4DRAA

Crystal structure of mhf complex
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
93
structure length
93
Chain Sequence
FSYQQRLKAAVHYTVGCLCEEVALDKEMQFSKQTIAAISELTFRQCENFAKDLEMFARHAKRTTINTEDVKLLARRSNSLLKYITDKSEEIAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Centromere protein S
publication title The structure of the FANCM-MHF complex reveals physical features for functional assembly
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein
total genus 36
structure length 93
sequence length 93
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF15630 CENP-S CENP-S protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4draA00
3WTPA 5BNXB 1M18D 3AZKA 4X23D 3REJC 2FJ7A 3VH6W 3AN2A 3REKC 3TU4C 5GT3D 3W97B 1P3FA 3LZ0A 5CPJC 4KGCB 4R8PC 5BT1D 1KX3B 3W96C 5AVCD 5B2JA 5B0YC 4XZQB 1P3AD 5GT0A 5AY8C 5AVBA 4H9NB 1P3KB 4Z66D 1U35A 3AZED 3AZND 4XUJC 3REHD 3V9RB 3MGQD 3REJB 3REKB 3UT9C 4UUZA 5GSUD 3TU4B 3X1UA 3WKJB 5CPJB 4R8PB 3A6NC 3AZLD 5CPKA 5B0YB 1AOIC 1ZLAD 5AY8B 3NQJA 3B6GC 1BFMA 1M19A 5JRGA 5BNVB 1KX4A 4XUJB 4G91C 2BYMB 5FUGB 4H9RB 3MGSA 5G49A 4KUDA 5GXQA 3UT9B 4YS3C 5CP6C 4CAYB 5KDMA 1TZYD 2LY8A 2HIOD 3X1VD 3A6NB 1KX5A 1AOIB 5E5AD 4Z5TD 3AZJA 3B6GB 1EQZC 3TU4D 3AZMC 3WKJD 5CPJD 4NE5A 4G91B 3W97A 3B0BA 4KGCA 3AZHD 1P3ID 5F99A 4YS3B 3WAAC 5CP6B 3C1CA 5B32A 4XZQA 3WTPC 3RELD 3AZKC 1BH8B 2FJ7C 4J8VA 3AN2C 4Z2MH 1F1EA 1P3FC 1EQZB 3KXBD 3AV2D 3V9RA 3KWQC 3AZMB 4E45A 5B40C 4ZBJC 3REKA 1P34D 5AVBC 1U35C 1P3BD 4R8PA 3W99D 5B33A 3W96A 3WAAB 3NQUB 3WTPB 3AFAA 1R4VA 1P3PC 3X1TD 3AZKB 2FJ7B 3R45B 3AN2B 3O62D 3X1UC 1P3FB 4WNNA 4YS3D 5CP6D 3AZFD 5FUGA 3KWQB 2AROA 5B40B 5AV6C 4ZBJB 3C1BC 3UT9A 5B24C 3MVDD 4CAYA 5AVBB 3WA9C 1M19C 5JRGC 4J8UD 5DNND 1U35B 1EQZD 2JSSA 3LZ1C 3A6NA 1AOIA 3MGSC 1P3PB 4KUDC 5GXQC 4UUZB 3UTAD 3X1UB 3MGPA 5CPIA 1KU5A 5AV6B 1KX5C 2CV5A 3C1BB 2F8NB 5B24B 3NQJB 2NQBA 2HUEC 1M19B 5JRGB 2CWEA 1P3FD 3LZ0D 3LZ1B 5B0ZA 5B2JD 3MGSB 5G49B 5GT0D 4KUDB 5GXQB 3AZMA 4H9QA 5F99C 2F8NH 5B2IC 3C1CC 4J8XC 3AZIC 5B1MC 3LJAA 4J8VC 4NE3A 1KX5B 3WAAA 1B6WA 2HUEB 3NQUA 1HTAA 3R45A 5CPKD 4H9PA 1ULYA 1P3GD 3UTBC 5B33C 1M19D 3KWQA 5F99B 5B40A 5B2IB 1KX4D 3C1CB 4J8XB 5B32B 3AZIB 3AFAC 1ID3A 5AV5D 5B1MB 5DNMA 4J8VB 3MGSD 3VH5T 3B6FC 3AV1C 5GXQD 1F66C 3REIC 1P3PA 2AROC 3X1SA 5B1LA 4DRBA 4WV4B 3AZJD 3KUYD 5B33B 3UTBB 3W96B 5AV6A 3VH6T 3C1BA 2F8NA 3AFAB 5B24A 4LD9C 3WA9A 3W97D 4AWLC 4KGCD 3AV1B 1KX3D 3LZ1A 1HQ3A 4WNNB 4E44A 5B32D 5CPIC 4XZQD 3MGPC 2AROB 3REIB 2CV5C 1P3KD 2NQBC 4M6BA 1M18A 1WWIA 4WU8A 4X23A 5B0ZC 3REJD 2YFVA 4LD9B 2YFWB 5B31A 3VH5A 5C3IC 5GT3A 3REKD 2PYOC 4R8PD 5B33D 1P3LC 3W96D 5AVCA 5B0YD 3LJAC 3MGPB 5CPIB 5AY8D 2CV5B 5AV9C 3AZEA 4WU9C 5B2IA 4J8XA 3AZIA 2NQBB 3VH6A 4XUJD 4NE6A 5B1MA 5AV8A 3MGQA 3B0DC 5B0ZB 4J8WC 3UT9D 5C3IB 5BO0A 3LELC 4H9QB 4KHAB 2PYOB 1ID3C 1P3LB 1M1AC 3AZLA 3A6ND 1ZLAA 1AOID 5DNMC 3LJAB 3B6GD 3UTBA 1A7WA 4QLCA 5AV9B 4WU9B 2RVQC 4EO5C 4HGAC 2BYKB 3MNNC 3W98A 1WWSA 1S32C 3X1SC 5B32G 5B1LC 3B0DB 3B6FA 3AV1A 1F66A 4H9PB 4J8WB 1TZYA 2NQBD 3LELB 3REIA 4ZUXA 2HIOA 1ID3B 3MGRA 1M1AB 5E5AA 5DNMB 4JJNC 3AZMD 1HQ3C 4HGAB 1P3OA 3MNNB 2YFWA 4LD9A 1S32B 3X1SB 5B1LB 3WAAD 2IO5C 3WTPD 1M18C 4WU8C 3AZKD 4X23C 2FJ7D 3AN2D 5B31C 5GT3C 4G92C 3WA9B 1H3OA 5BT1C 4JJNB 3KWQD 1HQ3B 5B40D 5AVCC 1ID3D 5AVBD 4Z66C 3AZEC 1U35D 5DNMD 4KHAA 2PYOA 3AZNC 1P3LA 1BH9B 2IO5B 2RVQD 5AV8C 1M18B 4Z2MG 3X1TA 1P3PD 4WU8B 3MGQC 4X23B 5JA4A 5AV9A 3X1SD 3O62A 4WU9A 2YFVB 5B31B 5GT3B 4G92B 2NZDA 2BYKA 3X1UD 4YM6A 4H9OA 5AVCB 5AV6D 3AZLC 1ZLAC 3C1BD 4J8WA 2F8ND 3MVDA 5B24D 4Z66B 3WA9D 3LELA 4QLCC 5JRGD 3AZEB 3AZNB 3W98C 1M1AA 3LZ1D 1HQ3D 5AV8B 3MGQB 4KUDD 2F8NK 5BO0B 1TZYC 3MNNA 4ZUXC 2HIOC 1S32A 3MGRC 3X1VC 4WU8D 3AZLB 1KX5D 1ZLAB 5E5AC 4Z5TC 5B31D 4QLCB 3WKJC 3AZGA 1P3OC 3W98B 4CSRB 1Q9CA 3AZHC 1P3MA 3B6FB 4JJNA 1P3IC 1F66B 5F99D 5B2ID 1TZYB 3C1CD 4J8XD 3RELC 3AZID 4ZUXB 2HIOB 5B1MD 5AV8D 3MGRB 4J8VD 3X1VB 3AYWA 5E5AB 4Z5TB 1BH9A 3KXBC 3AV2C 1JFIA 1P3OB 1P34C 2F8NG 1P3GA 4H9SC 1P3BC 4AWLB 3W99C 3AZHB 1P3IB 3UTBD 4QLCD 5BS7A 3WTPE 3RELB 1P3AA 3AFAD 3X1TC 3W98D 5AV5A 4Z66A 3O62C 3AZNA 4DRAA 2NZDC 3B6FD 1N1JB 3AV1D 1F66D 3REHA 1H3OB 3KXBB 3AZFC 3AV2B 4YM6C 3REID 1B67A 4ZUXD 2AROD 2L5AA 5CHLB 3MGRD 5GSUA 3MVDC 1P34B 4J8UC 5DNNC 5B31G 1P3BB 1TAFA 3W99B 3KUYA 5BNXA 3X1TB 1P3OD 4LD9D 4WZSB 5JA4B 3O62B 3UTAC 2NZDB 1KX3A 3AZFB 4CSRA 4YM6B 4H9OB 3MGPD 5CPID 3B0CW 4H9NA 1P3KA 2CV5D 3MVDB 4J8UB 5DNNB 3LZ0C 3AZGC 3X1VA 3REJA 5B2JC 5B0ZD 4Z5TA 3TU4A 5GT0C 1P3MC 3WKJA 5CPJA 4EO5B 3UTAB 2PYOD 1P3LD 4NFTA 5B0YA 3LJAD 5AY8A 3AZHA 3AYWC 1P3IA 5AV9D 5BNVA 4WU9D 3RELA 2NZDD 4XUJA 3LZ0B 3AZGB 2BYMA 4YM6D 4H9RA 3B0CT 5B2JB 5CPKC 1N1JA 4J8WD 1P3GC 5GT0B 3KXBA 3AV2A 1P3MB 3LELD 5BS7C 1KX4C 1P3AC 1P34A 5AV5C 1M1AD 4H9SA 1P3BA 3B6GA 3W99A 3AYWB 3REHC 3MNND 1JFIB 1S32D 5B1LD 5GSUC 5CPKB 4YS3A 1P3GB 5CP6A 3AZJC 3AZFA 3KUYC 1BH8A 3AZGD 1KX4B 1P3AB 5AV5B 3W97C 4J8UA 5DNNA 1EQZA 4KGCC 3KSYA 1P3MD 4JJND 1KX3C 3VH5W 3REHB 5KDMB 5B32C 4XZQC 1P3KC 5GSUB 3UTAA 3AYWD 3AZJB 1TAFB 3KUYB
