5DNMA

Nucleosome core particle containing adducts of ruthenium(ii)-toluene pta complex
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
97
structure length
97
Chain Sequence
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords Histone H3.2
publication title Allosteric cross-talk in chromatin can mediate drug-drug synergy
pubmed doi rcsb
source organism Xenopus laevis
total genus 32
structure length 97
sequence length 97
chains with identical sequence E
ec nomenclature
pdb deposition date 2015-09-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5dnmA00
3X1TA 5B1LC 5B0ZC 3UTAC 5B33A 4J8UB 2F8NH 3KWQD 1ULYA 2HUEC 5B1LD 4Z5TC 5B0ZD 3KXBD 3WA9A 5GT0A 1TAFB 4Z5TD 4XZQC 3NQJB 4H9OB 5CPKB 5JRGB 2PYOC 5B32A 3AZGA 4NE3A 2PYOD 1U35C 5AV5B 3W97B 5E5AB 5F99C 3NQJA 3W96B 5CPKA 1P3OC 1M18B 5BT1C 5JRGA 4WZSB 1U35D 1F66A 3C1BB 2HIOC 1P3OD 5BT1D 1ZLAB 3AZEC 5AV5A 3W97A 5B24A 5E5AA 3MGRC 1KX5B 3AZED 1H3OB 5CPIC 4R8PC 3C1BA 3AV2B 4ZBJC 1HQ3B 1WWSA 3AZNB 3RELB 1ZLAA 5CPID 4R8PD 2YFWA 1N1JB 5CP6C 4JJNC 3MGQC 4KGCA 5B40D 3AV1D 5AVBB 4Z2MG 3B6FA 4H9PB 1KX5A 1P3AC 1H3OA 5B1MC 5DNNC 5CP6D 3AZLC 5BNVB 3MGQD 1HQ3A 3AV2A 5GSUC 2NQBB 3AZID 3RELA 1P3AD 5DNND 3AZLD 5G49B 4CSRB 2NZDB 5B0YC 4M6BA 4CAYB 1ID3B 5AVBA 4J8VC 4H9PA 5B0YD 2NQBA 3REHC 5CPJA 4J8VD 1A7WA 3UT9B 1B6WA 2FJ7D 3REKC 5G49A 4HGAB 4CSRA 3REHD 2NZDA 2BYKB 4CAYA 5AVCA 4EO5B 1M19C 4Z66B 3REKD 3MGSC 4LD9B 4J8WB 4QLCA 5AY8C 1P3MB 5B2IA 4KUDC 3A6NB 1M19D 3TU4A 1BH8B 1P34C 3W98B 3MGSD 4NE5A 1EQZB 5AY8D 4KUDD 2BYKA 1AOIC 5AV6B 3MNND 3X1UC 4WU9C 4J8WA 5GXQB 3AZMA 1BFMA 3LJAB 1P3MA 2AROB 5B2JB 3LZ0A 1KX3A 3AZKC 1AOID 3KUYC 1P3PD 4H9QA 3X1UD 4WU9D 1EQZA 3AZJC 3X1VA 3KWQB 5AV6A 5B1LB 4AWLC 4YM6C 5B0ZB 3UTAB 3X1SC 4X23C 1P3LA 5B31A 5GXQA 4ZUXA 2AROA 3MGPD 2HUEB 3X1SD 1P3KA 3B0DC 4J8XA 3C1CC 3LELC 3W99C 1P3FC 1KX4C 5BO0B 4XZQB 4WU8A 3UTAA 3UTBA 2F8NA 3C1CD 3LELD 1S32C 3W99D 1KX4D 2PYOB 1S32D 1P3BC 3REJC 1U35B 5BS7A 5BO0A 4XZQA 5F99B 1P3GB 1P3OB 1P3BD 3REJD 3AFAD 2HIOB 3AYWA 1TZYC 5AV9A 3KXBC 5C3IC 4G92C 3AZEB 5BNXA 2LY8A 5F99A 3MGRB 1TZYD 1P3GA 2F8NK 3O62C 3WKJA 5CPIB 5AV8D 4R8PB 5KDMB 4ZBJB 3VH6A 4J8UA 2HIOA 3O62D 4KHAB 1P3ID 4XUJC 3NQUB 5CP6B 4JJNB 3MGQB 4H9RB 3MGRA 4XUJD 1TAFA 5B1MB 5DNNB 3AZLB 5GSUB 4H9OA 4KHAA 3VH6W 2CV5C 2IO5C 5B31G 3LZ1C 5DNMC 3NQUA 4JJNA 4H9SC 4Z2MH 4H9RA 4J8VB 2CV5D 3LZ1D 5B1MA 5DNMD 3AZLA 3W96A 5GSUA 3X1TC 1M18A 5B33C 3WTPD 3X1TD 5B40C 5B33D 3AV1C 2YFVB 1M19B 3WA9C 3MGSB 3REIC 5GT0C 5AY8B 3AZIC 3WA9D 1P34B 3REID 5GT0D 3AZNA 5B32C 4E45A 2YFVA 1AOIB 3AZGC 1N1JA 5B32D 3X1UB 4WU9B 3AZKB 3AZGD 5CPKC 3KUYB 1P34A 2FJ7C 1F66C 5BNVA 3VH5A 2JSSA 3AZJB 1M1AC 4NFTA 5CPKD 5JRGD 1F66D 3X1SB 4AWLB 4YM6B 4X23B 2L5AA 5B32G 1M1AD 1ID3A 5B24C 3AZKA 3KUYA 3W97D 3B0DB 5B24D 3AZHC 3C1CB 3LELB 3AZJA 1P3FB 3UT9A 3VH5W 1KX4B 1ZLAC 3MNNC 3C1BD 4UUZB 4YM6A 4X23A 3AZHD 1S32B 4KGCC 4Z66A 1ZLAD 3B6FC 1P3PC 3AN2B 4LD9A 3B0CW 3A6NA 4KGCD 1P3BB 1BH8A 4YS3C 3REJB 3B6FD 1P3FA 3W98A 1KX5D 4UUZA 3AV2D 4YS3D 3MGPC 3RELD 3AN2A 3LJAA 1TZYB 5B2JA 3KXBB 5C3IB 4G92B 5CPJC 3B6GC 5AVBD 4Z5TB 5CHLB 5JA4B 2NQBD 5CPJD 3O62B 3B6GD 3KWQA 5AVCC 5B1LA 5B0ZA 1R4VA 3WAAC 4QLCC 3KXBA 5B2IC 5AVCD 4XUJB 4Z5TA 3TU4C 5JA4A 1JFIB 2BYMB 3WAAD 4QLCD 3O62A 5B2ID 3TU4D 3AZFC 3AFAC 5GT3C 4NE6A 3KSYA 3AZMC 2PYOA 3AZFD 2CV5B 2IO5B 3LZ0C 5GT3D 3LZ1B 1KX3C 3R45B 5DNMB 4WNNB 1JFIA 3AZMD 3LZ0D 1U35A 1KX3D 5AV8C 2RVQC 3X1VC 4G91C 5AV6C 3X1TB 1P3LC 3MVDC 1P3OA 5B33B 5B31C 1P3IC 4H9NB 4ZUXC 2RVQD 3X1VD 3LZ1A 3R45A 5AV6D 1P3LD 3MVDD 5B40B 3WTPE 3AV1B 1P3KC 5B31D 5GXQD 4ZUXD 4J8XC 2AROD 3AZEA 3WA9B 3REIB 5GT0B 3AZIB 4WU8C 1P3KD 3UTBC 4J8XD 1P3AB 5CPIA 4H9NA 4R8PA 5KDMA 5B32B 4WU8D 3UTAD 5B40A 3UTBD 2F8ND 3AV1A 3AZGB 5B0YB 5CP6A 3REIA 5BS7C 3MGQA 3AZIA 3WTPC 1P3AA 5DNNA 1F66B 2FJ7B 3REHB 4XZQD 3VH6T 1M1AB 3AYWC 5AV9C 2F8NG 3REKB 5B0YA 4DRBA 5B24B 4J8VA 3AYWD 5AV9D 1P3GC 2FJ7A 3WKJC 3REHA 3B0BA 4KUDB 5F99D 3AZHB 1P3GD 4J8UC 1M1AA 4DRAA 3WKJD 3MNNB 3REKA 2YFWB 4J8UD 2HIOD 4KGCB 1M19A 3B6FB 1P3PB 3MGSA 5AY8A 4KUDA 3MGRD 3AZHA 4YS3B 5JRGC 3MNNA 1BH9B 3MGPB 1AOIA 1F1EA 1P3PA 5AV5C 3X1UA 4WU9A 3W97C 3W96C 5E5AC 4JJND 5CPJB 3B6GB 3V9RB 4YS3A 1M18C 5AV5D 3C1BC 5B1MD 1BH9A 5E5AD 3W96D 1KU5A 5GSUD 3W99B 1M18D 3MGPA 5AVCB 3X1SA 3WAAB 4QLCB 3B6GA 1B67A 5B2IB 4WV4B 3V9RA 3TU4B 1KX5C 3AV2C 1HQ3C 3C1CA 3VH5T 3LELA 3AZNC 3W99A 1KX4A 3RELC 3AZFB 3AFAB 5GT3B 1HQ3D 3AZND 5FUGB 3WAAA 3AZMB 1S32A 5AVBC 3LZ0B 1KX3B 3B0CT 4H9QB 1WWIA 2NQBC 1P3BA 3REJA 5AV8B 3AZFA 3X1VB 3AFAA 1P34D 5GT3A 4G91B 2NZDC 1P3LB 3MVDB 5FUGA 5B31B 1P3IB 4E44A 4ZUXB 1ID3C 1Q9CA 2NZDD 1TZYA 1P3KB 1ID3D 4J8XB 5AV8A 3AZKD 3UT9C 3KUYD 4WU8B 4HGAC 3MVDA 3UTBB 2F8NB 1P3IA 3AZJD 4EO5C 3UT9D 4Z66C 4YM6D 4LD9C 4J8WC 4X23D 1P3MC 4XUJA 3A6NC 4Z66D 3W98C 4LD9D 2BYMA 4J8WD 1EQZC 1HTAA 1P3MD 3WTPB 3A6ND 1P3FD 3W98D 1EQZD 3AN2C 5GXQC 3LJAC 5AV9B 2AROC 5B2JC 3AYWB 2CV5A 5DNMA 5BNXB 3AN2D 4WNNA 2CWEA 4H9SA 3LJAD 5B2JD 3WTPA 3WKJB 3KWQC
