4DRAA

Crystal structure of mhf complex
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
93
structure length
93
Chain Sequence
FSYQQRLKAAVHYTVGCLCEEVALDKEMQFSKQTIAAISELTFRQCENFAKDLEMFARHAKRTTINTEDVKLLARRSNSLLKYITDKSEEIAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords Centromere protein S
publication title The structure of the FANCM-MHF complex reveals physical features for functional assembly
pubmed doi rcsb
source organism Homo sapiens
total genus 36
structure length 93
sequence length 93
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF15630 CENP-S CENP-S protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4draA00
1B6WA 3WKJB 5B2JC 4EO5C 5FUGB 3NQUA 4QLCD 5G49A 5JRGB 1P3AD 2NZDB 3B6FD 5B0YC 3W97D 5GT3A 3AZEA 5AV6D 4J8UA 2JSSA 4KUDA 1B67A 5CPIC 3WTPC 2IO5C 5DNMB 1F66B 2PYOC 1S32B 2BYMB 5B40B 3REKD 3REHB 3REIB 4H9PB 1BH8A 3MGSB 5B32A 3UT9A 3X1VA 3AV1A 3X1TA 4LD9B 1WWSA 5B1MC 2HIOC 3KUYA 3W96A 2F8ND 5B1LC 5B31D 3TU4D 1P3FD 1KX4A 1M1AA 4WV4B 4Z66B 2AROA 5E5AC 4CSRB 5KDMB 1P34D 3AZIC 4J8WD 5B0ZA 3AZKD 3AZFB 3LELC 3AV2B 4ZBJB 3AZGD 1ID3A 1HQ3B 3UTBA 5AVCC 5B2JA 5JA4B 3KXBD 1P3AB 5B0YA 4QLCB 5AY8C 4YM6C 3RELD 4Z2MH 5F99C 3REJD 3B6FB 3KWQC 3W97B 1M19C 5AV6B 4WNNA 4E45A 1P3OC 3AN2D 4H9RB 5CPIA 1KX5D 5CPKA 3WTPA 2BYKA 4XZQC 2PYOA 5BS7C 1P3KD 4J8XA 3MGQD 3W98C 3REKB 5CP6D 3NQJA 4UUZA 4XUJC 4ZUXA 3WA9A 4KHAA 2HIOA 5B1MA 4WU8D 4NE3A 4J8VC 5C3IB 3MGPC 3V9RB 5AV8A 2F8NB 5B31B 3TU4B 1P3FB 5BNVB 3B6GA 3AZHC 1TAFA 3AZIA 1P3MC 5B24D 3LELA 1P34B 4J8WB 4H9QB 3AZKB 3AZGB 3LJAC 5GSUD 3B0DC 5AVCA 4X23A 3AZMC 3MGRD 1BH9A 3KXBB 3MNND 3O62C 5AY8A 4YM6A 3AYWD 5GXQC 5F99A 3KWQA 3RELB 1M19A 3REJB 1M18C 1P3BC 3WAAC 5BNXB 4XZQA 3AN2B 5BS7A 4H9OA 1P3KB 3W98A 2CV5C 1H3OB 3MGQB 4WU9D 4AWLB 4XUJA 5GT0C 5CP6B 2FJ7D 2LY8A 4J8VA 2F8NG 4WU8B 3W99D 3AFAD 3AZLC 3MGPA 1KU5A 4NE6A 4J8UC 3B0CT 4H9NB 3AZHA 5DNMD 1KX3B 3WKJC 4Z5TA 5B24B 2NZDC 3AZMA 4DRBA 5GSUB 1ZLAD 3R45A 3MGRB 3UT9C 3X1VC 3LZ0C 1EQZA 3O62A 3A6ND 3AV1C 4KUDD 3MNNB 5B33B 5AVBC 3W96C 3AYWB 5B40C 5B2IB 3REIC 3WAAA 1M1AC 3X1TD 3AZJC 3KUYD 2HUEB 2CV5A 1ID3C 5GT0A 3UTBC 4WU9B 3MVDD 2FJ7B 5BT1D 1U35D 3X1UD 1P3GA 5B0ZD 3AZLA 2RVQC 3AFAB 3W99B 3WKJA 5CPKC 5FUGA 2NZDA 4J8XC 4QLCC 5BO0B 3VH6T 5GT3B 3AZEB 1ZLAB 3LZ0A 1N1JB 4ZUXC 3WA9C 1AOID 4KUDB 5AVBA 3A6NB 1P3IC 2BYMA 5B40A 3REIA 4YS3C 5AV9C 5AV8C 1BFMA 3UTAD 4H9SC 3B6GC 3AZJA 5B1MD 2HIOD 3X1TB 4R8PD 3KUYB 5B1LD 1A7WA 4X23C 1P3LC 5B31C 1P3FC 5E5AD 2YFVB 4CSRA 4DRAA 5KDMA 3MVDB 3AZID 2AROB 4HGAB 1U35B 3X1UB 5B0ZB 4J8WC 1HQ3A 4G91C 4Z2MG 5JA4A 5CPJC 3VH6A 5B2JB 4EO5B 2NQBD 1P3AA 4QLCA 4KGCD 1R4VA 1M19D 3REJC 5AV6A 1P3OD 4JJND 4XZQD 5AV5D 1P3IA 3AN2C 1AOIB 1KX5C 2IO5B 2PYOB 4YS3A 1P3KC 5AV9A 3C1CD 3REKA 5B32G 4H9SA 5DNND 1KX3D 4AWLC 3UTAB 4UUZB 2CWEA 5CP6C 4Z5TC 4J8VD 5B1MB 2HIOB 4WU8C 4R8PB 3MGPD 5B1LB 2F8NA 1P3LA 5B31A 3TU4A 1P3FA 1P3PC 1P3MD 5B33D 5E5AB 1EQZC 1JFIA 3AZIB 1TAFB 1P34A 4J8WA 3AZKA 5B24C 3LJAD 3AZGA 5B2ID 4G92B 3AZMD 5AVCB 5CPJA 1TZYD 5GXQD 3X1SD 3LZ1D 2NQBB 5F99B 1M18D 4KGCB 3REJA 4CAYB 3C1BD 1M19B 1P3BD 1F1EA 1P3OB 3AZND 3AN2A 1KX5A 4JJNB 1P3GC 4XZQB 5AV5B 2HUEC 1P3KA 1H3OA 3C1CB 5CP6A 5DNNB 2FJ7C 4WU8A 5JRGC 4J8VB 5GT3D 3W99C 3AFAC 3AZED 3MGPB 1P3PA 4J8UD 4H9NA 1P3MB 5B24A 2F8NH 5DNMC 1F66C 1S32C 3LJAB 3REHC 3AZMB 5B32D 3MGSC 3MGRA 3UT9D 2YFWB 3X1VD 1ZLAC 3AV1D 1TZYB 4LD9C 5AVBD 3W96D 5GXQB 3X1SB 3AYWA 3KSYA 3LZ1B 1KX4D 1M18B 1M1AD 3C1BB 1P3BB 2AROD 4Z66C 3AZNB 3AZJD 3AZFC 3AV2C 4ZBJC 1ID3D 1HQ3C 3UTBD 4WZSB 5B2JD 2FJ7A 3WTPE 5JRGA 5B0YD 3NQUB 5BT1C 5G49B 3X1UC 3AZLB 1P3AC 3AFAA 3W99A 3B6FC 3W97C 5AV6C 4J8UB 5CPID 5CPKD 3WTPD 5DNMA 1F66A 2PYOD 3VH5W 1S32A 4J8XD 3REHA 5BO0A 4H9PA 3REKC 3MGSA 1ZLAA 1BH8B 4ZUXD 5B32B 3UT9B 1N1JA 3LZ0B 3X1VB 3WA9D 4LD9A 3AV1B 3A6NA 1P3ID 5AVBB 1AOIC 3W96B 4YS3D 5C3IC 5AV8D 5AV9D 1KX4B 3TU4C 4Z66A 1M1AB 3B6GD 3UTAC 3LELD 3AZFA 3AV2A 1P34C 3AZJB 3AZKC 3AZGC 1ID3B 4R8PC 4X23D 3B0BA 5AVCD 3VH5T 1P3LD 3UTBB 2YFVA 3MVDA 3KXBC 5AY8D 4YM6D 3X1UA 1U35A 5F99D 3KWQD 5B0YB 3B6FA 3W97A 3RELC 4G92C 4H9RA 5CPJD 4WNNB 5CPIB 5CPKB 3WTPB 2BYKB 4J8XB 3W98D 2NQBC 4NE5A 4KGCC 3MGQC 4XUJD 3NQJB 4ZUXB 3WA9B 4KHAB 5CHLB 1AOIA 4JJNC 1P3IB 5AV5C 3V9RA 1Q9CA 4M6BA 4YS3B 5BNVA 5AV8B 5AV9B 3C1CC 4NFTA 3AZHD 3UTAA 5DNNC 3VH5A 1HTAA 1KX3C 4Z5TD 3B6GB 4H9QA 3LELB 4R8PA 5B1LA 4X23B 5GSUC 1P3PD 1P3LB 3MGRC 3KXBA 3O62D 1EQZD 5E5AA 1BH9B 3MNNC 5B33C 1JFIB 5AY8B 4YM6B 3AYWC 3RELA 4G91B 3KWQB 5B2IC 3WAAD 5BNXA 5CPJB 2F8NK 1TZYC 2CV5D 2NQBA 3X1SC 4H9OB 4KGCA 3LZ1C 3MGQA 3W98B 3B0CW 4CAYA 5GT0D 3VH6W 4WU9C 4XUJB 1P3OA 3C1BC 1P3GD 4JJNA 3AZLD 3AZNC 5AV5A 1KX5B 3C1CA 5DNNA 3WKJD 1KX3A 3AZHB 2NZDD 4Z5TB 5JRGD 5B31G 3B0DB 2L5AA 5GSUA 5GT3C 3LZ0D 3AZEC 1P3PB 3R45B 1WWIA 1P3MA 1EQZB 3MNNA 5B33A 3O62B 3A6NC 1F66D 4KUDC 1S32D 5B40D 3LJAA 3REHD 5B2IA 3REID 3MGSD 2YFWA 3WAAB 4LD9D 1TZYA 5B32C 3X1TC 3X1SA 5GXQA 3LZ1A 3KUYC 2CV5B 1M18A 4WU9A 3C1BA 1ULYA 5GT0B 1KX4C 4Z66D 1P3BA 4E44A 3MVDC 3AZNA 3AZFD 3AV2D 2AROC 1P3GB 2RVQD 4HGAC 1U35C 5B0ZC 1HQ3D