chains in the Genus database with same CATH superfamily
3WTPA 5BNXB 1M18D 3AZKA 4X23D 3REJC 2FJ7A 3VH6W 3AN2A 3REKC 3TU4C 5GT3D 3W97B 1P3FA 3LZ0A 5CPJC 4KGCB 4R8PC 5BT1D 1KX3B 3W96C 5AVCD 5B2JA 5B0YC 1Z2CB 4XZQB 2Y2OA 1P3AD 5GT0A 5AY8C 5AVBA 4H9NB 1P3KB 4Z66D 1U35A 3AZED 3AZND 2JCHA 4XUJC 3REHD 3V9RB 3EPJA 3MGQD 3REJB 3REKB 3UT9C 4UUZA 5GSUD 3TU4B 3X1UA 3WKJB 5CPJB 4R8PB 3A6NC 3AZLD 5CPKA 5B0YB 1AOIC 1ZLAD 5AY8B 3NQJA 3B6GC 1BFMA 1M19A 5JRGA 5BNVB 1KX4A 4XUJB 4G91C 2BYMB 5FUGB 4H9RB 3MGSA 5G49A 4KUDA 5GXQA 3UT9B 4UPKA 4YS3C 2G5HC 5CP6C 4CAYB 5KDMA 1TZYD 2LY8A 2HIOD 3X1VD 3A6NB 1KX5A 1AOIB 5E5AD 4Z5TD 3EG5B 3AZJA 1EQZC 3TU4D 3B6GB 3KFUG 3AZMC 3WKJD 5CPJD 4NE5A 4G91B 3W97A 3B0BA 4KGCA 3AZHD 1P3ID 5F99A 4YS3B 3WAAC 5CP6B 3C1CA 5B32A 4XZQA 3WTPC 3RELD 3AZKC 2RIQA 1BH8B 2FJ7C 4J8VA 3AN2C 4Z2MH 1F1EA 1P3FC 1EQZB 3KXBD 3AV2D 3V9RA 2G5IC 3KWQC 3AZMB 4E45A 5B40C 2JE5A 4ZBJC 3REKA 1P34D 5AVBC 1U35C 1P3BD 4R8PA 3W99D 5B33A 3A1IA 3W96A 3WAAB 3NQUB 3WTPB 3AFAA 1R4VA 1P3PC 3X1TD 3AZKB 2FJ7B 3R45B 3AN2B 3O62D 3X1UC 1P3FB 4WNNA 4YS3D 5CP6D 3AZFD 5FUGA 3KWQB 2AROA 5B40B 4WJ3C 5AV6C 4ZBJB 3C1BC 3UT9A 5B24C 3MVDD 4CAYA 5AVBB 3WA9C 1M19C 5JRGC 4J8UD 5DNND 1U35B 1EQZD 2JSSA 3LZ1C 3A6NA 1AOIA 3MGSC 1P3PB 4KUDC 5GXQC 4UUZB 3UTAD 3X1UB 3MGPA 5CPIA 1KU5A 5AV6B 1KX5C 2CV5A 3C1BB 2F8NB 5B24B 3NQJB 2NQBA 2HUEC 1M19B 2Y2IA 5JRGB 2CWEA 1P3FD 3LZ0D 3LZ1B 5B0ZA 5B2JD 3MGSB 5G49B 5GT0D 4KUDB 2ZY4A 5GXQB 3AZMA 4H9QA 5F99C 2F8NH 5B2IC 3C1CC 4J8XC 3AZIC 5B1MC 3LJAA 4J8VC 4NE3A 1KX5B 2DQNC 3WAAA 1B6WA 2HUEB 3NQUA 1HTAA 3R45A 5CPKD 4H9PA 2XD1A 1ULYA 1P3GD 3UTBC 5B33C 1M19D 2UWXA 3KWQA 5F99B 5B40A 5B2IB 1KX4D 3C1CB 4J8XB 5B32B 3AZIB 3AFAC 1ID3A 3H0MC 5AV5D 5B1MB 5DNMA 4J8VB 3MGSD 3VH5T 3B6FC 3AV1C 5GXQD 1F66C 3REIC 1P3PA 2AROC 3X1SA 5B1LA 4DRBA 4WV4B 3AZJD 3KUYD 5B33B 3UTBB 3W96B 5AV6A 3VH6T 3C1BA 2F8NA 3AFAB 5B24A 4LD9C 3WA9A 3W97D 2F2AC 4AWLC 4KGCD 3AV1B 1KX3D 3LZ1A 1HQ3A 4WNNB 4E44A 2ZY2A 5B32D 5CPIC 4XZQD 3MGPC 2AROB 3REIB 2CV5C 1P3KD 2NQBC 4M6BA 1M18A 1WWIA 4WU8A 4X23A 2ZY3A 5B0ZC 3REJD 2YFVA 4LD9B 2YFWB 5B31A 3VH5A 5C3IC 5GT3A 3REKD 2PYOC 4R8PD 5B33D 1P3LC 3W96D 5AVCA 5B0YD 3LJAC 3MGPB 5CPIB 5AY8D 2CV5B 5AV9C 3AZEA 4WU9C 3FDDA 5B2IA 4J8XA 3AZIA 2NQBB 3VH6A 4XUJD 4NE6A 5B1MA 5AV8A 3MGQA 3B0DC 5B0ZB 4J8WC 3UT9D 5C3IB 5BO0A 3LELC 4H9QB 2Y2HA 4KHAB 2PYOB 1ID3C 1P3LB 1M1AC 3AZLA 3A6ND 1ZLAA 1AOID 5DNMC 3LJAB 3B6GD 3UTBA 1A7WA 4QLCA 5AV9B 2ZY5A 3H0LC 4WU9B 2RVQC 4EO5C 4HGAC 2BYKB 3MNNC 3W98A 1WWSA 1S32C 3X1SC 5B32G 5B1LC 1PZRA 3B0DB 3B6FA 3AV1A 1F66A 4H9PB 4J8WB 1TZYA 2Y2PA 2NQBD 3LELB 3REIA 4ZUXA 2HIOA 1ID3B 3MGRA 2XD5A 1M1AB 5E5AA 5DNMB 4JJNC 3AZMD 1HQ3C 2BG1A 4HGAB 3MNNB 2YFWA 1P3OA 4LD9A 1S32B 3X1SB 5B1LB 3WAAD 2IO5C 3WTPD 1M18C 4WU8C 3AZKD 4X23C 2FJ7D 3AN2D 5B31C 5GT3C 4G92C 3WA9B 1H3OA 5BT1C 4JJNB 3KWQD 1HQ3B 5B40D 5AVCC 1ID3D 5AVBD 4Z66C 3AZEC 1U35D 5DNMD 4KHAA 2PYOA 3AZNC 1P3LA 1BH9B 2IO5B 2RVQD 5AV8C 1M18B 4Z2MG 3X1TA 1P3PD 4WU8B 3MGQC 4X23B 5JA4A 5AV9A 3X1SD 3O62A 4WU9A 2YFVB 5B31B 5GT3B 4G92B 2NZDA 2BYKA 3X1UD 4YM6A 4H9OA 5AVCB 5AV6D 3AZLC 1ZLAC 3C1BD 4J8WA 2F8ND 3MVDA 5B24D 4Z66B 3WA9D 3LELA 4QLCC 5JRGD 3AZEB 3AZNB 3W98C 1M1AA 3LZ1D 1HQ3D 5AV8B 3MGQB 4KUDD 2F8NK 3EPHA 5BO0B 1TZYC 3MNNA 4ZUXC 2HIOC 1S32A 3MGRC 3X1VC 4WU8D 3AZLB 1KX5D 1ZLAB 5E5AC 4Z5TC 5B31D 4QLCB 3WKJC 3AZGA 1P3OC 3W98B 4CSRB 2Y2QA 1Q9CA 3AZHC 1P3MA 3B6FB 4JJNA 1P3IC 1F66B 5F99D 5B2ID 1TZYB 3C1CD 4J8XD 3RELC 3AZID 4ZUXB 2HIOB 2Y2JA 5B1MD 5AV8D 3MGRB 2Y2MA 3AL0C 4J8VD 3X1VB 3AYWA 5E5AB 4Z5TB 1BH9A 3KXBC 3AV2C 1JFIA 1P3OB 1P34C 2F8NG 1P3GA 4H9SC 1P3BC 4AWLB 3W99C 3AZHB 1P3IB 3UTBD 4QLCD 5BS7A 3WTPE 3RELB 1P3AA 3AFAD 3X1TC 3W98D 2VQRA 5AV5A 4Z66A 3O62C 3P5JB 3AZNA 4DRAA 2NZDC 3B6FD 1N1JB 2Y2KA 3AV1D 3REHA 1H3OB 1F66D 3KXBB 3AZFC 3AV2B 4YM6C 3REID 