4DRAA

Crystal structure of mhf complex
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
93
structure length
93
Chain Sequence
FSYQQRLKAAVHYTVGCLCEEVALDKEMQFSKQTIAAISELTFRQCENFAKDLEMFARHAKRTTINTEDVKLLARRSNSLLKYITDKSEEIAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Centromere protein S
publication title The structure of the FANCM-MHF complex reveals physical features for functional assembly
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein
total genus 36
structure length 93
sequence length 93
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF15630 CENP-S CENP-S protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4draA00
4UUZB 2YFVB 3VH6T 3KXBC 3TU4D 5DNNB 5BNXA 1P3LA 3KXBB 1KU5A 3R45B 1H3OA 4WV4B 5AV9D 1P3LC 5BNXB 1P3LB 3NQUA 5AV6D 3MVDA 1HQ3D 1H3OB 5JRGA 3LZ1D 4JJNA 5B32D 3KWQD 4H9NA 5AV8D 3UT9A 4NFTA 5F99A 3MVDC 3A6ND 5JRGC 3NQUB 3MVDB 4JJNC 3UTBA 1ZLAA 3UT9C 3AZMA 4DRBA 5JRGB 5F99C 1ID3A 5CPJA 4JJNB 4H9NB 3UT9B 5F99B 1M18D 3UTBC 1ZLAC 3X1VA 4KGCD 5AVBA 5BNVA 3AZMC 1ID3C 5CPJC 5BT1D 3UTBB 1ZLAB 3AZMB 4J8WA 3AZND 1ID3B 5CPJB 3W97D 3X1VC 5AVBC 3AZIA 5B0YD 5AV5A 3AYWD 3X1VB 5AVBB 5BNVB 3X1UD 4J8WC 3RELD 3WKJA 3AZIC 4J8WB 4NE3A 5AV5C 3REHD 3AV2A 4QLCA 4ZBJC 3AZIB 3WKJC 5AV5B 1JFIA 2NQBD 4ZBJB 5B1LD 3WKJB 3W98A 4YM6D 3AV2C 3KUYD 1BH8A 4QLCC 3MGPD 3AV2B 3LELD 1P3AA 4QLCB 3W98C 5AY8D 1JFIB 2F8NH 3TU4A 3W98B 1P3AC 1BH8B 1P3AB 3TU4C 3AZFD 5AV9A 4H9OA 5GT3A 3TU4B 5BO0A 5B2IA 5AV6A 4AWLC 3NQJA 5AV9C 1HQ3A 3LJAD 4H9QA 4Z66D 5GT3C 4AWLB 5B32A 5AV9B 3KWQA 3W96D 4H9OB 5AV8A 5B2IC 5AV6C 5GT3B 1HQ3C 5B1MD 1P3LD 5DNMB 5BO0B 5B2IB 5AV6B 3NQJB 5B32C 1HQ3B 3KWQC 5AV8C 4H9QB 4Z2MG 5B32B 3KWQB 1R4VA 3WTPE 4X23D 1M18A 3O62D 4KGCA 4NE6A 2HIOD 2RVQC 3AZNA 1M18C 3W97A 4KGCC 3UT9D 3AZED 5B0YA 1M18B 5BT1C 3AYWA 4KGCB 3AZNC 3RELA 1F1EA 5B2JD 3W97C 1ZLAD 5FUGA 3AZNB 5B0YC 3REHA 3AYWC 3W97B 3VH5W 3X1UC 3RELC 5B0YB 3AYWB 2NQBA 5B1LA 3RELB 4YM6A 3REHC 3KUYA 5FUGB 3MGPA 4DRAA 3REHB 3LELA 3AZID 2NQBC 5B1LC 4YM6C 3KUYC 5AY8A 3WAAD 2NQBB 3MGPC 5B1LB 4ZUXD 3LELC 3KUYB 4WU8D 3MGPB 3LELB 3MGQA 5AY8C 3VH6W 1M19D 3AZFA 5JA4A 5AY8B 4UUZA 5GXQA 1B67A 1KX4D 3MGQC 4LD9D 3AZFC 3WTPD 3MGQB 3LJAA 1Q9CA 4WNNA 5GXQC 4Z66A 3W96A 2F8NK 5JA4B 5GXQB 5B32G 5B1MA 3LJAC 1S32D 4Z66C 2CV5A 4Z2MH 3W96C 4E44A 3LJAB 4WNNB 4Z66B 5B1MC 1KX5D 3W96B 4X23A 5GT3D 2CV5C 3O62A 3X1SD 5B1MB 3LZ0A 5DNMD 2HIOA 5B2ID 2CV5B 4X23C 1BH9A 5B31D 3O62C 3LZ0C 5GSUD 4X23B 5CPID 2HIOC 3AZEA 3O62B 1P3MA 3LZ0B 2HIOB 3AN2B 5B2JA 3X1TD 4Z5TD 3AZEC 1BH9B 2RVQD 1P3MC 3AZEB 5B40D 5B2JC 1P3MB 3REKD 5B2JB 3B0CT 4YS3D 5CP6A 3WAAA 4ZUXA 2F8ND 3AFAD 4WU8A 2IO5C 3V9RA 1M1AD 3WAAC 5CP6B 1M19A 4ZUXC 2IO5B 4WU8C 3WAAB 4ZUXB 1KX4A 4LD9A 4WU8B 1M19C 3WTPA 3V9RB 5G49A 1KX3D 1M19B 1KX4C 4LD9C 5B24A 3WTPC 1KX4B 4LD9B 1BFMA 1S32A 2FJ7D 3WTPB 5B24C 3MGQD 3B0DC 5G49B 1KX5A 5B24B 1P3PA 3B0DB 1S32C 3W99A 5GXQD 3X1SA 1S32B 5DNMA 3AZGA 1KX5C 1P3PC 4H9PA 3W99C 5B31A 3B0BA 1A7WA 1P3OD 3X1SC 1KX5B 1P3PB 5GSUA 5DNMC 5CPIA 3W99B 3AZGC 5CPKD 3X1SB 5B0ZD 2NZDD 5B31C 5GT0A 3UTAD 3AZGB 3X1TA 2CV5D 3WA9D 4Z5TA 5GSUC 4H9PB 5CPIC 3AZJD 5B31B 5KDMA 5GSUB 5CPIB 2AROD 5GT0C 5B40A 3X1TC 3AV1D 4Z5TC 3LZ0D 4XUJD 3KSYA 5AVCA 4J8UA 5GT0B 3REKA 3AN2D 3X1TB 4Z5TB 1N1JA 5B40C 5KDMB 4YS3A 4J8UC 5AVCC 3REKC 5B40B 1P3MD 4J8UB 5AVCB 3REKB 2F8NA 4YS3C 3AFAA 4G91C 1N1JB 4KUDD 3REJD 4YS3B 1M1AA 4G91B 3VH5A 3AFAC 2F8NB 1M1AC 3AFAB 2PYOD 1M1AB 1KX3A 5CP6D 3REID 1AOID 1KX3C 2FJ7A 1KX3B 3VH6A 1TZYD 4HGAC 2FJ7C 4HGAB 2FJ7B 2BYKA 1P3OA 5B24D 5B31G 5CPKA 5B0ZA 4XZQD 2NZDA 3UTAA 4R8PA 3MNNA 3AZLA 1P3OC 3WA9A 3AZJA 2BYKB 1P3OB 5CPKC 5B0ZC 1P3KD 5C3IC 1P3PD 3W99D 2NZDC 2AROA 4R8PC 3MNNC 3UTAC 3AZLC 3AV1A 5CPKB 3WA9C 5B0ZB 3AZJC 4XUJA 4EO5C 5C3IB 3AN2A 3UTAB 4R8PB 3MNNB 3AZGD 3AZLB 2NZDB 3C1CD 3WA9B 3AZJB 4EO5B 2AROC 4NE5A 1P3IA 3AV1C 5E5AD 4XUJC 3AN2C 2AROB 3AV1B 4XUJB 3B0CW 4CAYA 5GT0D 1P3IC 2F8NG 4KUDA 3REJA 1P3IB 4CSRA 1P3BD 3MGRA 4J8UD 5AVCD 3REJC 4CAYB 4KUDC 2PYOA 1EQZD 4KUDB 3REJB 4CSRB 3MGSA 3MGRC 3REIA 1P34D 2PYOC 1AOIA 5CHLB 3MGRB 1F66D 1B6WA 3MGSC 2PYOB 5CP6C 3REIC 3B6FA 3AZHD 1AOIC 3MGSB 1U35D 3REIB 1AOIB 1TZYA 3B6FC 3B6FB 5B33D 1TZYC 4J8VD 1TZYB 3C1BD 5BS7A 4XZQA 1HTAA 5BS7C 1P3GD 1P3KA 4XZQC 2HUEC 3AZKD 4XZQB 2HUEB 4WZSB 1P3FD 2YFWA 3C1CA 1P3KC 4M6BA 3B6GD 1P3KB 5E5AA 3C1CC 4R8PD 3MNND 3AZLD 2YFWB 3C1CB 5E5AC 4WU9D 1P3BA 5E5AB 4J8XD 2L5AA 1P3BC 2LY8A 5DNND 4E45A 1EQZA 1P3ID 3KXBD 1P3BB 1P34A 1TAFA 3LZ1A 1EQZC 1F66A 3A6NA 1EQZB 1ULYA 3AZHA 1P34C 3LZ1C 4H9RA 1U35A 1P34B 1TAFB 3LZ1B 1F66C 3A6NC 3MGRD 5AV8B 3AZHC 1WWIA 1F66B 3A6NB 1U35C 3AZHB 2BYMA 4H9RB 5B33A 3MVDD 3MGSD 4J8VA 1U35B 5JRGD 4JJND 3C1BA 5F99D 5B33C 4J8VC 3X1UA 3B6FD 2BYMB 5B33B 4J8VB 3UTBD 3C1BC 3AZMD 1P3GA 5CPJD 1ID3D 3C1BB 3AZKA 2JSSA 3X1VD 5AVBD 3X1UB 1P3FA 1P3GC 4H9SA 4KHAA 3AZKC 4J8WD 3B6GA 1P3GB 1P3FC 3AZKB 5AV5D 4H9SC 1P3FB 3VH5T 3B6GC 3WKJD 4YM6B 4WU9A 4KHAB 1WWSA 3B6GB 3AV2D 4QLCD 4J8XA 2CWEA 4WU9C 4G92C 2YFVA 3W98D 5DNNA 4WU9B 4J8XC 4G92B 3KXBA 3R45A 1P3AD 4J8XB 5DNNC 3AZFB
