7C 3AZNB 5CPKC 3X1UD 3REJD 3WAAA 4H9RA 1M18B 4Z2MH 3AZLC 3X1TA 2ZY2A 5B0ZA 3AZJD 3B6FD 4WU9A 2BYKA 5CP6A 3W97C 1H3OA 2AROB 4Z5TB 3AZFD 3AV1A 3B0CT 5AVCB 3EPLA 5GXQC 3LJAD 3VH6W 1F66B 3MNND 4R8PC 3REIB 3AZJB 3A6NA 1KX5C 4J8WA 1TZYD 1B6WA 3REHA 2HUEB 3W99C 4JJNB 2CV5C 3VH5W 3LZ1D 4UUZB 5BO0B 2BYMA 3UTBA 1BH9B 5B24D 5AV6D 3AFAA 5GT0D 3TU4C 1P34B 2Y2OA 5AY8D 4J8XD 2NZDD 5B1LA 3LZ0A 3AZGD 4WU9C 5CPKB 2JE5A 4H9PA 5B33D 4QLCD 4LD9A 5AV5A 1P3ID 3W98A 3KUYD 3C1CD 4M6BA 3AYWB 1U35D 3W97B 1N1JA 5B24B 4G92C 2G5HC 1AOIC 3O62C 3KXBC 5JRGD 3WA9A 1P3BC 5BNXA 2NZDB 3WKJD 3NQJB 5B32A 3X1VB 4YS3D 2Y2GA 5E5AB 3AZIA 2FJ7A 1M1AD 4YM6A 2Y2QA 5B0ZD 2IO5C 2HIOA 4E44A 3REKA 1KX5B 2NQBD 1U35B 5CP6D 5B2IA 3AZKA 3X1UA 3REJA 2CV5B 3LELA 3AFAC 2J8PA 3AV1D 3B6FA 1P3PA 5B1LC 5AV8D 3LZ0C 2CWEA 3VH6A 3WAAB 4H9RB 5B31C 3X1TB 3AZFA 5B0ZB 4UPKA 4H9OA 4X23C 4LD9C 5AV5C 4H9NA 3A6ND 4CAYA 4WU9B 5B32G 4J8WD 1S32A 5CP6B 1M19C 5B0YA 2F8NH 1H3OB 3REHD 2Y2MA 4KHAA 2FFFB 2VQRA 2YFWA 3VH5A 4KUDC 2ZY3A 4G92B 3NQUA 1P3MC 1BH8A 3KXBB 4AWLB 5B32C 3X1SD 4Z66D 2FJ7C 4YM6C 1P3FD 2AROC 3LZ1A 4Z5TC 3A6NB 4J8WB 3REKC 3REHB 5AV6A 3EPKA 3B6GD 3C1BA 1KU5A 5GT0A 3X1UC 3REJC 3AV2D 1F66C 1B67A 5AY8A 3UTBB 2BYMB 4J8XA 3W98D 3AZJC 3AZGA 1P3OD 5B33A 1P3KA 4QLCA 4J8UD 3AFAB 3WA9D 1EQZA 3H0LC 2HUEC 4JJNC 3AZFC 1P3IA 1P3LD 3KWQA 5B1LB 3LZ0B 3KUYA 3C1CA 5FUGA 4H9PB 4CSRA 3AZID 1KX4A 3LJAC 4X23B 4LD9B 5JRGA 5AV5B 1WWSA 4KGCD 3MNNC 1P34C 4HGAB 3VH6T 3W98B 4XUJD 3WKJA 5B2ID 1TZYC 4YS3A 1P3AA 5DNNA 3AZKD 4H9QB 4H9SA 5DNMD 1TAFA 3MGPD 1M1AA 1ID3A 3LELD 2PYOA 4KUDB 1A7WA 5BNXB 1P3MB 2NQBA 4WNNA 3AZMD 1P3PD 5B32B 3VH5T 3AYWC 3KFUG 3AZIB 5B24C 3RELA 2FJ7B 4YM6B 1HQ3D 5GT0C 2HIOB 5C3IC 3REKB 2F2AC 1S32D 3MGRD 4G91C 5B0YD 2NZDC 5G49B 5AV8A 5B2IB 3AZKB 3X1VC 3X1UB 3REJB 3AZEA 5E5AC 4QLCC 3LELB 3MVDA 3B6FB 1P3IC 4DRAA 3KUYC 1P3PB 1U35C 1P3GA 2JSSA 5BNVA 2XD5A 5AVBA 3UT9D 3AZFB 3P5JB 4H9OB 3R45A 4H9NB 1S32B 5B0YB 3LJAB 3X1SA 3C1BD 1ZLAD 4YS3C 3MNNB 5B1MD 4Z66A 3AZHA 2YFWB 3WAAC 1JFIA 1P3FA 1Z2CB 3X1TC 5B0ZC 2DQNC 4XZQD 3NQUB 1TZYB 3WTPE 1BH8B 3UTAA 5CP6C 1P3KD 3B6GA 2Y2JA 1EQZD 3AV2A 5GT3D 2Y2IA 3LZ1B 4EO5B 3AV1C 3KWQD 1P3OA 5AV6B 5CPID 1KX4D 3AN2A 3C1BB 1BFMA 4J8UA 4AWLC 5GT0B 5C3IB 5AY8B 4J8XB 3B0CW 4G91B 1P3LA 3AZGB 3A6NC 5B33B 4J8WC 1P3AD 1P3KB 5DNND 5B2JA 5GXQD 4QLCB 3REHC 2PYOD 1ID3D 4J8VA 1EQZB 4KGCA 4ZUXD 1P3IB 2BG1A 3KWQB 3KUYB 3C1CB 3UTBC 5BT1C 5FUGB 4XUJA 4CSRB 4DRBA 1KX4B 3W96D 3RELD 3MGPA 5DNMA 5JRGB 3X1SC 2Y2KA 4Z66C 1PZRA 1P3FC 1M18A 3AZMA 3WKJB 1P3AB 4YS3B 5DNNB 1TAFB 1M1AB 3AZED 2PYOB 1ID3B 5B40D 3B6GC 1HQ3A 5CHLB 3MVDD 2LY8A 3TU4D 2BYKB 2NQBB 4HGAC 4WNNB 3MGRA 3W98C 1P3GD 3RELB 5AVBD 2L5AA 4Z2MG 4J8UC 1KX3A 3AV1B 5F99D 4WJ3C 3MGQD 4NFTA 1ULYA 3WA9C 1P3LC 5AV8B 4WU8A 3AZEB 3AZIC 3AZHD 1T3UA 3O62D 3UT9A 3MVDB 3MGSD 2HIOC 3UTAD 1P3GB 1ZLAA
chains in the Genus database with same CATH topology
5B2IC 5JA4A 5BNVB 5B1MA 3AZKC 3W96A 3WTPA 2Y2PA 3R45B 3LELC 5GSUA 4XZQA 5CPJA 3B6FC 2G5IC 5AV9D 3AZMC 5BS7A 1P3PC 3X1SB 1R4VA 3AN2D 4Z66B 3AZHB 1JFIB 4NE5A 5CPKA 1P3FB 3AL0C 3F6TA 1HQ3C 5GT3A 3AZLA 3UTAB 1S32C 3MGRC 5CPIA 5B0YC 5B2JD 3B6GB 3W97A 4J8VD 3AV2B 5B31D 3V9RA 1N1JB 1P3OB 3AN2B 1M19D 5GXQA 4J8UB 4WV4B 3WA9B 4ZUXA 4WZSB 3UT9C 3AZND 1P3LB 4R8PA 3LZ1C 1M18D 4EO5C 2RVQD 5B2JB 5AV6C 4ZBJC 2YFVA 3C1BC 4J8VB 1ZLAC 4KGCB 3EG5B 5AY8C 3W99A 2AROD 4J8XC 4XUJB 4Z5TD 3AZGC 5B33C 2F8NA 3MGPB 5DNMB 2DF4C 5AVCD 1P3KC 5B40A 1KX3D 2Y2NA 1EQZC 3TU4A 1HTAA 1F66D 5GT3C 3AZMB 3KWQC 3C1CC 3REID 4WU8D 2ZY4A 5CPIC 1KX4C 1HQ3B 5F99A 3A1IA 