1B67A 4ZUXD 2AROD 2L5AA 5CHLB 3MGRD 5GSUA 3MVDC 1P34B 4J8UC 5DNNC 5B31G 1P3BB 1TAFA 3W99B 3KUYA 5BNXA 3X1TB 1P3OD 4LD9D 4WZSB 5JA4B 3O62B 3UTAC 2NZDB 1KX3A 2Y2GA 3AZFB 4CSRA 4YM6B 4H9OB 3MGPD 5CPID 3B0CW 4H9NA 1P3KA 2CV5D 2Y2LA 3MVDB 2Y2NA 4J8UB 5DNNB 1T3UA 3LZ0C 3AZGC 3X1VA 3REJA 3H0RC 5B2JC 5B0ZD 4Z5TA 3TU4A 5GT0C 3EPLA 1P3MC 3WKJA 2W8SA 5CPJA 4EO5B 3UTAB 2PYOD 1P3LD 4NFTA 5B0YA 4DQYB 3LJAD 5AY8A 3AZHA 3AYWC 1P3IA 5AV9D 5BNVA 4WU9D 3RELA 2NZDD 4XUJA 3F6TA 3LZ0B 3AZGB 2BYMA 4YM6D 4H9RA 3B0CT 5B2JB 5CPKC 1N1JA 4J8WD 1P3GC 5GT0B 3KXBA 3AV2A 1P3MB 3LELD 5BS7C 1KX4C 1P3AC 1P34A 5AV5C 1M1AD 4H9SA 1P3BA 3B6GA 3W99A 3EPKA 3AYWB 3REHC 3MNND 1JFIB 1S32D 5B1LD 5GSUC 5CPKB 1W2EA 2J8PA 4YS3A 1P3GB 2FFFB 5CP6A 3AZJC 3AZFA 3KUYC 1BH8A 3AZGD 1KX4B 1P3AB 5AV5B 3W97C 4J8UA 5DNNA 1EQZA 4KGCC 3KSYA 3A1KA 1P3MD 4JJND 1KX3C 3VH5W 3REHB 2DF4C 3IP4C 5KDMB 4XZQC 5B32C 2ZM5A 1P3KC 5GSUB 3UTAA 3AYWD 3AZJB 1TAFB 3KUYB
chains in the Genus database with same CATH topology
3WTPA 5BNXB 1M18D 3AZKA 4X23D 3REJC 2FJ7A 3VH6W 3AN2A 3REKC 3TU4C 5GT3D 3W97B 1P3FA 3LZ0A 5CPJC 4KGCB 4R8PC 5BT1D 1KX3B 3W96C 5AVCD 5B2JA 5B0YC 1Z2CB 4XZQB 2Y2OA 1P3AD 5GT0A 5AY8C 5AVBA 4H9NB 1P3KB 4Z66D 1U35A 3AZED 3AZND 2JCHA 4XUJC 3REHD 3V9RB 3EPJA 3MGQD 3REJB 3REKB 3UT9C 4UUZA 5GSUD 3TU4B 3X1UA 3WKJB 5CPJB 4R8PB 3A6NC 3AZLD 5CPKA 5B0YB 1AOIC 1ZLAD 5AY8B 3NQJA 3B6GC 1BFMA 1M19A 5JRGA 5BNVB 1KX4A 4XUJB 4G91C 2BYMB 5FUGB 4H9RB 3MGSA 5G49A 4KUDA 5GXQA 3UT9B 4UPKA 4YS3C 2G5HC 5CP6C 4CAYB 5KDMA 1TZYD 2LY8A 2HIOD 3X1VD 3A6NB 1KX5A 1AOIB 5E5AD 4Z5TD 3EG5B 3AZJA 1EQZC 3TU4D 3B6GB 3KFUG 3AZMC 3WKJD 5CPJD 4NE5A 4G91B 3W97A 3B0BA 4KGCA 3AZHD 1P3ID 5F99A 4YS3B 3WAAC 5CP6B 3C1CA 5B32A 4XZQA 3WTPC 3RELD 3AZKC 2RIQA 1BH8B 2FJ7C 4J8VA 3AN2C 4Z2MH 1F1EA 1P3FC 1EQZB 3KXBD 3AV2D 3V9RA 2G5IC 3KWQC 3AZMB 4E45A 5B40C 2JE5A 4ZBJC 3REKA 1P34D 5AVBC 1U35C 1P3BD 4R8PA 3W99D 5B33A 3A1IA 3W96A 3WAAB 3NQUB 3WTPB 3AFAA 1R4VA 1P3PC 3X1TD 3AZKB 2FJ7B 3R45B 3AN2B 3O62D 3X1UC 1P3FB 4WNNA 4YS3D 5CP6D 3AZFD 5FUGA 3KWQB 2AROA 5B40B 4WJ3C 5AV6C 4ZBJB 3C1BC 3UT9A 5B24C 3MVDD 4CAYA 5AVBB 3WA9C 1M19C 5JRGC 4J8UD 5DNND 1U35B 1EQZD 2JSSA 3LZ1C 3A6NA 1AOIA 3MGSC 1P3PB 4KUDC 5GXQC 4UUZB 3UTAD 3X1UB 3MGPA 5CPIA 1KU5A 5AV6B 1KX5C 2CV5A 3C1BB 2F8NB 5B24B 3NQJB 2NQBA 2HUEC 1M19B 2Y2IA 5JRGB 2CWEA 1P3FD 3LZ0D 3LZ1B 5B0ZA 5B2JD 3MGSB 5G49B 5GT0D 4KUDB 2ZY4A 5GXQB 3AZMA 4H9QA 5F99C 2F8NH 5B2IC 3C1CC 4J8XC 3AZIC 5B1MC 3LJAA 4J8VC 4NE3A 1KX5B 2DQNC 3WAAA 1B6WA 2HUEB 3NQUA 1HTAA 3R45A 5CPKD 4H9PA 2XD1A 1ULYA 1P3GD 3UTBC 5B33C 1M19D 2UWXA 3KWQA 5F99B 5B40A 5B2IB 1KX4D 3C1CB 4J8XB 5B32B 3AZIB 3AFAC 1ID3A 3H0MC 5AV5D 5B1MB 5DNMA 4J8VB 3MGSD 3VH5T 3B6FC 3AV1C 5GXQD 1F66C 3REIC 1P3PA 2AROC 3X1SA 5B1LA 4DRBA 4WV4B 3AZJD 3KUYD 5B33B 3UTBB 3W96B 5AV6A 3VH6T 3C1BA 2F8NA 3AFAB 5B24A 4LD9C 3WA9A 3W97D 2F2AC 4AWLC 4KGCD 3AV1B 1KX3D 3LZ1A 1HQ3A 4WNNB 4E44A 2ZY2A 5B32D 5CPIC 4XZQD 3MGPC 2AROB 3REIB 2CV5C 1P3KD 2NQBC 4M6BA 1M18A 1WWIA 4WU8A 4X23A 2ZY3A 5B0ZC 3REJD 2YFVA 4LD9B 2YFWB 5B31A 3VH5A 5C3IC 5GT3A 3REKD 2PYOC 4R8PD 5B33D 1P3LC 3W96D 5AVCA 5B0YD 3LJAC 3MGPB 5CPIB 5AY8D 2CV5B 5AV9C 3AZEA 4WU9C 3FDDA 5B2IA 4J8XA 3AZIA 2NQBB 3VH6A 4XUJD 4NE6A 5B1MA 5AV8A 3MGQA 3B0DC 5B0ZB 4J8WC 3UT9D 5C3IB 5BO0A 3LELC 4H9QB 2Y2HA 4KHAB 2PYOB 1ID3C 1P3LB 1M1AC 3AZLA 3A6ND 1ZLAA 1AOID 5DNMC 3LJAB 3B6GD 3UTBA 1A7WA 4QLCA 5AV9B 2ZY5A 3H0LC 4WU9B 2RVQC 4EO5C 4HGAC 2BYKB 3MNNC 3W98A 1WWSA 1S32C 3X1SC 5B32G 5B1LC 1PZRA 3B0DB 3B6FA 3AV1A 1F66A 4H9PB 4J8WB 1TZYA 2Y2PA 2NQBD 3LELB 3REIA 4ZUXA 2HIOA 1ID3B 3MGRA 2XD5A 1M1AB 5E5AA 5DNMB 4JJNC 3AZMD 1HQ3C 2BG1A 4HGAB 3MNNB 2YFWA 1P3OA 4LD9A 1S32B 3X1SB 5B1LB 3WAAD 2IO5C 3WTPD 1M18C 4WU8C 3AZKD 4X23C 2FJ7D 3AN2D 5B31C 5GT3C 4G92C 3WA9B 1H3OA 5BT1C 4JJNB 3KWQD 1HQ3B 5B40D 5AVCC 1ID3D 5AVBD 4Z66C 3AZEC 1U35D 5DNMD 4KHAA 2PYOA 3AZNC 1P3LA 1BH9B 2IO5B 2RVQD 5AV8C 1M18B 4Z2MG 3X1TA 1P3PD 4WU8B 3MGQC 4X23B 5JA4A 5AV9A 3X1SD 3O62A 4WU9A 2YFVB 5B31B 5GT3B 4G92B 2NZDA 2BYKA 3X1UD 4YM6A 4H9OA 5AVCB 5AV6D 3AZLC 1ZLAC 3C1BD 4J8WA 2F8ND 3MVDA 5B24D 4Z66B 3WA9D 3LELA 4QLCC 5JRGD 3AZEB 3AZNB 3W98C 1M1AA 3LZ1D 1HQ3D 5AV8B 3MGQB 4KUDD 2F8NK 3EPHA 5BO0B 1TZYC 3MNNA 4ZUXC 2HIOC 1S32A 3MGRC 3X1VC 4WU8D 3AZLB 1KX5D 1ZLAB 5E5AC 4Z5TC 5B31D 4QLCB 3WKJC 3AZGA 1P3OC 3W98B 4CSRB 2Y2QA 1Q9CA 3AZHC 1P3MA 3B6FB 4JJNA 1P3IC 1F66B 5F99D 5B2ID 1TZYB 3C1CD 4J8XD 3RELC 3AZID 4ZUXB 2HIOB 2Y2JA 5B1MD 