chains in the Genus database with same CATH superfamily
4UUZB 2YFVB 3VH6T 3KXBC 3TU4D 5DNNB 5BNXA 1P3LA 3KXBB 1KU5A 3R45B 1H3OA 2FFFB 4WV4B 5AV9D 1P3LC 5BNXB 1P3LB 3NQUA 2UWXA 5AV6D 3MVDA 1HQ3D 1H3OB 5JRGA 2Y2KA 3LZ1D 4JJNA 5B32D 3KWQD 4H9NA 5AV8D 3UT9A 4NFTA 5F99A 3MVDC 3A6ND 2Y2IA 5JRGC 3NQUB 3MVDB 4JJNC 3UTBA 1ZLAA 3UT9C 3AZMA 4DRBA 5JRGB 5F99C 1ID3A 5CPJA 4JJNB 4H9NB 3UT9B 5F99B 1M18D 3UTBC 1ZLAC 3X1VA 4KGCD 5AVBA 5BNVA 3AZMC 1ID3C 5CPJC 5BT1D 3UTBB 1ZLAB 3AZMB 2Y2JA 4J8WA 3AZND 1ID3B 5CPJB 3W97D 3X1VC 2JE5A 5AVBC 3AZIA 5B0YD 5AV5A 3AYWD 3X1VB 5AVBB 5BNVB 3X1UD 4J8WC 3RELD 3WKJA 3AZIC 4J8WB 1Z2CB 3EPKA 4NE3A 5AV5C 3REHD 3AV2A 4QLCA 4ZBJC 3AZIB 3WKJC 5AV5B 1JFIA 2NQBD 4ZBJB 5B1LD 3WKJB 3W98A 4YM6D 3AV2C 3KUYD 1BH8A 4QLCC 3MGPD 3AV2B 3LELD 1P3AA 4QLCB 3W98C 5AY8D 1JFIB 2F8NH 3TU4A 3W98B 2NZDB 1P3AC 1BH8B 1P3AB 3TU4C 3AZFD 5AV9A 4H9OA 2J8PA 5GT3A 3TU4B 5BO0A 5B2IA 5AV6A 4AWLC 3NQJA 5AV9C 1HQ3A 3LJAD 4H9QA 4Z66D 5GT3C 4AWLB 5B32A 5AV9B 3KWQA 3W96D 4H9OB 5AV8A 5B2IC 5AV6C 5GT3B 1HQ3C 5B1MD 1P3LD 4UPKA 5BO0B 5B2IB 5DNMB 5AV6B 3NQJB 5B32C 1HQ3B 3KWQC 5AV8C 4H9QB 4Z2MG 5B32B 3KWQB 1R4VA 3WTPE 4X23D 1M18A 3O62D 4KGCA 4NE6A 2HIOD 2RVQC 3AZNA 1M18C 3W97A 4KGCC 3UT9D 3AZED 5B0YA 1M18B 5BT1C 3AYWA 4KGCB 3A1IA 3AZNC 3RELA 4DQYB 1F1EA 5B2JD 3W97C 1ZLAD 5FUGA 3AZNB 5B0YC 3REHA 3AYWC 3W97B 3VH5W 3X1UC 3RELC 5B0YB 3AYWB 4WJ3C 2NQBA 5B1LA 3RELB 4YM6A 3REHC 3KUYA 5FUGB 3MGPA 4DRAA 3REHB 3LELA 3AZID 2NQBC 5B1LC 4YM6C 2F2AC 3KUYC 5AY8A 3WAAD 2NQBB 3MGPC 5B1LB 4ZUXD 3LELC 3KUYB 4WU8D 2ZY5A 3MGPB 3LELB 3MGQA 5AY8C 3VH6W 1M19D 3AZFA 5JA4A 3F6TA 5AY8B 3P5JB 4UUZA 5GXQA 1B67A 1KX4D 3MGQC 4LD9D 3AZFC 3WTPD 3MGQB 3LJAA 1Q9CA 2Y2QA 4WNNA 5GXQC 4Z66A 3W96A 2F8NK 5JA4B 5GXQB 5B32G 5B1MA 3LJAC 1S32D 4Z66C 2CV5A 4Z2MH 3W96C 4E44A 3LJAB 4WNNB 2ZY3A 4Z66B 5B1MC 1KX5D 3W96B 4X23A 5GT3D 2CV5C 3O62A 3X1SD 5B1MB 3LZ0A 2Y2OA 5DNMD 2HIOA 5B2ID 2CV5B 4X23C 1BH9A 5B31D 3O62C 3LZ0C 5GSUD 4X23B 5CPID 2HIOC 3AZEA 2XD1A 3O62B 3LZ0B 1P3MA 2HIOB 3AN2B 1PZRA 5B2JA 3X1TD 4Z5TD 3AZEC 1BH9B 2RVQD 3H0LC 1P3MC 3AZEB 5B40D 5B2JC 1P3MB 3REKD 5B2JB 3B0CT 4YS3D 3FDDA 5CP6A 3WAAA 4ZUXA 2F8ND 3AFAD 4WU8A 2IO5C 3V9RA 1M1AD 3WAAC 5CP6B 1M19A 4ZUXC 2IO5B 4WU8C 3WAAB 4ZUXB 1KX4A 4LD9A 4WU8B 1M19C 3WTPA 3V9RB 5G49A 1KX3D 1M19B 1KX4C 4LD9C 5B24A 3WTPC 1KX4B 4LD9B 1BFMA 1S32A 2FJ7D 3WTPB 5B24C 3MGQD 3B0DC 5G49B 1KX5A 5B24B 1P3PA 3B0DB 1S32C 3W99A 5GXQD 3H0RC 2Y2PA 3X1SA 1S32B 5DNMA 3AZGA 1KX5C 1P3PC 3IP4C 4H9PA 3W99C 5B31A 3B0BA 1A7WA 1P3OD 3X1SC 1KX5B 1P3PB 5GSUA 2G5HC 5DNMC 5CPIA 3W99B 3AZGC 5CPKD 3X1SB 5B0ZD 2NZDD 5B31C 5GT0A 3UTAD 3AZGB 3X1TA 2CV5D 3WA9D 4Z5TA 5GSUC 4H9PB 5CPIC 3AZJD 5B31B 5KDMA 5GSUB 5CPIB 2AROD 5GT0C 5B40A 3X1TC 3AV1D 4Z5TC 3LZ0D 4XUJD 3KSYA 5AVCA 4J8UA 5GT0B 3REKA 3AN2D 3X1TB 4Z5TB 1N1JA 5B40C 5KDMB 4YS3A 2VQRA 4J8UC 5AVCC 3REKC 5B40B 1P3MD 2Y2NA 4J8UB 5AVCB 3REKB 2F8NA 4YS3C 3AFAA 4G91C 1N1JB 4KUDD 3REJD 4YS3B 1M1AA 4G91B 3VH5A 3AFAC 2F8NB 1M1AC 3AFAB 2PYOD 1M1AB 2Y2GA 1KX3A 5CP6D 3REID 1AOID 2ZM5A 1KX3C 2FJ7A 1KX3B 3VH6A 1TZYD 4HGAC 2FJ7C 2W8SA 4HGAB 2FJ7B 2BYKA 1P3OA 5B24D 5B31G 5CPKA 5B0ZA 4XZQD 2NZDA 3UTAA 4R8PA 3MNNA 3AZLA 1P3OC 3WA9A 3AZJA 2BYKB 1P3OB 5CPKC 5B0ZC 1P3KD 5C3IC 1P3PD 3W99D 2NZDC 2AROA 4R8PC 3MNNC 3UTAC 3AZLC 3AV1A 5CPKB 3WA9C 5B0ZB 3AZJC 4XUJA 4EO5C 5C3IB 3AN2A 3UTAB 4R8PB 2BG1A 3MNNB 3AZGD 3AZLB 3C1CD 3WA9B 3AZJB 4EO5B 2AROC 4NE5A 1P3IA 3AV1C 5E5AD 4XUJC 3AN2C 2AROB 3AV1B 4XUJB 3B0CW 4CAYA 5GT0D 1P3IC 2F8NG 4KUDA 3REJA 1P3IB 4CSRA 1P3BD 3MGRA 4J8UD 5AVCD 3REJC 4CAYB 4KUDC 2PYOA 3EPJA 1EQZD 4KUDB 3REJB 2XD5A 4CSRB 3MGSA 3EPHA 3MGRC 3REIA 1P34D 2Y2MA 2PYOC 1AOIA 5CHLB 3MGRB 1F66D 1B6WA 3MGSC 2PYOB 5CP6C 3REIC 3B6FA 3AZHD 1AOIC 3MGSB 1U35D 3REIB 1AOIB 1TZYA 3B6FC 2G5IC 2Y2HA 3B6FB 5B33D 1TZYC 4J8VD 3KFUG 