4DRAA

Crystal structure of mhf complex
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
93
structure length
93
Chain Sequence
b'FSYQQRLKAAVHYTVGCLCEEVALDKEMQFSKQTIAAISELTFRQCENFAKDLEMFARHAKRTTINTEDVKLLARRSNSLLKYITDKSEEIAQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Centromere protein S
molecule tags Dna binding protein
source organism Homo sapiens
publication title The structure of the FANCM-MHF complex reveals physical features for functional assembly
pubmed doi rcsb
total genus 36
structure length 93
sequence length 93
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF15630 CENP-S CENP-S protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4draA00
3KWQA 5AV8C 4YS3C 4R8PC 4UUZB 2IO5B 3MGSA 3X1UC 3UTAA 5AVBB 1BH9A 3VH6A 5CPIB 5B1MC 3MGSB 3UTAB 5BS7C 3AZMD 2YFVB 5GSUC 3REJB 1M18B 3WTPC 1M19D 3AZMC 3RELC 1A7WA 4J8XB 3AV2C 2YFWB 3LZ1A 2FJ7B 1P3BC 4EO5C 5B0YD 5BNVB 1KX3C 3B6FA 4Z66C 1M18D 2HUEC 3LELA 5CPKB 1EQZD 5B24B 5BNXA 5AV5C 5GT3C 1ZLAC 4Z5TD 3LJAA 5B0ZA 4KUDA 2AROD 4J8WB 3WA9B 5B0ZD 3AZFA 1P3GB 4Z66A 5CPJB 1P3OC 4ZUXB 5B24D 5DNND 3UT9A 5AVBA 5CPIA 4YM6A 5B33A 4Z5TB 4WNNA 4XZQB 3AFAC 2NZDC 3REIA 3WTPA 3W97A 3AN2C 3WA9D 2NQBC 3X1SA 5AV8B 4WU8A 4YS3B 3LZ1D 3B6GB 5BNXB 4J8VD 4KUDC 3AYWB 3AZED 2HIOA 3O62C 5AY8A 3UT9B 5AVCA 3AZID 1P3AB 1JFIA 5AV5A 3REHB 5B31B 5AVCD 3MVDB 1ZLAB 4CAYB 1EQZA 3MGPC 3B0CW 1S32A 2NZDB 1U35C 1KX3A 3W98D 1HTAA 3MGQC 4JJNB 1P3AD 3WKJC 5DNMD 2AROA 5JA4B 1M19A 3LZ1C 5AVCB 5B31D 3MVDD 1F66D 5B2ID 3REKC 3C1CC 3AV1C 5GSUA 4G92C 3W97C 5B31C 3MVDC 2NZDA 3C1CB 4WU9B 4R8PA 3O62B 1U35D 3W99C 3B6GC 3X1UB 2F8NB 2IO5C 3VH6W 4Z2MG 5CP6D 4JJNC 2CV5D 1TZYB 3W96B 4H9OB 5CP6A 1P3FA 4WU9D 4J8UD 2BYMB 5GT3A 1HQ3B 4J8VC 2CWEA 1BH8A 3KUYD 5AVBD 5CPID 4XUJD 3WA9C 1P3MB 1M19B 3V9RA 3NQJA 1P3KC 3A6NB 3RELD 1P3BA 3AZNB 5DNNC 5B24C 1M19C 2JSSA 1P3OD 1BH8B 3AZEA 5CPKC 5DNMC 1P3PC 5B2JB 5AV6B 5JRGA 4WZSB 3TU4C 3KWQC 1KX5A 1KX4C 2FJ7A 1TAFA 1B67A 3AZIC 1P34A 5GT0B 3TU4D 4Z66D 3UTBB 4ZUXD 1P34B 3W99A 3REIC 5GT0C 4H9SC 5BO0A 1P3PD 3AFAA 3WTPE 3MGRD 4YM6D 3AFAD 3B6FB 5JA4A 3UT9C 4KUDB 4QLCD 1EQZB 4Z2MH 2YFWA 3LZ1B 3LZ0B 3AZFC 5B2JC 1HQ3C 5AV6C 4J8VB 3AZEB 3REHA 3REJC 5B0ZC 4XUJC 3MGRB 1ZLAA 3REHD 2BYKB 3W96C 4XZQC 3AFAB 1P3FD 3B6FD 4WNNB 5AY8D 3AZNC 1P3GD 1ZLAD 3A6NC 5GT3D 5CPJD 5C3IB 5AV5D 1WWSA 1S32C 5E5AD 5B32G 5CPJA 5B1LB 1P3GC 5AV9D 1P3IB 4XZQD 1WWIA 2CV5C 3B6FC 3MNND 3AYWC 3VH5A 5B1LC 4Z5TA 3C1BB 1P3IA 5C3IC 1F66A 3AV2A 5AV5B 1P3LC 3RELA 1P3BD 5F99C 3UT9D 5F99A 3AZIB 3AN2A 4M6BA 5G49A 5GSUD 3MGRA 3LZ0C 3AZFB 3C1CD 3C1BD 1M1AD 3X1VD 3REID 5B33C 3AZLB 1ID3B 1P3BB 3X1UD 2F8ND 4J8WC 4R8PD 5CHLB 5CP6B 2CV5A 4WU8D 3KXBD 4H9NB 1TZYD 5GXQA 4J8UB 3MGPD 3AZGC 5B31G 3UTBC 3X1VB 4H9PA 4WU9A 3KUYB 5FUGA 4H9QB 5E5AA 3LELC 5BT1D 3NQJB 4EO5B 5GXQC 3X1TC 4X23B 3W98A 4CAYA 4J8XC 4QLCA 3AZJA 3AV2B 3WAAC 2CV5B 4UUZA 2F8NH 1N1JB 4AWLB 4CSRB 4H9OA 1P3LD 5B1MA 3KUYC 1N1JA 3X1VA 1P34C 3AZJB 3X1UA 2F8NA 4J8UC 3AZGB 4XUJB 5AV9C 4Z5TC 3MNNA 3KXBA 1P3MD 5B40C 4ZBJC 4LD9B 4Z66B 1KX4B 3UTBD 5CPJC 3A6ND 3AZND 4X23C 1ID3C 1TZYC 3AZNA 3MGSD 4HGAC 3UTAD 3AZMB 3REJD 5B24A 5B2JD 5AV6D 1KX5B 3V9RB 3W99B 3WAAA 4LD9D 5B33D 4QLCB 1P3KA 5JRGB 5B2JA 5AV6A 3AZJC 3WAAD 5B2IC 3WTPD 3WA9A 1AOIA 3X1TA 5B0YB 4G92B 3W97B 3AZHA 1P3AC 5GXQD 5BT1C 5GT0D 3TU4B 5B0YA 3VH5T 5B33B 3AZLC 5JRGD 3WAAB 4WV4B 4ZBJB 4G91B 2AROB 3X1TB 5B0ZB 4NE5A 5AV9A 3KXBC 3AZHB 1KX4A 3AZLA 4KUDD 1P3KB 3X1VC 4ZUXA 3AZKC 1P3PA 4KGCD 3AZFD 5AY8B 1M1AB 5F99D 5GT3B 1P3KD 5DNNA 3C1BA 4H9QA 5E5AB 5KDMB 3X1SD 1TZYA 2RVQD 3AZKA 4HGAB 4ZUXC 2F8NG 1U35B 5E5AC 4E44A 4WU9C 4J8VA 5B32B 5AY8C 3W98B 1P3FC 5B40B 3KWQD 5CP6C 4JJND 3REHC 5GSUB 1M18C 1HQ3A 3REKB 3AV1B 4LD9A 5FUGB 3X1SC 1HQ3D 3R45B 3AZLD 2NQBA 1Q9CA 2HIOB 1AOID 3MGQB 2L5AA 1KX3B 1P3AA 4YM6C 3KWQB 1JFIB 3MGRC 4H9NA 4G91C 5GT0A 3REKD 3AV1D 1AOIC 3MGPB 1P3LB 4H9RA 3C1CA 4LD9C 1P3LA 3WKJD 1AOIB 1TAFB 3LJAC 3NQUB 3MGQD 1P3IC 5G49B 4E45A 1KU5A 4X23D 3MGQA 3TU4A 1KX4D 4X23A 2FJ7D 1P3MA 5BNVA 3MGPA 2NQBB 1P3MC 5JRGC 3A6NA 4J8WA 3AZEC 2LY8A 3W96A 3W99D 4J8UA 5CPKD 4XUJA 3REJA 3AZMA 2NQBD 3AZJD 3LELB 3W97D 4NE6A 3AZKD 3MGSC 3UTAC 1F66C 4J8XD 5AVBC 5CPIC 5DNNB 5B1LA 4J8XA 1P3OA 3LELD 1BH9B 3W98C 4AWLC 2YFVA 4JJNA 1M18A 4CSRA 3AZKB 1KX5D 3B6GA 4DRAA 3B0DB 2FJ7C 3VH5W 1P34D 3B6GD 3UTBA 3WTPB 3AZHC 1P3PB 5AV9B 1P3ID 5B31A 3MVDA 3LJAD 3KSYA 3MNNB 4KGCA 4J8WD 5GXQB 4YM6B 1ULYA 5CPKA 4NFTA 3AN2D 3C1BC 3LZ0D 1BFMA 2NZDD 3X1SB 3WKJA 3LZ0A 3LJAB 4KHAA 3X1TD 1ID3A 1S32B 5BS7A 1P3FB 1H3OB 3B0BA 3AZHD 3REIB 1ID3D 5B2IB 5AV8D 4YS3D 3AZIA 3AN2B 4NE3A 2PYOB 5B1LD 3MNNC 3AYWD 5AV8A 4WU8B 4YS3A 1KX5C 2F8NK 3NQUA 2HUEB 5B40D 1F1EA 5AVCC 3AYWA 3O62A 2HIOC 4KGCB 3R45A 1S32D 1P3GA 4KHAB 3O62D 4WU8C 3B0DC 5F99B 3KUYA 2PYOD 5DNMA 2RVQC 1M1AC 4XZQA 2PYOA 5B0YC 1KX3D 2BYKA 5B32C 5DNMB 1H3OA 3AV2D 4QLCC 1F66B 1R4VA 5B2IA 3VH6T 3REKA 3AV1A 1B6WA 4R8PB 4KGCC 3WKJB 5B32D 4H9PB 5KDMA 3KXBB 4DRBA 2BYMA 5B1MD 5B32A 2AROC 2PYOC 4H9SA 1M1AA 1U35A 3RELB 3AZGA 1P3OB 1EQZC 3AZGD 2HIOD 3B0CT 5BO0B 4H9RB 5B1MB 3W96D 5B40A