5JRGC 3MGQA 4CAYB 2XD1A 3MGRB 4JJND 4E45A 2F8NK 3WKJC 4KHAB 1P3AC 5DNNC 3WTPD 4H9SC 1M1AC 3KSYA 3O62A 1KX3B 1ID3C 3KXBA 1AOIA 2PYOC 5GSUD 5CPJD 4ZUXC 3H0MC 1W2EA 3MGSA 1P34D 1P3BA 2F8NG 2NQBC 4WU8B 3A1KA 3RELC 5CPKD 3UT9B 3B0DC 3AZLD 5AV9A 3H0RC 4ZBJB 5KDMA 5AV8C 1ZLAB 5JA4B 3W97D 3AYWD 5B1MB 3WTPB 4DQYB 3W96B 3AZEC 5B40C 5GSUB 4XZQB 3MVDC 5CPJB 3IP4C 1P3GC 3X1VD 5AVBC 5GT3B 5E5AD 1Q9CA 5B31A 4R8PD 5F99C 3AZLB 4X23A 2Y2LA 3MGQC 5CPIB 1KX5D 1M19A 3AZHC 3AZNA 3V9RB 3W99D 4H9QA 2CV5D 4KUDA 3MGSC 2ZM5A 2F8ND 5GXQB 3UTAC 1P3MA 4ZUXB 3AV2C 4R8PB 3WAAD 2AROA 4Z5TA 3X1TD 5AV9C 1P3OC 4WU9D 5AVCA 2YFVB 3AN2C 5B31G 3B0DB 5G49A 3W99B 2RIQA 1F66A 3REIA 4NE3A 3AZJA 2F8NB 5B2JC 5B40B 1AOID 3KXBD 4J8VC 3TU4B 3EPJA 4KGCC 4JJNA 1P3BD 4XUJC 4UUZA 5BO0A 1WWIA 1BH9A 5AVBB 3MGPC 4NE6A 5DNMC 5F99B 3LJAA 3MGQB 2ZY5A 3AZNC 3MNNA 3FDDA 1P34A 1M18C 2RVQC 2Y2HA 3UTBD 5BT1D 3EPHA 1TZYA 1AOIB 3O62B 3B0BA 3AFAD 3MGSB 1P3BB 5B1LD 3LZ0D 3AYWA 5B24A 5AVCC 1KX3C 4X23D 2IO5B 4LD9D 5AV5D 5AV9B 5KDMB 3REIC 4WU8C 2NZDA 3NQJA 3X1VA 2UWXA 5E5AA 1F1EA 4KUDD 1KX5A 1P3MD 1U35A 5B32D 5B1MC 3W96C 3WTPC 2FJ7D 5B31B 4YM6D 2CV5A 2JCHA 5GSUC 4XZQC 5CPJC 2HIOD 3REKD 1M19B 2W8SA 5BS7C 3AZNB 5CPKC 3X1UD 3REJD 3WAAA 4H9RA 1M18B 4Z2MH 3AZLC 3X1TA 2ZY2A 5B0ZA 3AZJD 3B6FD 4WU9A 2BYKA 5CP6A 3W97C 1H3OA 2AROB 4Z5TB 3AZFD 3AV1A 3B0CT 5AVCB 3EPLA 5GXQC 3LJAD 3VH6W 1F66B 3MNND 4R8PC 3REIB 3AZJB 3A6NA 1KX5C 4J8WA 1TZYD 1B6WA 3REHA 2HUEB 3W99C 4JJNB 2CV5C 3VH5W 3LZ1D 4UUZB 5BO0B 2BYMA 3UTBA 1BH9B 5B24D 5AV6D 3AFAA 5GT0D 3TU4C 1P34B 2Y2OA 5AY8D 4J8XD 2NZDD 5B1LA 3LZ0A 3AZGD 4WU9C 5CPKB 2JE5A 4H9PA 5B33D 4QLCD 4LD9A 5AV5A 1P3ID 3W98A 3KUYD 3C1CD 4M6BA 3AYWB 1U35D 3W97B 1N1JA 5B24B 4G92C 2G5HC 1AOIC 3O62C 3KXBC 5JRGD 3WA9A 1P3BC 5BNXA 2NZDB 3WKJD 3NQJB 5B32A 3X1VB 4YS3D 2Y2GA 5E5AB 3AZIA 2FJ7A 1M1AD 4YM6A 2Y2QA 5B0ZD 2IO5C 2HIOA 4E44A 3REKA 1KX5B 2NQBD 1U35B 5CP6D 5B2IA 3AZKA 3X1UA 3REJA 2CV5B 3LELA 3AFAC 2J8PA 3AV1D 3B6FA 1P3PA 5B1LC 5AV8D 3LZ0C 2CWEA 3VH6A 3WAAB 4H9RB 5B31C 3X1TB 3AZFA 5B0ZB 4UPKA 4H9OA 4X23C 4LD9C 5AV5C 4H9NA 3A6ND 4CAYA 4WU9B 5B32G 4J8WD 1S32A 5CP6B 1M19C 5B0YA 2F8NH 1H3OB 3REHD 2Y2MA 4KHAA 2FFFB 2VQRA 2YFWA 3VH5A 4KUDC 2ZY3A 4G92B 3NQUA 1P3MC 1BH8A 3KXBB 4AWLB 5B32C 3X1SD 4Z66D 2FJ7C 4YM6C 1P3FD 2AROC 3LZ1A 4Z5TC 3A6NB 4J8WB 3REKC 3REHB 5AV6A 3EPKA 3B6GD 3C1BA 1KU5A 5GT0A 3X1UC 3REJC 3AV2D 1F66C 1B67A 5AY8A 3UTBB 2BYMB 4J8XA 3W98D 3AZJC 3AZGA 1P3OD 5B33A 1P3KA 4QLCA 4J8UD 3AFAB 3WA9D 1EQZA 3H0LC 2HUEC 4JJNC 3AZFC 1P3IA 1P3LD 3KWQA 5B1LB 3LZ0B 3KUYA 3C1CA 5FUGA 4H9PB 4CSRA 3AZID 1KX4A 3LJAC 4X23B 4LD9B 5JRGA 5AV5B 1WWSA 4KGCD 3MNNC 1P34C 4HGAB 3VH6T 3W98B 4XUJD 3WKJA 5B2ID 1TZYC 4YS3A 1P3AA 5DNNA 3AZKD 4H9QB 4H9SA 5DNMD 1TAFA 3MGPD 1M1AA 1ID3A 3LELD 2PYOA 4KUDB 1A7WA 5BNXB 1P3MB 2NQBA 4WNNA 3AZMD 1P3PD 5B32B 3VH5T 3AYWC 3KFUG 3AZIB 5B24C 3RELA 2FJ7B 4YM6B 1HQ3D 5GT0C 2HIOB 5C3IC 3REKB 2F2AC 1S32D 3MGRD 4G91C 5B0YD 2NZDC 5G49B 5AV8A 5B2IB 3AZKB 3X1VC 3X1UB 3REJB 3AZEA 5E5AC 4QLCC 3LELB 3MVDA 3B6FB 1P3IC 4DRAA 3KUYC 1P3PB 1U35C 1P3GA 2JSSA 5BNVA 2XD5A 5AVBA 3UT9D 3AZFB 3P5JB 4H9OB 3R45A 4H9NB 1S32B 5B0YB 3LJAB 3X1SA 3C1BD 1ZLAD 4YS3C 3MNNB 5B1MD 4Z66A 3AZHA 2YFWB 3WAAC 1JFIA 1P3FA 1Z2CB 3X1TC 5B0ZC 2DQNC 4XZQD 3NQUB 1TZYB 3WTPE 1BH8B 3UTAA 5CP6C 1P3KD 3B6GA 2Y2JA 1EQZD 3AV2A 5GT3D 2Y2IA 3LZ1B 4EO5B 3AV1C 3KWQD 1P3OA 5AV6B 5CPID 1KX4D 3AN2A 3C1BB 1BFMA 4J8UA 4AWLC 5GT0B 5C3IB 5AY8B 4J8XB 3B0CW 4G91B 1P3LA 3AZGB 3A6NC 5B33B 4J8WC 1P3AD 1P3KB 5DNND 5B2JA 5GXQD 4QLCB 3REHC 2PYOD 1ID3D 4J8VA 1EQZB 