1TZYB 3C1BD 5BS7A 3EG5B 4XZQA 1HTAA 5BS7C 1P3GD 1P3KA 4XZQC 2HUEC 3AZKD 4XZQB 2HUEB 4WZSB 1P3FD 2YFWA 3C1CA 2RIQA 4M6BA 1P3KC 3B6GD 1P3KB 5E5AA 1T3UA 3C1CC 4R8PD 3MNND 3AZLD 2YFWB 3C1CB 5E5AC 3EPLA 4WU9D 2ZY2A 1P3BA 5E5AB 4J8XD 2L5AA 3AL0C 2ZY4A 1P3BC 2LY8A 5DNND 4E45A 1EQZA 1P3ID 3KXBD 2DF4C 1P3BB 1W2EA 1P34A 1TAFA 3LZ1A 1EQZC 1F66A 3A6NA 1EQZB 1ULYA 3AZHA 1P34C 3LZ1C 4H9RA 2DQNC 1U35A 1P34B 1TAFB 3LZ1B 1F66C 3A6NC 3MGRD 5AV8B 3AZHC 1WWIA 1F66B 3A6NB 2JCHA 1U35C 3AZHB 2BYMA 4H9RB 5B33A 3MVDD 3MGSD 4J8VA 1U35B 2Y2LA 5JRGD 4JJND 3C1BA 5F99D 5B33C 4J8VC 3X1UA 3B6FD 2BYMB 5B33B 4J8VB 3UTBD 3C1BC 3H0MC 3AZMD 1P3GA 5CPJD 1ID3D 3C1BB 3AZKA 2JSSA 3X1VD 5AVBD 3X1UB 1P3FA 1P3GC 4H9SA 4KHAA 3AZKC 4J8WD 3B6GA 1P3GB 1P3FC 3AZKB 5AV5D 4H9SC 1P3FB 3VH5T 3B6GC 3WKJD 4YM6B 4WU9A 4KHAB 1WWSA 3B6GB 3AV2D 4QLCD 4J8XA 3A1KA 2CWEA 4WU9C 4G92C 2YFVA 3W98D 5DNNA 4WU9B 4J8XC 4G92B 3KXBA 3R45A 1P3AD 4J8XB 5DNNC 3AZFB
chains in the Genus database with same CATH topology
4UUZB 2YFVB 3VH6T 3KXBC 3TU4D 5DNNB 5BNXA 1P3LA 3KXBB 1KU5A 3R45B 1H3OA 2FFFB 4WV4B 5AV9D 1P3LC 5BNXB 1P3LB 3NQUA 2UWXA 5AV6D 3MVDA 1HQ3D 1H3OB 5JRGA 2Y2KA 3LZ1D 4JJNA 5B32D 3KWQD 4H9NA 5AV8D 3UT9A 4NFTA 5F99A 3MVDC 3A6ND 2Y2IA 5JRGC 3NQUB 3MVDB 4JJNC 3UTBA 1ZLAA 3UT9C 3AZMA 4DRBA 5JRGB 5F99C 1ID3A 5CPJA 4JJNB 4H9NB 3UT9B 5F99B 1M18D 3UTBC 1ZLAC 3X1VA 4KGCD 5AVBA 5BNVA 3AZMC 1ID3C 5CPJC 5BT1D 3UTBB 1ZLAB 3AZMB 2Y2JA 4J8WA 3AZND 1ID3B 5CPJB 3W97D 3X1VC 2JE5A 5AVBC 3AZIA 5B0YD 5AV5A 3AYWD 3X1VB 5AVBB 5BNVB 3X1UD 4J8WC 3RELD 3WKJA 3AZIC 4J8WB 1Z2CB 3EPKA 4NE3A 5AV5C 3REHD 3AV2A 4QLCA 4ZBJC 3AZIB 3WKJC 5AV5B 1JFIA 2NQBD 4ZBJB 5B1LD 3WKJB 3W98A 4YM6D 3AV2C 3KUYD 1BH8A 4QLCC 3MGPD 3AV2B 3LELD 1P3AA 4QLCB 3W98C 5AY8D 1JFIB 2F8NH 3TU4A 3W98B 2NZDB 1P3AC 1BH8B 1P3AB 3TU4C 3AZFD 5AV9A 4H9OA 2J8PA 5GT3A 3TU4B 5BO0A 5B2IA 5AV6A 4AWLC 3NQJA 5AV9C 1HQ3A 3LJAD 4H9QA 4Z66D 5GT3C 4AWLB 5B32A 5AV9B 3KWQA 3W96D 4H9OB 5AV8A 5B2IC 5AV6C 5GT3B 1HQ3C 5B1MD 1P3LD 4UPKA 5BO0B 5B2IB 5DNMB 5AV6B 3NQJB 5B32C 1HQ3B 3KWQC 5AV8C 4H9QB 4Z2MG 5B32B 3KWQB 1R4VA 3WTPE 4X23D 1M18A 3O62D 4KGCA 4NE6A 2HIOD 2RVQC 3AZNA 1M18C 3W97A 4KGCC 3UT9D 3AZED 5B0YA 1M18B 5BT1C 3AYWA 4KGCB 3A1IA 3AZNC 3RELA 4DQYB 1F1EA 5B2JD 3W97C 1ZLAD 5FUGA 3AZNB 5B0YC 3REHA 3AYWC 3W97B 3VH5W 3X1UC 3RELC 5B0YB 3AYWB 4WJ3C 2NQBA 5B1LA 3RELB 4YM6A 3REHC 3KUYA 5FUGB 3MGPA 4DRAA 3REHB 3LELA 3AZID 2NQBC 5B1LC 4YM6C 2F2AC 3KUYC 5AY8A 3WAAD 2NQBB 3MGPC 5B1LB 4ZUXD 3LELC 3KUYB 4WU8D 2ZY5A 3MGPB 3LELB 3MGQA 5AY8C 3VH6W 1M19D 3AZFA 5JA4A 3F6TA 5AY8B 3P5JB 4UUZA 5GXQA 1B67A 1KX4D 3MGQC 4LD9D 3AZFC 3WTPD 3MGQB 3LJAA 1Q9CA 2Y2QA 4WNNA 5GXQC 4Z66A 3W96A 2F8NK 5JA4B 5GXQB 5B32G 5B1MA 3LJAC 1S32D 4Z66C 2CV5A 4Z2MH 3W96C 4E44A 3LJAB 4WNNB 2ZY3A 4Z66B 5B1MC 1KX5D 3W96B 4X23A 5GT3D 2CV5C 3O62A 3X1SD 5B1MB 3LZ0A 2Y2OA 5DNMD 2HIOA 5B2ID 2CV5B 4X23C 1BH9A 5B31D 3O62C 3LZ0C 5GSUD 4X23B 5CPID 2HIOC 3AZEA 2XD1A 3O62B 3LZ0B 1P3MA 2HIOB 3AN2B 1PZRA 5B2JA 3X1TD 4Z5TD 3AZEC 1BH9B 2RVQD 3H0LC 1P3MC 3AZEB 5B40D 5B2JC 1P3MB 3REKD 5B2JB 3B0CT 4YS3D 3FDDA 5CP6A 3WAAA 4ZUXA 2F8ND 3AFAD 4WU8A 2IO5C 3V9RA 1M1AD 3WAAC 5CP6B 1M19A 4ZUXC 2IO5B 4WU8C 3WAAB 4ZUXB 1KX4A 4LD9A 4WU8B 1M19C 3WTPA 3V9RB 5G49A 1KX3D 1M19B 1KX4C 4LD9C 5B24A 3WTPC 1KX4B 4LD9B 1BFMA 1S32A 2FJ7D 3WTPB 5B24C 3MGQD 3B0DC 5G49B 1KX5A 5B24B 1P3PA 3B0DB 1S32C 3W99A 5GXQD 3H0RC 2Y2PA 3X1SA 1S32B 5DNMA 3AZGA 1KX5C 1P3PC 3IP4C 4H9PA 3W99C 5B31A 3B0BA 1A7WA 1P3OD 3X1SC 1KX5B 1P3PB 5GSUA 2G5HC 5DNMC 5CPIA 3W99B 3AZGC 5CPKD 3X1SB 5B0ZD 2NZDD 5B31C 5GT0A 3UTAD 3AZGB 3X1TA 2CV5D 3WA9D 4Z5TA 5GSUC 4H9PB 5CPIC 3AZJD 5B31B 5KDMA 5GSUB 5CPIB 2AROD 5GT0C 5B40A 3X1TC 3AV1D 4Z5TC 3LZ0D 4XUJD 3KSYA 5AVCA 4J8UA 5GT0B 3REKA 3AN2D 3X1TB 4Z5TB 1N1JA 5B40C 5KDMB 4YS3A 2VQRA 4J8UC 5AVCC 3REKC 5B40B 1P3MD 2Y2NA 4J8UB 5AVCB 3REKB 2F8NA 4YS3C 3AFAA 4G91C 1N1JB 4KUDD 3REJD 4YS3B 1M1AA 4G91B 3VH5A 3AFAC 2F8NB 1M1AC 3AFAB 2PYOD 1M1AB 2Y2GA 1KX3A 5CP6D 3REID 1AOID 2ZM5A 1KX3C 2FJ7A 1KX3B 3VH6A 1TZYD 4HGAC 2FJ7C 2W8SA 4HGAB 2FJ7B 2BYKA 1P3OA 5B24D 5B31G 5CPKA 5B0ZA 4XZQD 2NZDA 3UTAA 4R8PA 3MNNA 3AZLA 1P3OC 3WA9A 3AZJA 2BYKB 1P3OB 5CPKC 5B0ZC 1P3KD 5C3IC 1P3PD 3W99D 2NZDC 2AROA 4R8PC 3MNNC 3UTAC 3AZLC 3AV1A 5CPKB 3WA9C 5B0ZB 3AZJC 4XUJA 4EO5C 5C3IB 3AN2A 3UTAB 4R8PB 2BG1A 3MNNB 3AZGD 3AZLB 3C1CD 3WA9B 3AZJB 4EO5B 2AROC 4NE5A 1P3IA 3AV1C 5E5AD 4XUJC 3AN2C 2AROB 3AV1B 4XUJB 3B0CW 4CAYA 5GT0D 