5AV8D 3MGRB 2Y2MA 3AL0C 4J8VD 3X1VB 3AYWA 5E5AB 4Z5TB 1BH9A 3KXBC 3AV2C 1JFIA 1P3OB 1P34C 2F8NG 1P3GA 4H9SC 1P3BC 4AWLB 3W99C 3AZHB 1P3IB 3UTBD 4QLCD 5BS7A 3WTPE 3RELB 1P3AA 3AFAD 3X1TC 3W98D 2VQRA 5AV5A 4Z66A 3O62C 3P5JB 3AZNA 4DRAA 2NZDC 3B6FD 1N1JB 2Y2KA 3AV1D 3REHA 1H3OB 1F66D 3KXBB 3AZFC 3AV2B 4YM6C 3REID 1B67A 4ZUXD 2AROD 2L5AA 5CHLB 3MGRD 5GSUA 3MVDC 1P34B 4J8UC 5DNNC 5B31G 1P3BB 1TAFA 3W99B 3KUYA 5BNXA 3X1TB 1P3OD 4LD9D 4WZSB 5JA4B 3O62B 3UTAC 2NZDB 1KX3A 2Y2GA 3AZFB 4CSRA 4YM6B 4H9OB 3MGPD 5CPID 3B0CW 4H9NA 1P3KA 2CV5D 2Y2LA 3MVDB 2Y2NA 4J8UB 5DNNB 1T3UA 3LZ0C 3AZGC 3X1VA 3REJA 3H0RC 5B2JC 5B0ZD 4Z5TA 3TU4A 5GT0C 3EPLA 1P3MC 3WKJA 2W8SA 5CPJA 4EO5B 3UTAB 2PYOD 1P3LD 4NFTA 5B0YA 4DQYB 3LJAD 5AY8A 3AZHA 3AYWC 1P3IA 5AV9D 5BNVA 4WU9D 3RELA 2NZDD 4XUJA 3F6TA 3LZ0B 3AZGB 2BYMA 4YM6D 4H9RA 3B0CT 5B2JB 5CPKC 1N1JA 4J8WD 1P3GC 5GT0B 3KXBA 3AV2A 1P3MB 3LELD 5BS7C 1KX4C 1P3AC 1P34A 5AV5C 1M1AD 4H9SA 1P3BA 3B6GA 3W99A 3EPKA 3AYWB 3REHC 3MNND 1JFIB 1S32D 5B1LD 5GSUC 5CPKB 1W2EA 2J8PA 4YS3A 1P3GB 2FFFB 5CP6A 3AZJC 3AZFA 3KUYC 1BH8A 3AZGD 1KX4B 1P3AB 5AV5B 3W97C 4J8UA 5DNNA 1EQZA 4KGCC 3KSYA 3A1KA 1P3MD 4JJND 1KX3C 3VH5W 3REHB 2DF4C 3IP4C 5KDMB 4XZQC 5B32C 2ZM5A 1P3KC 5GSUB 3UTAA 3AYWD 3AZJB 1TAFB 3KUYB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WTP A;  5BNX B;  1M18 D;  3AZK A;  4X23 D;  3REJ C;  2FJ7 A;  3VH6 W;  3AN2 A;  3REK C;  3TU4 C;  5GT3 D;  3W97 B;  1P3F A;  3LZ0 A;  5CPJ C;  4KGC B;  4R8P C;  5BT1 D;  1KX3 B;  3W96 C;  5AVC D;  5B2J A;  5B0Y C;  4XZQ B;  1P3A D;  5GT0 A;  5AY8 C;  5AVB A;  4H9N B;  1P3K B;  4Z66 D;  1U35 A;  3AZE D;  3AZN D;  4XUJ C;  3REH D;  3V9R B;  3MGQ D;  3REJ B;  3REK B;  3UT9 C;  4UUZ A;  5GSU D;  3TU4 B;  3X1U A;  3WKJ B;  5CPJ B;  4R8P B;  3A6N C;  3AZL D;  5CPK A;  5B0Y B;  1AOI C;  1ZLA D;  5AY8 B;  3NQJ A;  3B6G C;  1BFM A;  1M19 A;  5JRG A;  5BNV B;  1KX4 A;  4XUJ B;  4G91 C;  2BYM B;  5FUG B;  4H9R B;  3MGS A;  5G49 A;  4KUD A;  5GXQ A;  3UT9 B;  4YS3 C;  5CP6 C;  4CAY B;  5KDM A;  1TZY D;  2LY8 A;  2HIO D;  3X1V D;  3A6N B;  1KX5 A;  1AOI B;  5E5A D;  4Z5T D;  3AZJ A;  3B6G B;  1EQZ C;  3TU4 D;  3AZM C;  3WKJ D;  5CPJ D;  4NE5 A;  4G91 B;  3W97 A;  3B0B A;  4KGC A;  3AZH D;  1P3I D;  5F99 A;  4YS3 B;  3WAA C;  5CP6 B;  3C1C A;  5B32 A;  4XZQ A;  3WTP C;  3REL D;  3AZK C;  1BH8 B;  2FJ7 C;  4J8V A;  3AN2 C;  4Z2M H;  1F1E A;  1P3F C;  1EQZ B;  3KXB D;  3AV2 D;  3V9R A;  3KWQ C;  3AZM B;  4E45 A;  5B40 C;  4ZBJ C;  3REK A;  1P34 D;  5AVB C;  1U35 C;  1P3B D;  4R8P A;  3W99 D;  5B33 A;  3W96 A;  3WAA B;  3NQU B;  3WTP B;  3AFA A;  1R4V A;  1P3P C;  3X1T D;  3AZK B;  2FJ7 B;  3R45 B;  3AN2 B;  3O62 D;  3X1U C;  1P3F B;  4WNN A;  4YS3 D;  5CP6 D;  3AZF D;  5FUG A;  3KWQ B;  2ARO A;  5B40 B;  5AV6 C;  4ZBJ B;  3C1B C;  3UT9 A;  5B24 C;  3MVD D;  4CAY A;  5AVB B;  3WA9 C;  1M19 C;  5JRG C;  4J8U D;  5DNN D;  1U35 B;  1EQZ D;  2JSS A;  3LZ1 C;  3A6N A;  1AOI A;  3MGS C;  1P3P B;  4KUD C;  5GXQ C;  4UUZ B;  3UTA D;  3X1U B;  3MGP A;  5CPI A;  1KU5 A;  5AV6 B;  1KX5 C;  2CV5 A;  3C1B B;  2F8N B;  5B24 B;  3NQJ B;  2NQB A;  2HUE C;  1M19 B;  5JRG B;  2CWE A;  1P3F D;  3LZ0 D;  3LZ1 B;  5B0Z A;  5B2J D;  3MGS B;  5G49 B;  5GT0 D;  4KUD B;  5GXQ B;  3AZM A;  4H9Q A;  5F99 C;  2F8N H;  5B2I C;  3C1C C;  4J8X C;  3AZI C;  5B1M C;  3LJA A;  4J8V C;  4NE3 A;  1KX5 B;  3WAA A;  1B6W A;  2HUE B;  3NQU A;  1HTA A;  3R45 A;  5CPK D;  4H9P A;  1ULY A;  1P3G D;  3UTB C;  5B33 C;  1M19 D;  3KWQ A;  5F99 B;  5B40 A;  5B2I B;  1KX4 D;  3C1C B;  4J8X B;  5B32 B;  3AZI B;  3AFA C;  1ID3 A;  5AV5 D;  5B1M B;  5DNM A;  4J8V B;  3MGS D;  3VH5 T;  3B6F C;  3AV1 C;  5GXQ D;  1F66 C;  3REI C;  1P3P A;  2ARO C;  3X1S A;  5B1L A;  4DRB A;  4WV4 B;  3AZJ D;  3KUY D;  5B33 B;  3UTB B;  3W96 B;  5AV6 A;  3VH6 T;  3C1B A;  2F8N A;  3AFA B;  5B24 A;  4LD9 C;  3WA9 A;  3W97 D;  4AWL C;  4KGC D;  3AV1 B;  1KX3 D;  3LZ1 A;  1HQ3 A;  4WNN B;  4E44 A;  5B32 D;  5CPI C;  4XZQ D;  3MGP C;  2ARO B;  3REI B;  2CV5 C;  1P3K D;  2NQB C;  4M6B A;  1M18 A;  1WWI A;  4WU8 A;  4X23 A;  5B0Z C;  3REJ D;  2YFV A;  4LD9 B;  2YFW B;  5B31 A;  3VH5 A;  5C3I C;  5GT3 A;  3REK D;  2PYO C;  4R8P D;  5B33 D;  1P3L C;  3W96 D;  5AVC A;  5B0Y D;  3LJA C;  3MGP B;  5CPI B;  5AY8 D;  2CV5 B;  5AV9 C;  3AZE A;  4WU9 C;  5B2I A;  4J8X A;  3AZI A;  2NQB B;  3VH6 A;  4XUJ D;  4NE6 