chains in the Genus database with same CATH superfamily
3KWQA 5AV8C 4YS3C 4R8PC 4UUZB 2IO5B 3MGSA 3X1UC 3UTAA 5AVBB 1BH9A 3VH6A 5CPIB 5B1MC 3MGSB 3EPJA 5BS7C 3UTAB 2YFVB 5GSUC 3REJB 3AZMD 1M18B 3WTPC 1M19D 2Y2HA 3RELC 3AZMC 1A7WA 4J8XB 3AV2C 2YFWB 3LZ1A 2FJ7B 1P3BC 4EO5C 5B0YD 5BNVB 1KX3C 3B6FA 4Z66C 1M18D 2HUEC 3LELA 5CPKB 1EQZD 5B24B 5BNXA 2Y2MA 5AV5C 5GT3C 1ZLAC 4Z5TD 3LJAA 5B0ZA 4KUDA 2AROD 4J8WB 3WA9B 5B0ZD 3AZFA 1P3GB 4Z66A 5CPJB 1P3OC 4ZUXB 5B24D 5DNND 3UT9A 5AVBA 5CPIA 4YM6A 5B33A 4Z5TB 4WNNA 4XZQB 3AFAC 2NZDC 2BG1A 3REIA 3WTPA 3W97A 3AN2C 3WA9D 2NQBC 3X1SA 2DQNC 5AV8B 4WU8A 4YS3B 3LZ1D 3B6GB 5BNXB 4J8VD 4KUDC 3AYWB 3AZED 2HIOA 3O62C 5AY8A 3UT9B 3EPHA 5AVCA 3AZID 1P3AB 1JFIA 5AV5A 3REHB 5B31B 5AVCD 3MVDB 1ZLAB 4CAYB 1EQZA 3MGPC 3B0CW 1S32A 2NZDB 1U35C 1KX3A 3W98D 1HTAA 3MGQC 4JJNB 1P3AD 3WKJC 5DNMD 2AROA 5JA4B 1M19A 3LZ1C 5AVCB 5B31D 3MVDD 1F66D 3A1KA 5B2ID 3REKC 3C1CC 3AV1C 5GSUA 4G92C 3W97C 5B31C 3MVDC 2NZDA 3C1CB 4WU9B 4R8PA 3O62B 1U35D 3W99C 3H0RC 3X1UB 2F8NB 3B6GC 2ZY2A 2IO5C 2W8SA 3VH6W 4Z2MG 5CP6D 4JJNC 2CV5D 3IP4C 1TZYB 3W96B 4H9OB 5CP6A 2ZY4A 1P3FA 4WU9D 4J8UD 2BYMB 5GT3A 1HQ3B 4J8VC 2CWEA 1BH8A 3KUYD 4UPKA 5AVBD 5CPID 4XUJD 2G5HC 3WA9C 1P3MB 1M19B 3V9RA 3NQJA 2FFFB 1P3KC 3A6NB 3RELD 1P3BA 3AZNB 5DNNC 5B24C 1M19C 2JSSA 1PZRA 1P3OD 1BH8B 3AZEA 5CPKC 5DNMC 1P3PC 5B2JB 5AV6B 5JRGA 4WZSB 2Y2NA 3TU4C 3KWQC 1KX5A 1KX4C 2FJ7A 1TAFA 1B67A 3AZIC 1P34A 5GT0B 3TU4D 4Z66D 3UTBB 4ZUXD 1P34B 3W99A 3REIC 5GT0C 4H9SC 5BO0A 1P3PD 3AFAA 3WTPE 3MGRD 3H0MC 4YM6D 3AFAD 3B6FB 5JA4A 3UT9C 4KUDB 4QLCD 1EQZB 4Z2MH 2YFWA 3LZ1B 3LZ0B 3AZFC 5B2JC 1HQ3C 5AV6C 4J8VB 3AZEB 3REHA 3REJC 1T3UA 5B0ZC 4XUJC 3MGRB 1ZLAA 3REHD 2BYKB 3W96C 4XZQC 3AFAB 1P3FD 3B6FD 4WNNB 5AY8D 3AZNC 1P3GD 1ZLAD 3A6NC 5GT3D 5CPJD 5C3IB 5AV5D 2VQRA 1WWSA 1S32C 5E5AD 5B32G 2J8PA 5B1LB 5CPJA 1P3GC 5AV9D 1P3IB 4XZQD 1WWIA 2CV5C 3B6FC 2Y2KA 3MNND 3VH5A 5B1LC 4Z5TA 3AYWC 2G5IC 3KFUG 3C1BB 1P3IA 5C3IC 1F66A 3AV2A 5AV5B 1P3LC 3RELA 1P3BD 5F99C 3UT9D 2Y2GA 5F99A 3AZIB 3AN2A 4M6BA 5G49A 5GSUD 3MGRA 3LZ0C 3AZFB 3C1CD 3C1BD 1M1AD 3X1VD 3REID 5B33C 3AZLB 1ID3B 1P3BB 3X1UD 2F8ND 4J8WC 4R8PD 5CHLB 5CP6B 2CV5A 4WU8D 3KXBD 4H9NB 1TZYD 5GXQA 2DF4C 2UWXA 4J8UB 3MGPD 3AZGC 5B31G 3UTBC 3X1VB 4H9PA 4WU9A 3KUYB 5FUGA 4H9QB 5E5AA 3LELC 5BT1D 3NQJB 4EO5B 5GXQC 3X1TC 4X23B 3W98A 4CAYA 3EPKA 4J8XC 4QLCA 3AZJA 3AV2B 3WAAC 2CV5B 4UUZA 2F8NH 1N1JB 4AWLB 4CSRB 4H9OA 1P3LD 5B1MA 3KUYC 1N1JA 3X1VA 1P34C 3AZJB 3X1UA 2F8NA 4J8UC 3AZGB 4XUJB 5AV9C 2JCHA 4Z5TC 3MNNA 3KXBA 5B40C 1P3MD 4ZBJC 4LD9B 4Z66B 1KX4B 3UTBD 5CPJC 3A6ND 3AZND 2XD5A 4X23C 1ID3C 1TZYC 3AZNA 3MGSD 4HGAC 3UTAD 3AZMB 3REJD 5B24A 5B2JD 5AV6D 1KX5B 3V9RB 3W99B 3WAAA 4LD9D 5B33D 4QLCB 1P3KA 5JRGB 5B2JA 5AV6A 3AZJC 3WAAD 5B2IC 3WTPD 3WA9A 1AOIA 3X1TA 1Z2CB 5B0YB 4G92B 3W97B 3AZHA 1P3AC 5GXQD 5BT1C 5GT0D 3TU4B 5B0YA 3VH5T 5B33B 3AZLC 3P5JB 5JRGD 3WAAB 4WV4B 4ZBJB 4G91B 2AROB 3X1TB 5B0ZB 4NE5A 5AV9A 3KXBC 3AZHB 1KX4A 3AZLA 4KUDD 1P3KB 3X1VC 4ZUXA 3AZKC 2F2AC 1P3PA 4KGCD 3AZFD 2Y2PA 5AY8B 2Y2OA 1M1AB 5F99D 5GT3B 1P3KD 5DNNA 3A1IA 3C1BA 4H9QA 5E5AB 5KDMB 3X1SD 1TZYA 2RVQD 3AZKA 4HGAB 4ZUXC 2F8NG 1U35B 5E5AC 4E44A 4WU9C 4J8VA 4WJ3C 2Y2QA 5B32B 5AY8C 3W98B 1P3FC 5B40B 3KWQD 5CP6C 4JJND 3REHC 5GSUB 1M18C 1HQ3A 3REKB 3AV1B 4LD9A 5FUGB 3X1SC 1HQ3D 3R45B 3AZLD 2NQBA 2Y2JA 3FDDA 1Q9CA 2HIOB 2RIQA 1AOID 3MGQB 2L5AA 1KX3B 1P3AA 4YM6C 3KWQB 1JFIB 3MGRC 4H9NA 4G91C 5GT0A 3REKD 3AV1D 1AOIC 3MGPB 1P3LB 4H9RA 3C1CA 4LD9C 2JE5A 1P3LA 3WKJD 1AOIB 1TAFB 3LJAC 3NQUB 3MGQD 1P3IC 5G49B 4E45A 1KU5A 4X23D 3MGQA 3TU4A 1KX4D 4X23A 2FJ7D 1P3MA 5BNVA 3MGPA 2NQBB 1P3MC 5JRGC 3A6NA 4J8WA 3AZEC 2LY8A 3AL0C 3W96A 3W99D 4J8UA 5CPKD 4XUJA 3REJA 3AZMA 2NQBD 4DQYB 3AZJD 3LELB 3W97D 2ZY5A 4NE6A 3AZKD 3MGSC 3UTAC 1F66C 