1P3IC 2F8NG 4KUDA 3REJA 1P3IB 4CSRA 1P3BD 3MGRA 4J8UD 5AVCD 3REJC 4CAYB 4KUDC 2PYOA 3EPJA 1EQZD 4KUDB 3REJB 2XD5A 4CSRB 3MGSA 3EPHA 3MGRC 3REIA 1P34D 2Y2MA 2PYOC 1AOIA 5CHLB 3MGRB 1F66D 1B6WA 3MGSC 2PYOB 5CP6C 3REIC 3B6FA 3AZHD 1AOIC 3MGSB 1U35D 3REIB 1AOIB 1TZYA 3B6FC 2G5IC 2Y2HA 3B6FB 5B33D 1TZYC 4J8VD 3KFUG 1TZYB 3C1BD 5BS7A 3EG5B 4XZQA 1HTAA 5BS7C 1P3GD 1P3KA 4XZQC 2HUEC 3AZKD 4XZQB 2HUEB 4WZSB 1P3FD 2YFWA 3C1CA 2RIQA 4M6BA 1P3KC 3B6GD 1P3KB 5E5AA 1T3UA 3C1CC 4R8PD 3MNND 3AZLD 2YFWB 3C1CB 5E5AC 3EPLA 4WU9D 2ZY2A 1P3BA 5E5AB 4J8XD 2L5AA 3AL0C 2ZY4A 1P3BC 2LY8A 5DNND 4E45A 1EQZA 1P3ID 3KXBD 2DF4C 1P3BB 1W2EA 1P34A 1TAFA 3LZ1A 1EQZC 1F66A 3A6NA 1EQZB 1ULYA 3AZHA 1P34C 3LZ1C 4H9RA 2DQNC 1U35A 1P34B 1TAFB 3LZ1B 1F66C 3A6NC 3MGRD 5AV8B 3AZHC 1WWIA 1F66B 3A6NB 2JCHA 1U35C 3AZHB 2BYMA 4H9RB 5B33A 3MVDD 3MGSD 4J8VA 1U35B 2Y2LA 5JRGD 4JJND 3C1BA 5F99D 5B33C 4J8VC 3X1UA 3B6FD 2BYMB 5B33B 4J8VB 3UTBD 3C1BC 3H0MC 3AZMD 1P3GA 5CPJD 1ID3D 3C1BB 3AZKA 2JSSA 3X1VD 5AVBD 3X1UB 1P3FA 1P3GC 4H9SA 4KHAA 3AZKC 4J8WD 3B6GA 1P3GB 1P3FC 3AZKB 5AV5D 4H9SC 1P3FB 3VH5T 3B6GC 3WKJD 4YM6B 4WU9A 4KHAB 1WWSA 3B6GB 3AV2D 4QLCD 4J8XA 3A1KA 2CWEA 4WU9C 4G92C 2YFVA 3W98D 5DNNA 4WU9B 4J8XC 4G92B 3KXBA 3R45A 1P3AD 4J8XB 5DNNC 3AZFB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UUZ B;  2YFV B;  3VH6 T;  3KXB C;  3TU4 D;  5DNN B;  5BNX A;  1P3L A;  3KXB B;  1KU5 A;  3R45 B;  1H3O A;  4WV4 B;  5AV9 D;  1P3L C;  5BNX B;  1P3L B;  3NQU A;  5AV6 D;  3MVD A;  1HQ3 D;  1H3O B;  5JRG A;  3LZ1 D;  4JJN A;  5B32 D;  3KWQ D;  4H9N A;  5AV8 D;  3UT9 A;  4NFT A;  5F99 A;  3MVD C;  3A6N D;  5JRG C;  3NQU B;  3MVD B;  4JJN C;  3UTB A;  1ZLA A;  3UT9 C;  3AZM A;  4DRB A;  5JRG B;  5F99 C;  1ID3 A;  5CPJ A;  4JJN B;  4H9N B;  3UT9 B;  5F99 B;  1M18 D;  3UTB C;  1ZLA C;  3X1V A;  4KGC D;  5AVB A;  5BNV A;  3AZM C;  1ID3 C;  5CPJ C;  5BT1 D;  3UTB B;  1ZLA B;  3AZM B;  4J8W A;  3AZN D;  1ID3 B;  5CPJ B;  3W97 D;  3X1V C;  5AVB C;  3AZI A;  5B0Y D;  5AV5 A;  3AYW D;  3X1V B;  5AVB B;  5BNV B;  3X1U D;  4J8W C;  3REL D;  3WKJ A;  3AZI C;  4J8W B;  4NE3 A;  5AV5 C;  3REH D;  3AV2 A;  4QLC A;  4ZBJ C;  3AZI B;  3WKJ C;  5AV5 B;  1JFI A;  2NQB D;  4ZBJ B;  5B1L D;  3WKJ B;  3W98 A;  4YM6 D;  3AV2 C;  3KUY D;  1BH8 A;  4QLC C;  3MGP D;  3AV2 B;  3LEL D;  1P3A A;  4QLC B;  3W98 C;  5AY8 D;  1JFI B;  2F8N H;  3TU4 A;  3W98 B;  1P3A C;  1BH8 B;  1P3A B;  3TU4 C;  3AZF D;  5AV9 A;  4H9O A;  5GT3 A;  3TU4 B;  5BO0 A;  5B2I A;  5AV6 A;  4AWL C;  3NQJ A;  5AV9 C;  1HQ3 A;  3LJA D;  4H9Q A;  4Z66 D;  5GT3 C;  4AWL B;  5B32 A;  5AV9 B;  3KWQ A;  3W96 D;  4H9O B;  5AV8 A;  5B2I C;  5AV6 C;  5GT3 B;  1HQ3 C;  5B1M D;  1P3L D;  5DNM B;  5BO0 B;  5B2I B;  5AV6 B;  3NQJ B;  5B32 C;  1HQ3 B;  3KWQ C;  5AV8 C;  4H9Q B;  4Z2M G;  5B32 B;  3KWQ B;  1R4V A;  3WTP E;  4X23 D;  1M18 A;  3O62 D;  4KGC A;  4NE6 A;  2HIO D;  2RVQ C;  3AZN A;  1M18 C;  3W97 A;  4KGC C;  3UT9 D;  3AZE D;  5B0Y A;  1M18 B;  5BT1 C;  3AYW A;  4KGC B;  3AZN C;  3REL A;  1F1E A;  5B2J D;  3W97 C;  1ZLA D;  5FUG A;  3AZN B;  5B0Y C;  3REH A;  3AYW C;  3W97 B;  3VH5 W;  3X1U C;  3REL C;  5B0Y B;  3AYW B;  2NQB A;  5B1L A;  3REL B;  4YM6 A;  3REH C;  3KUY A;  5FUG B;  3MGP A;  4DRA A;  3REH B;  3LEL A;  3AZI D;  2NQB C;  5B1L C;  4YM6 C;  3KUY C;  5AY8 A;  3WAA D;  2NQB B;  3MGP C;  5B1L B;  4ZUX D;  3LEL C;  3KUY B;  4WU8 D;  3MGP B;  3LEL B;  3MGQ A;  5AY8 C;  3VH6 W;  1M19 D;  3AZF A;  5JA4 A;  5AY8 B;  4UUZ A;  5GXQ A;  1B67 A;  1KX4 D;  3MGQ C;  4LD9 D;  3AZF C;  3WTP D;  3MGQ B;  3LJA A;  1Q9C A;  4WNN A;  5GXQ C;  4Z66 A;  3W96 A;  2F8N K;  5JA4 B;  5GXQ B;  5B32 G;  5B1M A;  3LJA C;  1S32 D;  4Z66 C;  2CV5 A;  4Z2M H;  3W96 C;  4E44 A;  3LJA B;  4WNN B;  4Z66 B;  5B1M C;  1KX5 D;  3W96 B;  4X23 A;  5GT3 D;  2CV5 C;  3O62 A;  3X1S D;  5B1M B;  3LZ0 A;  5DNM D;  2HIO A;  5B2I D;  2CV5 B;  4X23 C;  1BH9 A;  5B31 D;  3O62 C;  3LZ0 C;  5GSU D;  4X23 B;  5CPI D;  2HIO C;  3AZE A;  3O62 B;  1P3M A;  3LZ0 B;  2HIO B;  3AN2 B;  5B2J A;  3X1T D;  4Z5T D;  3AZE C;  1BH9 B;  2RVQ D;  1P3M C;  3AZE B;  5B40 D;  5B2J C;  1P3M B;  3REK D;  5B2J B;  3B0C T;  4YS3 D;  5CP6 A;  3WAA A;  4ZUX A;  2F8N D;  3AFA D;  4WU8 A;  2IO5 C;  3V9R A;  1M1A D;  3WAA C;  5CP6 B;  1M19 A;  4ZUX C;  2IO5 B;  4WU8 C;  3WAA B;  4ZUX B;  1KX4 A;  4LD9 A;  4WU8 B;  1M19 C;  3WTP A;  3V9R