A;  5B1M A;  5AV8 A;  3MGQ A;  3B0D C;  5B0Z B;  4J8W C;  3UT9 D;  5C3I B;  5BO0 A;  3LEL C;  4H9Q B;  4KHA B;  2PYO B;  1ID3 C;  1P3L B;  1M1A C;  3AZL A;  3A6N D;  1ZLA A;  1AOI D;  5DNM C;  3LJA B;  3B6G D;  3UTB A;  1A7W A;  4QLC A;  5AV9 B;  4WU9 B;  2RVQ C;  4EO5 C;  4HGA C;  2BYK B;  3MNN C;  3W98 A;  1WWS A;  1S32 C;  3X1S C;  5B32 G;  5B1L C;  3B0D B;  3B6F A;  3AV1 A;  1F66 A;  4H9P B;  4J8W B;  1TZY A;  2NQB D;  3LEL B;  3REI A;  4ZUX A;  2HIO A;  1ID3 B;  3MGR A;  1M1A B;  5E5A A;  5DNM B;  4JJN C;  3AZM D;  1HQ3 C;  4HGA B;  1P3O A;  3MNN B;  2YFW A;  4LD9 A;  1S32 B;  3X1S B;  5B1L B;  3WAA D;  2IO5 C;  3WTP D;  1M18 C;  4WU8 C;  3AZK D;  4X23 C;  2FJ7 D;  3AN2 D;  5B31 C;  5GT3 C;  4G92 C;  3WA9 B;  1H3O A;  5BT1 C;  4JJN B;  3KWQ D;  1HQ3 B;  5B40 D;  5AVC C;  1ID3 D;  5AVB D;  4Z66 C;  3AZE C;  1U35 D;  5DNM D;  4KHA A;  2PYO A;  3AZN C;  1P3L A;  1BH9 B;  2IO5 B;  2RVQ D;  5AV8 C;  1M18 B;  4Z2M G;  3X1T A;  1P3P D;  4WU8 B;  3MGQ C;  4X23 B;  5JA4 A;  5AV9 A;  3X1S D;  3O62 A;  4WU9 A;  2YFV B;  5B31 B;  5GT3 B;  4G92 B;  2NZD A;  2BYK A;  3X1U D;  4YM6 A;  4H9O A;  5AVC B;  5AV6 D;  3AZL C;  1ZLA C;  3C1B D;  4J8W A;  2F8N D;  3MVD A;  5B24 D;  4Z66 B;  3WA9 D;  3LEL A;  4QLC C;  5JRG D;  3AZE B;  3AZN B;  3W98 C;  1M1A A;  3LZ1 D;  1HQ3 D;  5AV8 B;  3MGQ B;  4KUD D;  2F8N K;  5BO0 B;  1TZY C;  3MNN A;  4ZUX C;  2HIO C;  1S32 A;  3MGR C;  3X1V C;  4WU8 D;  3AZL B;  1KX5 D;  1ZLA B;  5E5A C;  4Z5T C;  5B31 D;  4QLC B;  3WKJ C;  3AZG A;  1P3O C;  3W98 B;  4CSR B;  1Q9C A;  3AZH C;  1P3M A;  3B6F B;  4JJN A;  1P3I C;  1F66 B;  5F99 D;  5B2I D;  1TZY B;  3C1C D;  4J8X D;  3REL C;  3AZI D;  4ZUX B;  2HIO B;  5B1M D;  5AV8 D;  3MGR B;  4J8V D;  3X1V B;  3AYW A;  5E5A B;  4Z5T B;  1BH9 A;  3KXB C;  3AV2 C;  1JFI A;  1P3O B;  1P34 C;  2F8N G;  1P3G A;  4H9S C;  1P3B C;  4AWL B;  3W99 C;  3AZH B;  1P3I B;  3UTB D;  4QLC D;  5BS7 A;  3WTP E;  3REL B;  1P3A A;  3AFA D;  3X1T C;  3W98 D;  5AV5 A;  4Z66 A;  3O62 C;  3AZN A;  4DRA A;  2NZD C;  3B6F D;  1N1J B;  3AV1 D;  1F66 D;  3REH A;  1H3O B;  3KXB B;  3AZF C;  3AV2 B;  4YM6 C;  3REI D;  1B67 A;  4ZUX D;  2ARO D;  2L5A A;  5CHL B;  3MGR D;  5GSU A;  3MVD C;  1P34 B;  4J8U C;  5DNN C;  5B31 G;  1P3B B;  1TAF A;  3W99 B;  3KUY A;  5BNX A;  3X1T B;  1P3O D;  4LD9 D;  4WZS B;  5JA4 B;  3O62 B;  3UTA C;  2NZD B;  1KX3 A;  3AZF B;  4CSR A;  4YM6 B;  4H9O B;  3MGP D;  5CPI D;  3B0C W;  4H9N A;  1P3K A;  2CV5 D;  3MVD B;  4J8U B;  5DNN B;  3LZ0 C;  3AZG C;  3X1V A;  3REJ A;  5B2J C;  5B0Z D;  4Z5T A;  3TU4 A;  5GT0 C;  1P3M C;  3WKJ A;  5CPJ A;  4EO5 B;  3UTA B;  2PYO D;  1P3L D;  4NFT A;  5B0Y A;  3LJA D;  5AY8 A;  3AZH A;  3AYW C;  1P3I A;  5AV9 D;  5BNV A;  4WU9 D;  3REL A;  2NZD D;  4XUJ A;  3LZ0 B;  3AZG B;  2BYM A;  4YM6 D;  4H9R A;  3B0C T;  5B2J B;  5CPK C;  1N1J A;  4J8W D;  1P3G C;  5GT0 B;  3KXB A;  3AV2 A;  1P3M B;  3LEL D;  5BS7 C;  1KX4 C;  1P3A C;  1P34 A;  5AV5 C;  1M1A D;  4H9S A;  1P3B A;  3B6G A;  3W99 A;  3AYW B;  3REH C;  3MNN D;  1JFI B;  1S32 D;  5B1L D;  5GSU C;  5CPK B;  4YS3 A;  1P3G B;  5CP6 A;  3AZJ C;  3AZF A;  3KUY C;  1BH8 A;  3AZG D;  1KX4 B;  1P3A B;  5AV5 B;  3W97 C;  4J8U A;  5DNN A;  1EQZ A;  4KGC C;  3KSY A;  1P3M D;  4JJN D;  1KX3 C;  3VH5 W;  3REH B;  5KDM B;  5B32 C;  4XZQ C;  1P3K C;  5GSU B;  3UTA A;  3AYW D;  3AZJ B;  1TAF B;  3KUY B; 
#chains in the Genus database with same CATH topology
 3WTP A;  5BNX B;  1M18 D;  3AZK A;  4X23 D;  3REJ C;  2FJ7 A;  3VH6 W;  3AN2 A;  3REK C;  3TU4 C;  5GT3 D;  3W97 B;  1P3F A;  3LZ0 A;  5CPJ C;  4KGC B;  4R8P C;  5BT1 D;  1KX3 B;  3W96 C;  5AVC D;  5B2J A;  5B0Y C;  1Z2C B;  4XZQ B;  2Y2O A;  1P3A D;  5GT0 A;  5AY8 C;  5AVB A;  4H9N B;  1P3K B;  4Z66 D;  1U35 A;  3AZE D;  3AZN D;  2JCH A;  4XUJ C;  3REH D;  3V9R B;  3EPJ A;  3MGQ D;  3REJ B;  3REK B;  3UT9 C;  4UUZ A;  5GSU D;  3TU4 B;  3X1U A;  3WKJ B;  5CPJ B;  4R8P B;  3A6N C;  3AZL D;  5CPK A;  5B0Y B;  1AOI C;  1ZLA D;  5AY8 B;  3NQJ A;  3B6G C;  1BFM A;  1M19 A;  5JRG A;  5BNV B;  1KX4 A;  4XUJ B;  4G91 C;  2BYM B;  5FUG B;  4H9R B;  3MGS A;  5G49 A;  4KUD A;  5GXQ A;  3UT9 B;  4UPK A;  4YS3 C;  2G5H C;  5CP6 C;  4CAY B;  5KDM A;  1TZY D;  2LY8 A;  2HIO D;  3X1V D;  3A6N B;  1KX5 A;  1AOI B;  5E5A D;  4Z5T D;  3EG5 B;  3AZJ A;  1EQZ C;  3TU4 D;  3B6G B;  3KFU G;  3AZM C;  3WKJ D;  5CPJ D;  4NE5 A;  4G91 B;  3W97 A;  3B0B A;  4KGC A;  3AZH D;  1P3I D;  5F99 A;  4YS3 B;  3WAA C;  5CP6 B;  3C1C A;  5B32 A;  4XZQ A;  3WTP C;  3REL D;  3AZK C;  2RIQ A;  1BH8 B;  2FJ7 C;  4J8V A;  3AN2 C;  4Z2M H;  1F1E A;  1P3F C;  1EQZ B;  3KXB D;  3AV2 D;  3V9R A;  2G5I C;  3KWQ C;  3AZM B;  4E45 A;  5B40 C;  2JE5 A;  4ZBJ C;  3REK A;  1P34 D;  5AVB C;  1U35 C;  1P3B D;  4R8P A;  3W99 D;  5B33 A;  3A1I A;  3W96 A;  3WAA B;  3NQU B;  3WTP B;  3AFA A;  1R4V A;  1P3P C;  3X1T D;  3AZK B;  2FJ7 B;  3R45 B;  3AN2 B;  3O62 D;  3X1U C;  1P3F B;  4WNN A;  4YS3 D;  5CP6 D;  3AZF D;  5FUG A;  3KWQ B;  2ARO A;  5B40 B;  4WJ3 C;  5AV6 C;  4ZBJ B;  3C1B C;  3UT9 A;  5B24 C;  3MVD D;  4CAY A;  5AVB B;  3WA9 C;  1M19 C;  5JRG C;  4J8U D;  5DNN D;  1U35 B;  1EQZ D;  2JSS A;  3LZ1 C;  3A6N A;  1AOI A;  3MGS C;  1P3P B;  4KUD C;  5GXQ C;  4UUZ B;  3UTA D;  3X1U B;  3MGP A;  5CPI A;  1KU5 A;  5AV6 B;  1KX5 C;  2CV5 A;  3C1B B;  2F8N B;  5B24 B;  3NQJ B;  2NQB A;  2HUE C;  1M19 B;  2Y2I A;  5JRG B;  2CWE A;  1P3F D;  3LZ0 D;  3LZ1 B;  5B0Z A;  5B2J D;  3MGS B;  5G49 B;  5GT0 D;  4KUD B;  2ZY4 A;  5GXQ B;  3AZM A;  4H9Q A;  5F99 C;  2F8N H;  5B2I C;  3C1C C;  4J8X C;  3AZI C;  5B1M C;  3LJA A;  4J8V C;  4NE3 A;  1KX5 B;  2DQN C;  3WAA A;  1B6W A;  2HUE B;  3NQU A;  1HTA A;  3R45 A;  5CPK D;  4H9P A;  2XD1 A;  1ULY A;  1P3G D;  3UTB C;  5B33 C;  1M19 D;  2UWX A;  3KWQ A;  5F99 B;  5B40 A;  5B2I B;  1KX4 D;  3C1C B;  4J8X B;  5B32 B;  3AZI B;  3AFA C;  1ID3 A;  3H0M C;  5AV5 D;  5B1M B;  5DNM A;  4J8V B;  3MGS D;  3VH5 T;  3B6F C;  3AV1 C;  5GXQ D;  1F66 C;  3REI C;  1P3P A;  2ARO C;  3X1S A;  5B1L A;  4DRB A;  4WV4 B;  3AZJ D;  3KUY D;  5B33 B;  3UTB B;  3W96 B;  5AV6 A;  3VH6 T;  3C1B A;  2F8N A;  3AFA B;  5B24 A;  4LD9 C;  3WA9 A;  3W97 D;  2F2A C;  4AWL C;  4KGC D;  3AV1 B;  1KX3 D;  3LZ1 A;  1HQ3 A;  4WNN B;  4E44 A;  2ZY2 A;  5B32 D;  5CPI C;  4XZQ D;  3MGP C;  2ARO B;  3REI B;  2CV5 C;  1P3K D;  2NQB C;  4M6B A;  1M18 A;  1WWI A;  4WU8 A;  4X23 A;  2ZY3 A;  5B0Z C;  3REJ D;  2YFV A;  4LD9 B;  2YFW B;  5B31 A;  3VH5 A;  5C3I C;  5GT3 A;  3REK D;  2PYO C;  4R8P D;  5B33 D;  1P3L C;  3W96 D;  5AVC A;  5B0Y D;  3LJA C;  3MGP B;  5CPI B;  5AY8 D;  2CV5 B;  5AV9 C;  3AZE A;  4WU9 C;  3FDD A;  5B2I A;  4J8X A;  3AZI A;  2NQB B;  3VH6 A;  4XUJ D;  4NE6 A;  5B1M A;  5AV8 A;  3MGQ A;  3B0D C;  5B0Z B;  4J8W C;  3UT9 D;  5C3I B;  5BO0 A;  3LEL C;  4H9Q B;  2Y2H A;  4KHA B;  2PYO B;  1ID3 C;  1P3L B;  1M1A C;  3AZL A;  3A6N D;  1ZLA A;  1AOI D;  5DNM C;  3LJA B;  3B6G D;  3UTB A;  1A7W A;  4QLC A;  5AV9 B;  2ZY5 A;  3H0L C;  4WU9 B;  2RVQ C;  4EO5 C;  4HGA C;  2BYK B;  3MNN C;  3W98 A;  1WWS A;  1S32 C;  3X1S C;  5B32 G;  5B1L C;  1PZR A;  3B0D B;  3B6F A;  3AV1 A;  1F66 A;  4H9P B;  4J8W B;  1TZY A;  2Y2P A;  2NQB D;  3LEL B;  3REI A;  4ZUX A;  2HIO A;  1ID3 B;  3MGR A;  2XD5 A;  1M1A B;  5E5A A;  5DNM B;  4JJN C;  3AZM D;  1HQ3 C;  2BG1 A;  4HGA B;  3MNN B;  2YFW A;  1P3O A;  4LD9 A;  1S32 B;  3X1S B;  5B1L B;  3WAA D;  2IO5 C;  3WTP D;  1M18 C;  4WU8 C;  3AZK D;  4X23 C;  2FJ7 D;  3AN2 D;  5B31 C;  5GT3 C;  4G92 C;  3WA9 B;  1H3O A;  5BT1 C;  4JJN B;  3KWQ D;  1HQ3 B;  5B40 D;  5AVC C;  1ID3 D;  5AVB D;  4Z66 C;  3AZE C;  1U35 D;  5DNM D;  4KHA A;  2PYO A;  3AZN C;  1P3L A;  1BH9 B;  2IO5 B;  2RVQ D;  5AV8 C;  1M18 B;  4Z2M G;  3X1T A;  1P3P D;  4WU8 B;  3MGQ C;  4X23 B;  5JA4 A;  5AV9 A;  3X1S D;  3O62 A;  4WU9 A;  2YFV B;  5B31 B;  5GT3 B;  4G92 B;  2NZD A;  2BYK A;  3X1U D;  4YM6 A;  4H9O A;  5AVC B;  5AV6 D;  3AZL C;  1ZLA C;  3C1B D;  4J8W A;  2F8N D;  3MVD A;  5B24 D;  4Z66 B;  3WA9 D;  3LEL A;  4QLC C;  5JRG D;  3AZE B;  3AZN B;  3W98 C;  1M1A A;  3LZ1 D;  1HQ3 D;  5AV8 B;  3MGQ B;  4KUD D;  2F8N K;  3EPH A;  5BO0 B;  1TZY C;  3MNN A;  4ZUX C;  2HIO C;  1S32 A;  3MGR C;  3X1V C;  4WU8 D;  3AZL B;  1KX5 D;  1ZLA B;  5E5A C;  4Z5T C;  5B31 D;  4QLC B;  3WKJ C;  3AZG A;  1P3O C;  3W98 B;  4CSR B;  2Y2Q A;  1Q9C A;  3AZH C;  1P3M A;  3B6F B;  4JJN A;  1P3I C;  1F66 B;  5F99 D;  5B2I D;  1TZY B;  3C1C D;  4J8X D;  3REL C;  3AZI D;  4ZUX B;  2HIO B;  2Y2J A;  5B1M D;  5AV8 D;  3MGR B;  2Y2M A;  3AL0 C;  4J8V D;  3X1V B;  3AYW A;  5E5A B;  4Z5T B;  1BH9 A;  3KXB C;  3AV2 C;  1JFI A;  1P3O B;  1P34 C;  2F8N G;  1P3G A;  4H9S C;  1P3B C;  4AWL B;  3W99 C;  3AZH B;  1P3I B;  