chains in the Genus database with same CATH superfamily
3X1TA 5B1LC 5B0ZC 3UTAC 5B33A 1Z2CB 4J8UB 2F8NH 3KWQD 1ULYA 2HUEC 5B1LD 4Z5TC 5B0ZD 3KXBD 3WA9A 5GT0A 1TAFB 4Z5TD 4XZQC 4UPKA 3NQJB 4H9OB 5CPKB 5JRGB 2PYOC 5B32A 2VQRA 3AZGA 4NE3A 2PYOD 2G5HC 5AV5B 1U35C 3W97B 5E5AB 5F99C 3NQJA 3W96B 5CPKA 1P3OC 1M18B 5BT1C 5JRGA 4WZSB 1U35D 1F66A 3C1BB 2W8SA 2HIOC 1P3OD 5BT1D 1ZLAB 3H0MC 2Y2LA 3AZEC 5AV5A 2J8PA 2XD1A 3W97A 5B24A 5E5AA 3MGRC 1KX5B 3AZED 1H3OB 5CPIC 4R8PC 3C1BA 3AV2B 4ZBJC 1HQ3B 1WWSA 3AZNB 4DQYB 3RELB 1ZLAA 5CPID 4R8PD 2YFWA 1N1JB 5CP6C 4JJNC 3MGQC 2Y2HA 4KGCA 5B40D 3AV1D 5AVBB 4Z2MG 3B6FA 4H9PB 1KX5A 1P3AC 1H3OA 5B1MC 1PZRA 5DNNC 5CP6D 5BNVB 3MGQD 1HQ3A 3AZLC 5GSUC 3AV2A 2NQBB 3AZID 3RELA 1P3AD 5DNND 3AZLD 5G49B 4CSRB 2NZDB 5B0YC 4M6BA 4CAYB 1ID3B 5AVBA 4J8VC 2Y2NA 4H9PA 5B0YD 2NQBA 3REHC 5CPJA 4J8VD 1A7WA 3UT9B 1B6WA 2FJ7D 3REKC 5G49A 4HGAB 4CSRA 3REHD 2NZDA 2BYKB 4CAYA 5AVCA 4EO5B 1M19C 4Z66B 3REKD 3MGSC 4LD9B 4J8WB 4QLCA 5AY8C 1P3MB 5B2IA 4KUDC 2JCHA 3A6NB 1M19D 3TU4A 1BH8B 1P34C 3W98B 3MGSD 4NE5A 1EQZB 5AY8D 4KUDD 2BYKA 1AOIC 5AV6B 3MNND 3AL0C 3X1UC 4WU9C 4J8WA 5GXQB 3AZMA 1BFMA 3LJAB 1P3MA 2AROB 5B2JB 3LZ0A 1KX3A 3AZKC 1AOID 3KUYC 1P3PD 4H9QA 3X1UD 4WU9D 1EQZA 3AZJC 3X1VA 3KWQB 5AV6A 5B1LB 4AWLC 4YM6C 5B0ZB 3UTAB 3X1SC 4X23C 1P3LA 5B31A 5GXQA 4ZUXA 2AROA 3MGPD 2HUEB 3X1SD 1P3KA 3A1IA 2ZY2A 3B0DC 4J8XA 3C1CC 3LELC 3W99C 1P3FC 1KX4C 5BO0B 4XZQB 4WU8A 3UTAA 3UTBA 2F8NA 3C1CD 3LELD 1S32C 3W99D 1KX4D 2PYOB 3H0LC 1S32D 1P3BC 3REJC 1U35B 5BS7A 5BO0A 4XZQA 5F99B 1P3GB 1P3OB 1P3BD 3REJD 3AFAD 2HIOB 3AYWA 1TZYC 5AV9A 3KXBC 3EPLA 5C3IC 4G92C 3AZEB 5BNXA 2LY8A 5F99A 3MGRB 1TZYD 1P3GA 2F8NK 3O62C 3WKJA 5CPIB 5AV8D 4R8PB 5KDMB 4ZBJB 3VH6A 3EPHA 4J8UA 2HIOA 2F2AC 3O62D 4KHAB 1P3ID 4XUJC 3NQUB 5CP6B 4JJNB 3MGQB 4H9RB 3MGRA 4XUJD 1TAFA 5B1MB 5DNNB 3AZLB 5GSUB 4H9OA 4KHAA 3VH6W 2CV5C 2IO5C 5B31G 3LZ1C 5DNMC 3NQUA 4JJNA 4H9SC 4Z2MH 4H9RA 4J8VB 2CV5D 3LZ1D 2DF4C 3P5JB 5B1MA 5DNMD 3AZLA 3W96A 5GSUA 3X1TC 1M18A 5B33C 3WTPD 3X1TD 5B40C 5B33D 3AV1C 2YFVB 1M19B 3WA9C 3MGSB 3REIC 5GT0C 5AY8B 3AZIC 3WA9D 1P34B 3REID 5GT0D 3AZNA 5B32C 4E45A 2UWXA 2YFVA 1AOIB 3AZGC 1N1JA 5B32D 3X1UB 4WU9B 3AZKB 3AZGD 5CPKC 3KUYB 1P34A 2FJ7C 1F66C 5BNVA 2BG1A 3VH5A 2JSSA 3H0RC 3AZJB 1M1AC 4NFTA 5CPKD 5JRGD 1F66D 2RIQA 3X1SB 4AWLB 2Y2OA 2Y2JA 4YM6B 4X23B 2L5AA 5B32G 1M1AD 2Y2MA 5B24C 1ID3A 3AZKA 3KUYA 3W97D 3B0DB 5B24D 3AZHC 3C1CB 3LELB 3AZJA 1P3FB 3UT9A 3VH5W 1KX4B 1ZLAC 3MNNC 3C1BD 4UUZB 4YM6A 4X23A 3AZHD 1S32B 4KGCC 4Z66A 1ZLAD 3B6FC 1P3PC 3AN2B 4LD9A 3B0CW 3A6NA 4KGCD 1P3BB 1BH8A 4YS3C 3REJB 3B6FD 1P3FA 3W98A 1KX5D 4UUZA 3AV2D 4YS3D 3MGPC 3RELD 3AN2A 2ZY5A 3LJAA 1TZYB 5B2JA 3KXBB 5C3IB 4G92B 5CPJC 3B6GC 5AVBD 4Z5TB 2XD5A 5CHLB 5JA4B 2NQBD 5CPJD 3O62B 3B6GD 3KWQA 5AVCC 5B1LA 5B0ZA 1R4VA 3WAAC 4QLCC 3KXBA 5B2IC 5AVCD 4XUJB 4Z5TA 3TU4C 3KFUG 5JA4A 1JFIB 2BYMB 3WAAD 4QLCD 3O62A 5B2ID 3TU4D 3AZFC 3AFAC 5GT3C 4NE6A 3KSYA 3EPKA 3AZMC 2PYOA 3AZFD 2CV5B 2IO5B 3LZ0C 5GT3D 3LZ1B 1KX3C 3R45B 5DNMB 4WNNB 1JFIA 3AZMD 3LZ0D 1U35A 1KX3D 5AV8C 2RVQC 3X1VC 4G91C 5AV6C 3X1TB 1P3LC 3MVDC 1P3OA 5B33B 5B31C 1P3IC 4H9NB 4ZUXC 2RVQD 3X1VD 3LZ1A 3R45A 5AV6D 1P3LD 3MVDD 5B40B 3WTPE 3AV1B 1P3KC 5B31D 5GXQD 4ZUXD 4J8XC 2AROD 3AZEA 3WA9B 2ZM5A 3REIB 5GT0B 3AZIB 4WU8C 1P3KD 3UTBC 4J8XD 1P3AB 5CPIA 4H9NA 4R8PA 5KDMA 5B32B 4WU8D 3UTAD 5B40A 3UTBD 2F8ND 3AV1A 3AZGB 5B0YB 5CP6A 3REIA 5BS7C 3MGQA 3AZIA 3WTPC 1P3AA 5DNNA 1F66B 2FJ7B 3REHB 3IP4C 4XZQD 3VH6T 1M1AB 3AYWC 5AV9C 2F8NG 3REKB 4WJ3C 1W2EA 5B0YA 4DRBA 5B24B 4J8VA 3AYWD 5AV9D 1P3GC 2ZY3A 2FJ7A 3WKJC 3REHA 3B0BA 4KUDB 5F99D 3AZHB 1P3GD 4J8UC 1M1AA 4DRAA 3WKJD 3MNNB 3REKA 2YFWB 4J8UD 2HIOD 2Y2KA 4KGCB 1M19A 3B6FB 1P3PB 3MGSA 5AY8A 2Y2PA 4KUDA 3MGRD 3AZHA 4YS3B 5JRGC 3MNNA 1BH9B 2FFFB 3MGPB 1AOIA 1F1EA 1P3PA 5AV5C 3X1UA 4WU9A 3W97C 3W96C 5E5AC 4JJND 5CPJB 