4J8XD 5AVBC 5CPIC 5DNNB 5B1LA 4J8XA 1P3OA 3LELD 1BH9B 3W98C 3EPLA 4AWLC 2YFVA 4JJNA 1M18A 4CSRA 3AZKB 1KX5D 2Y2IA 3B6GA 4DRAA 3B0DB 2FJ7C 3VH5W 2ZY3A 1P34D 3B6GD 3UTBA 3WTPB 3AZHC 1P3PB 5AV9B 1P3ID 5B31A 3MVDA 3F6TA 3LJAD 3KSYA 3MNNB 4KGCA 4J8WD 5GXQB 4YM6B 1ULYA 3H0LC 5CPKA 4NFTA 3AN2D 3C1BC 3LZ0D 1BFMA 2NZDD 3X1SB 1W2EA 3WKJA 3LZ0A 3LJAB 4KHAA 3X1TD 1ID3A 1S32B 5BS7A 1P3FB 1H3OB 3B0BA 3AZHD 3REIB 1ID3D 5B2IB 5AV8D 4YS3D 3AZIA 3AN2B 4NE3A 2PYOB 5B1LD 3MNNC 3AYWD 5AV8A 4WU8B 4YS3A 1KX5C 2F8NK 3NQUA 5B40D 2HUEB 2Y2LA 1F1EA 5AVCC 3AYWA 2HIOC 3O62A 4KGCB 3R45A 1S32D 1P3GA 4KHAB 3O62D 4WU8C 3B0DC 5F99B 3KUYA 2PYOD 5DNMA 2RVQC 1M1AC 4XZQA 2PYOA 5B0YC 1KX3D 2BYKA 5B32C 2ZM5A 5DNMB 1H3OA 3AV2D 4QLCC 1F66B 1R4VA 5B2IA 3VH6T 3REKA 3AV1A 1B6WA 4R8PB 3EG5B 3WKJB 4KGCC 5B32D 4H9PB 5KDMA 4DRBA 3KXBB 2BYMA 5B1MD 5B32A 2XD1A 2AROC 2PYOC 4H9SA 1M1AA 1U35A 3RELB 3AZGA 1P3OB 1EQZC 3AZGD 2HIOD 3B0CT 5BO0B 4H9RB 5B1MB 3W96D 5B40A
chains in the Genus database with same CATH topology
3KWQA 5AV8C 4YS3C 4R8PC 4UUZB 2IO5B 3MGSA 3X1UC 3UTAA 5AVBB 1BH9A 3VH6A 5CPIB 5B1MC 3MGSB 3EPJA 5BS7C 3UTAB 2YFVB 5GSUC 3REJB 3AZMD 1M18B 3WTPC 1M19D 2Y2HA 3RELC 3AZMC 1A7WA 4J8XB 3AV2C 2YFWB 3LZ1A 2FJ7B 1P3BC 4EO5C 5B0YD 5BNVB 1KX3C 3B6FA 4Z66C 1M18D 2HUEC 3LELA 5CPKB 1EQZD 5B24B 5BNXA 2Y2MA 5AV5C 5GT3C 1ZLAC 4Z5TD 3LJAA 5B0ZA 4KUDA 2AROD 4J8WB 3WA9B 5B0ZD 3AZFA 1P3GB 4Z66A 5CPJB 1P3OC 4ZUXB 5B24D 5DNND 3UT9A 5AVBA 5CPIA 4YM6A 5B33A 4Z5TB 4WNNA 4XZQB 3AFAC 2NZDC 2BG1A 3REIA 3WTPA 3W97A 3AN2C 3WA9D 2NQBC 3X1SA 2DQNC 5AV8B 4WU8A 4YS3B 3LZ1D 3B6GB 5BNXB 4J8VD 4KUDC 3AYWB 3AZED 2HIOA 3O62C 5AY8A 3UT9B 3EPHA 5AVCA 3AZID 1P3AB 1JFIA 5AV5A 3REHB 5B31B 5AVCD 3MVDB 1ZLAB 4CAYB 1EQZA 3MGPC 3B0CW 1S32A 2NZDB 1U35C 1KX3A 3W98D 1HTAA 3MGQC 4JJNB 1P3AD 3WKJC 5DNMD 2AROA 5JA4B 1M19A 3LZ1C 5AVCB 5B31D 3MVDD 1F66D 3A1KA 5B2ID 3REKC 3C1CC 3AV1C 5GSUA 4G92C 3W97C 5B31C 3MVDC 2NZDA 3C1CB 4WU9B 4R8PA 3O62B 1U35D 3W99C 3H0RC 3X1UB 2F8NB 3B6GC 2ZY2A 2IO5C 2W8SA 3VH6W 4Z2MG 5CP6D 4JJNC 2CV5D 3IP4C 1TZYB 3W96B 4H9OB 5CP6A 2ZY4A 1P3FA 4WU9D 4J8UD 2BYMB 5GT3A 1HQ3B 4J8VC 2CWEA 1BH8A 3KUYD 4UPKA 5AVBD 5CPID 4XUJD 2G5HC 3WA9C 1P3MB 1M19B 3V9RA 3NQJA 2FFFB 1P3KC 3A6NB 3RELD 1P3BA 3AZNB 5DNNC 5B24C 1M19C 2JSSA 1PZRA 1P3OD 1BH8B 3AZEA 5CPKC 5DNMC 1P3PC 5B2JB 5AV6B 5JRGA 4WZSB 2Y2NA 3TU4C 3KWQC 1KX5A 1KX4C 2FJ7A 1TAFA 1B67A 3AZIC 1P34A 5GT0B 3TU4D 4Z66D 3UTBB 4ZUXD 1P34B 3W99A 3REIC 5GT0C 4H9SC 5BO0A 1P3PD 3AFAA 3WTPE 3MGRD 3H0MC 4YM6D 3AFAD 3B6FB 5JA4A 3UT9C 4KUDB 4QLCD 1EQZB 4Z2MH 2YFWA 3LZ1B 3LZ0B 3AZFC 5B2JC 1HQ3C 5AV6C 4J8VB 3AZEB 3REHA 3REJC 1T3UA 5B0ZC 4XUJC 3MGRB 1ZLAA 3REHD 2BYKB 3W96C 4XZQC 3AFAB 1P3FD 3B6FD 4WNNB 5AY8D 3AZNC 1P3GD 1ZLAD 3A6NC 5GT3D 5CPJD 5C3IB 5AV5D 2VQRA 1WWSA 1S32C 5E5AD 5B32G 2J8PA 5B1LB 5CPJA 1P3GC 5AV9D 1P3IB 4XZQD 1WWIA 2CV5C 3B6FC 2Y2KA 3MNND 3VH5A 5B1LC 4Z5TA 3AYWC 2G5IC 3KFUG 3C1BB 1P3IA 5C3IC 1F66A 3AV2A 5AV5B 1P3LC 3RELA 1P3BD 5F99C 3UT9D 2Y2GA 5F99A 3AZIB 3AN2A 4M6BA 5G49A 5GSUD 3MGRA 3LZ0C 3AZFB 3C1CD 3C1BD 1M1AD 3X1VD 3REID 5B33C 3AZLB 1ID3B 1P3BB 3X1UD 2F8ND 4J8WC 4R8PD 5CHLB 5CP6B 2CV5A 4WU8D 3KXBD 4H9NB 1TZYD 5GXQA 2DF4C 2UWXA 4J8UB 3MGPD 3AZGC 5B31G 3UTBC 3X1VB 4H9PA 4WU9A 3KUYB 5FUGA 4H9QB 5E5AA 3LELC 5BT1D 3NQJB 4EO5B 5GXQC 3X1TC 4X23B 3W98A 4CAYA 3EPKA 4J8XC 4QLCA 3AZJA 3AV2B 3WAAC 2CV5B 4UUZA 2F8NH 1N1JB 4AWLB 4CSRB 4H9OA 1P3LD 5B1MA 3KUYC 1N1JA 3X1VA 1P34C 3AZJB 3X1UA 2F8NA 4J8UC 3AZGB 4XUJB 5AV9C 2JCHA 4Z5TC 3MNNA 3KXBA 5B40C 1P3MD 4ZBJC 4LD9B 4Z66B 1KX4B 3UTBD 5CPJC 3A6ND 3AZND 2XD5A 4X23C 1ID3C 1TZYC 3AZNA 3MGSD 4HGAC 3UTAD 3AZMB 3REJD 5B24A 5B2JD 5AV6D 1KX5B 3V9RB 3W99B 3WAAA 4LD9D 5B33D 4QLCB 1P3KA 5JRGB 5B2JA 5AV6A 3AZJC 3WAAD 5B2IC 3WTPD 3WA9A 1AOIA 3X1TA 1Z2CB 5B0YB 4G92B 3W97B 3AZHA 1P3AC 5GXQD 5BT1C 5GT0D 3TU4B 5B0YA 3VH5T 5B33B 3AZLC 3P5JB 5JRGD 3WAAB 4WV4B 4ZBJB 4G91B 2AROB 3X1TB 5B0ZB 4NE5A 5AV9A 3KXBC 3AZHB 1KX4A 3AZLA 4KUDD 1P3KB 3X1VC 4ZUXA 3AZKC 2F2AC 1P3PA 4KGCD 3AZFD 2Y2PA 5AY8B 2Y2OA 1M1AB 5F99D 5GT3B 1P3KD 5DNNA 3A1IA 3C1BA 4H9QA 5E5AB 5KDMB 3X1SD 1TZYA 2RVQD 3AZKA 4HGAB 4ZUXC 2F8NG 1U35B 5E5AC 4E44A 4WU9C 4J8VA 4WJ3C 2Y2QA 5B32B 5AY8C 3W98B 1P3FC 5B40B 3KWQD 5CP6C 4JJND 3REHC 5GSUB 1M18C 1HQ3A 3REKB 3AV1B 4LD9A 5FUGB 3X1SC 1HQ3D 3R45B 3AZLD 2NQBA 2Y2JA 3FDDA 1Q9CA 2HIOB 2RIQA 1AOID 3MGQB 2L5AA 1KX3B 1P3AA 4YM6C 3KWQB 1JFIB 3MGRC 4H9NA 4G91C 5GT0A 3REKD 3AV1D 1AOIC 