chains in the Genus database with same CATH superfamily
1B6WA 3WKJB 5B2JC 4EO5C 5FUGB 3NQUA 4QLCD 5G49A 5JRGB 1P3AD 2NZDB 3B6FD 5B0YC 3W97D 5GT3A 3AZEA 5AV6D 4J8UA 2JSSA 4KUDA 1B67A 5CPIC 3WTPC 2IO5C 5DNMB 1F66B 2PYOC 1S32B 2BYMB 5B40B 3REKD 3REHB 3REIB 4H9PB 1BH8A 3MGSB 5B32A 3UT9A 3X1VA 3AV1A 3X1TA 2BG1A 4LD9B 1WWSA 5B1MC 2HIOC 3KUYA 3W96A 2F8ND 5B1LC 5B31D 3TU4D 1P3FD 1KX4A 2JE5A 1M1AA 4WV4B 4Z66B 2AROA 5E5AC 4CSRB 5KDMB 1P34D 3AZIC 4J8WD 5B0ZA 3AZKD 3AZFB 3LELC 3AV2B 4ZBJB 3AZGD 2ZY4A 1ID3A 1HQ3B 3UTBA 5AVCC 2Y2JA 5B2JA 5JA4B 3KXBD 1P3AB 5B0YA 4QLCB 5AY8C 4YM6C 3RELD 4Z2MH 5F99C 3REJD 3B6FB 3KWQC 3W97B 1M19C 5AV6B 4WNNA 4E45A 1P3OC 3AN2D 2JCHA 4H9RB 5CPIA 1KX5D 5CPKA 3WTPA 2BYKA 4XZQC 2PYOA 5BS7C 1P3KD 4J8XA 3MGQD 3W98C 3REKB 5CP6D 2Y2LA 3NQJA 4UUZA 4XUJC 2Y2QA 4ZUXA 3WA9A 4KHAA 2HIOA 5B1MA 4WU8D 4NE3A 4J8VC 3P5JB 5C3IB 3MGPC 3AL0C 3V9RB 5AV8A 2F8NB 5B31B 3TU4B 1P3FB 5BNVB 3B6GA 3AZHC 1TAFA 3AZIA 1P3MC 5B24D 3LELA 1P34B 4J8WB 4H9QB 3AZKB 4DQYB 3AZGB 3LJAC 5GSUD 3B0DC 5AVCA 4X23A 3AZMC 3MGRD 1BH9A 3KXBB 3MNND 3O62C 5AY8A 4YM6A 3AYWD 5GXQC 5F99A 3KWQA 3RELB 1M19A 3REJB 1M18C 1P3BC 3WAAC 5BNXB 3A1KA 4XZQA 3AN2B 5BS7A 4H9OA 1P3KB 3W98A 2CV5C 2DF4C 1H3OB 3MGQB 4WU9D 4AWLB 4XUJA 5GT0C 5CP6B 2FJ7D 2LY8A 4J8VA 2F8NG 4WU8B 3W99D 3AFAD 3AZLC 3MGPA 4LD9A 1KU5A 4NE6A 4J8UC 3B0CT 4H9NB 3AZHA 5DNMD 1KX3B 3WKJC 2XD1A 4Z5TA 4WJ3C 5B24B 2NZDC 3AZMA 4DRBA 5GSUB 1ZLAD 3R45A 3MGRB 3UT9C 3X1VC 3LZ0C 1EQZA 3O62A 3A6ND 3AV1C 4KUDD 3MNNB 5B33B 5AVBC 3W96C 3AYWB 5B40C 5B2IB 3REIC 3WAAA 1M1AC 3X1TD 3AZJC 3KUYD 2HUEB 2CV5A 1ID3C 5GT0A 3UTBC 4WU9B 4UPKA 3MVDD 2Y2HA 2FJ7B 5BT1D 1U35D 3X1UD 1P3GA 5B0ZD 3AZLA 2RVQC 3AFAB 3W99B 1PZRA 3WKJA 5CPKC 1Z2CB 5FUGA 2NZDA 4J8XC 4QLCC 3KFUG 5BO0B 3VH6T 5GT3B 3AZEB 1ZLAB 3LZ0A 1N1JB 2FFFB 4ZUXC 3WA9C 1AOID 4KUDB 5AVBA 3A6NB 1P3IC 2BYMA 2W8SA 5B40A 3REIA 4YS3C 5AV9C 5AV8C 1BFMA 3UTAD 4H9SC 3B6GC 3AZJA 5B1MD 2HIOD 3X1TB 4R8PD 3KUYB 5B1LD 1A7WA 4X23C 3IP4C 1P3LC 5B31C 1P3FC 5E5AD 2YFVB 4CSRA 4DRAA 5KDMA 3MVDB 5B0ZC 2AROB 3AZID 4HGAB 1U35B 3X1UB 5B0ZB 4J8WC 1HQ3A 4G91C 4Z2MG 5JA4A 3EPJA 3VH6A 5CPJC 5B2JB 2Y2NA 4EO5B 2NQBD 1P3AA 4QLCA 4KGCD 1R4VA 1M19D 3REJC 5AV6A 1P3OD 4JJND 4XZQD 5AV5D 1P3IA 3AN2C 1AOIB 1KX5C 2IO5B 2PYOB 4YS3A 1P3KC 5AV9A 3C1CD 3REKA 5B32G 4H9SA 5DNND 1KX3D 4AWLC 3UTAB 4UUZB 2CWEA 5CP6C 4Z5TC 4J8VD 5B1MB 2HIOB 4WU8C 4R8PB 3MGPD 5B1LB 2F8NA 1P3LA 5B31A 3TU4A 1P3FA 1P3PC 1P3MD 5B33D 5E5AB 1EQZC 1JFIA 3AZIB 1TAFB 1P34A 3A1IA 4J8WA 3AZKA 5B24C 3LJAD 3AZGA 5B2ID 3EPLA 4G92B 3AZMD 5AVCB 5CPJA 1TZYD 5GXQD 3X1SD 3LZ1D 2NQBB 5F99B 1M18D 2ZY2A 4KGCB 3REJA 4CAYB 3C1BD 1M19B 1P3BD 1F1EA 1P3OB 2Y2IA 3AZND 3AN2A 1KX5A 4JJNB 1P3GC 4XZQB 5AV5B 2HUEC 1P3KA 1H3OA 3C1CB 2ZY5A 5CP6A 5DNNB 2FJ7C 2G5HC 4WU8A 5JRGC 4J8VB 5GT3D 3W99C 3AFAC 3AZED 3MGPB 1P3PA 4J8UD 1T3UA 4H9NA 1P3MB 5B24A 2F8NH 5DNMC 1F66C 1S32C 2DQNC 2J8PA 3LJAB 3FDDA 3REHC 3AZMB 5B32D 3MGSC 3MGRA 3UT9D 2YFWB 3X1VD 1ZLAC 3AV1D 1TZYB 4LD9C 5AVBD 3W96D 1W2EA 5GXQB 3X1SB 3AYWA 3KSYA 3LZ1B 1KX4D 1M18B 1M1AD 3C1BB 1P3BB 2AROD 4Z66C 3AZNB 3AZJD 3AZFC 3AV2C 4ZBJC 1ID3D 1HQ3C 3UTBD 4WZSB 5B2JD 2FJ7A 3WTPE 5JRGA 5B0YD 3NQUB 5BT1C 5G49B 3X1UC 3AZLB 1P3AC 3AFAA 3W99A 3B6FC 2XD5A 3W97C 5AV6C 4J8UB 5CPID 5CPKD 3WTPD 5DNMA 1F66A 2PYOD 3VH5W 1S32A 4J8XD 3REHA 5BO0A 4H9PA 3REKC 3MGSA 1ZLAA 1BH8B 4ZUXD 3H0RC 5B32B 1N1JA 3H0LC 3LZ0B 3UT9B 3X1VB 3AV1B 3A6NA 3WA9D 1P3ID 5AVBB 1AOIC 3W96B 4YS3D 5C3IC 5AV8D 5AV9D 3EPKA 1KX4B 2Y2MA 3TU4C 4Z66A 1M1AB 3B6GD 3UTAC 3LELD 3AZFA 3AV2A 1P34C 3AZJB 2RIQA 3AZKC 3AZGC 1ID3B 4R8PC 4X23D 3B0BA 5AVCD 3VH5T 3EG5B 1P3LD 3UTBB 3EPHA 3F6TA 2YFVA 3MVDA 3KXBC 5AY8D 4YM6D 3X1UA 1U35A 5F99D 3KWQD 5B0YB 3B6FA 3W97A 3RELC 4G92C 4H9RA 5CPJD 4WNNB 5CPIB 2VQRA 5CPKB 3WTPB 2BYKB 4J8XB 3W98D 2NQBC 2Y2GA 4NE5A 4KGCC 3MGQC 