3B6GB 3V9RB 4YS3A 1M18C 5AV5D 3C1BC 5B1MD 1BH9A 5E5AD 3W96D 1KU5A 5GSUD 3W99B 1M18D 3MGPA 3FDDA 5AVCB 3X1SA 2Y2QA 2JE5A 3WAAB 4QLCB 3B6GA 1B67A 5B2IB 4WV4B 3V9RA 3TU4B 1KX5C 3AV2C 1HQ3C 2Y2IA 3C1CA 3VH5T 3LELA 3AZNC 3W99A 1KX4A 1T3UA 2ZY4A 3RELC 3AFAB 3AZFB 5GT3B 1HQ3D 3AZND 5FUGB 3WAAA 3AZMB 1S32A 2G5IC 2Y2GA 5AVBC 3A1KA 3LZ0B 1KX3B 3F6TA 3B0CT 4H9QB 1WWIA 2NQBC 1P3BA 3REJA 5AV8B 3AZFA 3X1VB 3AFAA 1P34D 5GT3A 4G91B 2NZDC 1P3LB 3MVDB 5FUGA 5B31B 1P3IB 4E44A 4ZUXB 1ID3C 1Q9CA 2NZDD 1TZYA 1P3KB 3EG5B 1ID3D 4J8XB 5AV8A 3AZKD 3UT9C 3KUYD 4WU8B 4HGAC 3MVDA 3UTBB 3EPJA 2F8NB 1P3IA 3AZJD 4EO5C 3UT9D 4Z66C 4YM6D 4LD9C 4J8WC 4X23D 1P3MC 4XUJA 3A6NC 4Z66D 3W98C 4LD9D 2BYMA 4J8WD 1EQZC 1HTAA 1P3MD 2DQNC 3WTPB 3A6ND 1P3FD 3W98D 1EQZD 3AN2C 5GXQC 3LJAC 5AV9B 2AROC 5B2JC 3AYWB 2CV5A 5DNMA 5BNXB 3AN2D 4WNNA 2CWEA 4H9SA 3LJAD 5B2JD 3WTPA 3WKJB 3KWQC
chains in the Genus database with same CATH topology
3X1TA 5B1LC 5B0ZC 3UTAC 5B33A 1Z2CB 4J8UB 2F8NH 3KWQD 1ULYA 2HUEC 5B1LD 4Z5TC 5B0ZD 3KXBD 3WA9A 5GT0A 1TAFB 4Z5TD 4XZQC 4UPKA 3NQJB 4H9OB 5CPKB 5JRGB 2PYOC 5B32A 2VQRA 3AZGA 4NE3A 2PYOD 2G5HC 5AV5B 1U35C 3W97B 5E5AB 5F99C 3NQJA 3W96B 5CPKA 1P3OC 1M18B 5BT1C 5JRGA 4WZSB 1U35D 1F66A 3C1BB 2W8SA 2HIOC 1P3OD 5BT1D 1ZLAB 3H0MC 2Y2LA 3AZEC 5AV5A 2J8PA 2XD1A 3W97A 5B24A 5E5AA 3MGRC 1KX5B 3AZED 1H3OB 5CPIC 4R8PC 3C1BA 3AV2B 4ZBJC 1HQ3B 1WWSA 3AZNB 4DQYB 3RELB 1ZLAA 5CPID 4R8PD 2YFWA 1N1JB 5CP6C 4JJNC 3MGQC 2Y2HA 4KGCA 5B40D 3AV1D 5AVBB 4Z2MG 3B6FA 4H9PB 1KX5A 1P3AC 1H3OA 5B1MC 1PZRA 5DNNC 5CP6D 5BNVB 3MGQD 1HQ3A 3AZLC 5GSUC 3AV2A 2NQBB 3AZID 3RELA 1P3AD 5DNND 3AZLD 5G49B 4CSRB 2NZDB 5B0YC 4M6BA 4CAYB 1ID3B 5AVBA 4J8VC 2Y2NA 4H9PA 5B0YD 2NQBA 3REHC 5CPJA 4J8VD 1A7WA 3UT9B 1B6WA 2FJ7D 3REKC 5G49A 4HGAB 4CSRA 3REHD 2NZDA 2BYKB 4CAYA 5AVCA 4EO5B 1M19C 4Z66B 3REKD 3MGSC 4LD9B 4J8WB 4QLCA 5AY8C 1P3MB 5B2IA 4KUDC 2JCHA 3A6NB 1M19D 3TU4A 1BH8B 1P34C 3W98B 3MGSD 4NE5A 1EQZB 5AY8D 4KUDD 2BYKA 1AOIC 5AV6B 3MNND 3AL0C 3X1UC 4WU9C 4J8WA 5GXQB 3AZMA 1BFMA 3LJAB 1P3MA 2AROB 5B2JB 3LZ0A 1KX3A 3AZKC 1AOID 3KUYC 1P3PD 4H9QA 3X1UD 4WU9D 1EQZA 3AZJC 3X1VA 3KWQB 5AV6A 5B1LB 4AWLC 4YM6C 5B0ZB 3UTAB 3X1SC 4X23C 1P3LA 5B31A 5GXQA 4ZUXA 2AROA 3MGPD 2HUEB 3X1SD 1P3KA 3A1IA 2ZY2A 3B0DC 4J8XA 3C1CC 3LELC 3W99C 1P3FC 1KX4C 5BO0B 4XZQB 4WU8A 3UTAA 3UTBA 2F8NA 3C1CD 3LELD 1S32C 3W99D 1KX4D 2PYOB 3H0LC 1S32D 1P3BC 3REJC 1U35B 5BS7A 5BO0A 4XZQA 5F99B 1P3GB 1P3OB 1P3BD 3REJD 3AFAD 2HIOB 3AYWA 1TZYC 5AV9A 3KXBC 3EPLA 5C3IC 4G92C 3AZEB 5BNXA 2LY8A 5F99A 3MGRB 1TZYD 1P3GA 2F8NK 3O62C 3WKJA 5CPIB 5AV8D 4R8PB 5KDMB 4ZBJB 3VH6A 3EPHA 4J8UA 2HIOA 2F2AC 3O62D 4KHAB 1P3ID 4XUJC 3NQUB 5CP6B 4JJNB 3MGQB 4H9RB 3MGRA 4XUJD 1TAFA 5B1MB 5DNNB 3AZLB 5GSUB 4H9OA 4KHAA 3VH6W 2CV5C 2IO5C 5B31G 3LZ1C 5DNMC 3NQUA 4JJNA 4H9SC 4Z2MH 4H9RA 4J8VB 2CV5D 3LZ1D 2DF4C 3P5JB 5B1MA 5DNMD 3AZLA 3W96A 5GSUA 3X1TC 1M18A 5B33C 3WTPD 3X1TD 5B40C 5B33D 3AV1C 2YFVB 1M19B 3WA9C 3MGSB 3REIC 5GT0C 5AY8B 3AZIC 3WA9D 1P34B 3REID 5GT0D 3AZNA 5B32C 4E45A 2UWXA 2YFVA 1AOIB 3AZGC 1N1JA 5B32D 3X1UB 4WU9B 3AZKB 3AZGD 5CPKC 3KUYB 1P34A 2FJ7C 1F66C 5BNVA 2BG1A 3VH5A 2JSSA 3H0RC 3AZJB 1M1AC 4NFTA 5CPKD 5JRGD 1F66D 2RIQA 3X1SB 4AWLB 2Y2OA 2Y2JA 4YM6B 4X23B 2L5AA 5B32G 1M1AD 2Y2MA 5B24C 1ID3A 3AZKA 3KUYA 3W97D 3B0DB 5B24D 3AZHC 3C1CB 3LELB 3AZJA 1P3FB 3UT9A 3VH5W 1KX4B 1ZLAC 3MNNC 3C1BD 4UUZB 4YM6A 4X23A 3AZHD 1S32B 4KGCC 4Z66A 1ZLAD 3B6FC 1P3PC 3AN2B 4LD9A 3B0CW 3A6NA 4KGCD 1P3BB 1BH8A 4YS3C 3REJB 3B6FD 1P3FA 3W98A 1KX5D 4UUZA 3AV2D 4YS3D 3MGPC 3RELD 3AN2A 2ZY5A 3LJAA 1TZYB 5B2JA 3KXBB 5C3IB 4G92B 5CPJC 3B6GC 5AVBD 4Z5TB 2XD5A 5CHLB 5JA4B 2NQBD 5CPJD 3O62B 3B6GD 3KWQA 5AVCC 5B1LA 5B0ZA 1R4VA 3WAAC 4QLCC 3KXBA 5B2IC 5AVCD 4XUJB 4Z5TA 3TU4C 3KFUG 5JA4A 1JFIB 2BYMB 3WAAD 4QLCD 3O62A 5B2ID 3TU4D 3AZFC 3AFAC 5GT3C 4NE6A 3KSYA 3EPKA 3AZMC 2PYOA 3AZFD 2CV5B 2IO5B 3LZ0C 5GT3D 3LZ1B 1KX3C 3R45B 5DNMB 4WNNB 1JFIA 3AZMD 3LZ0D 1U35A 1KX3D 5AV8C 2RVQC 3X1VC 4G91C 5AV6C 3X1TB 1P3LC 3MVDC 1P3OA 5B33B 5B31C 1P3IC 4H9NB 4ZUXC 2RVQD 3X1VD 3LZ1A 3R45A 5AV6D 1P3LD 3MVDD 5B40B 3WTPE 3AV1B 1P3KC 5B31D 5GXQD 4ZUXD 4J8XC 2AROD 3AZEA 3WA9B 2ZM5A 3REIB 5GT0B 3AZIB 4WU8C 1P3KD 3UTBC 4J8XD 1P3AB 5CPIA 4H9NA 4R8PA 5KDMA 5B32B 4WU8D 3UTAD 5B40A 3UTBD 2F8ND 3AV1A 3AZGB 5B0YB 5CP6A 3REIA 5BS7C 3MGQA 3AZIA 3WTPC 1P3AA 5DNNA 1F66B 2FJ7B 3REHB 3IP4C 4XZQD 3VH6T 1M1AB 3AYWC 5AV9C 2F8NG 3REKB 4WJ3C 