3MGPB 1P3LB 4H9RA 3C1CA 4LD9C 2JE5A 1P3LA 3WKJD 1AOIB 1TAFB 3LJAC 3NQUB 3MGQD 1P3IC 5G49B 4E45A 1KU5A 4X23D 3MGQA 3TU4A 1KX4D 4X23A 2FJ7D 1P3MA 5BNVA 3MGPA 2NQBB 1P3MC 5JRGC 3A6NA 4J8WA 3AZEC 2LY8A 3AL0C 3W96A 3W99D 4J8UA 5CPKD 4XUJA 3REJA 3AZMA 2NQBD 4DQYB 3AZJD 3LELB 3W97D 2ZY5A 4NE6A 3AZKD 3MGSC 3UTAC 1F66C 4J8XD 5AVBC 5CPIC 5DNNB 5B1LA 4J8XA 1P3OA 3LELD 1BH9B 3W98C 3EPLA 4AWLC 2YFVA 4JJNA 1M18A 4CSRA 3AZKB 1KX5D 2Y2IA 3B6GA 4DRAA 3B0DB 2FJ7C 3VH5W 2ZY3A 1P34D 3B6GD 3UTBA 3WTPB 3AZHC 1P3PB 5AV9B 1P3ID 5B31A 3MVDA 3F6TA 3LJAD 3KSYA 3MNNB 4KGCA 4J8WD 5GXQB 4YM6B 1ULYA 3H0LC 5CPKA 4NFTA 3AN2D 3C1BC 3LZ0D 1BFMA 2NZDD 3X1SB 1W2EA 3WKJA 3LZ0A 3LJAB 4KHAA 3X1TD 1ID3A 1S32B 5BS7A 1P3FB 1H3OB 3B0BA 3AZHD 3REIB 1ID3D 5B2IB 5AV8D 4YS3D 3AZIA 3AN2B 4NE3A 2PYOB 5B1LD 3MNNC 3AYWD 5AV8A 4WU8B 4YS3A 1KX5C 2F8NK 3NQUA 5B40D 2HUEB 2Y2LA 1F1EA 5AVCC 3AYWA 2HIOC 3O62A 4KGCB 3R45A 1S32D 1P3GA 4KHAB 3O62D 4WU8C 3B0DC 5F99B 3KUYA 2PYOD 5DNMA 2RVQC 1M1AC 4XZQA 2PYOA 5B0YC 1KX3D 2BYKA 5B32C 2ZM5A 5DNMB 1H3OA 3AV2D 4QLCC 1F66B 1R4VA 5B2IA 3VH6T 3REKA 3AV1A 1B6WA 4R8PB 3EG5B 3WKJB 4KGCC 5B32D 4H9PB 5KDMA 4DRBA 3KXBB 2BYMA 5B1MD 5B32A 2XD1A 2AROC 2PYOC 4H9SA 1M1AA 1U35A 3RELB 3AZGA 1P3OB 1EQZC 3AZGD 2HIOD 3B0CT 5BO0B 4H9RB 5B1MB 3W96D 5B40A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KWQ A;  5AV8 C;  4YS3 C;  4R8P C;  4UUZ B;  2IO5 B;  3MGS A;  3X1U C;  3UTA A;  5AVB B;  1BH9 A;  3VH6 A;  5CPI B;  5B1M C;  3MGS B;  3UTA B;  5BS7 C;  3AZM D;  2YFV B;  5GSU C;  3REJ B;  1M18 B;  3WTP C;  1M19 D;  3AZM C;  3REL C;  1A7W A;  4J8X B;  3AV2 C;  2YFW B;  3LZ1 A;  2FJ7 B;  1P3B C;  4EO5 C;  5B0Y D;  5BNV B;  1KX3 C;  3B6F A;  4Z66 C;  1M18 D;  2HUE C;  3LEL A;  5CPK B;  1EQZ D;  5B24 B;  5BNX A;  5AV5 C;  5GT3 C;  1ZLA C;  4Z5T D;  3LJA A;  5B0Z A;  4KUD A;  2ARO D;  4J8W B;  3WA9 B;  5B0Z D;  3AZF A;  1P3G B;  4Z66 A;  5CPJ B;  1P3O C;  4ZUX B;  5B24 D;  5DNN D;  3UT9 A;  5AVB A;  5CPI A;  4YM6 A;  5B33 A;  4Z5T B;  4WNN A;  4XZQ B;  3AFA C;  2NZD C;  3REI A;  3WTP A;  3W97 A;  3AN2 C;  3WA9 D;  2NQB C;  3X1S A;  5AV8 B;  4WU8 A;  4YS3 B;  3LZ1 D;  3B6G B;  5BNX B;  4J8V D;  4KUD C;  3AYW B;  3AZE D;  2HIO A;  3O62 C;  5AY8 A;  3UT9 B;  5AVC A;  3AZI D;  1P3A B;  1JFI A;  5AV5 A;  3REH B;  5B31 B;  5AVC D;  3MVD B;  1ZLA B;  4CAY B;  1EQZ A;  3MGP C;  3B0C W;  1S32 A;  2NZD B;  1U35 C;  1KX3 A;  3W98 D;  1HTA A;  3MGQ C;  4JJN B;  1P3A D;  3WKJ C;  5DNM D;  2ARO A;  5JA4 B;  1M19 A;  3LZ1 C;  5AVC B;  5B31 D;  3MVD D;  1F66 D;  5B2I D;  3REK C;  3C1C C;  3AV1 C;  5GSU A;  4G92 C;  3W97 C;  5B31 C;  3MVD C;  2NZD A;  3C1C B;  4WU9 B;  4R8P A;  3O62 B;  1U35 D;  3W99 C;  3B6G C;  3X1U B;  2F8N B;  2IO5 C;  3VH6 W;  4Z2M G;  5CP6 D;  4JJN C;  2CV5 D;  1TZY B;  3W96 B;  4H9O B;  5CP6 A;  1P3F A;  4WU9 D;  4J8U D;  2BYM B;  5GT3 A;  1HQ3 B;  4J8V C;  2CWE A;  1BH8 A;  3KUY D;  5AVB D;  5CPI D;  4XUJ D;  3WA9 C;  1P3M B;  1M19 B;  3V9R A;  3NQJ A;  1P3K C;  3A6N B;  3REL D;  1P3B A;  3AZN B;  5DNN C;  5B24 C;  1M19 C;  2JSS A;  1P3O D;  1BH8 B;  3AZE A;  5CPK C;  5DNM C;  1P3P C;  5B2J B;  5AV6 B;  5JRG A;  4WZS B;  3TU4 C;  3KWQ C;  1KX5 A;  1KX4 C;  2FJ7 A;  1TAF A;  1B67 A;  3AZI C;  1P34 A;  5GT0 B;  3TU4 D;  4Z66 D;  3UTB B;  4ZUX D;  1P34 B;  3W99 A;  3REI C;  5GT0 C;  4H9S C;  5BO0 A;  1P3P D;  3AFA A;  3WTP E;  3MGR D;  4YM6 D;  3AFA D;  3B6F B;  5JA4 A;  3UT9 C;  4KUD B;  4QLC D;  1EQZ B;  4Z2M H;  2YFW A;  3LZ1 B;  3LZ0 B;  3AZF C;  5B2J C;  1HQ3 C;  5AV6 C;  4J8V B;  3AZE B;  3REH A;  3REJ C;  5B0Z C;  4XUJ C;  3MGR B;  1ZLA A;  3REH D;  2BYK B;  3W96 C;  4XZQ C;  3AFA B;  1P3F D;  3B6F D;  4WNN B;  5AY8 D;  3AZN C;  1P3G D;  1ZLA D;  3A6N C;  5GT3 D;  5CPJ D;  5C3I B;  5AV5 D;  1WWS A;  1S32 C;  5E5A D;  5B32 G;  5CPJ A;  5B1L B;  1P3G C;  5AV9 D;  1P3I B;  4XZQ D;  1WWI A;  2CV5 C;  3B6F C;  3MNN D;  3AYW C;  3VH5 A;  5B1L C;  4Z5T A;  3C1B B;  1P3I A;  5C3I C;  1F66 A;  3AV2 A;  5AV5 B;  1P3L C;  3REL A;  1P3B D;  5F99 C;  3UT9 D;  5F99 A;  3AZI B;  3AN2 A;  4M6B A;  5G49 A;  5GSU D;  3MGR A;  3LZ0 C;  3AZF B;  3C1C D;  3C1B D;  1M1A D;  3X1V D;  3REI D;  5B33 C;  3AZL B;  1ID3 B;  1P3B B;  3X1U D;  2F8N D;  4J8W C;  4R8P D;  5CHL B;  5CP6 B;  2CV5 A;  4WU8 D;  3KXB D;  4H9N B;  1TZY D;  5GXQ A;  4J8U B;  3MGP D;  3AZG C;  5B31 G;  3UTB C;  3X1V B;  4H9P A;  4WU9 A;  3KUY B;  