B;  5G49 A;  1KX3 D;  1M19 B;  1KX4 C;  4LD9 C;  5B24 A;  3WTP C;  1KX4 B;  4LD9 B;  1BFM A;  1S32 A;  2FJ7 D;  3WTP B;  5B24 C;  3MGQ D;  3B0D C;  5G49 B;  1KX5 A;  5B24 B;  1P3P A;  3B0D B;  1S32 C;  3W99 A;  5GXQ D;  3X1S A;  1S32 B;  5DNM A;  3AZG A;  1KX5 C;  1P3P C;  4H9P A;  3W99 C;  5B31 A;  3B0B A;  1A7W A;  1P3O D;  3X1S C;  1KX5 B;  1P3P B;  5GSU A;  5DNM C;  5CPI A;  3W99 B;  3AZG C;  5CPK D;  3X1S B;  5B0Z D;  2NZD D;  5B31 C;  5GT0 A;  3UTA D;  3AZG B;  3X1T A;  2CV5 D;  3WA9 D;  4Z5T A;  5GSU C;  4H9P B;  5CPI C;  3AZJ D;  5B31 B;  5KDM A;  5GSU B;  5CPI B;  2ARO D;  5GT0 C;  5B40 A;  3X1T C;  3AV1 D;  4Z5T C;  3LZ0 D;  4XUJ D;  3KSY A;  5AVC A;  4J8U A;  5GT0 B;  3REK A;  3AN2 D;  3X1T B;  4Z5T B;  1N1J A;  5B40 C;  5KDM B;  4YS3 A;  4J8U C;  5AVC C;  3REK C;  5B40 B;  1P3M D;  4J8U B;  5AVC B;  3REK B;  2F8N A;  4YS3 C;  3AFA A;  4G91 C;  1N1J B;  4KUD D;  3REJ D;  4YS3 B;  1M1A A;  4G91 B;  3VH5 A;  3AFA C;  2F8N B;  1M1A C;  3AFA B;  2PYO D;  1M1A B;  1KX3 A;  5CP6 D;  3REI D;  1AOI D;  1KX3 C;  2FJ7 A;  1KX3 B;  3VH6 A;  1TZY D;  4HGA C;  2FJ7 C;  4HGA B;  2FJ7 B;  2BYK A;  1P3O A;  5B24 D;  5B31 G;  5CPK A;  5B0Z A;  4XZQ D;  2NZD A;  3UTA A;  4R8P A;  3MNN A;  3AZL A;  1P3O C;  3WA9 A;  3AZJ A;  2BYK B;  1P3O B;  5CPK C;  5B0Z C;  1P3K D;  5C3I C;  1P3P D;  3W99 D;  2NZD C;  2ARO A;  4R8P C;  3MNN C;  3UTA C;  3AZL C;  3AV1 A;  5CPK B;  3WA9 C;  5B0Z B;  3AZJ C;  4XUJ A;  4EO5 C;  5C3I B;  3AN2 A;  3UTA B;  4R8P B;  3MNN B;  3AZG D;  3AZL B;  2NZD B;  3C1C D;  3WA9 B;  3AZJ B;  4EO5 B;  2ARO C;  4NE5 A;  1P3I A;  3AV1 C;  5E5A D;  4XUJ C;  3AN2 C;  2ARO B;  3AV1 B;  4XUJ B;  3B0C W;  4CAY A;  5GT0 D;  1P3I C;  2F8N G;  4KUD A;  3REJ A;  1P3I B;  4CSR A;  1P3B D;  3MGR A;  4J8U D;  5AVC D;  3REJ C;  4CAY B;  4KUD C;  2PYO A;  1EQZ D;  4KUD B;  3REJ B;  4CSR B;  3MGS A;  3MGR C;  3REI A;  1P34 D;  2PYO C;  1AOI A;  5CHL B;  3MGR B;  1F66 D;  1B6W A;  3MGS C;  2PYO B;  5CP6 C;  3REI C;  3B6F A;  3AZH D;  1AOI C;  3MGS B;  1U35 D;  3REI B;  1AOI B;  1TZY A;  3B6F C;  3B6F B;  5B33 D;  1TZY C;  4J8V D;  1TZY B;  3C1B D;  5BS7 A;  4XZQ A;  1HTA A;  5BS7 C;  1P3G D;  1P3K A;  4XZQ C;  2HUE C;  3AZK D;  4XZQ B;  2HUE B;  4WZS B;  1P3F D;  2YFW A;  3C1C A;  1P3K C;  4M6B A;  3B6G D;  1P3K B;  5E5A A;  3C1C C;  4R8P D;  3MNN D;  3AZL D;  2YFW B;  3C1C B;  5E5A C;  4WU9 D;  1P3B A;  5E5A B;  4J8X D;  2L5A A;  1P3B C;  2LY8 A;  5DNN D;  4E45 A;  1EQZ A;  1P3I D;  3KXB D;  1P3B B;  1P34 A;  1TAF A;  3LZ1 A;  1EQZ C;  1F66 A;  3A6N A;  1EQZ B;  1ULY A;  3AZH A;  1P34 C;  3LZ1 C;  4H9R A;  1U35 A;  1P34 B;  1TAF B;  3LZ1 B;  1F66 C;  3A6N C;  3MGR D;  5AV8 B;  3AZH C;  1WWI A;  1F66 B;  3A6N B;  1U35 C;  3AZH B;  2BYM A;  4H9R B;  5B33 A;  3MVD D;  3MGS D;  4J8V A;  1U35 B;  5JRG D;  4JJN D;  3C1B A;  5F99 D;  5B33 C;  4J8V C;  3X1U A;  3B6F D;  2BYM B;  5B33 B;  4J8V B;  3UTB D;  3C1B C;  3AZM D;  1P3G A;  5CPJ D;  1ID3 D;  3C1B B;  3AZK A;  2JSS A;  3X1V D;  5AVB D;  3X1U B;  1P3F A;  1P3G C;  4H9S A;  4KHA A;  3AZK C;  4J8W D;  3B6G A;  1P3G B;  1P3F C;  3AZK B;  5AV5 D;  4H9S C;  1P3F B;  3VH5 T;  3B6G C;  3WKJ D;  4YM6 B;  4WU9 A;  4KHA B;  1WWS A;  3B6G B;  3AV2 D;  4QLC D;  4J8X A;  2CWE A;  4WU9 C;  4G92 C;  2YFV A;  3W98 D;  5DNN A;  4WU9 B;  4J8X C;  4G92 B;  3KXB A;  3R45 A;  1P3A D;  4J8X B;  5DNN C;  3AZF B; 
#chains in the Genus database with same CATH topology
 4UUZ B;  2YFV B;  3VH6 T;  3KXB C;  3TU4 D;  5DNN B;  5BNX A;  1P3L A;  3KXB B;  1KU5 A;  3R45 B;  1H3O A;  2FFF B;  4WV4 B;  5AV9 D;  1P3L C;  5BNX B;  1P3L B;  3NQU A;  2UWX A;  5AV6 D;  3MVD A;  1HQ3 D;  1H3O B;  5JRG A;  2Y2K A;  3LZ1 D;  4JJN A;  5B32 D;  3KWQ D;  4H9N A;  5AV8 D;  3UT9 A;  4NFT A;  5F99 A;  3MVD C;  3A6N D;  2Y2I A;  5JRG C;  3NQU B;  3MVD B;  4JJN C;  3UTB A;  1ZLA A;  3UT9 C;  3AZM A;  4DRB A;  5JRG B;  5F99 C;  1ID3 A;  5CPJ A;  4JJN B;  4H9N B;  3UT9 B;  5F99 B;  1M18 D;  3UTB C;  1ZLA C;  3X1V A;  4KGC D;  5AVB A;  5BNV A;  3AZM C;  1ID3 C;  5CPJ C;  5BT1 D;  3UTB B;  1ZLA B;  3AZM B;  2Y2J A;  4J8W A;  3AZN D;  1ID3 B;  5CPJ B;  3W97 D;  3X1V C;  2JE5 A;  5AVB C;  3AZI A;  5B0Y D;  5AV5 A;  3AYW D;  3X1V B;  5AVB B;  5BNV B;  3X1U D;  4J8W C;  3REL D;  3WKJ A;  3AZI C;  4J8W B;  1Z2C B;  3EPK A;  4NE3 A;  5AV5 C;  3REH D;  3AV2 A;  4QLC A;  4ZBJ C;  3AZI