1W2EA 5B0YA 4DRBA 5B24B 4J8VA 3AYWD 5AV9D 1P3GC 2ZY3A 2FJ7A 3WKJC 3REHA 3B0BA 4KUDB 5F99D 3AZHB 1P3GD 4J8UC 1M1AA 4DRAA 3WKJD 3MNNB 3REKA 2YFWB 4J8UD 2HIOD 2Y2KA 4KGCB 1M19A 3B6FB 1P3PB 3MGSA 5AY8A 2Y2PA 4KUDA 3MGRD 3AZHA 4YS3B 5JRGC 3MNNA 1BH9B 2FFFB 3MGPB 1AOIA 1F1EA 1P3PA 5AV5C 3X1UA 4WU9A 3W97C 3W96C 5E5AC 4JJND 5CPJB 3B6GB 3V9RB 4YS3A 1M18C 5AV5D 3C1BC 5B1MD 1BH9A 5E5AD 3W96D 1KU5A 5GSUD 3W99B 1M18D 3MGPA 3FDDA 5AVCB 3X1SA 2Y2QA 2JE5A 3WAAB 4QLCB 3B6GA 1B67A 5B2IB 4WV4B 3V9RA 3TU4B 1KX5C 3AV2C 1HQ3C 2Y2IA 3C1CA 3VH5T 3LELA 3AZNC 3W99A 1KX4A 1T3UA 2ZY4A 3RELC 3AFAB 3AZFB 5GT3B 1HQ3D 3AZND 5FUGB 3WAAA 3AZMB 1S32A 2G5IC 2Y2GA 5AVBC 3A1KA 3LZ0B 1KX3B 3F6TA 3B0CT 4H9QB 1WWIA 2NQBC 1P3BA 3REJA 5AV8B 3AZFA 3X1VB 3AFAA 1P34D 5GT3A 4G91B 2NZDC 1P3LB 3MVDB 5FUGA 5B31B 1P3IB 4E44A 4ZUXB 1ID3C 1Q9CA 2NZDD 1TZYA 1P3KB 3EG5B 1ID3D 4J8XB 5AV8A 3AZKD 3UT9C 3KUYD 4WU8B 4HGAC 3MVDA 3UTBB 3EPJA 2F8NB 1P3IA 3AZJD 4EO5C 3UT9D 4Z66C 4YM6D 4LD9C 4J8WC 4X23D 1P3MC 4XUJA 3A6NC 4Z66D 3W98C 4LD9D 2BYMA 4J8WD 1EQZC 1HTAA 1P3MD 2DQNC 3WTPB 3A6ND 1P3FD 3W98D 1EQZD 3AN2C 5GXQC 3LJAC 5AV9B 2AROC 5B2JC 3AYWB 2CV5A 5DNMA 5BNXB 3AN2D 4WNNA 2CWEA 4H9SA 3LJAD 5B2JD 3WTPA 3WKJB 3KWQC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3X1T A;  5B1L C;  5B0Z C;  3UTA C;  5B33 A;  4J8U B;  2F8N H;  3KWQ D;  1ULY A;  2HUE C;  5B1L D;  4Z5T C;  5B0Z D;  3KXB D;  3WA9 A;  5GT0 A;  1TAF B;  4Z5T D;  4XZQ C;  3NQJ B;  4H9O B;  5CPK B;  5JRG B;  2PYO C;  5B32 A;  3AZG A;  4NE3 A;  2PYO D;  1U35 C;  5AV5 B;  3W97 B;  5E5A B;  5F99 C;  3NQJ A;  3W96 B;  5CPK A;  1P3O C;  1M18 B;  5BT1 C;  5JRG A;  4WZS B;  1U35 D;  1F66 A;  3C1B B;  2HIO C;  1P3O D;  5BT1 D;  1ZLA B;  3AZE C;  5AV5 A;  3W97 A;  5B24 A;  5E5A A;  3MGR C;  1KX5 B;  3AZE D;  1H3O B;  5CPI C;  4R8P C;  3C1B A;  3AV2 B;  4ZBJ C;  1HQ3 B;  1WWS A;  3AZN B;  3REL B;  1ZLA A;  5CPI D;  4R8P D;  2YFW A;  1N1J B;  5CP6 C;  4JJN C;  3MGQ C;  4KGC A;  5B40 D;  3AV1 D;  5AVB B;  4Z2M G;  3B6F A;  4H9P B;  1KX5 A;  1P3A C;  1H3O A;  5B1M C;  5DNN C;  5CP6 D;  3AZL C;  5BNV B;  3MGQ D;  1HQ3 A;  3AV2 A;  5GSU C;  2NQB B;  3AZI D;  3REL A;  1P3A D;  5DNN D;  3AZL D;  5G49 B;  4CSR B;  2NZD B;  5B0Y C;  4M6B A;  4CAY B;  1ID3 B;  5AVB A;  4J8V C;  4H9P A;  5B0Y D;  2NQB A;  3REH C;  5CPJ A;  4J8V D;  1A7W A;  3UT9 B;  1B6W A;  2FJ7 D;  3REK C;  5G49 A;  4HGA B;  4CSR A;  3REH D;  2NZD A;  2BYK B;  4CAY A;  5AVC A;  4EO5 B;  1M19 C;  4Z66 B;  3REK D;  3MGS C;  4LD9 B;  4J8W B;  4QLC A;  5AY8 C;  1P3M B;  5B2I A;  4KUD C;  3A6N B;  1M19 D;  3TU4 A;  1BH8 B;  1P34 C;  3W98 B;  3MGS D;  4NE5 A;  1EQZ B;  5AY8 D;  4KUD D;  2BYK A;  1AOI C;  5AV6 B;  3MNN D;  3X1U C;  4WU9 C;  4J8W A;  5GXQ B;  3AZM A;  1BFM A;  3LJA B;  1P3M A;  2ARO B;  5B2J B;  3LZ0 A;  1KX3 A;  3AZK C;  1AOI D;  3KUY C;  1P3P D;  4H9Q A;  3X1U D;  4WU9 D;  1EQZ A;  3AZJ C;  3X1V A;  3KWQ B;  5AV6 A;  5B1L B;  4AWL C;  4YM6 C;  5B0Z B;  3UTA B;  3X1S C;  4X23 C;  1P3L A;  5B31 A;  5GXQ A;  4ZUX A;  2ARO A;  3MGP D;  2HUE B;  3X1S D;  1P3K A;  3B0D C;  4J8X A;  3C1C C;  3LEL C;  3W99 C;  1P3F C;  1KX4 C;  5BO0 B;  4XZQ B;  4WU8 A;  3UTA A;  3UTB A;  2F8N A;  3C1C D;  3LEL D;  1S32 C;  3W99 D;  1KX4 D;  2PYO B;  1S32 D;  1P3B C;  3REJ C;  1U35 B;  5BS7 A;  5BO0 A;  4XZQ A;  5F99 B;  1P3G B;  1P3O B;  1P3B D;  3REJ D;  3AFA D;  2HIO B;  3AYW A;  1TZY C;  5AV9 A;  3KXB C;  5C3I C;  4G92 C;  3AZE B;  5BNX A;  2LY8 A;  5F99 A;  3MGR B;  1TZY D;  1P3G A;  2F8N K;  3O62 C;  3WKJ A;  5CPI B;  5AV8 D;  4R8P B;  5KDM B;  4ZBJ B;  3VH6 A;  4J8U A;  2HIO A;  3O62 D;  4KHA B;  1P3I D;  4XUJ C;  3NQU B;  5CP6 B;  4JJN B;  3MGQ B;  4H9R B;  3MGR A;  4XUJ D;  1TAF A;  5B1M B;  5DNN B;  3AZL B;  5GSU B;  4H9O A;  4KHA A;  3VH6 W;  2CV5 C;  2IO5 C;  5B31 G;  3LZ1 C;  5DNM C;  3NQU A;  4JJN A;  4H9S C;  4Z2M H;  4H9R A;  4J8V B;  2CV5 D;  3LZ1 D;  5B1M A;  5DNM D;  3AZL A;  3W96 A;  5GSU A;  3X1T C;  1M18 A;  5B33 C;  3WTP D;  3X1T D;  5B40 C;  5B33 D;  3AV1 C;  2YFV B;  1M19 B;  3WA9 C;  3MGS B;  3REI C;  5GT0 C;  5AY8 B;  3AZI C;  3WA9 D;  1P34 B;  3REI D;  5GT0 D;  3AZN A;  5B32 C;  4E45 A;  2YFV A;  1AOI B;  3AZG C;  1N1J A;  5B32 D;  3X1U B;  4WU9 B;  3AZK B;  3AZG D;  5CPK C;  3KUY B;  1P34 A;  2FJ7 C;  1F66 C;  5BNV A;  3VH5 A;  2JSS A;  3AZJ B;  1M1A C;  4NFT A;  5CPK D;  5JRG D;  1F66 D;  