5FUG A;  4H9Q B;  5E5A A;  3LEL C;  5BT1 D;  3NQJ B;  4EO5 B;  5GXQ C;  3X1T C;  4X23 B;  3W98 A;  4CAY A;  4J8X C;  4QLC A;  3AZJ A;  3AV2 B;  3WAA C;  2CV5 B;  4UUZ A;  2F8N H;  1N1J B;  4AWL B;  4CSR B;  4H9O A;  1P3L D;  5B1M A;  3KUY C;  1N1J A;  3X1V A;  1P34 C;  3AZJ B;  3X1U A;  2F8N A;  4J8U C;  3AZG B;  4XUJ B;  5AV9 C;  4Z5T C;  3MNN A;  3KXB A;  1P3M D;  5B40 C;  4ZBJ C;  4LD9 B;  4Z66 B;  1KX4 B;  3UTB D;  5CPJ C;  3A6N D;  3AZN D;  4X23 C;  1ID3 C;  1TZY C;  3AZN A;  3MGS D;  4HGA C;  3UTA D;  3AZM B;  3REJ D;  5B24 A;  5B2J D;  5AV6 D;  1KX5 B;  3V9R B;  3W99 B;  3WAA A;  4LD9 D;  5B33 D;  4QLC B;  1P3K A;  5JRG B;  5B2J A;  5AV6 A;  3AZJ C;  3WAA D;  5B2I C;  3WTP D;  3WA9 A;  1AOI A;  3X1T A;  5B0Y B;  4G92 B;  3W97 B;  3AZH A;  1P3A C;  5GXQ D;  5BT1 C;  5GT0 D;  3TU4 B;  5B0Y A;  3VH5 T;  5B33 B;  3AZL C;  5JRG D;  3WAA B;  4WV4 B;  4ZBJ B;  4G91 B;  2ARO B;  3X1T B;  5B0Z B;  4NE5 A;  5AV9 A;  3KXB C;  3AZH B;  1KX4 A;  3AZL A;  4KUD D;  1P3K B;  3X1V C;  4ZUX A;  3AZK C;  1P3P A;  4KGC D;  3AZF D;  5AY8 B;  1M1A B;  5F99 D;  5GT3 B;  1P3K D;  5DNN A;  3C1B A;  4H9Q A;  5E5A B;  5KDM B;  3X1S D;  1TZY A;  2RVQ D;  3AZK A;  4HGA B;  4ZUX C;  2F8N G;  1U35 B;  5E5A C;  4E44 A;  4WU9 C;  4J8V A;  5B32 B;  5AY8 C;  3W98 B;  1P3F C;  5B40 B;  3KWQ D;  5CP6 C;  4JJN D;  3REH C;  5GSU B;  1M18 C;  1HQ3 A;  3REK B;  3AV1 B;  4LD9 A;  5FUG B;  3X1S C;  1HQ3 D;  3R45 B;  3AZL D;  2NQB A;  1Q9C A;  2HIO B;  1AOI D;  3MGQ B;  2L5A A;  1KX3 B;  1P3A A;  4YM6 C;  3KWQ B;  1JFI B;  3MGR C;  4H9N A;  4G91 C;  5GT0 A;  3REK D;  3AV1 D;  1AOI C;  3MGP B;  1P3L B;  4H9R A;  3C1C A;  4LD9 C;  1P3L A;  3WKJ D;  1AOI B;  1TAF B;  3LJA C;  3NQU B;  3MGQ D;  1P3I C;  5G49 B;  4E45 A;  1KU5 A;  4X23 D;  3MGQ A;  3TU4 A;  1KX4 D;  4X23 A;  2FJ7 D;  1P3M A;  5BNV A;  3MGP A;  2NQB B;  1P3M C;  5JRG C;  3A6N A;  4J8W A;  3AZE C;  2LY8 A;  3W96 A;  3W99 D;  4J8U A;  5CPK D;  4XUJ A;  3REJ A;  3AZM A;  2NQB D;  3AZJ D;  3LEL B;  3W97 D;  4NE6 A;  3AZK D;  3MGS C;  3UTA C;  1F66 C;  4J8X D;  5AVB C;  5CPI C;  5DNN B;  5B1L A;  4J8X A;  1P3O A;  3LEL D;  1BH9 B;  3W98 C;  4AWL C;  2YFV A;  4JJN A;  1M18 A;  4CSR A;  3AZK B;  1KX5 D;  3B6G A;  4DRA A;  3B0D B;  2FJ7 C;  3VH5 W;  1P34 D;  3B6G D;  3UTB A;  3WTP B;  3AZH C;  1P3P B;  5AV9 B;  1P3I D;  5B31 A;  3MVD A;  3LJA D;  3KSY A;  3MNN B;  4KGC A;  4J8W D;  5GXQ B;  4YM6 B;  1ULY A;  5CPK A;  4NFT A;  3AN2 D;  3C1B C;  3LZ0 D;  1BFM A;  2NZD D;  3X1S B;  3WKJ A;  3LZ0 A;  3LJA B;  4KHA A;  3X1T D;  1ID3 A;  1S32 B;  5BS7 A;  1P3F B;  1H3O B;  3B0B A;  3AZH D;  3REI B;  1ID3 D;  5B2I B;  5AV8 D;  4YS3 D;  3AZI A;  3AN2 B;  4NE3 A;  2PYO B;  5B1L D;  3MNN C;  3AYW D;  5AV8 A;  4WU8 B;  4YS3 A;  1KX5 C;  2F8N K;  3NQU A;  2HUE B;  5B40 D;  1F1E A;  5AVC C;  3AYW A;  3O62 A;  2HIO C;  4KGC B;  3R45 A;  1S32 D;  1P3G A;  4KHA B;  3O62 D;  4WU8 C;  3B0D C;  5F99 B;  3KUY A;  2PYO D;  5DNM A;  2RVQ C;  1M1A C;  4XZQ A;  2PYO A;  5B0Y C;  1KX3 D;  2BYK A;  5B32 C;  5DNM B;  1H3O A;  3AV2 D;  4QLC C;  1F66 B;  1R4V A;  5B2I A;  3VH6 T;  3REK A;  3AV1 A;  1B6W A;  4R8P B;  4KGC C;  3WKJ B;  5B32 D;  4H9P B;  5KDM A;  3KXB B;  4DRB A;  2BYM A;  5B1M D;  5B32 A;  2ARO C;  2PYO C;  4H9S A;  1M1A A;  1U35 A;  3REL B;  3AZG A;  1P3O B;  1EQZ C;  3AZG D;  2HIO D;  3B0C T;  5BO0 B;  4H9R B;  5B1M B;  3W96 D;  5B40 A; 
#chains in the Genus database with same CATH topology
 3KWQ A;  5AV8 C;  4YS3 C;  4R8P C;  4UUZ B;  2IO5 B;  3MGS A;  3X1U C;  3UTA A;  5AVB B;  1BH9 A;  3VH6 A;  5CPI B;  5B1M C;  3MGS B;  3EPJ A;  5BS7 C;  3UTA B;  2YFV B;  5GSU C;  3REJ B;  3AZM D;  1M18 B;  3WTP C;  1M19 D;  2Y2H A;  3REL C;  3AZM C;  1A7W A;  4J8X B;  3AV2 C;  2YFW B;  3LZ1 A;  2FJ7 B;  1P3B C;  4EO5 C;  5B0Y D;  5BNV B;  1KX3 C;  3B6F A;  4Z66 C;  1M18 D;  2HUE C;  3LEL A;  5CPK B;  1EQZ D;  5B24 B;  5BNX A;  2Y2M A;  5AV5 C;  5GT3 C;  1ZLA C;  4Z5T D;  3LJA A;  5B0Z A;  4KUD A;  2ARO D;  4J8W B;  3WA9 B;  5B0Z D;  3AZF A;  1P3G B;  4Z66 A;  5CPJ B;  1P3O C;  4ZUX B;  5B24 D;  5DNN D;  3UT9 A;  5AVB A;  5CPI A;  4YM6 A;  5B33 A;  4Z5T B;  4WNN A;  4XZQ B;  3AFA C;  2NZD C;  2BG1 A;  3REI A;  3WTP A;  3W97 A;  3AN2 C;  3WA9 D;  2NQB C;  3X1S A;  2DQN C;  5AV8 B;  4WU8 A;  4YS3 B;  3LZ1 D;  3B6G B;  5BNX B;  4J8V D;  4KUD C;  3AYW B;  3AZE D;  2HIO A;  