4XUJD 3NQJB 4ZUXB 3WA9B 4KHAB 5CHLB 1AOIA 4JJNC 1P3IB 5AV5C 3V9RA 1Q9CA 4M6BA 4YS3B 5BNVA 5AV8B 5AV9B 3C1CC 4NFTA 3AZHD 3UTAA 5DNNC 3VH5A 1HTAA 1KX3C 4Z5TD 2ZM5A 3B6GB 4H9QA 3LELB 4R8PA 5B1LA 4X23B 5GSUC 1P3PD 1P3LB 3MGRC 2F2AC 3KXBA 3O62D 1EQZD 5E5AA 1BH9B 3MNNC 5B33C 1JFIB 5AY8B 4YM6B 3AYWC 3RELA 3H0MC 4G91B 3KWQB 2Y2PA 5B2IC 3WAAD 5BNXA 5CPJB 2F8NK 1TZYC 2CV5D 2NQBA 3X1SC 4H9OB 4KGCA 3LZ1C 3MGQA 3W98B 3B0CW 4CAYA 5GT0D 4WU9C 4XUJB 1P3OA 3C1BC 1P3GD 4JJNA 3AZLD 3AZNC 5AV5A 1KX5B 3C1CA 5DNNA 3WKJD 1KX3A 3AZHB 2NZDD 4Z5TB 5JRGD 5B31G 3B0DB 2L5AA 5GSUA 5GT3C 3LZ0D 3AZEC 1P3PB 3R45B 1WWIA 1P3MA 1EQZB 3MNNA 5B33A 3O62B 3A6NC 1F66D 4KUDC 1S32D 2G5IC 5B40D 3LJAA 3REHD 5B2IA 3REID 3MGSD 2Y2OA 2YFWA 3WAAB 4LD9D 1TZYA 5B32C 3X1TC 3X1SA 5GXQA 2Y2KA 3LZ1A 3KUYC 2CV5B 2ZY3A 1M18A 4WU9A 3C1BA 1ULYA 2UWXA 5GT0B 4Z66D 1P3BA 1KX4C 4E44A 3MVDC 3AZNA 3AZFD 3AV2D 2AROC 1P3GB 2RVQD 4HGAC 1U35C 3VH6W 1HQ3D
chains in the Genus database with same CATH topology
1B6WA 3WKJB 5B2JC 4EO5C 5FUGB 3NQUA 4QLCD 5G49A 5JRGB 1P3AD 2NZDB 3B6FD 5B0YC 3W97D 5GT3A 3AZEA 5AV6D 4J8UA 2JSSA 4KUDA 1B67A 5CPIC 3WTPC 2IO5C 5DNMB 1F66B 2PYOC 1S32B 2BYMB 5B40B 3REKD 3REHB 3REIB 4H9PB 1BH8A 3MGSB 5B32A 3UT9A 3X1VA 3AV1A 3X1TA 2BG1A 4LD9B 1WWSA 5B1MC 2HIOC 3KUYA 3W96A 2F8ND 5B1LC 5B31D 3TU4D 1P3FD 1KX4A 2JE5A 1M1AA 4WV4B 4Z66B 2AROA 5E5AC 4CSRB 5KDMB 1P34D 3AZIC 4J8WD 5B0ZA 3AZKD 3AZFB 3LELC 3AV2B 4ZBJB 3AZGD 2ZY4A 1ID3A 1HQ3B 3UTBA 5AVCC 2Y2JA 5B2JA 5JA4B 3KXBD 1P3AB 5B0YA 4QLCB 5AY8C 4YM6C 3RELD 4Z2MH 5F99C 3REJD 3B6FB 3KWQC 3W97B 1M19C 5AV6B 4WNNA 4E45A 1P3OC 3AN2D 2JCHA 4H9RB 5CPIA 1KX5D 5CPKA 3WTPA 2BYKA 4XZQC 2PYOA 5BS7C 1P3KD 4J8XA 3MGQD 3W98C 3REKB 5CP6D 2Y2LA 3NQJA 4UUZA 4XUJC 2Y2QA 4ZUXA 3WA9A 4KHAA 2HIOA 5B1MA 4WU8D 4NE3A 4J8VC 3P5JB 5C3IB 3MGPC 3AL0C 3V9RB 5AV8A 2F8NB 5B31B 3TU4B 1P3FB 5BNVB 3B6GA 3AZHC 1TAFA 3AZIA 1P3MC 5B24D 3LELA 1P34B 4J8WB 4H9QB 3AZKB 4DQYB 3AZGB 3LJAC 5GSUD 3B0DC 5AVCA 4X23A 3AZMC 3MGRD 1BH9A 3KXBB 3MNND 3O62C 5AY8A 4YM6A 3AYWD 5GXQC 5F99A 3KWQA 3RELB 1M19A 3REJB 1M18C 1P3BC 3WAAC 5BNXB 3A1KA 4XZQA 3AN2B 5BS7A 4H9OA 1P3KB 3W98A 2CV5C 2DF4C 1H3OB 3MGQB 4WU9D 4AWLB 4XUJA 5GT0C 5CP6B 2FJ7D 2LY8A 4J8VA 2F8NG 4WU8B 3W99D 3AFAD 3AZLC 3MGPA 4LD9A 1KU5A 4NE6A 4J8UC 3B0CT 4H9NB 3AZHA 5DNMD 1KX3B 3WKJC 2XD1A 4Z5TA 4WJ3C 5B24B 2NZDC 3AZMA 4DRBA 5GSUB 1ZLAD 3R45A 3MGRB 3UT9C 3X1VC 3LZ0C 1EQZA 3O62A 3A6ND 3AV1C 4KUDD 3MNNB 5B33B 5AVBC 3W96C 3AYWB 5B40C 5B2IB 3REIC 3WAAA 1M1AC 3X1TD 3AZJC 3KUYD 2HUEB 2CV5A 1ID3C 5GT0A 3UTBC 4WU9B 4UPKA 3MVDD 2Y2HA 2FJ7B 5BT1D 1U35D 3X1UD 1P3GA 5B0ZD 3AZLA 2RVQC 3AFAB 3W99B 1PZRA 3WKJA 5CPKC 1Z2CB 5FUGA 2NZDA 4J8XC 4QLCC 3KFUG 5BO0B 3VH6T 5GT3B 3AZEB 1ZLAB 3LZ0A 1N1JB 2FFFB 4ZUXC 3WA9C 1AOID 4KUDB 5AVBA 3A6NB 1P3IC 2BYMA 2W8SA 5B40A 3REIA 4YS3C 5AV9C 5AV8C 1BFMA 3UTAD 4H9SC 3B6GC 3AZJA 5B1MD 2HIOD 3X1TB 4R8PD 3KUYB 5B1LD 1A7WA 4X23C 3IP4C 1P3LC 5B31C 1P3FC 5E5AD 2YFVB 4CSRA 4DRAA 5KDMA 3MVDB 5B0ZC 2AROB 3AZID 4HGAB 1U35B 3X1UB 5B0ZB 4J8WC 1HQ3A 4G91C 4Z2MG 5JA4A 3EPJA 3VH6A 5CPJC 5B2JB 2Y2NA 4EO5B 2NQBD 1P3AA 4QLCA 4KGCD 1R4VA 1M19D 3REJC 5AV6A 1P3OD 4JJND 4XZQD 5AV5D 1P3IA 3AN2C 1AOIB 1KX5C 2IO5B 2PYOB 4YS3A 1P3KC 5AV9A 3C1CD 3REKA 5B32G 4H9SA 5DNND 1KX3D 4AWLC 3UTAB 4UUZB 2CWEA 5CP6C 4Z5TC 4J8VD 5B1MB 2HIOB 4WU8C 4R8PB 3MGPD 5B1LB 2F8NA 1P3LA 5B31A 3TU4A 1P3FA 1P3PC 1P3MD 5B33D 5E5AB 1EQZC 1JFIA 3AZIB 1TAFB 1P34A 3A1IA 4J8WA 3AZKA 5B24C 3LJAD 3AZGA 5B2ID 3EPLA 4G92B 3AZMD 5AVCB 5CPJA 1TZYD 5GXQD 3X1SD 3LZ1D 2NQBB 5F99B 1M18D 2ZY2A 4KGCB 3REJA 4CAYB 3C1BD 1M19B 1P3BD 1F1EA 1P3OB 2Y2IA 3AZND 3AN2A 1KX5A 4JJNB 1P3GC 4XZQB 5AV5B 2HUEC 1P3KA 1H3OA 3C1CB 2ZY5A 5CP6A 5DNNB 2FJ7C 2G5HC 4WU8A 5JRGC 4J8VB 5GT3D 3W99C 3AFAC 3AZED 3MGPB 1P3PA 4J8UD 1T3UA 4H9NA 1P3MB 5B24A 2F8NH 5DNMC 1F66C 1S32C 2DQNC 2J8PA 3LJAB 3FDDA 3REHC 3AZMB 5B32D 3MGSC 3MGRA 3UT9D 2YFWB 3X1VD 1ZLAC 3AV1D 1TZYB 4LD9C 5AVBD 3W96D 1W2EA 5GXQB 3X1SB 3AYWA 3KSYA 3LZ1B 1KX4D 1M18B 1M1AD 3C1BB 1P3BB 2AROD 4Z66C 3AZNB 3AZJD 3AZFC 3AV2C 4ZBJC 1ID3D 1HQ3C 3UTBD 4WZSB 5B2JD 2FJ7A 3WTPE 5JRGA 5B0YD 3NQUB 5BT1C 5G49B 3X1UC 3AZLB 1P3AC 3AFAA 3W99A 3B6FC 2XD5A 3W97C 5AV6C 4J8UB 5CPID 5CPKD 3WTPD 5DNMA 1F66A 2PYOD 3VH5W 1S32A 4J8XD 3REHA 5BO0A 4H9PA 3REKC 3MGSA 1ZLAA 1BH8B 4ZUXD 3H0RC 5B32B 1N1JA 3H0LC 3LZ0B 3UT9B 3X1VB 3AV1B 3A6NA 3WA9D 1P3ID 5AVBB 1AOIC 3W96B 4YS3D 5C3IC 5AV8D 5AV9D 3EPKA 1KX4B 2Y2MA 