3X1S B;  4AWL B;  4YM6 B;  4X23 B;  2L5A A;  5B32 G;  1M1A D;  1ID3 A;  5B24 C;  3AZK A;  3KUY A;  3W97 D;  3B0D B;  5B24 D;  3AZH C;  3C1C B;  3LEL B;  3AZJ A;  1P3F B;  3UT9 A;  3VH5 W;  1KX4 B;  1ZLA C;  3MNN C;  3C1B D;  4UUZ B;  4YM6 A;  4X23 A;  3AZH D;  1S32 B;  4KGC C;  4Z66 A;  1ZLA D;  3B6F C;  1P3P C;  3AN2 B;  4LD9 A;  3B0C W;  3A6N A;  4KGC D;  1P3B B;  1BH8 A;  4YS3 C;  3REJ B;  3B6F D;  1P3F A;  3W98 A;  1KX5 D;  4UUZ A;  3AV2 D;  4YS3 D;  3MGP C;  3REL D;  3AN2 A;  3LJA A;  1TZY B;  5B2J A;  3KXB B;  5C3I B;  4G92 B;  5CPJ C;  3B6G C;  5AVB D;  4Z5T B;  5CHL B;  5JA4 B;  2NQB D;  5CPJ D;  3O62 B;  3B6G D;  3KWQ A;  5AVC C;  5B1L A;  5B0Z A;  1R4V A;  3WAA C;  4QLC C;  3KXB A;  5B2I C;  5AVC D;  4XUJ B;  4Z5T A;  3TU4 C;  5JA4 A;  1JFI B;  2BYM B;  3WAA D;  4QLC D;  3O62 A;  5B2I D;  3TU4 D;  3AZF C;  3AFA C;  5GT3 C;  4NE6 A;  3KSY A;  3AZM C;  2PYO A;  3AZF D;  2CV5 B;  2IO5 B;  3LZ0 C;  5GT3 D;  3LZ1 B;  1KX3 C;  3R45 B;  5DNM B;  4WNN B;  1JFI A;  3AZM D;  3LZ0 D;  1U35 A;  1KX3 D;  5AV8 C;  2RVQ C;  3X1V C;  4G91 C;  5AV6 C;  3X1T B;  1P3L C;  3MVD C;  1P3O A;  5B33 B;  5B31 C;  1P3I C;  4H9N B;  4ZUX C;  2RVQ D;  3X1V D;  3LZ1 A;  3R45 A;  5AV6 D;  1P3L D;  3MVD D;  5B40 B;  3WTP E;  3AV1 B;  1P3K C;  5B31 D;  5GXQ D;  4ZUX D;  4J8X C;  2ARO D;  3AZE A;  3WA9 B;  3REI B;  5GT0 B;  3AZI B;  4WU8 C;  1P3K D;  3UTB C;  4J8X D;  1P3A B;  5CPI A;  4H9N A;  4R8P A;  5KDM A;  5B32 B;  4WU8 D;  3UTA D;  5B40 A;  3UTB D;  2F8N D;  3AV1 A;  3AZG B;  5B0Y B;  5CP6 A;  3REI A;  5BS7 C;  3MGQ A;  3AZI A;  3WTP C;  1P3A A;  5DNN A;  1F66 B;  2FJ7 B;  3REH B;  4XZQ D;  3VH6 T;  1M1A B;  3AYW C;  5AV9 C;  2F8N G;  3REK B;  5B0Y A;  4DRB A;  5B24 B;  4J8V A;  3AYW D;  5AV9 D;  1P3G C;  2FJ7 A;  3WKJ C;  3REH A;  3B0B A;  4KUD B;  5F99 D;  3AZH B;  1P3G D;  4J8U C;  1M1A A;  4DRA A;  3WKJ D;  3MNN B;  3REK A;  2YFW B;  4J8U D;  2HIO D;  4KGC B;  1M19 A;  3B6F B;  1P3P B;  3MGS A;  5AY8 A;  4KUD A;  3MGR D;  3AZH A;  4YS3 B;  5JRG C;  3MNN A;  1BH9 B;  3MGP B;  1AOI A;  1F1E A;  1P3P A;  5AV5 C;  3X1U A;  4WU9 A;  3W97 C;  3W96 C;  5E5A C;  4JJN D;  5CPJ B;  3B6G B;  3V9R B;  4YS3 A;  1M18 C;  5AV5 D;  3C1B C;  5B1M D;  1BH9 A;  5E5A D;  3W96 D;  1KU5 A;  5GSU D;  3W99 B;  1M18 D;  3MGP A;  5AVC B;  3X1S A;  3WAA B;  4QLC B;  3B6G A;  1B67 A;  5B2I B;  4WV4 B;  3V9R A;  3TU4 B;  1KX5 C;  3AV2 C;  1HQ3 C;  3C1C A;  3VH5 T;  3LEL A;  3AZN C;  3W99 A;  1KX4 A;  3REL C;  3AZF B;  3AFA B;  5GT3 B;  1HQ3 D;  3AZN D;  5FUG B;  3WAA A;  3AZM B;  1S32 A;  5AVB C;  3LZ0 B;  1KX3 B;  3B0C T;  4H9Q B;  1WWI A;  2NQB C;  1P3B A;  3REJ A;  5AV8 B;  3AZF A;  3X1V B;  3AFA A;  1P34 D;  5GT3 A;  4G91 B;  2NZD C;  1P3L B;  3MVD B;  5FUG A;  5B31 B;  1P3I B;  4E44 A;  4ZUX B;  1ID3 C;  1Q9C A;  2NZD D;  1TZY A;  1P3K B;  1ID3 D;  4J8X B;  5AV8 A;  3AZK D;  3UT9 C;  3KUY D;  4WU8 B;  4HGA C;  3MVD A;  3UTB B;  2F8N B;  1P3I A;  3AZJ D;  4EO5 C;  3UT9 D;  4Z66 C;  4YM6 D;  4LD9 C;  4J8W C;  4X23 D;  1P3M C;  4XUJ A;  3A6N C;  4Z66 D;  3W98 C;  4LD9 D;  2BYM A;  4J8W D;  1EQZ C;  1HTA A;  1P3M D;  3WTP B;  3A6N D;  1P3F D;  3W98 D;  1EQZ D;  3AN2 C;  5GXQ C;  3LJA C;  5AV9 B;  2ARO C;  5B2J C;  3AYW B;  2CV5 A;  5DNM A;  5BNX B;  3AN2 D;  4WNN A;  2CWE A;  4H9S A;  3LJA D;  5B2J D;  3WTP A;  3WKJ B;  3KWQ C; 
#chains in the Genus database with same CATH topology
 3X1T A;  5B1L C;  5B0Z C;  3UTA C;  5B33 A;  1Z2C B;  4J8U B;  2F8N H;  3KWQ D;  1ULY A;  2HUE C;  5B1L D;  4Z5T C;  5B0Z D;  3KXB D;  3WA9 A;  5GT0 A;  1TAF B;  4Z5T D;  4XZQ C;  4UPK A;  3NQJ B;  4H9O B;  5CPK B;  5JRG B;  2PYO C;  5B32 A;  2VQR A;  3AZG A;  4NE3 A;  2PYO D;  2G5H C;  5AV5 B;  1U35 C;  3W97 B;  5E5A B;  5F99 C;  3NQJ A;  3W96 B;  5CPK A;  1P3O C;  1M18 B;  5BT1 C;  5JRG A;  4WZS B;  1U35 D;  1F66 A;  3C1B B;  2W8S A;  2HIO C;  1P3O D;  5BT1 D;  1ZLA B;  3H0M C;  2Y2L A;  3AZE C;  5AV5 A;  2J8P A;  2XD1 A;  3W97 A;  5B24 A;  5E5A A;  3MGR C;  1KX5 B;  3AZE D;  1H3O B;  5CPI C;  4R8P C;  3C1B A;  3AV2 B;  4ZBJ C;  1HQ3 B;  1WWS A;  3AZN B;  4DQY B;  3REL B;  1ZLA A;  5CPI D;  4R8P D;  2YFW A;  1N1J B;  5CP6 C;  4JJN C;  3MGQ C;  2Y2H A;  4KGC A;  5B40 D;  3AV1 D;  5AVB B;  4Z2M G;  3B6F A;  4H9P B;  1KX5 A;  1P3A C;  1H3O A;  5B1M C;  1PZR A;  5DNN C;  5CP6 D;  5BNV B;  3MGQ D;  1HQ3 A;  3AZL