3O62 C;  5AY8 A;  3UT9 B;  3EPH A;  5AVC A;  3AZI D;  1P3A B;  1JFI A;  5AV5 A;  3REH B;  5B31 B;  5AVC D;  3MVD B;  1ZLA B;  4CAY B;  1EQZ A;  3MGP C;  3B0C W;  1S32 A;  2NZD B;  1U35 C;  1KX3 A;  3W98 D;  1HTA A;  3MGQ C;  4JJN B;  1P3A D;  3WKJ C;  5DNM D;  2ARO A;  5JA4 B;  1M19 A;  3LZ1 C;  5AVC B;  5B31 D;  3MVD D;  1F66 D;  3A1K A;  5B2I D;  3REK C;  3C1C C;  3AV1 C;  5GSU A;  4G92 C;  3W97 C;  5B31 C;  3MVD C;  2NZD A;  3C1C B;  4WU9 B;  4R8P A;  3O62 B;  1U35 D;  3W99 C;  3H0R C;  3X1U B;  2F8N B;  3B6G C;  2ZY2 A;  2IO5 C;  2W8S A;  3VH6 W;  4Z2M G;  5CP6 D;  4JJN C;  2CV5 D;  3IP4 C;  1TZY B;  3W96 B;  4H9O B;  5CP6 A;  2ZY4 A;  1P3F A;  4WU9 D;  4J8U D;  2BYM B;  5GT3 A;  1HQ3 B;  4J8V C;  2CWE A;  1BH8 A;  3KUY D;  4UPK A;  5AVB D;  5CPI D;  4XUJ D;  2G5H C;  3WA9 C;  1P3M B;  1M19 B;  3V9R A;  3NQJ A;  2FFF B;  1P3K C;  3A6N B;  3REL D;  1P3B A;  3AZN B;  5DNN C;  5B24 C;  1M19 C;  2JSS A;  1PZR A;  1P3O D;  1BH8 B;  3AZE A;  5CPK C;  5DNM C;  1P3P C;  5B2J B;  5AV6 B;  5JRG A;  4WZS B;  2Y2N A;  3TU4 C;  3KWQ C;  1KX5 A;  1KX4 C;  2FJ7 A;  1TAF A;  1B67 A;  3AZI C;  1P34 A;  5GT0 B;  3TU4 D;  4Z66 D;  3UTB B;  4ZUX D;  1P34 B;  3W99 A;  3REI C;  5GT0 C;  4H9S C;  5BO0 A;  1P3P D;  3AFA A;  3WTP E;  3MGR D;  3H0M C;  4YM6 D;  3AFA D;  3B6F B;  5JA4 A;  3UT9 C;  4KUD B;  4QLC D;  1EQZ B;  4Z2M H;  2YFW A;  3LZ1 B;  3LZ0 B;  3AZF C;  5B2J C;  1HQ3 C;  5AV6 C;  4J8V B;  3AZE B;  3REH A;  3REJ C;  1T3U A;  5B0Z C;  4XUJ C;  3MGR B;  1ZLA A;  3REH D;  2BYK B;  3W96 C;  4XZQ C;  3AFA B;  1P3F D;  3B6F D;  4WNN B;  5AY8 D;  3AZN C;  1P3G D;  1ZLA D;  3A6N C;  5GT3 D;  5CPJ D;  5C3I B;  5AV5 D;  2VQR A;  1WWS A;  1S32 C;  5E5A D;  5B32 G;  2J8P A;  5B1L B;  5CPJ A;  1P3G C;  5AV9 D;  1P3I B;  4XZQ D;  1WWI A;  2CV5 C;  3B6F C;  2Y2K A;  3MNN D;  3VH5 A;  5B1L C;  4Z5T A;  3AYW C;  2G5I C;  3KFU G;  3C1B B;  1P3I A;  5C3I C;  1F66 A;  3AV2 A;  5AV5 B;  1P3L C;  3REL A;  1P3B D;  5F99 C;  3UT9 D;  2Y2G A;  5F99 A;  3AZI B;  3AN2 A;  4M6B A;  5G49 A;  5GSU D;  3MGR A;  3LZ0 C;  3AZF B;  3C1C D;  3C1B D;  1M1A D;  3X1V D;  3REI D;  5B33 C;  3AZL B;  1ID3 B;  1P3B B;  3X1U D;  2F8N D;  4J8W C;  4R8P D;  5CHL B;  5CP6 B;  2CV5 A;  4WU8 D;  3KXB D;  4H9N B;  1TZY D;  5GXQ A;  2DF4 C;  2UWX A;  4J8U B;  3MGP D;  3AZG C;  5B31 G;  3UTB C;  3X1V B;  4H9P A;  4WU9 A;  3KUY B;  5FUG A;  4H9Q B;  5E5A A;  3LEL C;  5BT1 D;  3NQJ B;  4EO5 B;  5GXQ C;  3X1T C;  4X23 B;  3W98 A;  4CAY A;  3EPK A;  4J8X C;  4QLC A;  3AZJ A;  3AV2 B;  3WAA C;  2CV5 B;  4UUZ A;  2F8N H;  1N1J B;  4AWL B;  4CSR B;  4H9O A;  1P3L D;  5B1M A;  3KUY C;  1N1J A;  3X1V A;  1P34 C;  3AZJ B;  3X1U A;  2F8N A;  4J8U C;  3AZG B;  4XUJ B;  5AV9 C;  2JCH A;  4Z5T C;  3MNN A;  3KXB A;  5B40 C;  1P3M D;  4ZBJ C;  4LD9 B;  4Z66 B;  1KX4 B;  3UTB D;  5CPJ C;  3A6N D;  3AZN D;  2XD5 A;  4X23 C;  1ID3 C;  1TZY C;  3AZN A;  3MGS D;  4HGA C;  3UTA D;  3AZM B;  3REJ D;  5B24 A;  5B2J D;  5AV6 D;  1KX5 B;  3V9R B;  3W99 B;  3WAA A;  4LD9 D;  5B33 D;  4QLC B;  1P3K A;  5JRG B;  5B2J A;  5AV6 A;  3AZJ C;  3WAA D;  5B2I C;  3WTP D;  3WA9 A;  1AOI A;  3X1T A;  1Z2C B;  5B0Y B;  4G92 B;  3W97 B;  3AZH A;  1P3A C;  5GXQ D;  5BT1 C;  5GT0 D;  3TU4 B;  5B0Y A;  3VH5 T;  5B33 B;  3AZL C;  3P5J B;  5JRG D;  3WAA B;  4WV4 B;  4ZBJ B;  4G91 B;  2ARO B;  3X1T B;  5B0Z B;  4NE5 A;  5AV9 A;  3KXB C;  3AZH B;  1KX4 A;  3AZL A;  4KUD D;  1P3K B;  3X1V C;  4ZUX A;  3AZK C;  2F2A C;  1P3P A;  4KGC D;  3AZF D;  2Y2P A;  5AY8 B;  2Y2O A;  1M1A B;  5F99 D;  5GT3 B;  1P3K D;  5DNN A;  3A1I A;  3C1B A;  4H9Q A;  5E5A B;  5KDM B;  3X1S D;  1TZY A;  2RVQ D;  3AZK A;  4HGA B;  4ZUX C;  2F8N G;  1U35 B;  5E5A C;  4E44 A;  4WU9 C;  4J8V A;  4WJ3 C;  2Y2Q A;  5B32 B;  5AY8 C;  3W98 B;  1P3F C;  5B40 B;  3KWQ D;  5CP6 C;  4JJN D;  3REH C;  5GSU B;  1M18 C;  1HQ3 A;  3REK B;  3AV1 B;  4LD9 A;  5FUG B;  3X1S C;  1HQ3 D;  3R45 B;  3AZL D;  2NQB A;  2Y2J A;  3FDD A;  1Q9C A;  2HIO B;  2RIQ A;  1AOI D;  3MGQ B;  2L5A A;  1KX3 B;  1P3A A;  4YM6 C;  3KWQ B;  1JFI B;  3MGR C;  4H9N A;  4G91 C;  5GT0 A;  3REK D;  3AV1 D;  1AOI C;  3MGP B;  1P3L B;  4H9R A;  3C1C A;  4LD9 C;  2JE5 A;  1P3L A;  3WKJ D;  1AOI B;  1TAF B;  3LJA C;  3NQU B;  3MGQ D;  1P3I C;  5G49 B;  4E45 A;  1KU5 A;  4X23 D;  3MGQ A;  3TU4 A;  1KX4 D;  4X23 A;  2FJ7 D;  1P3M A;  5BNV A;  3MGP