3B0DB

Crystal structure of the chicken cenp-t histone fold/cenp-w complex, crystal form ii
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
95
structure length
95
Chain Sequence
EIASSLIKQIFSHYVKTPVTRDAYKIVEKCSERYFKQISSDLEAYSQHAGRKTVEMADVELLMRRQGLVTDKMPLHVLVERHLPLEYRKLLIPIA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Dna binding protein
molecule keywords Centromere protein T
publication title CENP-T-W-S-X Forms a Unique Centromeric Chromatin Structure with a Histone-like Fold.
pubmed doi rcsb
source organism Gallus gallus
total genus 31
structure length 95
sequence length 95
chains with identical sequence T
ec nomenclature
pdb deposition date 2011-06-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3b0dB00
3NQUA 1P3AB 4WU8C 3AZNC 5GXQA 4X23C 2AROA 3MGQD 4X23A 3LJAC 3WA9A 3AZHA 4WU8B 3AZNB 3VH6T 5AV9A 4X23B 5BNXB 3LJAB 3X1VD 3AZLC 5FUGA 3AZND 4WU8D 3AZLA 5E5AC 5GT0A 5E5AA 3VH5A 3LJAD 5AVBC 3AZLB 5E5AB 3WTPE 5AVBB 1JFIA 5DNNC 2HIOA 5B2JA 4H9RB 1P3KD 3LZ1C 4WNNB 1M19D 3LZ1A 1JFIB 1P34A 3X1TD 1TZYC 5DNNB 3AFAA 2BYMB 3LZ1B 4J8VD 1TZYB 4H9QA 1P3FD 1BH8A 1TZYD 4YM6C 4J8UD 4YM6B 5BS7C 5BS7A 5F99C 2YFWB 4YM6D 1P3GD 5F99B 4NE6A 1P3LA 3MNND 1H3OA 5CPKD 2F8NH 3LELA 5CPJA 5AVCC 4WV4B 3KXBD 4WU9D 4J8WD 5AVCB 5AV6D 1P3IC 3X1SD 5B40A 4ZUXA 4XUJA 2F8ND 1P3IB 3AZGD 1BH9B 5GT3A 1ZLAC 3B6GC 4H9PB 1P3ID 1ZLAB 2FJ7A 3B6GB 5B1LD 4J8XA 3C1CC 1ZLAD 2LY8A 3C1CA 3REHA 3WTPD 5B1MD 3LZ0D 4JJNA 5AV5C 3B0CW 5AV5A 3C1CB 3WAAC 5KDMA 1U35C 1KX5C 5AV5B 3W99C 1U35B 1KX5B 3W99A 3WAAB 4LD9D 3W99B 3AZIC 2IO5C 1U35D 3WAAD 3AZIA 1P3BA 3AN2D 4YS3C 3AZIB 2IO5B 5B0YC 4YS3B 5B0YA 2PYOA 5B0YB 3W97A 3REJC 3W98D 1M18D 4QLCC 1KX4C 3REJB 5BNVA 4QLCB 3MGPD 3REJD 1KX4B 3UT9D 3VH5W 1S32C 4QLCD 4CSRB 1KX3A 1KX4D 5AY8D 3MGRC 5AV8A 3AV1A 5B32D 1S32B 5JRGC 3REKC 3MGRB 3REKA 3AZEC 1F66A 2NQBA 3MGSA 3AZFC 5JRGB 3X1UD 2NZDC 3REIC 3REKB 5B2IC 5DNMA 3AZEB 3AZMC 1P3PA 5JRGD 1M1AC 3AZMA 3AZFB 3AYWA 1M1AA 2NZDB 3REIB 5B2IB 3AZMB 5B24D 1M1AB 2NZDD 3C1BD 5B2ID 3TU4C 3O62D 4H9SA 3TU4A 3MVDD 2NQBD 5GXQC 2AROC 3TU4B 3NQUB 1P3AD 3WA9C 3AZHC 2F8NG 5AV9C 5GXQB 5GSUA 2AROB 3WA9B 3AZHB 