3TU4C 4Z66A 1M1AB 3B6GD 3UTAC 3LELD 3AZFA 3AV2A 1P34C 3AZJB 2RIQA 3AZKC 3AZGC 1ID3B 4R8PC 4X23D 3B0BA 5AVCD 3VH5T 3EG5B 1P3LD 3UTBB 3EPHA 3F6TA 2YFVA 3MVDA 3KXBC 5AY8D 4YM6D 3X1UA 1U35A 5F99D 3KWQD 5B0YB 3B6FA 3W97A 3RELC 4G92C 4H9RA 5CPJD 4WNNB 5CPIB 2VQRA 5CPKB 3WTPB 2BYKB 4J8XB 3W98D 2NQBC 2Y2GA 4NE5A 4KGCC 3MGQC 4XUJD 3NQJB 4ZUXB 3WA9B 4KHAB 5CHLB 1AOIA 4JJNC 1P3IB 5AV5C 3V9RA 1Q9CA 4M6BA 4YS3B 5BNVA 5AV8B 5AV9B 3C1CC 4NFTA 3AZHD 3UTAA 5DNNC 3VH5A 1HTAA 1KX3C 4Z5TD 2ZM5A 3B6GB 4H9QA 3LELB 4R8PA 5B1LA 4X23B 5GSUC 1P3PD 1P3LB 3MGRC 2F2AC 3KXBA 3O62D 1EQZD 5E5AA 1BH9B 3MNNC 5B33C 1JFIB 5AY8B 4YM6B 3AYWC 3RELA 3H0MC 4G91B 3KWQB 2Y2PA 5B2IC 3WAAD 5BNXA 5CPJB 2F8NK 1TZYC 2CV5D 2NQBA 3X1SC 4H9OB 4KGCA 3LZ1C 3MGQA 3W98B 3B0CW 4CAYA 5GT0D 4WU9C 4XUJB 1P3OA 3C1BC 1P3GD 4JJNA 3AZLD 3AZNC 5AV5A 1KX5B 3C1CA 5DNNA 3WKJD 1KX3A 3AZHB 2NZDD 4Z5TB 5JRGD 5B31G 3B0DB 2L5AA 5GSUA 5GT3C 3LZ0D 3AZEC 1P3PB 3R45B 1WWIA 1P3MA 1EQZB 3MNNA 5B33A 3O62B 3A6NC 1F66D 4KUDC 1S32D 2G5IC 5B40D 3LJAA 3REHD 5B2IA 3REID 3MGSD 2Y2OA 2YFWA 3WAAB 4LD9D 1TZYA 5B32C 3X1TC 3X1SA 5GXQA 2Y2KA 3LZ1A 3KUYC 2CV5B 2ZY3A 1M18A 4WU9A 3C1BA 1ULYA 2UWXA 5GT0B 4Z66D 1P3BA 1KX4C 4E44A 3MVDC 3AZNA 3AZFD 3AV2D 2AROC 1P3GB 2RVQD 4HGAC 1U35C 3VH6W 1HQ3D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1B6W A;  3WKJ B;  5B2J C;  4EO5 C;  5FUG B;  3NQU A;  4QLC D;  5G49 A;  5JRG B;  1P3A D;  2NZD B;  3B6F D;  5B0Y C;  3W97 D;  5GT3 A;  3AZE A;  5AV6 D;  4J8U A;  2JSS A;  4KUD A;  1B67 A;  5CPI C;  3WTP C;  2IO5 C;  5DNM B;  1F66 B;  2PYO C;  1S32 B;  2BYM B;  5B40 B;  3REK D;  3REH B;  3REI B;  4H9P B;  1BH8 A;  3MGS B;  5B32 A;  3UT9 A;  3X1V A;  3AV1 A;  3X1T A;  4LD9 B;  1WWS A;  5B1M C;  2HIO C;  3KUY A;  3W96 A;  2F8N D;  5B1L C;  5B31 D;  3TU4 D;  1P3F D;  1KX4 A;  1M1A A;  4WV4 B;  4Z66 B;  2ARO A;  5E5A C;  4CSR B;  5KDM B;  1P34 D;  3AZI C;  4J8W D;  5B0Z A;  3AZK D;  3AZF B;  3LEL C;  3AV2 B;  4ZBJ B;  3AZG D;  1ID3 A;  1HQ3 B;  3UTB A;  5AVC C;  5B2J A;  5JA4 B;  3KXB D;  1P3A B;  5B0Y A;  4QLC B;  5AY8 C;  4YM6 C;  3REL D;  4Z2M H;  5F99 C;  3REJ D;  3B6F B;  3KWQ C;  3W97 B;  1M19 C;  5AV6 B;  4WNN A;  4E45 A;  1P3O C;  3AN2 D;  4H9R B;  5CPI A;  1KX5 D;  5CPK A;  3WTP A;  2BYK A;  4XZQ C;  2PYO A;  5BS7 C;  1P3K D;  4J8X A;  3MGQ D;  3W98 C;  3REK B;  5CP6 D;  3NQJ A;  4UUZ A;  4XUJ C;  4ZUX A;  3WA9 A;  4KHA A;  2HIO A;  5B1M A;  4WU8 D;  4NE3 A;  4J8V C;  5C3I B;  3MGP C;  3V9R B;  5AV8 A;  2F8N B;  5B31 B;  3TU4 B;  1P3F B;  5BNV B;  3B6G A;  3AZH C;  1TAF A;  3AZI A;  1P3M C;  5B24 D;  3LEL A;  1P34 B;  4J8W B;  4H9Q B;  3AZK B;  3AZG B;  3LJA C;  5GSU D;  3B0D C;  5AVC A;  4X23 A;  3AZM C;  3MGR D;  1BH9 A;  3KXB B;  3MNN D;  3O62 C;  5AY8 A;  4YM6 A;  3AYW D;  5GXQ C;  5F99 A;  3KWQ A;  3REL B;  1M19 A;  3REJ B;  1M18 C;  1P3B C;  3WAA C;  5BNX B;  4XZQ A;  3AN2 B;  5BS7 A;  4H9O A;  1P3K B;  3W98 A;  2CV5 C;  1H3O B;  3MGQ B;  4WU9 D;  4AWL B;  4XUJ A;  5GT0 C;  5CP6 B;  2FJ7 D;  2LY8 A;  4J8V A;  2F8N G;  4WU8 B;  3W99 D;  3AFA D;  3AZL C;  3MGP A;  1KU5 A;  4NE6 A;  4J8U C;  3B0C T;  4H9N B;  3AZH A;  5DNM D;  1KX3 B;  3WKJ C;  4Z5T A;  5B24 B;  2NZD C;  3AZM A;  4DRB A;  5GSU B;  1ZLA D;  3R45 A;  3MGR B;  3UT9 C;  3X1V C;  3LZ0 C;  1EQZ A;  3O62 A;  3A6N D;  3AV1 C;  4KUD D;  3MNN B;  5B33 B;  5AVB C;  3W96 C;  3AYW B;  5B40 C;  5B2I B;  3REI C;  3WAA A;  1M1A C;  3X1T D;  3AZJ C;  3KUY D;  2HUE B;  2CV5 A;  1ID3 C;  5GT0 A;  3UTB C;  4WU9 B;  3MVD D;  2FJ7 B;  5BT1 D;  1U35 D;  3X1U D;  1P3G A;  5B0Z D;  3AZL A;  2RVQ C;  3AFA B;  3W99 B;  3WKJ A;  5CPK C;  5FUG A;  2NZD A;  4J8X C;  4QLC C;  5BO0 B;  3VH6 T;  5GT3 B;  3AZE B;  1ZLA B;  3LZ0 A;  1N1J B;  4ZUX C;  3WA9 C;  1AOI D;  4KUD B;  5AVB A;  3A6N B;  1P3I C;  2BYM A;  5B40 A;  3REI A;  4YS3 C;  5AV9 C;  5AV8 C;  1BFM A;  3UTA D;  4H9S C;  3B6G C;  3AZJ A;  5B1M D;  2HIO D;  3X1T B;  4R8P D;  3KUY B;  5B1L D;  1A7W A;  4X23 C;  1P3L C;  5B31 C;  1P3F C;  5E5A D;  2YFV B;  4CSR A;  4DRA A;  5KDM A;  3MVD B;  3AZI D;  2ARO B;  4HGA B;  1U35 B;  3X1U B;  5B0Z B;  4J8W C;  1HQ3 A;  4G91 C;  4Z2M G;  5JA4 A;  5CPJ C;  3VH6 A;  5B2J B;  4EO5 B;  2NQB D;  1P3A A;  4QLC A;  4KGC D;  1R4V A;  1M19 D;  3REJ C;  5AV6 A;  1P3O D;  4JJN D;  4XZQ D;  5AV5 D;  1P3I A;  3AN2 C;  1AOI B;  1KX5 C;  2IO5 B;  2PYO B;  4YS3 A;  1P3K C;  5AV9 A;  3C1C D;  