C;  5GSU C;  3AV2 A;  2NQB B;  3AZI D;  3REL A;  1P3A D;  5DNN D;  3AZL D;  5G49 B;  4CSR B;  2NZD B;  5B0Y C;  4M6B A;  4CAY B;  1ID3 B;  5AVB A;  4J8V C;  2Y2N A;  4H9P A;  5B0Y D;  2NQB A;  3REH C;  5CPJ A;  4J8V D;  1A7W A;  3UT9 B;  1B6W A;  2FJ7 D;  3REK C;  5G49 A;  4HGA B;  4CSR A;  3REH D;  2NZD A;  2BYK B;  4CAY A;  5AVC A;  4EO5 B;  1M19 C;  4Z66 B;  3REK D;  3MGS C;  4LD9 B;  4J8W B;  4QLC A;  5AY8 C;  1P3M B;  5B2I A;  4KUD C;  2JCH A;  3A6N B;  1M19 D;  3TU4 A;  1BH8 B;  1P34 C;  3W98 B;  3MGS D;  4NE5 A;  1EQZ B;  5AY8 D;  4KUD D;  2BYK A;  1AOI C;  5AV6 B;  3MNN D;  3AL0 C;  3X1U C;  4WU9 C;  4J8W A;  5GXQ B;  3AZM A;  1BFM A;  3LJA B;  1P3M A;  2ARO B;  5B2J B;  3LZ0 A;  1KX3 A;  3AZK C;  1AOI D;  3KUY C;  1P3P D;  4H9Q A;  3X1U D;  4WU9 D;  1EQZ A;  3AZJ C;  3X1V A;  3KWQ B;  5AV6 A;  5B1L B;  4AWL C;  4YM6 C;  5B0Z B;  3UTA B;  3X1S C;  4X23 C;  1P3L A;  5B31 A;  5GXQ A;  4ZUX A;  2ARO A;  3MGP D;  2HUE B;  3X1S D;  1P3K A;  3A1I A;  2ZY2 A;  3B0D C;  4J8X A;  3C1C C;  3LEL C;  3W99 C;  1P3F C;  1KX4 C;  5BO0 B;  4XZQ B;  4WU8 A;  3UTA A;  3UTB A;  2F8N A;  3C1C D;  3LEL D;  1S32 C;  3W99 D;  1KX4 D;  2PYO B;  3H0L C;  1S32 D;  1P3B C;  3REJ C;  1U35 B;  5BS7 A;  5BO0 A;  4XZQ A;  5F99 B;  1P3G B;  1P3O B;  1P3B D;  3REJ D;  3AFA D;  2HIO B;  3AYW A;  1TZY C;  5AV9 A;  3KXB C;  3EPL A;  5C3I C;  4G92 C;  3AZE B;  5BNX A;  2LY8 A;  5F99 A;  3MGR B;  1TZY D;  1P3G A;  2F8N K;  3O62 C;  3WKJ A;  5CPI B;  5AV8 D;  4R8P B;  5KDM B;  4ZBJ B;  3VH6 A;  3EPH A;  4J8U A;  2HIO A;  2F2A C;  3O62 D;  4KHA B;  1P3I D;  4XUJ C;  3NQU B;  5CP6 B;  4JJN B;  3MGQ B;  4H9R B;  3MGR A;  4XUJ D;  1TAF A;  5B1M B;  5DNN B;  3AZL B;  5GSU B;  4H9O A;  4KHA A;  3VH6 W;  2CV5 C;  2IO5 C;  5B31 G;  3LZ1 C;  5DNM C;  3NQU A;  4JJN A;  4H9S C;  4Z2M H;  4H9R A;  4J8V B;  2CV5 D;  3LZ1 D;  2DF4 C;  3P5J B;  5B1M A;  5DNM D;  3AZL A;  3W96 A;  5GSU A;  3X1T C;  1M18 A;  5B33 C;  3WTP D;  3X1T D;  5B40 C;  5B33 D;  3AV1 C;  2YFV B;  1M19 B;  3WA9 C;  3MGS B;  3REI C;  5GT0 C;  5AY8 B;  3AZI C;  3WA9 D;  1P34 B;  3REI D;  5GT0 D;  3AZN A;  5B32 C;  4E45 A;  2UWX A;  2YFV A;  1AOI B;  3AZG C;  1N1J A;  5B32 D;  3X1U B;  4WU9 B;  3AZK B;  3AZG D;  5CPK C;  3KUY B;  1P34 A;  2FJ7 C;  1F66 C;  5BNV A;  2BG1 A;  3VH5 A;  2JSS A;  3H0R C;  3AZJ B;  1M1A C;  4NFT A;  5CPK D;  5JRG D;  1F66 D;  2RIQ A;  3X1S B;  4AWL B;  2Y2O A;  2Y2J A;  4YM6 B;  4X23 B;  2L5A A;  5B32 G;  1M1A D;  2Y2M A;  5B24 C;  1ID3 A;  3AZK A;  3KUY A;  3W97 D;  3B0D B;  5B24 D;  3AZH C;  3C1C B;  3LEL B;  3AZJ A;  1P3F B;  3UT9 A;  3VH5 W;  1KX4 B;  1ZLA C;  3MNN C;  3C1B D;  4UUZ B;  4YM6 A;  4X23 A;  3AZH D;  1S32 B;  4KGC C;  4Z66 A;  1ZLA D;  3B6F C;  1P3P C;  3AN2 B;  4LD9 A;  3B0C W;  3A6N A;  4KGC D;  1P3B B;  1BH8 A;  4YS3 C;  3REJ B;  3B6F D;  1P3F A;  3W98 A;  1KX5 D;  4UUZ A;  3AV2 D;  4YS3 D;  3MGP C;  3REL D;  3AN2 A;  2ZY5 A;  3LJA A;  1TZY B;  5B2J A;  3KXB B;  5C3I B;  4G92 B;  5CPJ C;  3B6G C;  5AVB D;  4Z5T B;  2XD5 A;  5CHL B;  5JA4 B;  2NQB D;  5CPJ D;  3O62 B;  3B6G D;  3KWQ A;  5AVC C;  5B1L A;  5B0Z A;  1R4V A;  3WAA C;  4QLC C;  3KXB A;  5B2I C;  5AVC D;  4XUJ B;  4Z5T A;  3TU4 C;  3KFU G;  5JA4 A;  1JFI B;  2BYM B;  3WAA D;  4QLC D;  3O62 A;  5B2I D;  3TU4 D;  3AZF C;  3AFA C;  5GT3 C;  4NE6 A;  3KSY A;  3EPK A;  3AZM C;  2PYO A;  3AZF D;  2CV5 B;  2IO5 B;  3LZ0 C;  5GT3 D;  3LZ1 B;  1KX3 C;  3R45 B;  5DNM B;  4WNN B;  1JFI A;  3AZM D;  3LZ0 D;  1U35 A;  1KX3 D;  5AV8 C;  2RVQ C;  3X1V C;  4G91 C;  5AV6 C;  3X1T B;  1P3L C;  3MVD C;  1P3O A;  5B33 B;  5B31 C;  1P3I C;  4H9N B;  4ZUX C;  2RVQ D;  3X1V D;  3LZ1 A;  3R45 A;  5AV6 D;  1P3L D;  3MVD D;  5B40 B;  3WTP E;  3AV1 B;  1P3K C;  5B31 D;  5GXQ D;  4ZUX D;  4J8X C;  2ARO D;  3AZE A;  3WA9 B;  2ZM5 A;  3REI B;  5GT0 B;  3AZI B;  4WU8 C;  1P3K D;  3UTB C;  4J8X D;  1P3A B;  5CPI A;  4H9N A;  4R8P A;  5KDM A;  5B32 B;  4WU8 D;  3UTA D;  5B40 A;  3UTB D;  2F8N D;  3AV1 A;  3AZG B;  5B0Y B;  5CP6 A;  3REI A;  5BS7 C;  3MGQ A;  3AZI A;  3WTP C;  1P3A A;  5DNN A;  1F66 B;  2FJ7 B;  3REH B;  3IP4 C;  4XZQ D;  3VH6 T;  1M1A B;  3AYW C;  5AV9 C;  2F8N G;  3REK B;  4WJ3 C;  1W2E A;  5B0Y A;  4DRB A;  5B24 B;  4J8V A;  3AYW D;  5AV9 D;  1P3G C;  2ZY3 A;  2FJ7 A;  3WKJ C;  3REH A;  3B0B A;  4KUD B;  5F99 D;  3AZH B;  1P3G D;  4J8U