3RELA 5GXQD 5GT0C 5AV9B 2AROD 4X23D 3AZKA 3WA9D 3AZHD 5FUGB 4CAYA 5B31G 5AV9D 5GT0B 4ZBJC 2RVQC 2HIOC 5B2JC 3AZLD 3MGQA 5E5AD 4H9OA 4ZBJB 1P34C 5AVBD 2HIOB 5JA4A 5B2JB 3AFAC 3X1VA 2RVQD 4XZQA 1B67A 1P34B 5JA4B 5B2JD 3W96A 5DNND 3AFAB 4KHAA 3LZ1D 4M6BA 3W96B 3AFAD 4NE5A 3UTAA 4H9QB 1BH8B 1N1JA 4EO5C 1M19A 1ULYA 4DRBA 3X1TA 4EO5B 1P3MA 4HGAC 4J8VA 5CPIA 1P3FA 3AZJA 1P3LC 4HGAB 3KUYA 4UUZA 5F99D 1WWIA 1P3LB 4J8UA 1H3OB 3LELC 5CPJC 1P3LD 5BT1C 1P3OA 3LELB 4Z5TC 4E45A 5CPJB 4Z5TA 5B32G 1P3GA 5B40C 5G49A 5CPJD 4Z5TB 4ZUXC 4NFTA 4XUJC 5B0ZA 2JSSA 5AVCD 5BT1D 5GT3C 5B40B 3B6FA 4ZUXB 4XUJB 1BFMA 5B40D 2FJ7C 3B0BA 5GT3B 4ZUXD 3KXBA 4XUJD 4WU9A 1R4VA 4J8XC 5GT3D 2FJ7B 3REHC 3B6GD 5AV6A 4JJNC 4J8XB 3REHB 2F8NA 4J8XD 4JJNB 3AZGA 3C1CD 3NQJA 5KDMB 4JJND 3R45A 1WWSA 5AV5D 1HQ3A 5B1LA 1KX5D 3R45B 5B31A 1P3BC 4WZSB 3W99D 5B1MA 3LZ0A 4G91C 2CV5A 1P3BB 2CWEA 4R8PA 4KUDA 3AZID 4G91B 2PYOC 1P3BD 4YS3D 3W97C 4LD9A 2PYOB 3UTBC 4G92C 3UTBA 4DRAA 5B0YD 3W97B 2PYOD 3UTBB 3B0DC 4G92B 1AOIC 1AOIA 4Z66C 3B0DB 4Z66A 5BNVB 1KX3C 1AOIB 3B0CT 5AV8C 4Z66B 3AV1C 1KX3B 3W98A 5CP6A 1M18A 5AV8B 1F66C 4Z2MH 3AV1B 2NQBC 1KX3D 3MGSC 1S32D 1ID3A 3V9RA 5AV8D 3MGRD 5DNMC 3MGPA 1P3PC 1F66B 2NQBB 3MGSB 3UT9A 3AYWC 3A6NA 4KGCA 3REKD 3KWQC 5DNMB 3AZED 1P3PB 3KWQA 5B33A 3AYWB 3VH6W 3AZFD 3REID 5B32A 5DNMD 3KWQB 3AZMD 3AYWD 1M1AD 4H9SC 3X1UA 3AV2C 4H9NA 3AV2A 5GSUC 3AV2B 3TU4D 3WKJA 3RELC 5B24A 4AWLC 1EQZA 3VH5T 5GSUB 5C3IC 3AZKC 4E44A 3RELB 4AWLB 3O62A 5GSUD 3MVDA 5C3IB 3AZKB 2BYKA 3RELD 4CAYB 3MGQC 5GT0D 3MGQB 3X1VC 4H9OB 4XZQC 4WU8A 3AZNA 3W96C 2HIOD 1A7WA 5BNXA 3LJAA 3X1VB 4XZQB 1P34D 3UTAC 4KHAB 3KSYA 3VH6A 4XZQD 1P3KC 3W96D 1P3KA 1M19C 3UTAB 3X1TC 5AVBA 1P3KB 1N1JB 4H9RA 1P3MC 3UTAD 4WNNA 1M19B 3X1TB 4J8VC 5CPIC 5DNNA 1P3FC 1P3MB 2BYMA 3AZJC 3KUYC 4J8VB 5CPIB 1TZYA 1P3MD 1P3FB 3AZJB 2L5AA 4J8UC 3KUYB 5CPID 4UUZB 3AZJD 3KUYD 4J8UB 1P3OC 4NE3A 4YM6A 5BO0A 1P3GC 2YFVA 1P3OB 2YFWA 3LELD 5BO0B 3MNNC 5B0ZC 2F8NK 5CPKC 3MNNA 2YFVB 5CPKA 1P3GB 5F99A 1P3OD 5G49B 3B6FC 4Z5TD 3MNNB 5B0ZB 5CPKB 3KXBC 3B6FB 5B0ZD 4WU9C 4J8WC 2HUEC 4J8WA 3B6FD 5AV6C 3KXBB 4WU9B 4J8WB 2HUEB 3X1SC 3X1SA 