4KGCA 4ZUXD 1P3IB 2BG1A 3KWQB 3KUYB 3C1CB 3UTBC 5BT1C 5FUGB 4XUJA 4CSRB 4DRBA 1KX4B 3W96D 3RELD 3MGPA 5DNMA 5JRGB 3X1SC 2Y2KA 4Z66C 1PZRA 1P3FC 1M18A 3AZMA 3WKJB 1P3AB 4YS3B 5DNNB 1TAFB 1M1AB 3AZED 2PYOB 1ID3B 5B40D 3B6GC 1HQ3A 5CHLB 3MVDD 2LY8A 3TU4D 2BYKB 2NQBB 4HGAC 4WNNB 3MGRA 3W98C 1P3GD 3RELB 5AVBD 2L5AA 4Z2MG 4J8UC 1KX3A 3AV1B 5F99D 4WJ3C 3MGQD 4NFTA 1ULYA 3WA9C 1P3LC 5AV8B 4WU8A 3AZEB 3AZIC 3AZHD 1T3UA 3O62D 3UT9A 3MVDB 3MGSD 2HIOC 3UTAD 1P3GB 1ZLAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5B2I C;  5JA4 A;  5BNV B;  5B1M A;  3AZK C;  3W96 A;  3WTP A;  3R45 B;  3LEL C;  5GSU A;  4XZQ A;  5CPJ A;  3B6F C;  5AV9 D;  3AZM C;  5BS7 A;  1P3P C;  3X1S B;  1R4V A;  3AN2 D;  4Z66 B;  3AZH B;  1JFI B;  4NE5 A;  5CPK A;  1P3F B;  1HQ3 C;  5GT3 A;  3AZL A;  3UTA B;  1S32 C;  3MGR C;  5CPI A;  5B0Y C;  5B2J D;  3B6G B;  3W97 A;  4J8V D;  3AV2 B;  5B31 D;  3V9R A;  1N1J B;  1P3O B;  3AN2 B;  1M19 D;  5GXQ A;  4J8U B;  4WV4 B;  3WA9 B;  4ZUX A;  4WZS B;  3UT9 C;  3AZN D;  1P3L B;  4R8P A;  3LZ1 C;  1M18 D;  4EO5 C;  2RVQ D;  5B2J B;  5AV6 C;  4ZBJ C;  2YFV A;  3C1B C;  4J8V B;  1ZLA C;  4KGC B;  5AY8 C;  3W99 A;  2ARO D;  4J8X C;  4XUJ B;  4Z5T D;  3AZG C;  5B33 C;  2F8N A;  3MGP B;  5DNM B;  5AVC D;  1P3K C;  5B40 A;  1KX3 D;  1EQZ C;  3TU4 A;  1HTA A;  1F66 D;  5GT3 C;  3AZM B;  3KWQ C;  3C1C C;  3REI D;  4WU8 D;  5CPI C;  1KX4 C;  1HQ3 B;  5F99 A;  5JRG C;  3MGQ A;  4CAY B;  3MGR B;  4JJN D;  4E45 A;  2F8N K;  3WKJ C;  4KHA B;  1P3A C;  5DNN C;  3WTP D;  4H9S C;  1M1A C;  3KSY A;  3O62 A;  1KX3 B;  1ID3 C;  3KXB A;  1AOI A;  2PYO C;  5GSU D;  5CPJ D;  4ZUX C;  3MGS A;  1P34 D;  1P3B A;  2F8N G;  2NQB C;  4WU8 B;  3REL C;  5CPK D;  3UT9 B;  3B0D C;  3AZL D;  5AV9 A;  5KDM A;  4ZBJ B;  5AV8 C;  1ZLA B;  5JA4 B;  3W97 D;  3AYW D;  5B1M B;  3WTP B;  3W96 B;  3AZE C;  5B40 C;  5GSU B;  4XZQ B;  3MVD C;  5CPJ B;  1P3G C;  3X1V D;  5AVB C;  5GT3 B;  5E5A D;  1Q9C A;  5B31 A;  4R8P D;  5F99 C;  3AZL B;  4X23 A;  3MGQ C;  5CPI B;  1KX5 D;  1M19 A;  3AZH C;  3AZN A;  3V9R B;  3W99 D;  4H9Q A;  2CV5 D;  4KUD A;  3MGS C;  2F8N D;  5GXQ B;  3UTA C;  1P3M A;  4ZUX B;  3AV2 C;  4R8P B;  3WAA D;  2ARO A;  4Z5T A;  3X1T D;  5AV9 C;  1P3O C;  4WU9 D;  5AVC A;  2YFV B;  3AN2 C;  5B31 G;  3B0D B;  5G49 A;  3W99 B;  1F66 A;  3REI A;  4NE3 A;  3AZJ A;  2F8N B;  5B2J C;  5B40 B;  1AOI D;  3KXB D;  4J8V C;  3TU4 B;  4KGC C;  4JJN A;  1P3B D;  4XUJ C;  4UUZ A;  5BO0 A;  1WWI A;  1BH9 A;  5AVB B;  3MGP C;  4NE6 A;  5DNM C;  5F99 B;  3LJA A;  3MGQ B;  3AZN C;  3MNN A;  1P34 A;  1M18 C;  2RVQ C;  3UTB D;  5BT1 D;  1TZY A;  1AOI B;  3O62 B;  3B0B A;  3AFA D;  3MGS B;  1P3B B;  5B1L D;  3LZ0 D;  3AYW A;  5B24 A;  5AVC C;  1KX3 C;  4X23 D;  2IO5 B;  4LD9 D;  5AV5 D;  5AV9 B;  5KDM B;  3REI C;  4WU8 C;  2NZD A;  3NQJ A;  3X1V A;  5E5A A;  1F1E A;  4KUD D;  1KX5 A;  1P3M D;  1U35 A;  5B32 D;  5B1M C;  3WTP C;  3W96 C;  2FJ7 D;  5B31 B;  4YM6 D;  2CV5 A;  5GSU C;  4XZQ C;  5CPJ C;  2HIO D;  3REK D;  1M19 B;  5BS7 C;  3AZN B;  5CPK C;  3X1U D;  3REJ D;  3WAA A;  4H9R A;  1M18 B;  4Z2M H;  3AZL C;  3X1T A;  5B0Z A;  3AZJ D;  3B6F D;  4WU9 A;  2BYK A;  5CP6 A;  3W97 C;  1H3O A;  2ARO B;  4Z5T B;  3AZF D;  3AV1 A;  3B0C T;  5AVC B;  5GXQ C;  3LJA D;  3VH6 W;  1F66 B;  3MNN D;  4R8P C;  3REI B;  3AZJ B;  3A6N A;  1KX5 C;  4J8W A;  1TZY D;  1B6W A;  3REH A;  2HUE B;  3W99 C;  4JJN B;  2CV5 C;  3VH5 W;  3LZ1 D;  4UUZ B;  5BO0 B;  2BYM A;  3UTB A;  1BH9 B;  5B24 D;  5AV6 D;  3AFA A;  5GT0 D;  3TU4 C;  1P34 B;  5AY8 D;  4J8X D;  2NZD D;  5B1L A;  3LZ0 A;  3AZG D;  4WU9 C;  5CPK B;  4H9P A;  5B33 D;  4QLC D;  4LD9 A;  5AV5 A;  1P3I D;  3W98 A;  3KUY D;  3C1C D;  4M6B A;  3AYW B;  1U35 D;  3W97 B;  1N1J A;  5B24 B;  4G92 C;  1AOI C;  3O62 C;  3KXB C;  5JRG D;  3WA9 A;  1P3B C;  5BNX A;  2NZD B;  3WKJ D;  3NQJ B;  5B32 A;  3X1V B;  4YS3 D;  5E5A B;  3AZI A;  2FJ7 A;  1M1A D;  4YM6 A;  5B0Z D;  2IO5 C;  2HIO A;  4E44 A;  3REK A;  1KX5 B;  2NQB D;  1U35 B;  5CP6 D;  5B2I A;  3AZK A;  3X1U A;  3REJ A;  2CV5 B;  3LEL A;  3AFA C;  3AV1 D;  3B6F A;  1P3P A;  5B1L C;  5AV8 D;  3LZ0 C;  2CWE A;  3VH6 A;  3WAA B;  4H9R B;  5B31 C;  3X1T B;  3AZF A;  5B0Z B;  4X23 C;  4H9O A;  4LD9 C;  5AV5 C;  4H9N A;  3A6N D;  4CAY A;  4WU9 B;  5B32 G;  4J8W D;  1S32 A;  5CP6 B;  1M19 C;  5B0Y A;  2F8N H;  1H3O B;  3REH D;  4KHA A;  2YFW A;  3VH5 A;  4KUD C;  4G92 B;  3NQU A;  1P3M C;  1BH8 A;  3KXB B;  4AWL B;  5B32 C;  3X1S D;  4Z66 D;  2FJ7 C;  4YM6 C;  1P3F D;  2ARO C;  3LZ1 A;  4Z5T C;  3A6N B;  4J8W B;  3REK C;  3REH B;  5AV6 A;  3B6G D;  3C1B A;  1KU5 A;  5GT0 A;  3X1U C;  3REJ C;  3AV2 D;  1F66 C;  1B67 A;  5AY8 A;  3UTB B;  2BYM B;  4J8X A;  3W98 D;  3AZJ C;  3AZG A;  1P3O D;  5B33 A;  1P3K A;  4QLC A;  4J8U D;  3AFA B;  3WA9 D;  1EQZ A;  2HUE C;  4JJN C;  3AZF C;  1P3I A;  1P3L D;  3KWQ A;  5B1L B;  3LZ0 B;  3KUY A;  3C1C A;  5FUG A;  4H9P B;  4CSR A;  3AZI D;  1KX4 A;  3LJA C;  4X23 B;  4LD9 B;  5JRG A;  5AV5 B;  1WWS A;  4KGC D;  3MNN C;  1P34 C;  4HGA B;  3VH6 T;  3W98 B;  4XUJ D;  3WKJ A;  5B2I D;  1TZY C;  4YS3 A;  1P3A A;  5DNN A;  3AZK D;  4H9Q B;  4H9S A;  5DNM D;  1TAF A;  3MGP D;  1M1A A;  1ID3 A;  3LEL D;  2PYO A;  4KUD B;  1A7W A;  5BNX B;  1P3M B;  2NQB A;  4WNN A;  3AZM D;  1P3P D;  5B32 B;  3VH5 T;  3AYW C;  3AZI B;  5B24 C;  3REL A;  2FJ7 B;  4YM6 B;  1HQ3 D;  5GT0 C;  2HIO B;  5C3I C;  3REK B;  1S32 D;  3MGR D;  4G91 C;  5B0Y D;  2NZD C;  5G49 B;  5AV8 A;  5B2I B;  3AZK B;  3X1V C;  3X1U B;  3REJ B;  3AZE A;  5E5A C;  4QLC C;  3LEL B;  3MVD A;  3B6F B;  1P3I C;  4DRA A;  3KUY C;  1P3P B;  1U35 C;  1P3G A;  2JSS A;  5BNV A;  5AVB A;  3UT9 D;  3AZF B;  4H9O B;  4H9N B;  3R45 A;  1S32 B;  5B0Y B;  3LJA B;  3X1S A;  3C1B D;  1ZLA D;  4YS3 C;  3MNN B;  4Z66 A;  5B1M D;  3AZH A;  2YFW B;  3WAA C;  1JFI A;  1P3F A;  3X1T C;  5B0Z C;  4XZQ D;  3NQU B;  1TZY B;  3WTP E;  1BH8 B;  3UTA A;  5CP6 C;  1P3K D;  3B6G A;  1EQZ D;  3AV2 A;  5GT3 D;  3LZ1 B;  4EO5 B;  3AV1 C;  3KWQ D;  1P3O A;  5AV6 B;  5CPI D;  1KX4 D;  3AN2 A;  3C1B B;  1BFM A;  4J8U A;  4AWL C;  5GT0 B;  5C3I B;  5AY8 B;  4J8X B;  3B0C W;  4G91 B;  1P3L A;  3AZG B;  3A6N C;  5B33 B;  4J8W C;  1P3A D;  1P3K B;  5DNN D;  5B2J A;  5GXQ D;  4QLC B;  3REH C;  2PYO D;  1ID3 D;  4J8V A;  1EQZ B;  4KGC A;  4ZUX D;  1P3I B;  3KWQ B;  3KUY B;  3C1C B;  3UTB C;  5BT1 C;  5FUG B;  4XUJ A;  4CSR B;  4DRB A;  1KX4 B;  3W96 D;  3REL D;  3MGP A;  5DNM A;  5JRG B;  3X1S C;  4Z66 C;  1P3F C;  1M18 A;  3AZM A;  3WKJ B;  1P3A B;  4YS3 B;  5DNN B;  1TAF B;  1M1A B;  3AZE D;  2PYO B;  1ID3 B;  5B40 D;  3B6G C;  1HQ3 A;  5CHL B;  3MVD D;  2LY8 A;  3TU4 D;  2BYK B;  2NQB B;  4HGA C;  4WNN B;  3MGR A;  3W98 C;  1P3G D;  3REL B;  5AVB D;  2L5A A;  4Z2M G;  4J8U C;  1KX3 A;  3AV1 B;  5F99 D;  3MGQ D;  4NFT A;  1ULY A;  3WA9 C;  1P3L C;  5AV8 B;  4WU8 A;  3AZE B;  3AZI C;  3AZH D;  3O62 D;  3UT9 A;  3MVD B;  3MGS D;  2HIO C;  3UTA D;  1P3G B;  1ZLA A; 
#chains in the Genus database with same CATH topology