C;  1M1A A;  4DRA A;  3WKJ D;  3MNN B;  3REK A;  2YFW B;  4J8U D;  2HIO D;  2Y2K A;  4KGC B;  1M19 A;  3B6F B;  1P3P B;  3MGS A;  5AY8 A;  2Y2P A;  4KUD A;  3MGR D;  3AZH A;  4YS3 B;  5JRG C;  3MNN A;  1BH9 B;  2FFF B;  3MGP B;  1AOI A;  1F1E A;  1P3P A;  5AV5 C;  3X1U A;  4WU9 A;  3W97 C;  3W96 C;  5E5A C;  4JJN D;  5CPJ B;  3B6G B;  3V9R B;  4YS3 A;  1M18 C;  5AV5 D;  3C1B C;  5B1M D;  1BH9 A;  5E5A D;  3W96 D;  1KU5 A;  5GSU D;  3W99 B;  1M18 D;  3MGP A;  3FDD A;  5AVC B;  3X1S A;  2Y2Q A;  2JE5 A;  3WAA B;  4QLC B;  3B6G A;  1B67 A;  5B2I B;  4WV4 B;  3V9R A;  3TU4 B;  1KX5 C;  3AV2 C;  1HQ3 C;  2Y2I A;  3C1C A;  3VH5 T;  3LEL A;  3AZN C;  3W99 A;  1KX4 A;  1T3U A;  2ZY4 A;  3REL C;  3AFA B;  3AZF B;  5GT3 B;  1HQ3 D;  3AZN D;  5FUG B;  3WAA A;  3AZM B;  1S32 A;  2G5I C;  2Y2G A;  5AVB C;  3A1K A;  3LZ0 B;  1KX3 B;  3F6T A;  3B0C T;  4H9Q B;  1WWI A;  2NQB C;  1P3B A;  3REJ A;  5AV8 B;  3AZF A;  3X1V B;  3AFA A;  1P34 D;  5GT3 A;  4G91 B;  2NZD C;  1P3L B;  3MVD B;  5FUG A;  5B31 B;  1P3I B;  4E44 A;  4ZUX B;  1ID3 C;  1Q9C A;  2NZD D;  1TZY A;  1P3K B;  3EG5 B;  1ID3 D;  4J8X B;  5AV8 A;  3AZK D;  3UT9 C;  3KUY D;  4WU8 B;  4HGA C;  3MVD A;  3UTB B;  3EPJ A;  2F8N B;  1P3I A;  3AZJ D;  4EO5 C;  3UT9 D;  4Z66 C;  4YM6 D;  4LD9 C;  4J8W C;  4X23 D;  1P3M C;  4XUJ A;  3A6N C;  4Z66 D;  3W98 C;  4LD9 D;  2BYM A;  4J8W D;  1EQZ C;  1HTA A;  1P3M D;  2DQN C;  3WTP B;  3A6N D;  1P3F D;  3W98 D;  1EQZ D;  3AN2 C;  5GXQ C;  3LJA C;  5AV9 B;  2ARO C;  5B2J C;  3AYW B;  2CV5 A;  5DNM A;  5BNX B;  3AN2 D;  4WNN A;  2CWE A;  4H9S A;  3LJA D;  5B2J D;  3WTP A;  3WKJ B;  3KWQ C; 
#chains in the Genus database with same CATH homology
 3X1T A;  5B1L C;  5B0Z C;  3UTA C;  5B33 A;  1Z2C B;  4J8U B;  2F8N H;  3KWQ D;  1ULY A;  2HUE C;  5B1L D;  4Z5T C;  5B0Z D;  3KXB D;  3WA9 A;  5GT0 A;  1TAF B;  4Z5T D;  4XZQ C;  4UPK A;  3NQJ B;  4H9O B;  5CPK B;  5JRG B;  2PYO C;  5B32 A;  2VQR A;  3AZG A;  4NE3 A;  2PYO D;  2G5H C;  5AV5 B;  1U35 C;  3W97 B;  5E5A B;  5F99 C;  3NQJ A;  3W96 B;  5CPK A;  1P3O C;  1M18 B;  5BT1 C;  5JRG A;  4WZS B;  1U35 D;  1F66 A;  3C1B B;  2W8S A;  2HIO C;  1P3O D;  5BT1 D;  1ZLA B;  3H0M C;  2Y2L A;  3AZE C;  5AV5 A;  2J8P A;  2XD1 A;  3W97 A;  5B24 A;  5E5A A;  3MGR C;  1KX5 B;  3AZE D;  1H3O B;  5CPI C;  4R8P C;  3C1B A;  3AV2 B;  4ZBJ C;  1HQ3 B;  1WWS A;  3AZN B;  4DQY B;  3REL B;  1ZLA A;  5CPI D;  4R8P D;  2YFW A;  1N1J B;  5CP6 C;  4JJN C;  3MGQ C;  2Y2H A;  4KGC A;  5B40 D;  3AV1 D;  5AVB B;  4Z2M G;  3B6F A;  4H9P B;  1KX5 A;  1P3A C;  1H3O A;  5B1M C;  1PZR A;  5DNN C;  5CP6 D;  5BNV B;  3MGQ D;  1HQ3 A;  3AZL C;  5GSU C;  3AV2 A;  2NQB B;  3AZI D;  3REL A;  1P3A D;  5DNN D;  3AZL D;  5G49 B;  4CSR B;  2NZD B;  5B0Y C;  4M6B A;  4CAY B;  1ID3 B;  5AVB A;  4J8V C;  2Y2N A;  4H9P A;  5B0Y D;  2NQB A;  3REH C;  5CPJ A;  4J8V D;  1A7W A;  3UT9 B;  1B6W A;  2FJ7 D;  3REK C;  5G49 A;  4HGA B;  4CSR A;  3REH D;  2NZD A;  2BYK B;  4CAY A;  5AVC A;  4EO5 B;  1M19 C;  4Z66 B;  3REK D;  3MGS C;  4LD9 B;  4J8W B;  4QLC A;  5AY8 C;  1P3M B;  5B2I A;  4KUD C;  2JCH A;  3A6N B;  1M19 D;  3TU4 A;  1BH8 B;  1P34 C;  3W98 B;  3MGS D;  4NE5 A;  1EQZ B;  5AY8 D;  4KUD D;  2BYK A;  1AOI C;  5AV6 B;  3MNN D;  3AL0 C;  3X1U C;  4WU9 C;  4J8W A;  5GXQ B;  3AZM A;  1BFM A;  3LJA B;  1P3M A;  2ARO B;  5B2J B;  3LZ0 A;  1KX3 A;  3AZK C;  1AOI D;  3KUY C;  1P3P D;  4H9Q A;  3X1U D;  4WU9 D;  1EQZ A;  3AZJ C;  3X1V A;  3KWQ B;  5AV6 A;  5B1L B;  4AWL C;  4YM6 C;  5B0Z B;  3UTA B;  3X1S C;  4X23 C;  1P3L A;  5B31 A;  5GXQ A;  4ZUX A;  2ARO A;  3MGP D;  2HUE B;  3X1S D;  1P3K A;  3A1I A;  2ZY2 A;  3B0D C;  4J8X A;  3C1C C;  3LEL C;  3W99 C;  1P3F C;  1KX4 C;  5BO0 B;  4XZQ B;  4WU8 A;  3UTA A;  3UTB A;  2F8N A;  3C1C D;  3LEL D;  1S32 C;  3W99 D;  1KX4 D;  2PYO B;  3H0L C;  1S32 D;  1P3B C;  3REJ C;  1U35 B;  5BS7 A;  5BO0 A;  4XZQ A;  5F99 B;  1P3G B;  1P3O B;  1P3B D;  3REJ D;  3AFA D;  2HIO B;  3AYW A;  1TZY C;  5AV9 A;  3KXB C;  3EPL A;  5C3I C;  4G92 C;  3AZE B;  5BNX A;  2LY8 A;  5F99 A;  3MGR B;  1TZY D;  1P3G A;  2F8N K;  3O62 C;  3WKJ A;  5CPI B;  5AV8 D;  4R8P B;  5KDM B;  4ZBJ B;  3VH6 A;  3EPH A;  4J8U A;  2HIO A;  2F2A C;  3O62 D;  4KHA B;  1P3I D;  4XUJ C;  3NQU B;  5CP6 B;  4JJN B;  3MGQ B;  4H9R B;  3MGR A;  4XUJ D;  1TAF A;  5B1M B;  5DNN B;  