3UTB D;  4QLC D;  5BS7 A;  3WTP E;  3REL B;  1P3A A;  3AFA D;  3X1T C;  3W98 D;  2VQR A;  5AV5 A;  4Z66 A;  3O62 C;  3P5J B;  3AZN A;  4DRA A;  2NZD C;  3B6F D;  1N1J B;  2Y2K A;  3AV1 D;  3REH A;  1H3O B;  1F66 D;  3KXB B;  3AZF C;  3AV2 B;  4YM6 C;  3REI D;  1B67 A;  4ZUX D;  2ARO D;  2L5A A;  5CHL B;  3MGR D;  5GSU A;  3MVD C;  1P34 B;  4J8U C;  5DNN C;  5B31 G;  1P3B B;  1TAF A;  3W99 B;  3KUY A;  5BNX A;  3X1T B;  1P3O D;  4LD9 D;  4WZS B;  5JA4 B;  3O62 B;  3UTA C;  2NZD B;  1KX3 A;  2Y2G A;  3AZF B;  4CSR A;  4YM6 B;  4H9O B;  3MGP D;  5CPI D;  3B0C W;  4H9N A;  1P3K A;  2CV5 D;  2Y2L A;  3MVD B;  2Y2N A;  4J8U B;  5DNN B;  1T3U A;  3LZ0 C;  3AZG C;  3X1V A;  3REJ A;  3H0R C;  5B2J C;  5B0Z D;  4Z5T A;  3TU4 A;  5GT0 C;  3EPL A;  1P3M C;  3WKJ A;  2W8S A;  5CPJ A;  4EO5 B;  3UTA B;  2PYO D;  1P3L D;  4NFT A;  5B0Y A;  4DQY B;  3LJA D;  5AY8 A;  3AZH A;  3AYW C;  1P3I A;  5AV9 D;  5BNV A;  4WU9 D;  3REL A;  2NZD D;  4XUJ A;  3F6T A;  3LZ0 B;  3AZG B;  2BYM A;  4YM6 D;  4H9R A;  3B0C T;  5B2J B;  5CPK C;  1N1J A;  4J8W D;  1P3G C;  5GT0 B;  3KXB A;  3AV2 A;  1P3M B;  3LEL D;  5BS7 C;  1KX4 C;  1P3A C;  1P34 A;  5AV5 C;  1M1A D;  4H9S A;  1P3B A;  3B6G A;  3W99 A;  3EPK A;  3AYW B;  3REH C;  3MNN D;  1JFI B;  1S32 D;  5B1L D;  5GSU C;  5CPK B;  1W2E A;  2J8P A;  4YS3 A;  1P3G B;  2FFF B;  5CP6 A;  3AZJ C;  3AZF A;  3KUY C;  1BH8 A;  3AZG D;  1KX4 B;  1P3A B;  5AV5 B;  3W97 C;  4J8U A;  5DNN A;  1EQZ A;  4KGC C;  3KSY A;  3A1K A;  1P3M D;  4JJN D;  1KX3 C;  3VH5 W;  3REH B;  2DF4 C;  3IP4 C;  5KDM B;  4XZQ C;  5B32 C;  2ZM5 A;  1P3K C;  5GSU B;  3UTA A;  3AYW D;  3AZJ B;  1TAF B;  3KUY B; 
#chains in the Genus database with same CATH homology
 3WTP A;  5BNX B;  1M18 D;  3AZK A;  4X23 D;  3REJ C;  2FJ7 A;  3VH6 W;  3AN2 A;  3REK C;  3TU4 C;  5GT3 D;  3W97 B;  1P3F A;  3LZ0 A;  5CPJ C;  4KGC B;  4R8P C;  5BT1 D;  1KX3 B;  3W96 C;  5AVC D;  5B2J A;  5B0Y C;  1Z2C B;  4XZQ B;  2Y2O A;  1P3A D;  5GT0 A;  5AY8 C;  5AVB A;  4H9N B;  1P3K B;  4Z66 D;  1U35 A;  3AZE D;  3AZN D;  2JCH A;  4XUJ C;  3REH D;  3V9R B;  3EPJ A;  3MGQ D;  3REJ B;  3REK B;  3UT9 C;  4UUZ A;  5GSU D;  3TU4 B;  3X1U A;  3WKJ B;  5CPJ B;  4R8P B;  3A6N C;  3AZL D;  5CPK A;  5B0Y B;  1AOI C;  1ZLA D;  5AY8 B;  3NQJ A;  3B6G C;  1BFM A;  1M19 A;  5JRG A;  5BNV B;  1KX4 A;  4XUJ B;  4G91 C;  2BYM B;  5FUG B;  4H9R B;  3MGS A;  5G49 A;  4KUD A;  5GXQ A;  3UT9 B;  4UPK A;  4YS3 C;  2G5H C;  5CP6 C;  4CAY B;  5KDM A;  1TZY D;  2LY8 A;  2HIO D;  3X1V D;  3A6N B;  1KX5 A;  1AOI B;  5E5A D;  4Z5T D;  3EG5 B;  3AZJ A;  1EQZ C;  3TU4 D;  3B6G B;  3KFU G;  3AZM C;  3WKJ D;  5CPJ D;  4NE5 A;  4G91 B;  3W97 A;  3B0B A;  4KGC A;  3AZH D;  1P3I D;  5F99 A;  4YS3 B;  3WAA C;  5CP6 B;  3C1C A;  5B32 A;  4XZQ A;  3WTP C;  3REL D;  3AZK C;  2RIQ A;  1BH8 B;  2FJ7 C;  4J8V A;  3AN2 C;  4Z2M H;  1F1E A;  1P3F C;  1EQZ B;  3KXB D;  3AV2 D;  3V9R A;  2G5I C;  3KWQ C;  3AZM B;  4E45 A;  5B40 C;  2JE5 A;  4ZBJ C;  3REK A;  1P34 D;  5AVB C;  1U35 C;  1P3B D;  4R8P A;  3W99 D;  5B33 A;  3A1I A;  3W96 A;  3WAA B;  3NQU B;  3WTP B;  3AFA A;  1R4V A;  1P3P C;  3X1T D;  3AZK B;  2FJ7 B;  3R45 B;  3AN2 B;  3O62 D;  3X1U C;  1P3F B;  4WNN A;  4YS3 D;  5CP6 D;  3AZF D;  5FUG A;  3KWQ B;  2ARO A;  5B40 B;  4WJ3 C;  5AV6 C;  4ZBJ B;  3C1B C;  3UT9 A;  5B24 C;  3MVD D;  4CAY A;  5AVB B;  3WA9 C;  1M19 C;  5JRG C;  4J8U D;  5DNN D;  1U35 B;  1EQZ D;  2JSS A;  3LZ1 C;  3A6N A;  1AOI A;  3MGS C;  1P3P B;  4KUD C;  5GXQ C;  4UUZ B;  3UTA D;  3X1U B;  3MGP A;  5CPI A;  1KU5 A;  5AV6 B;  1KX5 C;  2CV5 A;  3C1B B;  2F8N B;  5B24 B;  3NQJ B;  2NQB A;  2HUE C;  1M19 B;  2Y2I A;  5JRG B;  2CWE A;  1P3F D;  3LZ0 D;  3LZ1 B;  5B0Z A;  5B2J D;  3MGS B;  5G49 B;  5GT0 D;  4KUD B;  2ZY4 A;  5GXQ B;  3AZM A;  4H9Q A;  5F99 C;  2F8N H;  5B2I C;  3C1C C;  4J8X C;  3AZI C;  5B1M C;  3LJA A;  4J8V C;  4NE3 A;  1KX5 B;  2DQN C;  3WAA A;  1B6W A;  2HUE B;  3NQU A;  1HTA A;  3R45 A;  5CPK D;  4H9P A;  2XD1 A;  1ULY A;  1P3G D;  3UTB C;  5B33 C;  1M19 D;  2UWX A;  3KWQ A;  5F99 B;  5B40 A;  5B2I B;  1KX4 D;  3C1C B;  4J8X B;  5B32 B;  3AZI B;  3AFA C;  1ID3 A;  3H0M C;  5AV5 D;  5B1M B;  5DNM A;  4J8V B;  3MGS D;  3VH5 T;  3B6F C;  3AV1 C;  5GXQ D;  1F66 C;  3REI C;  1P3P A;  2ARO C;  3X1S A;  5B1L A;  4DRB A;  4WV4 B;  3AZJ D;  3KUY D;  5B33 B;  3UTB B;  