 5B2I C;  5JA4 A;  5BNV B;  5B1M A;  3AZK C;  3W96 A;  3WTP A;  2Y2P A;  3R45 B;  3LEL C;  5GSU A;  4XZQ A;  5CPJ A;  3B6F C;  2G5I C;  5AV9 D;  3AZM C;  5BS7 A;  1P3P C;  3X1S B;  1R4V A;  3AN2 D;  4Z66 B;  3AZH B;  1JFI B;  4NE5 A;  5CPK A;  1P3F B;  3AL0 C;  3F6T A;  1HQ3 C;  5GT3 A;  3AZL A;  3UTA B;  1S32 C;  3MGR C;  5CPI A;  5B0Y C;  5B2J D;  3B6G B;  3W97 A;  4J8V D;  3AV2 B;  5B31 D;  3V9R A;  1N1J B;  1P3O B;  3AN2 B;  1M19 D;  5GXQ A;  4J8U B;  4WV4 B;  3WA9 B;  4ZUX A;  4WZS B;  3UT9 C;  3AZN D;  1P3L B;  4R8P A;  3LZ1 C;  1M18 D;  4EO5 C;  2RVQ D;  5B2J B;  5AV6 C;  4ZBJ C;  2YFV A;  3C1B C;  4J8V B;  1ZLA C;  4KGC B;  3EG5 B;  5AY8 C;  3W99 A;  2ARO D;  4J8X C;  4XUJ B;  4Z5T D;  3AZG C;  5B33 C;  2F8N A;  3MGP B;  5DNM B;  2DF4 C;  5AVC D;  1P3K C;  5B40 A;  1KX3 D;  2Y2N A;  1EQZ C;  3TU4 A;  1HTA A;  1F66 D;  5GT3 C;  3AZM B;  3KWQ C;  3C1C C;  3REI D;  4WU8 D;  2ZY4 A;  5CPI C;  1KX4 C;  1HQ3 B;  5F99 A;  3A1I A;  5JRG C;  3MGQ A;  4CAY B;  2XD1 A;  3MGR B;  4JJN D;  4E45 A;  2F8N K;  3WKJ C;  4KHA B;  1P3A C;  5DNN C;  3WTP D;  4H9S C;  1M1A C;  3KSY A;  3O62 A;  1KX3 B;  1ID3 C;  3KXB A;  1AOI A;  2PYO C;  5GSU D;  5CPJ D;  4ZUX C;  3H0M C;  1W2E A;  3MGS A;  1P34 D;  1P3B A;  2F8N G;  2NQB C;  4WU8 B;  3A1K A;  3REL C;  5CPK D;  3UT9 B;  3B0D C;  3AZL D;  5AV9 A;  3H0R C;  4ZBJ B;  5KDM A;  5AV8 C;  1ZLA B;  5JA4 B;  3W97 D;  3AYW D;  5B1M B;  3WTP B;  4DQY B;  3W96 B;  3AZE C;  5B40 C;  5GSU B;  4XZQ B;  3MVD C;  5CPJ B;  3IP4 C;  1P3G C;  3X1V D;  5AVB C;  5GT3 B;  5E5A D;  1Q9C A;  5B31 A;  4R8P D;  5F99 C;  3AZL B;  4X23 A;  2Y2L A;  3MGQ C;  5CPI B;  1KX5 D;  1M19 A;  3AZH C;  3AZN A;  3V9R B;  3W99 D;  4H9Q A;  2CV5 D;  4KUD A;  3MGS C;  2ZM5 A;  2F8N D;  5GXQ B;  3UTA C;  1P3M A;  4ZUX B;  3AV2 C;  4R8P B;  3WAA D;  2ARO A;  4Z5T A;  3X1T D;  5AV9 C;  1P3O C;  4WU9 D;  5AVC A;  2YFV B;  3AN2 C;  5B31 G;  3B0D B;  5G49 A;  3W99 B;  2RIQ A;  1F66 A;  3REI A;  4NE3 A;  3AZJ A;  2F8N B;  5B2J C;  5B40 B;  1AOI D;  3KXB D;  4J8V C;  3TU4 B;  3EPJ A;  4KGC C;  4JJN A;  1P3B D;  4XUJ C;  4UUZ A;  5BO0 A;  1WWI A;  1BH9 A;  5AVB B;  3MGP C;  4NE6 A;  5DNM C;  5F99 B;  3LJA A;  3MGQ B;  2ZY5 A;  3AZN C;  3MNN A;  3FDD A;  1P34 A;  1M18 C;  2RVQ C;  2Y2H A;  3UTB D;  5BT1 D;  3EPH A;  1TZY A;  1AOI B;  3O62 B;  3B0B A;  3AFA D;  3MGS B;  1P3B B;  5B1L D;  3LZ0 D;  3AYW A;  5B24 A;  5AVC C;  1KX3 C;  4X23 D;  2IO5 B;  4LD9 D;  5AV5 D;  5AV9 B;  5KDM B;  3REI C;  4WU8 C;  2NZD A;  3NQJ A;  3X1V A;  2UWX A;  5E5A A;  1F1E A;  4KUD D;  1KX5 A;  1P3M D;  1U35 A;  5B32 D;  5B1M C;  3W96 C;  3WTP C;  2FJ7 D;  5B31 B;  4YM6 D;  2CV5 A;  2JCH A;  5GSU C;  4XZQ C;  5CPJ C;  2HIO D;  3REK D;  1M19 B;  2W8S A;  5BS7 C;  3AZN B;  5CPK C;  3X1U D;  3REJ D;  3WAA A;  4H9R A;  1M18 B;  4Z2M H;  3AZL C;  3X1T A;  2ZY2 A;  5B0Z A;  3AZJ D;  3B6F D;  4WU9 A;  2BYK A;  5CP6 A;  3W97 C;  1H3O A;  2ARO B;  4Z5T B;  3AZF D;  3AV1 A;  3B0C T;  5AVC B;  3EPL A;  5GXQ C;  3LJA D;  3VH6 W;  1F66 B;  3MNN D;  4R8P C;  3REI B;  3AZJ B;  3A6N A;  1KX5 C;  4J8W A;  1TZY D;  1B6W A;  3REH A;  2HUE B;  3W99 C;  4JJN B;  2CV5 C;  3VH5 W;  3LZ1 D;  4UUZ B;  5BO0 B;  2BYM A;  3UTB A;  1BH9 B;  5B24 D;  5AV6 D;  3AFA A;  5GT0 D;  3TU4 C;  1P34 B;  2Y2O A;  5AY8 D;  4J8X D;  2NZD D;  5B1L A;  3LZ0 A;  3AZG D;  4WU9 C;  5CPK B;  2JE5 A;  4H9P A;  5B33 D;  4QLC D;  4LD9 A;  5AV5 A;  1P3I D;  3W98 A;  3KUY D;  3C1C D;  4M6B A;  3AYW B;  1U35 D;  3W97 