A;  2NQB B;  1P3M C;  5JRG C;  3A6N A;  4J8W A;  3AZE C;  2LY8 A;  3AL0 C;  3W96 A;  3W99 D;  4J8U A;  5CPK D;  4XUJ A;  3REJ A;  3AZM A;  2NQB D;  4DQY B;  3AZJ D;  3LEL B;  3W97 D;  2ZY5 A;  4NE6 A;  3AZK D;  3MGS C;  3UTA C;  1F66 C;  4J8X D;  5AVB C;  5CPI C;  5DNN B;  5B1L A;  4J8X A;  1P3O A;  3LEL D;  1BH9 B;  3W98 C;  3EPL A;  4AWL C;  2YFV A;  4JJN A;  1M18 A;  4CSR A;  3AZK B;  1KX5 D;  2Y2I A;  3B6G A;  4DRA A;  3B0D B;  2FJ7 C;  3VH5 W;  2ZY3 A;  1P34 D;  3B6G D;  3UTB A;  3WTP B;  3AZH C;  1P3P B;  5AV9 B;  1P3I D;  5B31 A;  3MVD A;  3F6T A;  3LJA D;  3KSY A;  3MNN B;  4KGC A;  4J8W D;  5GXQ B;  4YM6 B;  1ULY A;  3H0L C;  5CPK A;  4NFT A;  3AN2 D;  3C1B C;  3LZ0 D;  1BFM A;  2NZD D;  3X1S B;  1W2E A;  3WKJ A;  3LZ0 A;  3LJA B;  4KHA A;  3X1T D;  1ID3 A;  1S32 B;  5BS7 A;  1P3F B;  1H3O B;  3B0B A;  3AZH D;  3REI B;  1ID3 D;  5B2I B;  5AV8 D;  4YS3 D;  3AZI A;  3AN2 B;  4NE3 A;  2PYO B;  5B1L D;  3MNN C;  3AYW D;  5AV8 A;  4WU8 B;  4YS3 A;  1KX5 C;  2F8N K;  3NQU A;  5B40 D;  2HUE B;  2Y2L A;  1F1E A;  5AVC C;  3AYW A;  2HIO C;  3O62 A;  4KGC B;  3R45 A;  1S32 D;  1P3G A;  4KHA B;  3O62 D;  4WU8 C;  3B0D C;  5F99 B;  3KUY A;  2PYO D;  5DNM A;  2RVQ C;  1M1A C;  4XZQ A;  2PYO A;  5B0Y C;  1KX3 D;  2BYK A;  5B32 C;  2ZM5 A;  5DNM B;  1H3O A;  3AV2 D;  4QLC C;  1F66 B;  1R4V A;  5B2I A;  3VH6 T;  3REK A;  3AV1 A;  1B6W A;  4R8P B;  3EG5 B;  3WKJ B;  4KGC C;  5B32 D;  4H9P B;  5KDM A;  4DRB A;  3KXB B;  2BYM A;  5B1M D;  5B32 A;  2XD1 A;  2ARO C;  2PYO C;  4H9S A;  1M1A A;  1U35 A;  3REL B;  3AZG A;  1P3O B;  1EQZ C;  3AZG D;  2HIO D;  3B0C T;  5BO0 B;  4H9R B;  5B1M B;  3W96 D;  5B40 A; 
#chains in the Genus database with same CATH homology
 3KWQ A;  5AV8 C;  4YS3 C;  4R8P C;  4UUZ B;  2IO5 B;  3MGS A;  3X1U C;  3UTA A;  5AVB B;  1BH9 A;  3VH6 A;  5CPI B;  5B1M C;  3MGS B;  3EPJ A;  5BS7 C;  3UTA B;  2YFV B;  5GSU C;  3REJ B;  3AZM D;  1M18 B;  3WTP C;  1M19 D;  2Y2H A;  3REL C;  3AZM C;  1A7W A;  4J8X B;  3AV2 C;  2YFW B;  3LZ1 A;  2FJ7 B;  1P3B C;  4EO5 C;  5B0Y D;  5BNV B;  1KX3 C;  3B6F A;  4Z66 C;  1M18 D;  2HUE C;  3LEL A;  5CPK B;  1EQZ D;  5B24 B;  5BNX A;  2Y2M A;  5AV5 C;  5GT3 C;  1ZLA C;  4Z5T D;  3LJA A;  5B0Z A;  4KUD A;  2ARO D;  4J8W B;  3WA9 B;  5B0Z D;  3AZF A;  1P3G B;  4Z66 A;  5CPJ B;  1P3O C;  4ZUX B;  5B24 D;  5DNN D;  3UT9 A;  5AVB A;  5CPI A;  4YM6 A;  5B33 A;  4Z5T B;  4WNN A;  4XZQ B;  3AFA C;  2NZD C;  2BG1 A;  3REI A;  3WTP A;  3W97 A;  3AN2 C;  3WA9 D;  2NQB C;  3X1S A;  2DQN C;  5AV8 B;  4WU8 A;  4YS3 B;  3LZ1 D;  3B6G B;  5BNX B;  4J8V D;  4KUD C;  3AYW B;  3AZE D;  2HIO A;  3O62 C;  5AY8 A;  3UT9 B;  3EPH A;  5AVC A;  3AZI D;  1P3A B;  1JFI A;  5AV5 A;  3REH B;  5B31 B;  5AVC D;  3MVD B;  1ZLA B;  4CAY B;  1EQZ A;  3MGP C;  3B0C W;  1S32 A;  2NZD B;  1U35 C;  1KX3 A;  3W98 D;  1HTA A;  3MGQ C;  4JJN B;  1P3A D;  3WKJ C;  5DNM D;  2ARO A;  5JA4 B;  1M19 A;  3LZ1 C;  5AVC B;  5B31 D;  3MVD D;  1F66 D;  3A1K A;  5B2I D;  3REK C;  3C1C C;  3AV1 C;  5GSU A;  4G92 C;  3W97 C;  5B31 C;  3MVD C;  2NZD A;  3C1C B;  4WU9 B;  4R8P A;  3O62 B;  1U35 D;  3W99 C;  3H0R C;  3X1U B;  2F8N B;  3B6G C;  2ZY2 A;  2IO5 C;  2W8S A;  3VH6 W;  4Z2M G;  5CP6 D;  4JJN C;  2CV5 D;  3IP4 C;  1TZY B;  3W96 B;  4H9O B;  5CP6 A;  2ZY4 A;  1P3F A;  4WU9 D;  4J8U D;  2BYM B;  5GT3 A;  1HQ3 B;  4J8V C;  2CWE A;  1BH8 A;  3KUY D;  4UPK A;  5AVB D;  5CPI D;  4XUJ D;  2G5H C;  3WA9 C;  1P3M B;  1M19 B;  3V9R A;  3NQJ A;  2FFF B;  1P3K C;  3A6N B;  3REL D;  1P3B A;  3AZN B;  5DNN C;  5B24 C;  1M19 C;  2JSS A;  1PZR A;  1P3O D;  1BH8 B;  3AZE A;  5CPK C;  5DNM C;  1P3P C;  5B2J B;  5AV6 B;  5JRG A;  4WZS B;  2Y2N A;  3TU4 C;  3KWQ C;  1KX5 A;  1KX4 C;  2FJ7 A;  1TAF A;  1B67 A;  3AZI C;  1P34 A;  5GT0 B;  3TU4 D;  4Z66 D;  3UTB B;  4ZUX D;  1P34 B;  3W99 A;  3REI C;  5GT0 C;  4H9S C;  5BO0 A;  1P3P D;  3AFA A;  3WTP E;  3MGR D;  3H0M C;  4YM6 D;  3AFA D;  3B6F B;  5JA4 A;  3UT9 C;  4KUD B;  4QLC D;  1EQZ B;  4Z2M H;  2YFW A;  3LZ1 B;  3LZ0 B;  3AZF C;  5B2J C;  1HQ3 C;  5AV6 C;  4J8V B;  3AZE B;  3REH A;  3REJ C;  1T3U A;  5B0Z C;  4XUJ C;  3MGR B;  1ZLA A;  3REH D;  2BYK B;  3W96 C;  4XZQ C;  3AFA B;  1P3F D;  3B6F D;  4WNN B;  5AY8 D;  3AZN C;  1P3G D;  1ZLA D;  3A6N C;  5GT3 D;  5CPJ D;  5C3I B;  5AV5 D;  2VQR A;  1WWS A;  1S32 C;  5E5A D;  5B32 G;  2J8P