B;  3WKJ C;  5AV5 B;  1JFI A;  2NQB D;  4ZBJ B;  5B1L D;  3WKJ B;  3W98 A;  4YM6 D;  3AV2 C;  3KUY D;  1BH8 A;  4QLC C;  3MGP D;  3AV2 B;  3LEL D;  1P3A A;  4QLC B;  3W98 C;  5AY8 D;  1JFI B;  2F8N H;  3TU4 A;  3W98 B;  2NZD B;  1P3A C;  1BH8 B;  1P3A B;  3TU4 C;  3AZF D;  5AV9 A;  4H9O A;  2J8P A;  5GT3 A;  3TU4 B;  5BO0 A;  5B2I A;  5AV6 A;  4AWL C;  3NQJ A;  5AV9 C;  1HQ3 A;  3LJA D;  4H9Q A;  4Z66 D;  5GT3 C;  4AWL B;  5B32 A;  5AV9 B;  3KWQ A;  3W96 D;  4H9O B;  5AV8 A;  5B2I C;  5AV6 C;  5GT3 B;  1HQ3 C;  5B1M D;  1P3L D;  4UPK A;  5BO0 B;  5B2I B;  5DNM B;  5AV6 B;  3NQJ B;  5B32 C;  1HQ3 B;  3KWQ C;  5AV8 C;  4H9Q B;  4Z2M G;  5B32 B;  3KWQ B;  1R4V A;  3WTP E;  4X23 D;  1M18 A;  3O62 D;  4KGC A;  4NE6 A;  2HIO D;  2RVQ C;  3AZN A;  1M18 C;  3W97 A;  4KGC C;  3UT9 D;  3AZE D;  5B0Y A;  1M18 B;  5BT1 C;  3AYW A;  4KGC B;  3A1I A;  3AZN C;  3REL A;  4DQY B;  1F1E A;  5B2J D;  3W97 C;  1ZLA D;  5FUG A;  3AZN B;  5B0Y C;  3REH A;  3AYW C;  3W97 B;  3VH5 W;  3X1U C;  3REL C;  5B0Y B;  3AYW B;  4WJ3 C;  2NQB A;  5B1L A;  3REL B;  4YM6 A;  3REH C;  3KUY A;  5FUG B;  3MGP A;  4DRA A;  3REH B;  3LEL A;  3AZI D;  2NQB C;  5B1L C;  4YM6 C;  2F2A C;  3KUY C;  5AY8 A;  3WAA D;  2NQB B;  3MGP C;  5B1L B;  4ZUX D;  3LEL C;  3KUY B;  4WU8 D;  2ZY5 A;  3MGP B;  3LEL B;  3MGQ A;  5AY8 C;  3VH6 W;  1M19 D;  3AZF A;  5JA4 A;  3F6T A;  5AY8 B;  3P5J B;  4UUZ A;  5GXQ A;  1B67 A;  1KX4 D;  3MGQ C;  4LD9 D;  3AZF C;  3WTP D;  3MGQ B;  3LJA A;  1Q9C A;  2Y2Q A;  4WNN A;  5GXQ C;  4Z66 A;  3W96 A;  2F8N K;  5JA4 B;  5GXQ B;  5B32 G;  5B1M A;  3LJA C;  1S32 D;  4Z66 C;  2CV5 A;  4Z2M H;  3W96 C;  4E44 A;  3LJA B;  4WNN B;  2ZY3 A;  4Z66 B;  5B1M C;  1KX5 D;  3W96 B;  4X23 A;  5GT3 D;  2CV5 C;  3O62 A;  3X1S D;  5B1M B;  3LZ0 A;  2Y2O A;  5DNM D;  2HIO A;  5B2I D;  2CV5 B;  4X23 C;  1BH9 A;  5B31 D;  3O62 C;  3LZ0 C;  5GSU D;  4X23 B;  5CPI D;  2HIO C;  3AZE A;  2XD1 A;  3O62 B;  3LZ0 B;  1P3M A;  2HIO B;  3AN2 B;  1PZR A;  5B2J A;  3X1T D;  4Z5T D;  3AZE C;  1BH9 B;  2RVQ D;  3H0L C;  1P3M C;  3AZE B;  5B40 D;  5B2J C;  1P3M B;  3REK D;  5B2J B;  3B0C T;  4YS3 D;  3FDD A;  5CP6 A;  3WAA A;  4ZUX A;  2F8N D;  3AFA D;  4WU8 A;  2IO5 C;  3V9R A;  1M1A D;  3WAA C;  5CP6 B;  1M19 A;  4ZUX C;  2IO5 B;  4WU8 C;  3WAA B;  4ZUX B;  1KX4 A;  4LD9 A;  4WU8 B;  1M19 C;  3WTP A;  3V9R B;  5G49 A;  1KX3 D;  1M19 B;  1KX4 C;  4LD9 C;  5B24 A;  3WTP C;  1KX4 B;  4LD9 B;  1BFM A;  1S32 A;  2FJ7 D;  3WTP B;  5B24 C;  3MGQ D;  3B0D C;  5G49 B;  1KX5 A;  5B24 B;  1P3P A;  3B0D B;  1S32 C;  3W99 A;  5GXQ D;  3H0R C;  2Y2P A;  3X1S A;  1S32 B;  5DNM A;  3AZG A;  1KX5 C;  1P3P C;  3IP4 C;  4H9P A;  3W99 C;  5B31 A;  3B0B A;  1A7W A;  1P3O D;  3X1S C;  1KX5 B;  1P3P B;  5GSU A;  2G5H C;  5DNM C;  5CPI A;  3W99 B;  3AZG C;  5CPK D;  3X1S B;  5B0Z D;  2NZD D;  5B31 C;  5GT0 A;  3UTA D;  3AZG B;  3X1T A;  2CV5 D;  3WA9 D;  4Z5T A;  5GSU C;  4H9P B;  5CPI C;  3AZJ D;  5B31 B;  5KDM A;  5GSU B;  5CPI B;  2ARO D;  5GT0 C;  5B40 A;  3X1T C;  3AV1 D;  4Z5T C;  3LZ0 D;  4XUJ D;  3KSY A;  5AVC A;  4J8U A;  5GT0 B;  3REK A;  3AN2 D;  3X1T B;  4Z5T B;  1N1J A;  5B40 C;  5KDM B;  4YS3 A;  2VQR A;  4J8U C;  5AVC C;  3REK C;  5B40 B;  1P3M D;  2Y2N A;  4J8U B;  5AVC B;  3REK B;  2F8N A;  4YS3 C;  3AFA A;  4G91 C;  1N1J B;  4KUD D;  3REJ D;  4YS3 B;  1M1A A;  4G91 B;  3VH5 A;  3AFA C;  2F8N B;  1M1A C;  3AFA B;  2PYO D;  1M1A B;  2Y2G A;  1KX3 A;  5CP6 D;  3REI D;  1AOI D;  2ZM5 A;  1KX3 C;  2FJ7 A;  1KX3 B;  3VH6 A;  1TZY D;  4HGA C;  2FJ7 C;  2W8S A;  4HGA B;  2FJ7 B;  2BYK A;  1P3O A;  5B24 D;  5B31 G;  5CPK A;  5B0Z A;  4XZQ D;  2NZD A;  3UTA A;  4R8P A;  3MNN A;  3AZL A;  1P3O C;  3WA9 A;  3AZJ A;  2BYK B;  1P3O B;  5CPK C;  5B0Z C;  1P3K D;  5C3I C;  1P3P D;  3W99 D;  2NZD C;  2ARO A;  4R8P C;  3MNN C;  3UTA C;  3AZL C;  3AV1 A;  5CPK B;  3WA9 C;  5B0Z B;  3AZJ C;  4XUJ A;  4EO5 C;  5C3I B;  3AN2 A;  3UTA B;  4R8P B;  2BG1 A;  3MNN B;  3AZG D;  3AZL B;  3C1C D;  3WA9 B;  3AZJ B;  4EO5 B;  2ARO C;  4NE5 A;  1P3I A;  3AV1 C;  5E5A D;  4XUJ C;  3AN2 C;  2ARO B;  3AV1 B;  4XUJ B;  3B0C W;  4CAY A;  5GT0 D;  1P3I C;  2F8N G;  4KUD A;  3REJ A;  1P3I B;  4CSR A;  1P3B D;  3MGR A;  4J8U D;  5AVC D;  3REJ C;  4CAY B;  4KUD C;  2PYO A;  3EPJ A;  1EQZ D;  4KUD B;  3REJ B;  2XD5 A;  4CSR B;  3MGS A;  3EPH A;  3MGR C;  