B;  1N1J A;  5B24 B;  4G92 C;  2G5H C;  1AOI C;  3O62 C;  3KXB C;  5JRG D;  3WA9 A;  1P3B C;  5BNX A;  2NZD B;  3WKJ D;  3NQJ B;  5B32 A;  3X1V B;  4YS3 D;  2Y2G A;  5E5A B;  3AZI A;  2FJ7 A;  1M1A D;  4YM6 A;  2Y2Q A;  5B0Z D;  2IO5 C;  2HIO A;  4E44 A;  3REK A;  1KX5 B;  2NQB D;  1U35 B;  5CP6 D;  5B2I A;  3AZK A;  3X1U A;  3REJ A;  2CV5 B;  3LEL A;  3AFA C;  2J8P A;  3AV1 D;  3B6F A;  1P3P A;  5B1L C;  5AV8 D;  3LZ0 C;  2CWE A;  3VH6 A;  3WAA B;  4H9R B;  5B31 C;  3X1T B;  3AZF A;  5B0Z B;  4UPK A;  4H9O A;  4X23 C;  4LD9 C;  5AV5 C;  4H9N A;  3A6N D;  4CAY A;  4WU9 B;  5B32 G;  4J8W D;  1S32 A;  5CP6 B;  1M19 C;  5B0Y A;  2F8N H;  1H3O B;  3REH D;  2Y2M A;  4KHA A;  2FFF B;  2VQR A;  2YFW A;  3VH5 A;  4KUD C;  2ZY3 A;  4G92 B;  3NQU A;  1P3M C;  1BH8 A;  3KXB B;  4AWL B;  5B32 C;  3X1S D;  4Z66 D;  2FJ7 C;  4YM6 C;  1P3F D;  2ARO C;  3LZ1 A;  4Z5T C;  3A6N B;  4J8W B;  3REK C;  3REH B;  5AV6 A;  3EPK A;  3B6G D;  3C1B A;  1KU5 A;  5GT0 A;  3X1U C;  3REJ C;  3AV2 D;  1F66 C;  1B67 A;  5AY8 A;  3UTB B;  2BYM B;  4J8X A;  3W98 D;  3AZJ C;  3AZG A;  1P3O D;  5B33 A;  1P3K A;  4QLC A;  4J8U D;  3AFA B;  3WA9 D;  1EQZ A;  3H0L C;  2HUE C;  4JJN C;  3AZF C;  1P3I A;  1P3L D;  3KWQ A;  5B1L B;  3LZ0 B;  3KUY A;  3C1C A;  5FUG A;  4H9P B;  4CSR A;  3AZI D;  1KX4 A;  3LJA C;  4X23 B;  4LD9 B;  5JRG A;  5AV5 B;  1WWS A;  4KGC D;  3MNN C;  1P34 C;  4HGA B;  3VH6 T;  3W98 B;  4XUJ D;  3WKJ A;  5B2I D;  1TZY C;  4YS3 A;  1P3A A;  5DNN A;  3AZK D;  4H9Q B;  4H9S A;  5DNM D;  1TAF A;  3MGP D;  1M1A A;  1ID3 A;  3LEL D;  2PYO A;  4KUD B;  1A7W A;  5BNX B;  1P3M B;  2NQB A;  4WNN A;  3AZM D;  1P3P D;  5B32 B;  3VH5 T;  3AYW C;  3KFU G;  3AZI B;  5B24 C;  3REL A;  2FJ7 B;  4YM6 B;  1HQ3 D;  5GT0 C;  2HIO B;  5C3I C;  3REK B;  2F2A C;  1S32 D;  3MGR D;  4G91 C;  5B0Y D;  2NZD C;  5G49 B;  5AV8 A;  5B2I B;  3AZK B;  3X1V C;  3X1U B;  3REJ B;  3AZE A;  5E5A C;  4QLC C;  3LEL B;  3MVD A;  3B6F B;  1P3I C;  4DRA A;  3KUY C;  1P3P B;  1U35 C;  1P3G A;  2JSS A;  5BNV A;  2XD5 A;  5AVB A;  3UT9 D;  3AZF B;  3P5J B;  4H9O B;  3R45 A;  4H9N B;  1S32 B;  5B0Y B;  3LJA B;  3X1S A;  3C1B D;  1ZLA D;  4YS3 C;  3MNN B;  5B1M D;  4Z66 A;  3AZH A;  2YFW B;  3WAA C;  1JFI A;  1P3F A;  1Z2C B;  3X1T C;  5B0Z C;  2DQN C;  4XZQ D;  3NQU B;  1TZY B;  3WTP E;  1BH8 B;  3UTA A;  5CP6 C;  1P3K D;  3B6G A;  2Y2J A;  1EQZ D;  3AV2 A;  5GT3 D;  2Y2I A;  3LZ1 B;  4EO5 B;  3AV1 C;  3KWQ D;  1P3O A;  5AV6 B;  5CPI D;  1KX4 D;  3AN2 A;  3C1B B;  1BFM A;  4J8U A;  4AWL C;  5GT0 B;  5C3I B;  5AY8 B;  4J8X B;  3B0C W;  4G91 B;  1P3L A;  3AZG B;  3A6N C;  5B33 B;  4J8W C;  1P3A D;  1P3K B;  5DNN D;  5B2J A;  5GXQ D;  4QLC B;  3REH C;  2PYO D;  1ID3 D;  4J8V A;  1EQZ B;  4KGC A;  4ZUX D;  1P3I B;  2BG1 A;  3KWQ B;  3KUY B;  3C1C B;  3UTB C;  5BT1 C;  5FUG B;  4XUJ A;  4CSR B;  4DRB A;  1KX4 B;  3W96 D;  3REL D;  3MGP A;  5DNM A;  5JRG B;  3X1S C;  2Y2K A;  4Z66 C;  1PZR A;  1P3F C;  1M18 A;  3AZM A;  3WKJ B;  1P3A B;  4YS3 B;  5DNN B;  1TAF B;  1M1A B;  3AZE D;  2PYO B;  1ID3 B;  5B40 D;  3B6G C;  1HQ3 A;  5CHL B;  3MVD D;  2LY8 A;  3TU4 D;  2BYK B;  2NQB B;  4HGA C;  4WNN B;  3MGR A;  3W98 C;  1P3G D;  3REL B;  5AVB D;  2L5A A;  4Z2M G;  4J8U C;  1KX3 A;  3AV1 B;  5F99 D;  4WJ3 C;  3MGQ D;  4NFT A;  1ULY A;  3WA9 C;  1P3L C;  5AV8 B;  4WU8 A;  3AZE B;  3AZI C;  3AZH D;  1T3U A;  3O62 D;  3UT9 A;  3MVD B;  3MGS D;  2HIO C;  3UTA D;  1P3G B;  1ZLA A; 
#chains in the Genus database with same CATH homology