3AZL B;  5GSU B;  4H9O A;  4KHA A;  3VH6 W;  2CV5 C;  2IO5 C;  5B31 G;  3LZ1 C;  5DNM C;  3NQU A;  4JJN A;  4H9S C;  4Z2M H;  4H9R A;  4J8V B;  2CV5 D;  3LZ1 D;  2DF4 C;  3P5J B;  5B1M A;  5DNM D;  3AZL A;  3W96 A;  5GSU A;  3X1T C;  1M18 A;  5B33 C;  3WTP D;  3X1T D;  5B40 C;  5B33 D;  3AV1 C;  2YFV B;  1M19 B;  3WA9 C;  3MGS B;  3REI C;  5GT0 C;  5AY8 B;  3AZI C;  3WA9 D;  1P34 B;  3REI D;  5GT0 D;  3AZN A;  5B32 C;  4E45 A;  2UWX A;  2YFV A;  1AOI B;  3AZG C;  1N1J A;  5B32 D;  3X1U B;  4WU9 B;  3AZK B;  3AZG D;  5CPK C;  3KUY B;  1P34 A;  2FJ7 C;  1F66 C;  5BNV A;  2BG1 A;  3VH5 A;  2JSS A;  3H0R C;  3AZJ B;  1M1A C;  4NFT A;  5CPK D;  5JRG D;  1F66 D;  2RIQ A;  3X1S B;  4AWL B;  2Y2O A;  2Y2J A;  4YM6 B;  4X23 B;  2L5A A;  5B32 G;  1M1A D;  2Y2M A;  5B24 C;  1ID3 A;  3AZK A;  3KUY A;  3W97 D;  3B0D B;  5B24 D;  3AZH C;  3C1C B;  3LEL B;  3AZJ A;  1P3F B;  3UT9 A;  3VH5 W;  1KX4 B;  1ZLA C;  3MNN C;  3C1B D;  4UUZ B;  4YM6 A;  4X23 A;  3AZH D;  1S32 B;  4KGC C;  4Z66 A;  1ZLA D;  3B6F C;  1P3P C;  3AN2 B;  4LD9 A;  3B0C W;  3A6N A;  4KGC D;  1P3B B;  1BH8 A;  4YS3 C;  3REJ B;  3B6F D;  1P3F A;  3W98 A;  1KX5 D;  4UUZ A;  3AV2 D;  4YS3 D;  3MGP C;  3REL D;  3AN2 A;  2ZY5 A;  3LJA A;  1TZY B;  5B2J A;  3KXB B;  5C3I B;  4G92 B;  5CPJ C;  3B6G C;  5AVB D;  4Z5T B;  2XD5 A;  5CHL B;  5JA4 B;  2NQB D;  5CPJ D;  3O62 B;  3B6G D;  3KWQ A;  5AVC C;  5B1L A;  5B0Z A;  1R4V A;  3WAA C;  4QLC C;  3KXB A;  5B2I C;  5AVC D;  4XUJ B;  4Z5T A;  3TU4 C;  3KFU G;  5JA4 A;  1JFI B;  2BYM B;  3WAA D;  4QLC D;  3O62 A;  5B2I D;  3TU4 D;  3AZF C;  3AFA C;  5GT3 C;  4NE6 A;  3KSY A;  3EPK A;  3AZM C;  2PYO A;  3AZF D;  2CV5 B;  2IO5 B;  3LZ0 C;  5GT3 D;  3LZ1 B;  1KX3 C;  3R45 B;  5DNM B;  4WNN B;  1JFI A;  3AZM D;  3LZ0 D;  1U35 A;  1KX3 D;  5AV8 C;  2RVQ C;  3X1V C;  4G91 C;  5AV6 C;  3X1T B;  1P3L C;  3MVD C;  1P3O A;  5B33 B;  5B31 C;  1P3I C;  4H9N B;  4ZUX C;  2RVQ D;  3X1V D;  3LZ1 A;  3R45 A;  5AV6 D;  1P3L D;  3MVD D;  5B40 B;  3WTP E;  3AV1 B;  1P3K C;  5B31 D;  5GXQ D;  4ZUX D;  4J8X C;  2ARO D;  3AZE A;  3WA9 B;  2ZM5 A;  3REI B;  5GT0 B;  3AZI B;  4WU8 C;  1P3K D;  3UTB C;  4J8X D;  1P3A B;  5CPI A;  4H9N A;  4R8P A;  5KDM A;  5B32 B;  4WU8 D;  3UTA D;  5B40 A;  3UTB D;  2F8N D;  3AV1 A;  3AZG B;  5B0Y B;  5CP6 A;  3REI A;  5BS7 C;  3MGQ A;  3AZI A;  3WTP C;  1P3A A;  5DNN A;  1F66 B;  2FJ7 B;  3REH B;  3IP4 C;  4XZQ D;  3VH6 T;  1M1A B;  3AYW C;  5AV9 C;  2F8N G;  3REK B;  4WJ3 C;  1W2E A;  5B0Y A;  4DRB A;  5B24 B;  4J8V A;  3AYW D;  5AV9 D;  1P3G C;  2ZY3 A;  2FJ7 A;  3WKJ C;  3REH A;  3B0B A;  4KUD B;  5F99 D;  3AZH B;  1P3G D;  4J8U C;  1M1A A;  4DRA A;  3WKJ D;  3MNN B;  3REK A;  2YFW B;  4J8U D;  2HIO D;  2Y2K A;  4KGC B;  1M19 A;  3B6F B;  1P3P B;  3MGS A;  5AY8 A;  2Y2P A;  4KUD A;  3MGR D;  3AZH A;  4YS3 B;  5JRG C;  3MNN A;  1BH9 B;  2FFF B;  3MGP B;  1AOI A;  1F1E A;  1P3P A;  5AV5 C;  3X1U A;  4WU9 A;  3W97 C;  3W96 C;  5E5A C;  4JJN D;  5CPJ B;  3B6G B;  3V9R B;  4YS3 A;  1M18 C;  5AV5 D;  3C1B C;  5B1M D;  1BH9 A;  5E5A D;  3W96 D;  1KU5 A;  5GSU D;  3W99 B;  1M18 D;  3MGP A;  3FDD A;  5AVC B;  3X1S A;  2Y2Q A;  2JE5 A;  3WAA B;  4QLC B;  3B6G A;  1B67 A;  5B2I B;  4WV4 B;  3V9R A;  3TU4 B;  1KX5 C;  3AV2 C;  1HQ3 C;  2Y2I A;  3C1C A;  3VH5 T;  3LEL A;  3AZN C;  3W99 A;  1KX4 A;  1T3U A;  2ZY4 A;  3REL C;  3AFA B;  3AZF B;  5GT3 B;  1HQ3 D;  3AZN D;  5FUG B;  3WAA A;  3AZM B;  1S32 A;  2G5I C;  2Y2G A;  5AVB C;  3A1K A;  3LZ0 B;  1KX3 B;  3F6T A;  3B0C T;  4H9Q B;  1WWI A;  2NQB C;  1P3B A;  3REJ A;  5AV8 B;  3AZF A;  3X1V B;  3AFA A;  1P34 D;  5GT3 A;  4G91 B;  2NZD C;  1P3L B;  3MVD B;  5FUG A;  5B31 B;  1P3I B;  4E44 A;  4ZUX B;  1ID3 C;  1Q9C A;  2NZD D;  1TZY A;  1P3K B;  3EG5 B;  1ID3 D;  4J8X B;  5AV8 A;  3AZK D;  3UT9 C;  3KUY D;  4WU8 B;  4HGA C;  3MVD A;  3UTB B;  3EPJ A;  2F8N B;  1P3I A;  3AZJ D;  4EO5 C;  3UT9 D;  4Z66 C;  4YM6 D;  4LD9 C;  4J8W C;  4X23 D;  1P3M C;  4XUJ A;  3A6N C;  4Z66 D;  3W98 C;  4LD9 D;  2BYM A;  4J8W D;  1EQZ C;  1HTA A;  1P3M D;  2DQN C;  3WTP B;  3A6N D;  1P3F D;  3W98 D;  1EQZ D;  3AN2 C;  5GXQ C;  3LJA C;  5AV9 B;  2ARO C;  5B2J C;  3AYW B;  2CV5 A;  5DNM A;  5BNX B;  3AN2 D;  4WNN A;  2CWE A;  4H9S A;  3LJA D;  5B2J D;  3WTP A;  3WKJ B;  3KWQ C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...