A;  5B1L B;  5CPJ A;  1P3G C;  5AV9 D;  1P3I B;  4XZQ D;  1WWI A;  2CV5 C;  3B6F C;  2Y2K A;  3MNN D;  3VH5 A;  5B1L C;  4Z5T A;  3AYW C;  2G5I C;  3KFU G;  3C1B B;  1P3I A;  5C3I C;  1F66 A;  3AV2 A;  5AV5 B;  1P3L C;  3REL A;  1P3B D;  5F99 C;  3UT9 D;  2Y2G A;  5F99 A;  3AZI B;  3AN2 A;  4M6B A;  5G49 A;  5GSU D;  3MGR A;  3LZ0 C;  3AZF B;  3C1C D;  3C1B D;  1M1A D;  3X1V D;  3REI D;  5B33 C;  3AZL B;  1ID3 B;  1P3B B;  3X1U D;  2F8N D;  4J8W C;  4R8P D;  5CHL B;  5CP6 B;  2CV5 A;  4WU8 D;  3KXB D;  4H9N B;  1TZY D;  5GXQ A;  2DF4 C;  2UWX A;  4J8U B;  3MGP D;  3AZG C;  5B31 G;  3UTB C;  3X1V B;  4H9P A;  4WU9 A;  3KUY B;  5FUG A;  4H9Q B;  5E5A A;  3LEL C;  5BT1 D;  3NQJ B;  4EO5 B;  5GXQ C;  3X1T C;  4X23 B;  3W98 A;  4CAY A;  3EPK A;  4J8X C;  4QLC A;  3AZJ A;  3AV2 B;  3WAA C;  2CV5 B;  4UUZ A;  2F8N H;  1N1J B;  4AWL B;  4CSR B;  4H9O A;  1P3L D;  5B1M A;  3KUY C;  1N1J A;  3X1V A;  1P34 C;  3AZJ B;  3X1U A;  2F8N A;  4J8U C;  3AZG B;  4XUJ B;  5AV9 C;  2JCH A;  4Z5T C;  3MNN A;  3KXB A;  5B40 C;  1P3M D;  4ZBJ C;  4LD9 B;  4Z66 B;  1KX4 B;  3UTB D;  5CPJ C;  3A6N D;  3AZN D;  2XD5 A;  4X23 C;  1ID3 C;  1TZY C;  3AZN A;  3MGS D;  4HGA C;  3UTA D;  3AZM B;  3REJ D;  5B24 A;  5B2J D;  5AV6 D;  1KX5 B;  3V9R B;  3W99 B;  3WAA A;  4LD9 D;  5B33 D;  4QLC B;  1P3K A;  5JRG B;  5B2J A;  5AV6 A;  3AZJ C;  3WAA D;  5B2I C;  3WTP D;  3WA9 A;  1AOI A;  3X1T A;  1Z2C B;  5B0Y B;  4G92 B;  3W97 B;  3AZH A;  1P3A C;  5GXQ D;  5BT1 C;  5GT0 D;  3TU4 B;  5B0Y A;  3VH5 T;  5B33 B;  3AZL C;  3P5J B;  5JRG D;  3WAA B;  4WV4 B;  4ZBJ B;  4G91 B;  2ARO B;  3X1T B;  5B0Z B;  4NE5 A;  5AV9 A;  3KXB C;  3AZH B;  1KX4 A;  3AZL A;  4KUD D;  1P3K B;  3X1V C;  4ZUX A;  3AZK C;  2F2A C;  1P3P A;  4KGC D;  3AZF D;  2Y2P A;  5AY8 B;  2Y2O A;  1M1A B;  5F99 D;  5GT3 B;  1P3K D;  5DNN A;  3A1I A;  3C1B A;  4H9Q A;  5E5A B;  5KDM B;  3X1S D;  1TZY A;  2RVQ D;  3AZK A;  4HGA B;  4ZUX C;  2F8N G;  1U35 B;  5E5A C;  4E44 A;  4WU9 C;  4J8V A;  4WJ3 C;  2Y2Q A;  5B32 B;  5AY8 C;  3W98 B;  1P3F C;  5B40 B;  3KWQ D;  5CP6 C;  4JJN D;  3REH C;  5GSU B;  1M18 C;  1HQ3 A;  3REK B;  3AV1 B;  4LD9 A;  5FUG B;  3X1S C;  1HQ3 D;  3R45 B;  3AZL D;  2NQB A;  2Y2J A;  3FDD A;  1Q9C A;  2HIO B;  2RIQ A;  1AOI D;  3MGQ B;  2L5A A;  1KX3 B;  1P3A A;  4YM6 C;  3KWQ B;  1JFI B;  3MGR C;  4H9N A;  4G91 C;  5GT0 A;  3REK D;  3AV1 D;  1AOI C;  3MGP B;  1P3L B;  4H9R A;  3C1C A;  4LD9 C;  2JE5 A;  1P3L A;  3WKJ D;  1AOI B;  1TAF B;  3LJA C;  3NQU B;  3MGQ D;  1P3I C;  5G49 B;  4E45 A;  1KU5 A;  4X23 D;  3MGQ A;  3TU4 A;  1KX4 D;  4X23 A;  2FJ7 D;  1P3M A;  5BNV A;  3MGP A;  2NQB B;  1P3M C;  5JRG C;  3A6N A;  4J8W A;  3AZE C;  2LY8 A;  3AL0 C;  3W96 A;  3W99 D;  4J8U A;  5CPK D;  4XUJ A;  3REJ A;  3AZM A;  2NQB D;  4DQY B;  3AZJ D;  3LEL B;  3W97 D;  2ZY5 A;  4NE6 A;  3AZK D;  3MGS C;  3UTA C;  1F66 C;  4J8X D;  5AVB C;  5CPI C;  5DNN B;  5B1L A;  4J8X A;  1P3O A;  3LEL D;  1BH9 B;  3W98 C;  3EPL A;  4AWL C;  2YFV A;  4JJN A;  1M18 A;  4CSR A;  3AZK B;  1KX5 D;  2Y2I A;  3B6G A;  4DRA A;  3B0D B;  2FJ7 C;  3VH5 W;  2ZY3 A;  1P34 D;  3B6G D;  3UTB A;  3WTP B;  3AZH C;  1P3P B;  5AV9 B;  1P3I D;  5B31 A;  3MVD A;  3F6T A;  3LJA D;  3KSY A;  3MNN B;  4KGC A;  4J8W D;  5GXQ B;  4YM6 B;  1ULY A;  3H0L C;  5CPK A;  4NFT A;  3AN2 D;  3C1B C;  3LZ0 D;  1BFM A;  2NZD D;  3X1S B;  1W2E A;  3WKJ A;  3LZ0 A;  3LJA B;  4KHA A;  3X1T D;  1ID3 A;  1S32 B;  5BS7 A;  1P3F B;  1H3O B;  3B0B A;  3AZH D;  3REI B;  1ID3 D;  5B2I B;  5AV8 D;  4YS3 D;  3AZI A;  3AN2 B;  4NE3 A;  2PYO B;  5B1L D;  3MNN C;  3AYW D;  5AV8 A;  4WU8 B;  4YS3 A;  1KX5 C;  2F8N K;  3NQU A;  5B40 D;  2HUE B;  2Y2L A;  1F1E A;  5AVC C;  3AYW A;  2HIO C;  3O62 A;  4KGC B;  3R45 A;  1S32 D;  1P3G A;  4KHA B;  3O62 D;  4WU8 C;  3B0D C;  5F99 B;  3KUY A;  2PYO D;  5DNM A;  2RVQ C;  1M1A C;  4XZQ A;  2PYO A;  5B0Y C;  1KX3 D;  2BYK A;  5B32 C;  2ZM5 A;  5DNM B;  1H3O A;  3AV2 D;  4QLC C;  1F66 B;  1R4V A;  5B2I A;  3VH6 T;  3REK A;  3AV1 A;  1B6W A;  4R8P B;  3EG5 B;  3WKJ B;  4KGC C;  5B32 D;  4H9P B;  5KDM A;  4DRB A;  3KXB B;  2BYM A;  5B1M D;  5B32 A;  2XD1 A;  2ARO C;  2PYO C;  4H9S A;  1M1A A;  1U35 A;  3REL B;  3AZG A;  1P3O B;  1EQZ C;  3AZG D;  2HIO D;  3B0C T;  5BO0 B;  4H9R B;  5B1M B;  3W96 D;  5B40 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...