 5B2I C;  5JA4 A;  5BNV B;  5B1M A;  3AZK C;  3W96 A;  3WTP A;  2Y2P A;  3R45 B;  3LEL C;  5GSU A;  4XZQ A;  5CPJ A;  3B6F C;  2G5I C;  5AV9 D;  3AZM C;  5BS7 A;  1P3P C;  3X1S B;  1R4V A;  3AN2 D;  4Z66 B;  3AZH B;  1JFI B;  4NE5 A;  5CPK A;  1P3F B;  3AL0 C;  3F6T A;  1HQ3 C;  5GT3 A;  3AZL A;  3UTA B;  1S32 C;  3MGR C;  5CPI A;  5B0Y C;  5B2J D;  3B6G B;  3W97 A;  4J8V D;  3AV2 B;  5B31 D;  3V9R A;  1N1J B;  1P3O B;  3AN2 B;  1M19 D;  5GXQ A;  4J8U B;  4WV4 B;  3WA9 B;  4ZUX A;  4WZS B;  3UT9 C;  3AZN D;  1P3L B;  4R8P A;  3LZ1 C;  1M18 D;  4EO5 C;  2RVQ D;  5B2J B;  5AV6 C;  4ZBJ C;  2YFV A;  3C1B C;  4J8V B;  1ZLA C;  4KGC B;  3EG5 B;  5AY8 C;  3W99 A;  2ARO D;  4J8X C;  4XUJ B;  4Z5T D;  3AZG C;  5B33 C;  2F8N A;  3MGP B;  5DNM B;  2DF4 C;  5AVC D;  1P3K C;  5B40 A;  1KX3 D;  2Y2N A;  1EQZ C;  3TU4 A;  1HTA A;  1F66 D;  5GT3 C;  3AZM B;  3KWQ C;  3C1C C;  3REI D;  4WU8 D;  2ZY4 A;  5CPI C;  1KX4 C;  1HQ3 B;  5F99 A;  3A1I A;  5JRG C;  3MGQ A;  4CAY B;  2XD1 A;  3MGR B;  4JJN D;  4E45 A;  2F8N K;  3WKJ C;  4KHA B;  1P3A C;  5DNN C;  3WTP D;  4H9S C;  1M1A C;  3KSY A;  3O62 A;  1KX3 B;  1ID3 C;  3KXB A;  1AOI A;  2PYO C;  5GSU D;  5CPJ D;  4ZUX C;  3H0M C;  1W2E A;  3MGS A;  1P34 D;  1P3B A;  2F8N G;  2NQB C;  4WU8 B;  3A1K A;  3REL C;  5CPK D;  3UT9 B;  3B0D C;  3AZL D;  5AV9 A;  3H0R C;  4ZBJ B;  5KDM A;  5AV8 C;  1ZLA B;  5JA4 B;  3W97 D;  3AYW D;  5B1M B;  3WTP B;  4DQY B;  3W96 B;  3AZE C;  5B40 C;  5GSU B;  4XZQ B;  3MVD C;  5CPJ B;  3IP4 C;  1P3G C;  3X1V D;  5AVB C;  5GT3 B;  5E5A D;  1Q9C A;  5B31 A;  4R8P D;  5F99 C;  3AZL B;  4X23 A;  2Y2L A;  3MGQ C;  5CPI B;  1KX5 D;  1M19 A;  3AZH C;  3AZN A;  3V9R B;  3W99 D;  4H9Q A;  2CV5 D;  4KUD A;  3MGS C;  2ZM5 A;  2F8N D;  5GXQ B;  3UTA C;  1P3M A;  4ZUX B;  3AV2 C;  4R8P B;  3WAA D;  2ARO A;  4Z5T A;  3X1T D;  5AV9 C;  1P3O C;  4WU9 D;  5AVC A;  2YFV B;  3AN2 C;  5B31 G;  3B0D B;  5G49 A;  3W99 B;  2RIQ A;  1F66 A;  3REI A;  4NE3 A;  3AZJ A;  2F8N B;  5B2J C;  5B40 B;  1AOI D;  3KXB D;  4J8V C;  3TU4 B;  3EPJ A;  4KGC C;  4JJN A;  1P3B D;  4XUJ C;  4UUZ A;  5BO0 A;  1WWI A;  1BH9 A;  5AVB B;  3MGP C;  4NE6 A;  5DNM C;  5F99 B;  3LJA A;  3MGQ B;  2ZY5 A;  3AZN C;  3MNN A;  3FDD A;  1P34 A;  1M18 C;  2RVQ C;  2Y2H A;  3UTB D;  5BT1 D;  3EPH A;  1TZY A;  1AOI B;  3O62 B;  3B0B A;  3AFA D;  3MGS B;  1P3B B;  5B1L D;  3LZ0 D;  3AYW A;  5B24 A;  5AVC C;  1KX3 C;  4X23 D;  2IO5 B;  4LD9 D;  5AV5 D;  5AV9 B;  5KDM B;  3REI C;  4WU8 C;  2NZD A;  3NQJ A;  3X1V A;  2UWX A;  5E5A A;  1F1E A;  4KUD D;  1KX5 A;  1P3M D;  1U35 A;  5B32 D;  5B1M C;  3W96 C;  3WTP C;  2FJ7 D;  5B31 B;  4YM6 D;  2CV5 A;  2JCH A;  5GSU C;  4XZQ C;  5CPJ C;  2HIO D;  3REK D;  1M19 B;  2W8S A;  5BS7 C;  3AZN B;  5CPK C;  3X1U D;  3REJ D;  3WAA A;  4H9R A;  1M18 B;  4Z2M H;  3AZL C;  3X1T A;  2ZY2 A;  5B0Z A;  3AZJ D;  3B6F D;  4WU9 A;  2BYK A;  5CP6 A;  3W97 C;  1H3O A;  2ARO B;  4Z5T B;  3AZF D;  3AV1 A;  3B0C T;  5AVC B;  3EPL A;  5GXQ C;  3LJA D;  3VH6 W;  1F66 B;  3MNN D;  4R8P C;  3REI B;  3AZJ B;  3A6N A;  1KX5 C;  4J8W A;  1TZY D;  1B6W A;  3REH A;  2HUE B;  3W99 C;  4JJN B;  2CV5 C;  3VH5 W;  3LZ1 D;  4UUZ B;  5BO0 B;  2BYM A;  3UTB A;  1BH9 B;  5B24 D;  5AV6 D;  3AFA A;  5GT0 D;  3TU4 C;  1P34 B;  2Y2O A;  5AY8 D;  4J8X D;  2NZD D;  5B1L A;  3LZ0 A;  3AZG D;  4WU9 C;  5CPK B;  2JE5 A;  4H9P A;  5B33 D;  4QLC D;  4LD9 A;  5AV5 A;  1P3I D;  3W98 A;  3KUY D;  3C1C D;  4M6B A;  3AYW B;  1U35 D;  3W97 B;  1N1J