3REI A;  1P34 D;  2Y2M A;  2PYO C;  1AOI A;  5CHL B;  3MGR B;  1F66 D;  1B6W A;  3MGS C;  2PYO B;  5CP6 C;  3REI C;  3B6F A;  3AZH D;  1AOI C;  3MGS B;  1U35 D;  3REI B;  1AOI B;  1TZY A;  3B6F C;  2G5I C;  2Y2H A;  3B6F B;  5B33 D;  1TZY C;  4J8V D;  3KFU G;  1TZY B;  3C1B D;  5BS7 A;  3EG5 B;  4XZQ A;  1HTA A;  5BS7 C;  1P3G D;  1P3K A;  4XZQ C;  2HUE C;  3AZK D;  4XZQ B;  2HUE B;  4WZS B;  1P3F D;  2YFW A;  3C1C A;  2RIQ A;  4M6B A;  1P3K C;  3B6G D;  1P3K B;  5E5A A;  1T3U A;  3C1C C;  4R8P D;  3MNN D;  3AZL D;  2YFW B;  3C1C B;  5E5A C;  3EPL A;  4WU9 D;  2ZY2 A;  1P3B A;  5E5A B;  4J8X D;  2L5A A;  3AL0 C;  2ZY4 A;  1P3B C;  2LY8 A;  5DNN D;  4E45 A;  1EQZ A;  1P3I D;  3KXB D;  2DF4 C;  1P3B B;  1W2E A;  1P34 A;  1TAF A;  3LZ1 A;  1EQZ C;  1F66 A;  3A6N A;  1EQZ B;  1ULY A;  3AZH A;  1P34 C;  3LZ1 C;  4H9R A;  2DQN C;  1U35 A;  1P34 B;  1TAF B;  3LZ1 B;  1F66 C;  3A6N C;  3MGR D;  5AV8 B;  3AZH C;  1WWI A;  1F66 B;  3A6N B;  2JCH A;  1U35 C;  3AZH B;  2BYM A;  4H9R B;  5B33 A;  3MVD D;  3MGS D;  4J8V A;  1U35 B;  2Y2L A;  5JRG D;  4JJN D;  3C1B A;  5F99 D;  5B33 C;  4J8V C;  3X1U A;  3B6F D;  2BYM B;  5B33 B;  4J8V B;  3UTB D;  3C1B C;  3H0M C;  3AZM D;  1P3G A;  5CPJ D;  1ID3 D;  3C1B B;  3AZK A;  2JSS A;  3X1V D;  5AVB D;  3X1U B;  1P3F A;  1P3G C;  4H9S A;  4KHA A;  3AZK C;  4J8W D;  3B6G A;  1P3G B;  1P3F C;  3AZK B;  5AV5 D;  4H9S C;  1P3F B;  3VH5 T;  3B6G C;  3WKJ D;  4YM6 B;  4WU9 A;  4KHA B;  1WWS A;  3B6G B;  3AV2 D;  4QLC D;  4J8X A;  3A1K A;  2CWE A;  4WU9 C;  4G92 C;  2YFV A;  3W98 D;  5DNN A;  4WU9 B;  4J8X C;  4G92 B;  3KXB A;  3R45 A;  1P3A D;  4J8X B;  5DNN C;  3AZF B; 
#chains in the Genus database with same CATH homology
 4UUZ B;  2YFV B;  3VH6 T;  3KXB C;  3TU4 D;  5DNN B;  5BNX A;  1P3L A;  3KXB B;  1KU5 A;  3R45 B;  1H3O A;  2FFF B;  4WV4 B;  5AV9 D;  1P3L C;  5BNX B;  1P3L B;  3NQU A;  2UWX A;  5AV6 D;  3MVD A;  1HQ3 D;  1H3O B;  5JRG A;  2Y2K A;  3LZ1 D;  4JJN A;  5B32 D;  3KWQ D;  4H9N A;  5AV8 D;  3UT9 A;  4NFT A;  5F99 A;  3MVD C;  3A6N D;  2Y2I A;  5JRG C;  3NQU B;  3MVD B;  4JJN C;  3UTB A;  1ZLA A;  3UT9 C;  3AZM A;  4DRB A;  5JRG B;  5F99 C;  1ID3 A;  5CPJ A;  4JJN B;  4H9N B;  3UT9 B;  5F99 B;  1M18 D;  3UTB C;  1ZLA C;  3X1V A;  4KGC D;  5AVB A;  5BNV A;  3AZM C;  1ID3 C;  5CPJ C;  5BT1 D;  3UTB B;  1ZLA B;  3AZM B;  2Y2J A;  4J8W A;  3AZN D;  1ID3 B;  5CPJ B;  3W97 D;  3X1V C;  2JE5 A;  5AVB C;  3AZI A;  5B0Y D;  5AV5 A;  3AYW D;  3X1V B;  5AVB B;  5BNV B;  3X1U D;  4J8W C;  3REL D;  3WKJ A;  3AZI C;  4J8W B;  1Z2C B;  3EPK A;  4NE3 A;  5AV5 C;  3REH D;  3AV2 A;  4QLC A;  4ZBJ C;  3AZI B;  3WKJ C;  5AV5 B;  1JFI A;  2NQB D;  4ZBJ B;  5B1L D;  3WKJ B;  3W98 A;  4YM6 D;  3AV2 C;  3KUY D;  1BH8 A;  4QLC C;  3MGP D;  3AV2 B;  3LEL D;  1P3A A;  4QLC B;  3W98 C;  5AY8 D;  1JFI B;  2F8N H;  3TU4 A;  3W98 B;  2NZD B;  1P3A C;  1BH8 B;  1P3A B;  3TU4 C;  3AZF D;  5AV9 A;  4H9O A;  2J8P A;  5GT3 A;  3TU4 B;  5BO0 A;  5B2I A;  5AV6 A;  4AWL C;  3NQJ A;  5AV9 C;  1HQ3 A;  3LJA D;  4H9Q A;  4Z66 D;  5GT3 C;  4AWL B;  5B32 A;  5AV9 B;  3KWQ A;  3W96 D;  4H9O B;  5AV8 A;  5B2I C;  5AV6 C;  5GT3 B;  1HQ3 C;  5B1M D;  1P3L D;  4UPK A;  5BO0 B;  5B2I B;  5DNM B;  5AV6 B;  3NQJ B;  5B32 C;  1HQ3 B;  3KWQ C;  5AV8 C;  4H9Q B;  4Z2M G;  5B32 B;  3KWQ B;  1R4V A;  3WTP E;  4X23 D;  1M18 A;  3O62 D;  4KGC A;  4NE6 A;  2HIO D;  2RVQ C;  3AZN A;  1M18 C;  3W97 A;  4KGC C;  3UT9 D;  3AZE D;  5B0Y A;  1M18 B;  5BT1 C;  3AYW A;  4KGC B;  3A1I A;  3AZN C;  3REL A;  4DQY B;  1F1E A;  5B2J D;  3W97 C;  1ZLA D;  5FUG A;  3AZN B;  5B0Y C;  3REH A;  3AYW C;  3W97 B;  3VH5 W;  3X1U C;  3REL C;  5B0Y B;  3AYW B;  4WJ3 C;  2NQB A;  5B1L A;  3REL B;  4YM6 A;  3REH C;  3KUY A;  5FUG B;  3MGP A;  4DRA A;  3REH B;  3LEL A;  3AZI D;  2NQB C;  5B1L C;  4YM6 C;  2F2A C;  3KUY C;  5AY8 A;  3WAA D;  2NQB B;  3MGP C;  5B1L B;  4ZUX D;  3LEL C;  3KUY B;  4WU8 D;  2ZY5 A;  3MGP B;  3LEL B;  3MGQ A;  5AY8 C;  3VH6 W;  1M19 D;  3AZF A;  5JA4 A;  3F6T A;  5AY8 B;  3P5J B;  4UUZ A;  5GXQ A;  1B67 A;  1KX4 D;  3MGQ C;  4LD9 D;  3AZF C;  3WTP D;  3MGQ B;  3LJA A;  1Q9C A;  2Y2Q A;  4WNN A;  5GXQ C;  4Z66 A;  3W96 A;  2F8N K;  5JA4 B;  5GXQ B;  5B32 G;  5B1M A;  3LJA C;  1S32 D;  4Z66 C;  2CV5 A;  4Z2M H;  3W96 C;  4E44 A;  3LJA B;  4WNN B;  2ZY3 A;  4Z66 B;  5B1M C;  1KX5 D;  