3REK A;  5B32 G;  4H9S A;  5DNN D;  1KX3 D;  4AWL C;  3UTA B;  4UUZ B;  2CWE A;  5CP6 C;  4Z5T C;  4J8V D;  5B1M B;  2HIO B;  4WU8 C;  4R8P B;  3MGP D;  5B1L B;  2F8N A;  1P3L A;  5B31 A;  3TU4 A;  1P3F A;  1P3P C;  1P3M D;  5B33 D;  5E5A B;  1EQZ C;  1JFI A;  3AZI B;  1TAF B;  1P34 A;  4J8W A;  3AZK A;  5B24 C;  3LJA D;  3AZG A;  5B2I D;  4G92 B;  3AZM D;  5AVC B;  5CPJ A;  1TZY D;  5GXQ D;  3X1S D;  3LZ1 D;  2NQB B;  5F99 B;  1M18 D;  4KGC B;  3REJ A;  4CAY B;  3C1B D;  1M19 B;  1P3B D;  1F1E A;  1P3O B;  3AZN D;  3AN2 A;  1KX5 A;  4JJN B;  1P3G C;  4XZQ B;  5AV5 B;  2HUE C;  1P3K A;  1H3O A;  3C1C B;  5CP6 A;  5DNN B;  2FJ7 C;  4WU8 A;  5JRG C;  4J8V B;  5GT3 D;  3W99 C;  3AFA C;  3AZE D;  3MGP B;  1P3P A;  4J8U D;  4H9N A;  1P3M B;  5B24 A;  2F8N H;  5DNM C;  1F66 C;  1S32 C;  3LJA B;  3REH C;  3AZM B;  5B32 D;  3MGS C;  3MGR A;  3UT9 D;  2YFW B;  3X1V D;  1ZLA C;  3AV1 D;  1TZY B;  4LD9 C;  5AVB D;  3W96 D;  5GXQ B;  3X1S B;  3AYW A;  3KSY A;  3LZ1 B;  1KX4 D;  1M18 B;  1M1A D;  3C1B B;  1P3B B;  2ARO D;  4Z66 C;  3AZN B;  3AZJ D;  3AZF C;  3AV2 C;  4ZBJ C;  1ID3 D;  1HQ3 C;  3UTB D;  4WZS B;  5B2J D;  2FJ7 A;  3WTP E;  5JRG A;  5B0Y D;  3NQU B;  5BT1 C;  5G49 B;  3X1U C;  3AZL B;  1P3A C;  3AFA A;  3W99 A;  3B6F C;  3W97 C;  5AV6 C;  4J8U B;  5CPI D;  5CPK D;  3WTP D;  5DNM A;  1F66 A;  2PYO D;  3VH5 W;  1S32 A;  4J8X D;  3REH A;  5BO0 A;  4H9P A;  3REK C;  3MGS A;  1ZLA A;  1BH8 B;  4ZUX D;  5B32 B;  3UT9 B;  1N1J A;  3LZ0 B;  3X1V B;  3WA9 D;  4LD9 A;  3AV1 B;  3A6N A;  1P3I D;  5AVB B;  1AOI C;  3W96 B;  4YS3 D;  5C3I C;  5AV8 D;  5AV9 D;  1KX4 B;  3TU4 C;  4Z66 A;  1M1A B;  3B6G D;  3UTA C;  3LEL D;  3AZF A;  3AV2 A;  1P34 C;  3AZJ B;  3AZK C;  3AZG C;  1ID3 B;  4R8P C;  4X23 D;  3B0B A;  5AVC D;  3VH5 T;  1P3L D;  3UTB B;  2YFV A;  3MVD A;  3KXB C;  5AY8 D;  4YM6 D;  3X1U A;  1U35 A;  5F99 D;  3KWQ D;  5B0Y B;  3B6F A;  3W97 A;  3REL C;  4G92 C;  4H9R A;  5CPJ D;  4WNN B;  5CPI B;  5CPK B;  3WTP B;  2BYK B;  4J8X B;  3W98 D;  2NQB C;  4NE5 A;  4KGC C;  3MGQ C;  4XUJ D;  3NQJ B;  4ZUX B;  3WA9 B;  4KHA B;  5CHL B;  1AOI A;  4JJN C;  1P3I B;  5AV5 C;  3V9R A;  1Q9C A;  4M6B A;  4YS3 B;  5BNV A;  5AV8 B;  5AV9 B;  3C1C C;  4NFT A;  3AZH D;  3UTA A;  5DNN C;  3VH5 A;  1HTA A;  1KX3 C;  4Z5T D;  3B6G B;  4H9Q A;  3LEL B;  4R8P A;  5B1L A;  4X23 B;  5GSU C;  1P3P D;  1P3L B;  3MGR C;  3KXB A;  3O62 D;  1EQZ D;  5E5A A;  1BH9 B;  3MNN C;  5B33 C;  1JFI B;  5AY8 B;  4YM6 B;  3AYW C;  3REL A;  4G91 B;  3KWQ B;  5B2I C;  3WAA D;  5BNX A;  5CPJ B;  2F8N K;  1TZY C;  2CV5 D;  2NQB A;  3X1S C;  4H9O B;  4KGC A;  3LZ1 C;  3MGQ A;  3W98 B;  3B0C W;  4CAY A;  5GT0 D;  3VH6 W;  4WU9 C;  4XUJ B;  1P3O A;  3C1B C;  1P3G D;  4JJN A;  3AZL D;  3AZN C;  5AV5 A;  1KX5 B;  3C1C A;  5DNN A;  3WKJ D;  1KX3 A;  3AZH B;  2NZD D;  4Z5T B;  5JRG D;  5B31 G;  3B0D B;  2L5A A;  5GSU A;  5GT3 C;  3LZ0 D;  3AZE C;  1P3P B;  3R45 B;  1WWI A;  1P3M A;  1EQZ B;  3MNN A;  5B33 A;  3O62 B;  3A6N C;  1F66 D;  4KUD C;  1S32 D;  5B40 D;  3LJA A;  3REH D;  5B2I A;  3REI D;  3MGS D;  2YFW A;  3WAA B;  4LD9 D;  1TZY A;  5B32 C;  3X1T C;  3X1S A;  5GXQ A;  3LZ1 A;  3KUY C;  2CV5 B;  1M18 A;  4WU9 A;  3C1B A;  1ULY A;  5GT0 B;  1KX4 C;  4Z66 D;  1P3B A;  4E44 A;  3MVD C;  3AZN A;  3AZF D;  3AV2 D;  2ARO C;  1P3G B;  2RVQ D;  4HGA C;  1U35 C;  5B0Z C;  1HQ3 D; 
#chains in the Genus database with same CATH topology
 1B6W A;  3WKJ B;  5B2J C;  4EO5 C;  5FUG B;  3NQU A;  4QLC D;  5G49 A;  5JRG B;  1P3A D;  2NZD B;  3B6F D;  5B0Y C;  3W97 D;  5GT3 A;  3AZE A;  5AV6 D;  4J8U A;  2JSS A;  4KUD A;  1B67 A;  5CPI C;  3WTP C;  2IO5 C;  5DNM B;  1F66 B;  2PYO C;  1S32 B;  2BYM B;  5B40 B;  3REK D;  3REH B;  3REI B;  4H9P B;  1BH8 A;  3MGS B;  5B32 A;  3UT9 A;  3X1V A;  3AV1 A;  3X1T A;  2BG1 A;  4LD9 B;  1WWS A;  5B1M C;  2HIO C;  3KUY A;  3W96 A;  2F8N D;  5B1L C;  5B31 D;  3TU4 D;  1P3F D;  1KX4 A;  2JE5 A;  1M1A A;  4WV4 B;  4Z66 B;  2ARO A;  5E5A C;  4CSR B;  5KDM B;  1P34 D;  3AZI C;  4J8W D;  5B0Z A;  3AZK D;  3AZF B;  3LEL C;  3AV2 B;  4ZBJ B;  3AZG D;  2ZY4 A;  1ID3 A;  1HQ3 B;  3UTB A;  5AVC C;  2Y2J A;  5B2J A;  5JA4 B;  3KXB D;  1P3A B;  5B0Y A;  4QLC B;  5AY8 C;  4YM6 C;  3REL D;  4Z2M H;  5F99 C;  3REJ D;  3B6F B;  3KWQ C;  3W97 B;  1M19 C;  5AV6 B;  4WNN A;  4E45 A;  1P3O C;  3AN2 D;  2JCH