A;  5B24 B;  4G92 C;  2G5H C;  1AOI C;  3O62 C;  3KXB C;  5JRG D;  3WA9 A;  1P3B C;  5BNX A;  2NZD B;  3WKJ D;  3NQJ B;  5B32 A;  3X1V B;  4YS3 D;  2Y2G A;  5E5A B;  3AZI A;  2FJ7 A;  1M1A D;  4YM6 A;  2Y2Q A;  5B0Z D;  2IO5 C;  2HIO A;  4E44 A;  3REK A;  1KX5 B;  2NQB D;  1U35 B;  5CP6 D;  5B2I A;  3AZK A;  3X1U A;  3REJ A;  2CV5 B;  3LEL A;  3AFA C;  2J8P A;  3AV1 D;  3B6F A;  1P3P A;  5B1L C;  5AV8 D;  3LZ0 C;  2CWE A;  3VH6 A;  3WAA B;  4H9R B;  5B31 C;  3X1T B;  3AZF A;  5B0Z B;  4UPK A;  4H9O A;  4X23 C;  4LD9 C;  5AV5 C;  4H9N A;  3A6N D;  4CAY A;  4WU9 B;  5B32 G;  4J8W D;  1S32 A;  5CP6 B;  1M19 C;  5B0Y A;  2F8N H;  1H3O B;  3REH D;  2Y2M A;  4KHA A;  2FFF B;  2VQR A;  2YFW A;  3VH5 A;  4KUD C;  2ZY3 A;  4G92 B;  3NQU A;  1P3M C;  1BH8 A;  3KXB B;  4AWL B;  5B32 C;  3X1S D;  4Z66 D;  2FJ7 C;  4YM6 C;  1P3F D;  2ARO C;  3LZ1 A;  4Z5T C;  3A6N B;  4J8W B;  3REK C;  3REH B;  5AV6 A;  3EPK A;  3B6G D;  3C1B A;  1KU5 A;  5GT0 A;  3X1U C;  3REJ C;  3AV2 D;  1F66 C;  1B67 A;  5AY8 A;  3UTB B;  2BYM B;  4J8X A;  3W98 D;  3AZJ C;  3AZG A;  1P3O D;  5B33 A;  1P3K A;  4QLC A;  4J8U D;  3AFA B;  3WA9 D;  1EQZ A;  3H0L C;  2HUE C;  4JJN C;  3AZF C;  1P3I A;  1P3L D;  3KWQ A;  5B1L B;  3LZ0 B;  3KUY A;  3C1C A;  5FUG A;  4H9P B;  4CSR A;  3AZI D;  1KX4 A;  3LJA C;  4X23 B;  4LD9 B;  5JRG A;  5AV5 B;  1WWS A;  4KGC D;  3MNN C;  1P34 C;  4HGA B;  3VH6 T;  3W98 B;  4XUJ D;  3WKJ A;  5B2I D;  1TZY C;  4YS3 A;  1P3A A;  5DNN A;  3AZK D;  4H9Q B;  4H9S A;  5DNM D;  1TAF A;  3MGP D;  1M1A A;  1ID3 A;  3LEL D;  2PYO A;  4KUD B;  1A7W A;  5BNX B;  1P3M B;  2NQB A;  4WNN A;  3AZM D;  1P3P D;  5B32 B;  3VH5 T;  3AYW C;  3KFU G;  3AZI B;  5B24 C;  3REL A;  2FJ7 B;  4YM6 B;  1HQ3 D;  5GT0 C;  2HIO B;  5C3I C;  3REK B;  2F2A C;  1S32 D;  3MGR D;  4G91 C;  5B0Y D;  2NZD C;  5G49 B;  5AV8 A;  5B2I B;  3AZK B;  3X1V C;  3X1U B;  3REJ B;  3AZE A;  5E5A C;  4QLC C;  3LEL B;  3MVD A;  3B6F B;  1P3I C;  4DRA A;  3KUY C;  1P3P B;  1U35 C;  1P3G A;  2JSS A;  5BNV A;  2XD5 A;  5AVB A;  3UT9 D;  3AZF B;  3P5J B;  4H9O B;  3R45 A;  4H9N B;  1S32 B;  5B0Y B;  3LJA B;  3X1S A;  3C1B D;  1ZLA D;  4YS3 C;  3MNN B;  5B1M D;  4Z66 A;  3AZH A;  2YFW B;  3WAA C;  1JFI A;  1P3F A;  1Z2C B;  3X1T C;  5B0Z C;  2DQN C;  4XZQ D;  3NQU B;  1TZY B;  3WTP E;  1BH8 B;  3UTA A;  5CP6 C;  1P3K D;  3B6G A;  2Y2J A;  1EQZ D;  3AV2 A;  5GT3 D;  2Y2I A;  3LZ1 B;  4EO5 B;  3AV1 C;  3KWQ D;  1P3O A;  5AV6 B;  5CPI D;  1KX4 D;  3AN2 A;  3C1B B;  1BFM A;  4J8U A;  4AWL C;  5GT0 B;  5C3I B;  5AY8 B;  4J8X B;  3B0C W;  4G91 B;  1P3L A;  3AZG B;  3A6N C;  5B33 B;  4J8W C;  1P3A D;  1P3K B;  5DNN D;  5B2J A;  5GXQ D;  4QLC B;  3REH C;  2PYO D;  1ID3 D;  4J8V A;  1EQZ B;  4KGC A;  4ZUX D;  1P3I B;  2BG1 A;  3KWQ B;  3KUY B;  3C1C B;  3UTB C;  5BT1 C;  5FUG B;  4XUJ A;  4CSR B;  4DRB A;  1KX4 B;  3W96 D;  3REL D;  3MGP A;  5DNM A;  5JRG B;  3X1S C;  2Y2K A;  4Z66 C;  1PZR A;  1P3F C;  1M18 A;  3AZM A;  3WKJ B;  1P3A B;  4YS3 B;  5DNN B;  1TAF B;  1M1A B;  3AZE D;  2PYO B;  1ID3 B;  5B40 D;  3B6G C;  1HQ3 A;  5CHL B;  3MVD D;  2LY8 A;  3TU4 D;  2BYK B;  2NQB B;  4HGA C;  4WNN B;  3MGR A;  3W98 C;  1P3G D;  3REL B;  5AVB D;  2L5A A;  4Z2M G;  4J8U C;  1KX3 A;  3AV1 B;  5F99 D;  4WJ3 C;  3MGQ D;  4NFT A;  1ULY A;  3WA9 C;  1P3L C;  5AV8 B;  4WU8 A;  3AZE B;  3AZI C;  3AZH D;  1T3U A;  3O62 D;  3UT9 A;  3MVD B;  3MGS D;  2HIO C;  3UTA D;  1P3G B;  1ZLA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...