3W96 B;  4X23 A;  5GT3 D;  2CV5 C;  3O62 A;  3X1S D;  5B1M B;  3LZ0 A;  2Y2O A;  5DNM D;  2HIO A;  5B2I D;  2CV5 B;  4X23 C;  1BH9 A;  5B31 D;  3O62 C;  3LZ0 C;  5GSU D;  4X23 B;  5CPI D;  2HIO C;  3AZE A;  2XD1 A;  3O62 B;  3LZ0 B;  1P3M A;  2HIO B;  3AN2 B;  1PZR A;  5B2J A;  3X1T D;  4Z5T D;  3AZE C;  1BH9 B;  2RVQ D;  3H0L C;  1P3M C;  3AZE B;  5B40 D;  5B2J C;  1P3M B;  3REK D;  5B2J B;  3B0C T;  4YS3 D;  3FDD A;  5CP6 A;  3WAA A;  4ZUX A;  2F8N D;  3AFA D;  4WU8 A;  2IO5 C;  3V9R A;  1M1A D;  3WAA C;  5CP6 B;  1M19 A;  4ZUX C;  2IO5 B;  4WU8 C;  3WAA B;  4ZUX B;  1KX4 A;  4LD9 A;  4WU8 B;  1M19 C;  3WTP A;  3V9R B;  5G49 A;  1KX3 D;  1M19 B;  1KX4 C;  4LD9 C;  5B24 A;  3WTP C;  1KX4 B;  4LD9 B;  1BFM A;  1S32 A;  2FJ7 D;  3WTP B;  5B24 C;  3MGQ D;  3B0D C;  5G49 B;  1KX5 A;  5B24 B;  1P3P A;  3B0D B;  1S32 C;  3W99 A;  5GXQ D;  3H0R C;  2Y2P A;  3X1S A;  1S32 B;  5DNM A;  3AZG A;  1KX5 C;  1P3P C;  3IP4 C;  4H9P A;  3W99 C;  5B31 A;  3B0B A;  1A7W A;  1P3O D;  3X1S C;  1KX5 B;  1P3P B;  5GSU A;  2G5H C;  5DNM C;  5CPI A;  3W99 B;  3AZG C;  5CPK D;  3X1S B;  5B0Z D;  2NZD D;  5B31 C;  5GT0 A;  3UTA D;  3AZG B;  3X1T A;  2CV5 D;  3WA9 D;  4Z5T A;  5GSU C;  4H9P B;  5CPI C;  3AZJ D;  5B31 B;  5KDM A;  5GSU B;  5CPI B;  2ARO D;  5GT0 C;  5B40 A;  3X1T C;  3AV1 D;  4Z5T C;  3LZ0 D;  4XUJ D;  3KSY A;  5AVC A;  4J8U A;  5GT0 B;  3REK A;  3AN2 D;  3X1T B;  4Z5T B;  1N1J A;  5B40 C;  5KDM B;  4YS3 A;  2VQR A;  4J8U C;  5AVC C;  3REK C;  5B40 B;  1P3M D;  2Y2N A;  4J8U B;  5AVC B;  3REK B;  2F8N A;  4YS3 C;  3AFA A;  4G91 C;  1N1J B;  4KUD D;  3REJ D;  4YS3 B;  1M1A A;  4G91 B;  3VH5 A;  3AFA C;  2F8N B;  1M1A C;  3AFA B;  2PYO D;  1M1A B;  2Y2G A;  1KX3 A;  5CP6 D;  3REI D;  1AOI D;  2ZM5 A;  1KX3 C;  2FJ7 A;  1KX3 B;  3VH6 A;  1TZY D;  4HGA C;  2FJ7 C;  2W8S A;  4HGA B;  2FJ7 B;  2BYK A;  1P3O A;  5B24 D;  5B31 G;  5CPK A;  5B0Z A;  4XZQ D;  2NZD A;  3UTA A;  4R8P A;  3MNN A;  3AZL A;  1P3O C;  3WA9 A;  3AZJ A;  2BYK B;  1P3O B;  5CPK C;  5B0Z C;  1P3K D;  5C3I C;  1P3P D;  3W99 D;  2NZD C;  2ARO A;  4R8P C;  3MNN C;  3UTA C;  3AZL C;  3AV1 A;  5CPK B;  3WA9 C;  5B0Z B;  3AZJ C;  4XUJ A;  4EO5 C;  5C3I B;  3AN2 A;  3UTA B;  4R8P B;  2BG1 A;  3MNN B;  3AZG D;  3AZL B;  3C1C D;  3WA9 B;  3AZJ B;  4EO5 B;  2ARO C;  4NE5 A;  1P3I A;  3AV1 C;  5E5A D;  4XUJ C;  3AN2 C;  2ARO B;  3AV1 B;  4XUJ B;  3B0C W;  4CAY A;  5GT0 D;  1P3I C;  2F8N G;  4KUD A;  3REJ A;  1P3I B;  4CSR A;  1P3B D;  3MGR A;  4J8U D;  5AVC D;  3REJ C;  4CAY B;  4KUD C;  2PYO A;  3EPJ A;  1EQZ D;  4KUD B;  3REJ B;  2XD5 A;  4CSR B;  3MGS A;  3EPH A;  3MGR C;  3REI A;  1P34 D;  2Y2M A;  2PYO C;  1AOI A;  5CHL B;  3MGR B;  1F66 D;  1B6W A;  3MGS C;  2PYO B;  5CP6 C;  3REI C;  3B6F A;  3AZH D;  1AOI C;  3MGS B;  1U35 D;  3REI B;  1AOI B;  1TZY A;  3B6F C;  2G5I C;  2Y2H A;  3B6F B;  5B33 D;  1TZY C;  4J8V D;  3KFU G;  1TZY B;  3C1B D;  5BS7 A;  3EG5 B;  4XZQ A;  1HTA A;  5BS7 C;  1P3G D;  1P3K A;  4XZQ C;  2HUE C;  3AZK D;  4XZQ B;  2HUE B;  4WZS B;  1P3F D;  2YFW A;  3C1C A;  2RIQ A;  4M6B A;  1P3K C;  3B6G D;  1P3K B;  5E5A A;  1T3U A;  3C1C C;  4R8P D;  3MNN D;  3AZL D;  2YFW B;  3C1C B;  5E5A C;  3EPL A;  4WU9 D;  2ZY2 A;  1P3B A;  5E5A B;  4J8X D;  2L5A A;  3AL0 C;  2ZY4 A;  1P3B C;  2LY8 A;  5DNN D;  4E45 A;  1EQZ A;  1P3I D;  3KXB D;  2DF4 C;  1P3B B;  1W2E A;  1P34 A;  1TAF A;  3LZ1 A;  1EQZ C;  1F66 A;  3A6N A;  1EQZ B;  1ULY A;  3AZH A;  1P34 C;  3LZ1 C;  4H9R A;  2DQN C;  1U35 A;  1P34 B;  1TAF B;  3LZ1 B;  1F66 C;  3A6N C;  3MGR D;  5AV8 B;  3AZH C;  1WWI A;  1F66 B;  3A6N B;  2JCH A;  1U35 C;  3AZH B;  2BYM A;  4H9R B;  5B33 A;  3MVD D;  3MGS D;  4J8V A;  1U35 B;  2Y2L A;  5JRG D;  4JJN D;  3C1B A;  5F99 D;  5B33 C;  4J8V C;  3X1U A;  3B6F D;  2BYM B;  5B33 B;  4J8V B;  3UTB D;  3C1B C;  3H0M C;  3AZM D;  1P3G A;  5CPJ D;  1ID3 D;  3C1B B;  3AZK A;  2JSS A;  3X1V D;  5AVB D;  3X1U B;  1P3F A;  1P3G C;  4H9S A;  4KHA A;  3AZK C;  4J8W D;  3B6G A;  1P3G B;  1P3F C;  3AZK B;  5AV5 D;  4H9S C;  1P3F B;  3VH5 T;  3B6G C;  3WKJ D;  4YM6 B;  4WU9 A;  4KHA B;  1WWS A;  3B6G B;  3AV2 D;  4QLC D;  4J8X A;  3A1K A;  2CWE A;  4WU9 C;  4G92 C;  2YFV A;  3W98 D;  5DNN A;  4WU9 B;  4J8X C;  4G92 B;  3KXB A;  3R45 A;  1P3A D;  4J8X B;  5DNN C;  3AZF B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...