A;  4H9R B;  5CPI A;  1KX5 D;  5CPK A;  3WTP A;  2BYK A;  4XZQ C;  2PYO A;  5BS7 C;  1P3K D;  4J8X A;  3MGQ D;  3W98 C;  3REK B;  5CP6 D;  2Y2L A;  3NQJ A;  4UUZ A;  4XUJ C;  2Y2Q A;  4ZUX A;  3WA9 A;  4KHA A;  2HIO A;  5B1M A;  4WU8 D;  4NE3 A;  4J8V C;  3P5J B;  5C3I B;  3MGP C;  3AL0 C;  3V9R B;  5AV8 A;  2F8N B;  5B31 B;  3TU4 B;  1P3F B;  5BNV B;  3B6G A;  3AZH C;  1TAF A;  3AZI A;  1P3M C;  5B24 D;  3LEL A;  1P34 B;  4J8W B;  4H9Q B;  3AZK B;  4DQY B;  3AZG B;  3LJA C;  5GSU D;  3B0D C;  5AVC A;  4X23 A;  3AZM C;  3MGR D;  1BH9 A;  3KXB B;  3MNN D;  3O62 C;  5AY8 A;  4YM6 A;  3AYW D;  5GXQ C;  5F99 A;  3KWQ A;  3REL B;  1M19 A;  3REJ B;  1M18 C;  1P3B C;  3WAA C;  5BNX B;  3A1K A;  4XZQ A;  3AN2 B;  5BS7 A;  4H9O A;  1P3K B;  3W98 A;  2CV5 C;  2DF4 C;  1H3O B;  3MGQ B;  4WU9 D;  4AWL B;  4XUJ A;  5GT0 C;  5CP6 B;  2FJ7 D;  2LY8 A;  4J8V A;  2F8N G;  4WU8 B;  3W99 D;  3AFA D;  3AZL C;  3MGP A;  4LD9 A;  1KU5 A;  4NE6 A;  4J8U C;  3B0C T;  4H9N B;  3AZH A;  5DNM D;  1KX3 B;  3WKJ C;  2XD1 A;  4Z5T A;  4WJ3 C;  5B24 B;  2NZD C;  3AZM A;  4DRB A;  5GSU B;  1ZLA D;  3R45 A;  3MGR B;  3UT9 C;  3X1V C;  3LZ0 C;  1EQZ A;  3O62 A;  3A6N D;  3AV1 C;  4KUD D;  3MNN B;  5B33 B;  5AVB C;  3W96 C;  3AYW B;  5B40 C;  5B2I B;  3REI C;  3WAA A;  1M1A C;  3X1T D;  3AZJ C;  3KUY D;  2HUE B;  2CV5 A;  1ID3 C;  5GT0 A;  3UTB C;  4WU9 B;  4UPK A;  3MVD D;  2Y2H A;  2FJ7 B;  5BT1 D;  1U35 D;  3X1U D;  1P3G A;  5B0Z D;  3AZL A;  2RVQ C;  3AFA B;  3W99 B;  1PZR A;  3WKJ A;  5CPK C;  1Z2C B;  5FUG A;  2NZD A;  4J8X C;  4QLC C;  3KFU G;  5BO0 B;  3VH6 T;  5GT3 B;  3AZE B;  1ZLA B;  3LZ0 A;  1N1J B;  2FFF B;  4ZUX C;  3WA9 C;  1AOI D;  4KUD B;  5AVB A;  3A6N B;  1P3I C;  2BYM A;  2W8S A;  5B40 A;  3REI A;  4YS3 C;  5AV9 C;  5AV8 C;  1BFM A;  3UTA D;  4H9S C;  3B6G C;  3AZJ A;  5B1M D;  2HIO D;  3X1T B;  4R8P D;  3KUY B;  5B1L D;  1A7W A;  4X23 C;  3IP4 C;  1P3L C;  5B31 C;  1P3F C;  5E5A D;  2YFV B;  4CSR A;  4DRA A;  5KDM A;  3MVD B;  5B0Z C;  2ARO B;  3AZI D;  4HGA B;  1U35 B;  3X1U B;  5B0Z B;  4J8W C;  1HQ3 A;  4G91 C;  4Z2M G;  5JA4 A;  3EPJ A;  3VH6 A;  5CPJ C;  5B2J B;  2Y2N A;  4EO5 B;  2NQB D;  1P3A A;  4QLC A;  4KGC D;  1R4V A;  1M19 D;  3REJ C;  5AV6 A;  1P3O D;  4JJN D;  4XZQ D;  5AV5 D;  1P3I A;  3AN2 C;  1AOI B;  1KX5 C;  2IO5 B;  2PYO B;  4YS3 A;  1P3K C;  5AV9 A;  3C1C D;  3REK A;  5B32 G;  4H9S A;  5DNN D;  1KX3 D;  4AWL C;  3UTA B;  4UUZ B;  2CWE A;  5CP6 C;  4Z5T C;  4J8V D;  5B1M B;  2HIO B;  4WU8 C;  4R8P B;  3MGP D;  5B1L B;  2F8N A;  1P3L A;  5B31 A;  3TU4 A;  1P3F A;  1P3P C;  1P3M D;  5B33 D;  5E5A B;  1EQZ C;  1JFI A;  3AZI B;  1TAF B;  1P34 A;  3A1I A;  4J8W A;  3AZK A;  5B24 C;  3LJA D;  3AZG A;  5B2I D;  3EPL A;  4G92 B;  3AZM D;  5AVC B;  5CPJ A;  1TZY D;  5GXQ D;  3X1S D;  3LZ1 D;  2NQB B;  5F99 B;  1M18 D;  2ZY2 A;  4KGC B;  3REJ A;  4CAY B;  3C1B D;  1M19 B;  1P3B D;  1F1E A;  1P3O B;  2Y2I A;  3AZN D;  3AN2 A;  1KX5 A;  4JJN B;  1P3G C;  4XZQ B;  5AV5 B;  2HUE C;  1P3K A;  1H3O A;  3C1C B;  2ZY5 A;  5CP6 A;  5DNN B;  2FJ7 C;  2G5H C;  4WU8 A;  5JRG C;  4J8V B;  5GT3 D;  3W99 C;  3AFA C;  3AZE D;  3MGP B;  1P3P A;  4J8U D;  1T3U A;  4H9N A;  1P3M B;  5B24 A;  2F8N H;  5DNM C;  1F66 C;  1S32 C;  2DQN C;  2J8P A;  3LJA B;  3FDD A;  3REH C;  3AZM B;  5B32 D;  3MGS C;  3MGR A;  3UT9 D;  2YFW B;  3X1V D;  1ZLA C;  3AV1 D;  1TZY B;  4LD9 C;  5AVB D;  3W96 D;  1W2E A;  5GXQ B;  3X1S B;  3AYW A;  3KSY A;  3LZ1 B;  1KX4 D;  1M18 B;  1M1A D;  3C1B B;  1P3B B;  2ARO D;  4Z66 C;  3AZN B;  3AZJ D;  3AZF C;  3AV2 C;  4ZBJ C;  1ID3 D;  1HQ3 C;  3UTB D;  4WZS B;  5B2J D;  2FJ7 A;  3WTP E;  5JRG A;  5B0Y D;  3NQU B;  5BT1 C;  5G49 B;  3X1U C;  3AZL B;  1P3A C;  3AFA A;  3W99 A;  3B6F C;  2XD5 A;  3W97 C;  5AV6 C;  4J8U B;  5CPI D;  5CPK D;  3WTP D;  5DNM A;  1F66 A;  2PYO D;  3VH5 W;  1S32 A;  4J8X D;  3REH A;  5BO0 A;  4H9P A;  3REK C;  3MGS A;  1ZLA A;  1BH8 B;  4ZUX D;  3H0R C;  5B32 B;  1N1J A;  3H0L C;  3LZ0 B;  3UT9 B;  3X1V B;  3AV1 B;  3A6N A;  3WA9 D;  1P3I D;  5AVB B;  1AOI C;  3W96 B;  4YS3 D;  5C3I C;  5AV8 D;  5AV9 D;  3EPK A;  1KX4 B;  2Y2M A;  3TU4 C;  4Z66 A;  1M1A B;  3B6G D;  3UTA C;  3LEL D;  3AZF A;  3AV2 A;  1P34 C;  3AZJ B;  2RIQ A;  3AZK C;  3AZG C;  1ID3 B;  4R8P C;  4X23 D;  3B0B A;  5AVC D;  3VH5 T;  3EG5 B;  1P3L D;  3UTB B;  3EPH A;  3F6T