3W96 B;  5AV6 A;  3VH6 T;  3C1B A;  2F8N A;  3AFA B;  5B24 A;  4LD9 C;  3WA9 A;  3W97 D;  2F2A C;  4AWL C;  4KGC D;  3AV1 B;  1KX3 D;  3LZ1 A;  1HQ3 A;  4WNN B;  4E44 A;  2ZY2 A;  5B32 D;  5CPI C;  4XZQ D;  3MGP C;  2ARO B;  3REI B;  2CV5 C;  1P3K D;  2NQB C;  4M6B A;  1M18 A;  1WWI A;  4WU8 A;  4X23 A;  2ZY3 A;  5B0Z C;  3REJ D;  2YFV A;  4LD9 B;  2YFW B;  5B31 A;  3VH5 A;  5C3I C;  5GT3 A;  3REK D;  2PYO C;  4R8P D;  5B33 D;  1P3L C;  3W96 D;  5AVC A;  5B0Y D;  3LJA C;  3MGP B;  5CPI B;  5AY8 D;  2CV5 B;  5AV9 C;  3AZE A;  4WU9 C;  3FDD A;  5B2I A;  4J8X A;  3AZI A;  2NQB B;  3VH6 A;  4XUJ D;  4NE6 A;  5B1M A;  5AV8 A;  3MGQ A;  3B0D C;  5B0Z B;  4J8W C;  3UT9 D;  5C3I B;  5BO0 A;  3LEL C;  4H9Q B;  2Y2H A;  4KHA B;  2PYO B;  1ID3 C;  1P3L B;  1M1A C;  3AZL A;  3A6N D;  1ZLA A;  1AOI D;  5DNM C;  3LJA B;  3B6G D;  3UTB A;  1A7W A;  4QLC A;  5AV9 B;  2ZY5 A;  3H0L C;  4WU9 B;  2RVQ C;  4EO5 C;  4HGA C;  2BYK B;  3MNN C;  3W98 A;  1WWS A;  1S32 C;  3X1S C;  5B32 G;  5B1L C;  1PZR A;  3B0D B;  3B6F A;  3AV1 A;  1F66 A;  4H9P B;  4J8W B;  1TZY A;  2Y2P A;  2NQB D;  3LEL B;  3REI A;  4ZUX A;  2HIO A;  1ID3 B;  3MGR A;  2XD5 A;  1M1A B;  5E5A A;  5DNM B;  4JJN C;  3AZM D;  1HQ3 C;  2BG1 A;  4HGA B;  3MNN B;  2YFW A;  1P3O A;  4LD9 A;  1S32 B;  3X1S B;  5B1L B;  3WAA D;  2IO5 C;  3WTP D;  1M18 C;  4WU8 C;  3AZK D;  4X23 C;  2FJ7 D;  3AN2 D;  5B31 C;  5GT3 C;  4G92 C;  3WA9 B;  1H3O A;  5BT1 C;  4JJN B;  3KWQ D;  1HQ3 B;  5B40 D;  5AVC C;  1ID3 D;  5AVB D;  4Z66 C;  3AZE C;  1U35 D;  5DNM D;  4KHA A;  2PYO A;  3AZN C;  1P3L A;  1BH9 B;  2IO5 B;  2RVQ D;  5AV8 C;  1M18 B;  4Z2M G;  3X1T A;  1P3P D;  4WU8 B;  3MGQ C;  4X23 B;  5JA4 A;  5AV9 A;  3X1S D;  3O62 A;  4WU9 A;  2YFV B;  5B31 B;  5GT3 B;  4G92 B;  2NZD A;  2BYK A;  3X1U D;  4YM6 A;  4H9O A;  5AVC B;  5AV6 D;  3AZL C;  1ZLA C;  3C1B D;  4J8W A;  2F8N D;  3MVD A;  5B24 D;  4Z66 B;  3WA9 D;  3LEL A;  4QLC C;  5JRG D;  3AZE B;  3AZN B;  3W98 C;  1M1A A;  3LZ1 D;  1HQ3 D;  5AV8 B;  3MGQ B;  4KUD D;  2F8N K;  3EPH A;  5BO0 B;  1TZY C;  3MNN A;  4ZUX C;  2HIO C;  1S32 A;  3MGR C;  3X1V C;  4WU8 D;  3AZL B;  1KX5 D;  1ZLA B;  5E5A C;  4Z5T C;  5B31 D;  4QLC B;  3WKJ C;  3AZG A;  1P3O C;  3W98 B;  4CSR B;  2Y2Q A;  1Q9C A;  3AZH C;  1P3M A;  3B6F B;  4JJN A;  1P3I C;  1F66 B;  5F99 D;  5B2I D;  1TZY B;  3C1C D;  4J8X D;  3REL C;  3AZI D;  4ZUX B;  2HIO B;  2Y2J A;  5B1M D;  5AV8 D;  3MGR B;  2Y2M A;  3AL0 C;  4J8V D;  3X1V B;  3AYW A;  5E5A B;  4Z5T B;  1BH9 A;  3KXB C;  3AV2 C;  1JFI A;  1P3O B;  1P34 C;  2F8N G;  1P3G A;  4H9S C;  1P3B C;  4AWL B;  3W99 C;  3AZH B;  1P3I B;  3UTB D;  4QLC D;  5BS7 A;  3WTP E;  3REL B;  1P3A A;  3AFA D;  3X1T C;  3W98 D;  2VQR A;  5AV5 A;  4Z66 A;  3O62 C;  3P5J B;  3AZN A;  4DRA A;  2NZD C;  3B6F D;  1N1J B;  2Y2K A;  3AV1 D;  3REH A;  1H3O B;  1F66 D;  3KXB B;  3AZF C;  3AV2 B;  4YM6 C;  3REI D;  1B67 A;  4ZUX D;  2ARO D;  2L5A A;  5CHL B;  3MGR D;  5GSU A;  3MVD C;  1P34 B;  4J8U C;  5DNN C;  5B31 G;  1P3B B;  1TAF A;  3W99 B;  3KUY A;  5BNX A;  3X1T B;  1P3O D;  4LD9 D;  4WZS B;  5JA4 B;  3O62 B;  3UTA C;  2NZD B;  1KX3 A;  2Y2G A;  3AZF B;  4CSR A;  4YM6 B;  4H9O B;  3MGP D;  5CPI D;  3B0C W;  4H9N A;  1P3K A;  2CV5 D;  2Y2L A;  3MVD B;  2Y2N A;  4J8U B;  5DNN B;  1T3U A;  3LZ0 C;  3AZG C;  3X1V A;  3REJ A;  3H0R C;  5B2J C;  5B0Z D;  4Z5T A;  3TU4 A;  5GT0 C;  3EPL A;  1P3M C;  3WKJ A;  2W8S A;  5CPJ A;  4EO5 B;  3UTA B;  2PYO D;  1P3L D;  4NFT A;  5B0Y A;  4DQY B;  3LJA D;  5AY8 A;  3AZH A;  3AYW C;  1P3I A;  5AV9 D;  5BNV A;  4WU9 D;  3REL A;  2NZD D;  4XUJ A;  3F6T A;  3LZ0 B;  3AZG B;  2BYM A;  4YM6 D;  4H9R A;  3B0C T;  5B2J B;  5CPK C;  1N1J A;  4J8W D;  1P3G C;  5GT0 B;  3KXB A;  3AV2 A;  1P3M B;  3LEL D;  5BS7 C;  1KX4 C;  1P3A C;  1P34 A;  5AV5 C;  1M1A D;  4H9S A;  1P3B A;  3B6G A;  3W99 A;  3EPK A;  3AYW B;  3REH C;  3MNN D;  1JFI B;  1S32 D;  5B1L D;  5GSU C;  5CPK B;  1W2E A;  2J8P A;  4YS3 A;  1P3G B;  2FFF B;  5CP6 A;  3AZJ C;  3AZF A;  3KUY C;  1BH8 A;  3AZG D;  1KX4 B;  1P3A B;  5AV5 B;  3W97 C;  4J8U A;  5DNN A;  1EQZ A;  4KGC C;  3KSY A;  3A1K A;  1P3M D;  4JJN D;  1KX3 C;  3VH5 W;  3REH B;  2DF4 C;  3IP4 C;  5KDM B;  4XZQ C;  5B32 C;  2ZM5 A;  1P3K C;  5GSU B;  3UTA A;  3AYW D;  3AZJ B;  1TAF B;  3KUY B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...