A;  2YFV A;  3MVD A;  3KXB C;  5AY8 D;  4YM6 D;  3X1U A;  1U35 A;  5F99 D;  3KWQ D;  5B0Y B;  3B6F A;  3W97 A;  3REL C;  4G92 C;  4H9R A;  5CPJ D;  4WNN B;  5CPI B;  2VQR A;  5CPK B;  3WTP B;  2BYK B;  4J8X B;  3W98 D;  2NQB C;  2Y2G A;  4NE5 A;  4KGC C;  3MGQ C;  4XUJ D;  3NQJ B;  4ZUX B;  3WA9 B;  4KHA B;  5CHL B;  1AOI A;  4JJN C;  1P3I B;  5AV5 C;  3V9R A;  1Q9C A;  4M6B A;  4YS3 B;  5BNV A;  5AV8 B;  5AV9 B;  3C1C C;  4NFT A;  3AZH D;  3UTA A;  5DNN C;  3VH5 A;  1HTA A;  1KX3 C;  4Z5T D;  2ZM5 A;  3B6G B;  4H9Q A;  3LEL B;  4R8P A;  5B1L A;  4X23 B;  5GSU C;  1P3P D;  1P3L B;  3MGR C;  2F2A C;  3KXB A;  3O62 D;  1EQZ D;  5E5A A;  1BH9 B;  3MNN C;  5B33 C;  1JFI B;  5AY8 B;  4YM6 B;  3AYW C;  3REL A;  3H0M C;  4G91 B;  3KWQ B;  2Y2P A;  5B2I C;  3WAA D;  5BNX A;  5CPJ B;  2F8N K;  1TZY C;  2CV5 D;  2NQB A;  3X1S C;  4H9O B;  4KGC A;  3LZ1 C;  3MGQ A;  3W98 B;  3B0C W;  4CAY A;  5GT0 D;  4WU9 C;  4XUJ B;  1P3O A;  3C1B C;  1P3G D;  4JJN A;  3AZL D;  3AZN C;  5AV5 A;  1KX5 B;  3C1C A;  5DNN A;  3WKJ D;  1KX3 A;  3AZH B;  2NZD D;  4Z5T B;  5JRG D;  5B31 G;  3B0D B;  2L5A A;  5GSU A;  5GT3 C;  3LZ0 D;  3AZE C;  1P3P B;  3R45 B;  1WWI A;  1P3M A;  1EQZ B;  3MNN A;  5B33 A;  3O62 B;  3A6N C;  1F66 D;  4KUD C;  1S32 D;  2G5I C;  5B40 D;  3LJA A;  3REH D;  5B2I A;  3REI D;  3MGS D;  2Y2O A;  2YFW A;  3WAA B;  4LD9 D;  1TZY A;  5B32 C;  3X1T C;  3X1S A;  5GXQ A;  2Y2K A;  3LZ1 A;  3KUY C;  2CV5 B;  2ZY3 A;  1M18 A;  4WU9 A;  3C1B A;  1ULY A;  2UWX A;  5GT0 B;  4Z66 D;  1P3B A;  1KX4 C;  4E44 A;  3MVD C;  3AZN A;  3AZF D;  3AV2 D;  2ARO C;  1P3G B;  2RVQ D;  4HGA C;  1U35 C;  3VH6 W;  1HQ3 D; 
#chains in the Genus database with same CATH homology
 1B6W A;  3WKJ B;  5B2J C;  4EO5 C;  5FUG B;  3NQU A;  4QLC D;  5G49 A;  5JRG B;  1P3A D;  2NZD B;  3B6F D;  5B0Y C;  3W97 D;  5GT3 A;  3AZE A;  5AV6 D;  4J8U A;  2JSS A;  4KUD A;  1B67 A;  5CPI C;  3WTP C;  2IO5 C;  5DNM B;  1F66 B;  2PYO C;  1S32 B;  2BYM B;  5B40 B;  3REK D;  3REH B;  3REI B;  4H9P B;  1BH8 A;  3MGS B;  5B32 A;  3UT9 A;  3X1V A;  3AV1 A;  3X1T A;  2BG1 A;  4LD9 B;  1WWS A;  5B1M C;  2HIO C;  3KUY A;  3W96 A;  2F8N D;  5B1L C;  5B31 D;  3TU4 D;  1P3F D;  1KX4 A;  2JE5 A;  1M1A A;  4WV4 B;  4Z66 B;  2ARO A;  5E5A C;  4CSR B;  5KDM B;  1P34 D;  3AZI C;  4J8W D;  5B0Z A;  3AZK D;  3AZF B;  3LEL C;  3AV2 B;  4ZBJ B;  3AZG D;  2ZY4 A;  1ID3 A;  1HQ3 B;  3UTB A;  5AVC C;  2Y2J A;  5B2J A;  5JA4 B;  3KXB D;  1P3A B;  5B0Y A;  4QLC B;  5AY8 C;  4YM6 C;  3REL D;  4Z2M H;  5F99 C;  3REJ D;  3B6F B;  3KWQ C;  3W97 B;  1M19 C;  5AV6 B;  4WNN A;  4E45 A;  1P3O C;  3AN2 D;  2JCH A;  4H9R B;  5CPI A;  1KX5 D;  5CPK A;  3WTP A;  2BYK A;  4XZQ C;  2PYO A;  5BS7 C;  1P3K D;  4J8X A;  3MGQ D;  3W98 C;  3REK B;  5CP6 D;  2Y2L A;  3NQJ A;  4UUZ A;  4XUJ C;  2Y2Q A;  4ZUX A;  3WA9 A;  4KHA A;  2HIO A;  5B1M A;  4WU8 D;  4NE3 A;  4J8V C;  3P5J B;  5C3I B;  3MGP C;  3AL0 C;  3V9R B;  5AV8 A;  2F8N B;  5B31 B;  3TU4 B;  1P3F B;  5BNV B;  3B6G A;  3AZH C;  1TAF A;  3AZI A;  1P3M C;  5B24 D;  3LEL A;  1P34 B;  4J8W B;  4H9Q B;  3AZK B;  4DQY B;  3AZG B;  3LJA C;  5GSU D;  3B0D C;  5AVC A;  4X23 A;  3AZM C;  3MGR D;  1BH9 A;  3KXB B;  3MNN D;  3O62 C;  5AY8 A;  4YM6 A;  3AYW D;  5GXQ C;  5F99 A;  3KWQ A;  3REL B;  1M19 A;  3REJ B;  1M18 C;  1P3B C;  3WAA C;  5BNX B;  3A1K A;  4XZQ A;  3AN2 B;  5BS7 A;  4H9O A;  1P3K B;  3W98 A;  2CV5 C;  2DF4 C;  1H3O B;  3MGQ B;  4WU9 D;  4AWL B;  4XUJ A;  5GT0 C;  5CP6 B;  2FJ7 D;  2LY8 A;  4J8V A;  2F8N G;  4WU8 B;  3W99 D;  3AFA D;  3AZL C;  3MGP A;  4LD9 A;  1KU5 A;  4NE6 A;  4J8U C;  3B0C T;  4H9N B;  3AZH A;  5DNM D;  1KX3 B;  3WKJ C;  2XD1 A;  4Z5T A;  4WJ3 C;  5B24 B;  2NZD C;  3AZM A;  4DRB A;  5GSU B;  1ZLA D;  3R45 A;  3MGR B;  3UT9 C;  3X1V C;  3LZ0 C;  1EQZ A;  3O62 A;  3A6N D;  3AV1 C;  4KUD D;  3MNN B;  5B33 B;  5AVB C;  3W96 C;  3AYW B;  5B40 C;  5B2I B;  3REI C;  3WAA A;  1M1A C;  3X1T D;  3AZJ C;  3KUY D;  2HUE B;  2CV5 A;  1ID3 C;  5GT0 A;  3UTB C;  4WU9 B;  4UPK A;  3MVD D;  2Y2H A;  2FJ7 B;  5BT1 D;  1U35 D;  3X1U D;  1P3G A;  5B0Z D;  3AZL A;  2RVQ C;  3AFA B;  3W99 B;  1PZR A;  3WKJ A;  5CPK C;  1Z2C B;  5FUG A;  2NZD A;  4J8X C;  4QLC C;  3KFU G;  5BO0 B;  3VH6 T;  5GT3 B;  3AZE B;  1ZLA B;  3LZ0 A;  1N1J B;  2FFF B;  4ZUX C;  3WA9 C;  1AOI D;  4KUD B;  5AVB A;  3A6N B;  1P3I C;  2BYM A;  2W8S A;  5B40 A;  3REI A;  4YS3 C;  5AV9 C;  5AV8 C;  1BFM A;  3UTA D;  4H9S C;  3B6G C;  3AZJ A;  5B1M D;  2HIO D;  3X1T B;  4R8P D;  3KUY B;  5B1L D;  1A7W A;  4X23 C;  3IP4 C;  1P3L C;  5B31 C;  1P3F C;  5E5A D;  2YFV B;  4CSR A;  4DRA A;  5KDM A;  3MVD B;  5B0Z C;  2ARO B;  3AZI D;  4HGA B;  1U35 B;  3X1U B;  5B0Z B;  4J8W C;  1HQ3 A;  4G91 C;  4Z2M G;  5JA4 A;  3EPJ A;  3VH6 A;  5CPJ C;  5B2J B;  2Y2N A;  4EO5 B;  2NQB D;  1P3A A;  4QLC A;  4KGC D;  1R4V A;  1M19 D;  3REJ C;  5AV6 A;  1P3O D;  4JJN D;  4XZQ D;  5AV5 D;  1P3I A;  3AN2 C;  1AOI B;  1KX5 C;  2IO5 B;  2PYO B;  4YS3 A;  1P3K C;  5AV9 A;  3C1C D;  3REK A;  5B32 G;  4H9S A;  5DNN D;  1KX3 D;  4AWL C;  3UTA B;  4UUZ B;  2CWE A;  5CP6 C;  4Z5T C;  4J8V D;  5B1M B;  2HIO B;  4WU8 C;  4R8P B;  3MGP D;  5B1L B;  2F8N A;  1P3L A;  5B31 A;  3TU4 A;  1P3F A;  1P3P C;  1P3M D;  5B33 D;  5E5A B;  1EQZ C;  1JFI A;  3AZI B;  1TAF B;  1P34 A;  3A1I A;  4J8W A;  3AZK A;  5B24 C;  3LJA D;  3AZG A;  5B2I D;  3EPL A;  4G92 B;  3AZM D;  5AVC B;  5CPJ A;  1TZY D;  5GXQ D;  3X1S D;  3LZ1 D;  2NQB B;  5F99 B;  1M18 D;  2ZY2 A;  4KGC B;  3REJ A;  4CAY B;  3C1B D;  1M19 B;  1P3B D;  1F1E A;  1P3O B;  2Y2I A;  3AZN D;  3AN2 A;  1KX5 A;  4JJN B;  1P3G C;  4XZQ B;  5AV5 B;  2HUE C;  1P3K A;  1H3O A;  3C1C B;  2ZY5 A;  5CP6 A;  5DNN B;  2FJ7 C;  2G5H C;  4WU8 A;  5JRG C;  4J8V B;  5GT3 D;  3W99 C;  3AFA C;  3AZE D;  3MGP B;  1P3P A;  4J8U D;  1T3U A;  4H9N A;  1P3M B;  5B24 A;  2F8N H;  5DNM C;  1F66 C;  1S32 C;  2DQN C;  2J8P A;  3LJA B;  3FDD A;  3REH C;  3AZM B;  5B32 D;  3MGS C;  3MGR A;  3UT9 D;  2YFW B;  3X1V D;  1ZLA C;  3AV1 D;  1TZY B;  4LD9 C;  5AVB D;  3W96 D;  1W2E A;  5GXQ B;  3X1S B;  3AYW A;  3KSY A;  3LZ1 B;  1KX4 D;  1M18 B;  1M1A D;  3C1B B;  1P3B B;  2ARO D;  4Z66 C;  3AZN B;  3AZJ D;  3AZF C;  3AV2 C;  4ZBJ C;  1ID3 D;  1HQ3 C;  3UTB D;  4WZS B;  5B2J D;  2FJ7 A;  3WTP E;  5JRG A;  5B0Y D;  3NQU B;  5BT1 C;  5G49 B;  3X1U C;  3AZL B;  1P3A C;  3AFA A;  3W99 A;  3B6F C;  2XD5 A;  3W97 C;  5AV6 C;  4J8U B;  5CPI D;  5CPK D;  3WTP D;  5DNM A;  1F66 A;  2PYO D;  3VH5 W;  1S32 A;  4J8X D;  3REH A;  5BO0 A;  4H9P A;  3REK C;  3MGS A;  1ZLA A;  1BH8 B;  4ZUX D;  3H0R C;  5B32 B;  1N1J A;  3H0L C;  3LZ0 B;  3UT9 B;  3X1V B;  3AV1 B;  3A6N A;  3WA9 D;  1P3I D;  5AVB B;  1AOI C;  3W96 B;  4YS3 D;  5C3I C;  5AV8 D;  5AV9 D;  3EPK A;  1KX4 B;  2Y2M A;  3TU4 C;  4Z66 A;  1M1A B;  3B6G D;  3UTA C;  3LEL D;  3AZF A;  3AV2 A;  1P34 C;  3AZJ B;  2RIQ A;  3AZK C;  3AZG C;  1ID3 B;  4R8P C;  4X23 D;  3B0B A;  5AVC D;  3VH5 T;  3EG5 B;  1P3L D;  3UTB B;  3EPH A;  3F6T A;  2YFV A;  3MVD A;  3KXB C;  5AY8 D;  4YM6 D;  3X1U A;  1U35 A;  5F99 D;  3KWQ D;  5B0Y B;  3B6F A;  3W97 A;  3REL C;  4G92 C;  4H9R A;  5CPJ D;  4WNN B;  5CPI B;  2VQR A;  5CPK B;  3WTP B;  2BYK B;  4J8X B;  3W98 D;  2NQB C;  2Y2G A;  4NE5 A;  4KGC C;  3MGQ C;  4XUJ D;  3NQJ B;  4ZUX B;  3WA9 B;  4KHA B;  5CHL B;  1AOI A;  4JJN C;  1P3I B;  5AV5 C;  3V9R A;  1Q9C A;  4M6B A;  4YS3 B;  5BNV A;  5AV8 B;  5AV9 B;  3C1C C;  4NFT A;  3AZH D;  3UTA A;  5DNN C;  3VH5 A;  1HTA A;  1KX3 C;  4Z5T D;  2ZM5 A;  3B6G B;  4H9Q A;  3LEL B;  4R8P A;  5B1L A;  4X23 B;  5GSU C;  1P3P D;  1P3L B;  3MGR C;  2F2A C;  3KXB A;  3O62 D;  1EQZ D;  5E5A A;  1BH9 B;  3MNN C;  5B33 C;  1JFI B;  5AY8 B;  4YM6 B;  3AYW C;  3REL A;  3H0M C;  4G91 B;  3KWQ B;  2Y2P A;  5B2I C;  3WAA D;  5BNX A;  5CPJ B;  2F8N K;  1TZY C;  2CV5 D;  2NQB A;  3X1S C;  4H9O B;  4KGC A;  3LZ1 C;  3MGQ A;  3W98 B;  3B0C W;  4CAY A;  5GT0 D;  4WU9 C;  4XUJ B;  1P3O A;  3C1B C;  1P3G D;  4JJN A;  3AZL D;  3AZN C;  5AV5 A;  1KX5 B;  3C1C A;  5DNN A;  3WKJ D;  1KX3 A;  3AZH B;  2NZD D;  4Z5T B;  5JRG D;  5B31 G;  3B0D B;  2L5A A;  5GSU A;  5GT3 C;  3LZ0 D;  3AZE C;  1P3P B;  3R45 B;  1WWI A;  1P3M A;  1EQZ B;  3MNN A;  5B33 A;  3O62 B;  3A6N C;  1F66 D;  4KUD C;  1S32 D;  2G5I C;  5B40 D;  3LJA A;  3REH D;  5B2I A;  3REI D;  3MGS D;  2Y2O A;  2YFW A;  3WAA B;  4LD9 D;  1TZY A;  5B32 C;  3X1T C;  3X1S A;  5GXQ A;  2Y2K A;  3LZ1 A;  3KUY C;  2CV5 B;  2ZY3 A;  1M18 A;  4WU9 A;  3C1B A;  1ULY A;  2UWX A;  5GT0 B;  4Z66 D;  1P3B A;  1KX4 C;  4E44 A;  3MVD C;  3AZN A;  3AZF D;  3AV2 D;  2ARO C;  1P3G B;  2RVQ D;  4HGA C;  1U35 C;  3VH6 W;  1HQ3 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...