4Z2MG 5AVCA 2FJ7D 5AV6B 1HTAA 1TAFA 3X1SB 3AZGC 3REHD 2F8NB 1TAFB 1P3IA 3AZGB 1BH9A 1HQ3C 5B1LC 3NQJB 4H9PA 5B31C 1ZLAA 3WTPC 1HQ3B 5B1LB 5B1MC 3LZ0C 3WTPA 2CV5C 3B6GA 5B31B 1HQ3D 4R8PC 4KUDC 3WTPB 5B1MB 3LZ0B 2CV5B 5B31D 4LD9C 4R8PB 2CV5D 4KUDB 4R8PD 1U35A 1KX5A 3WAAA 4KUDD 4LD9B 3AN2C 3AN2A 3W97D 3AN2B 3UTBD 4YS3A 3W98C 1AOID 5CP6C 1M18C 4Z66D 1Q9CA 1ID3C 3W98B 5CP6B 1M18B 3MGPC 3AV1D 3UT9C 3REJA 3A6NC 5CP6D 1ID3B 4KGCC 3V9RB 4QLCA 3MGPB 1F66D 5AY8C 1KX4A 3UT9B 3MGSD 1KU5A 5AY8A 3A6NB 5B33C 1B6WA 1ID3D 4KGCB 5B32C 4CSRA 1P3PD 5AY8B 3A6ND 5B33B 4KGCD 5B32B 1S32A 3X1UC 3KWQD 5B33D 3MGRA 5JRGA 3X1UB 4H9NB 3WKJC 3AZEA 5B24C 1EQZC 1F1EA 3C1BC 3AZFA 2NZDA 3C1BA 3REIA 3AV2D 5B2IA 3WKJB 5B24B 1EQZB 3O62C 3C1BB 3MVDC 3WKJD 1EQZD 5CHLB 3O62B 1P3AC 3MVDB 1P3AA 3AZKD 2BYKB
chains in the Genus database with same CATH superfamily
3NQUA 1P3AB 4WU8C 3AZNC 5GXQA 4X23C 2AROA 3MGQD 4X23A 3LJAC 3WA9A 3AZHA 4WU8B 3AZNB 3VH6T 5AV9A 4X23B 5BNXB 3LJAB 3X1VD 3AZLC 5FUGA 3AZND 4WU8D 3AZLA 5E5AC 5GT0A 5E5AA 3VH5A 3LJAD 5AVBC 2Y2GA 3AZLB 5E5AB 3WTPE 5AVBB 1JFIA 5DNNC 2HIOA 5B2JA 4H9RB 1P3KD 3LZ1C 4WNNB 2Y2QA 1M19D 3LZ1A 1JFIB 1P34A 3X1TD 1TZYC 5DNNB 3AFAA 2BYMB 3LZ1B 4J8VD 1TZYB 4H9QA 1P3FD 1BH8A 1TZYD 4YM6C 4J8UD 2UWXA 4YM6B 5BS7C 5BS7A 2J8PA 5F99C 2YFWB 4YM6D 1P3GD 5F99B 4NE6A 1P3LA 2W8SA 3MNND 1H3OA 5CPKD 2F8NH 2JCHA 3LELA 5CPJA 3A1IA 4WV4B 5AVCC 3KXBD 4WU9D 4J8WD 5AVCB 5AV6D 1P3IC 3X1SD 5B40A 4ZUXA 2ZY2A 4XUJA 2F8ND 1P3IB 3AZGD 1BH9B 3EG5B 5GT3A 1ZLAC 3B6GC 4H9PB 1P3ID 1ZLAB 2FJ7A 3B6GB 5B1LD 4J8XA 3C1CC 1ZLAD 2LY8A 3C1CA 3REHA 3WTPD 5B1MD 3LZ0D 4JJNA 5AV5C 3B0CW 5AV5A 3C1CB 3WAAC 5KDMA 1U35C 1KX5C 2DF4C 5AV5B 3W99C 1U35B 1KX5B 3W99A 3WAAB 4LD9D 3W99B 2Y2JA 2IO5C 3AZIC 1U35D 3WAAD 3AZIA 1P3BA 3AN2D 4YS3C 3AZIB 2IO5B 3EPJA 5B0YC 4YS3B 5B0YA 2PYOA 5B0YB 3W97A 3REJC 3W98D 1M18D 1T3UA 4QLCC 1KX4C 3REJB 3AL0C 5BNVA 4QLCB 3MGPD 3REJD 1KX4B 3EPHA 3UT9D 3VH5W 3F6TA 4QLCD 1S32C 4CSRB 1KX3A 1KX4D 5AY8D 3MGRC 5AV8A 3AV1A 3H0MC 5B32D 1S32B 5JRGC 3REKC 3MGRB 3REKA 3AZEC 1F66A 2NQBA 3MGSA 3AZFC 5JRGB 3X1UD 2NZDC 3REIC 3REKB 5B2IC 5DNMA 3AZEB 2FFFB 3AZMC 5JRGD 1P3PA 3AZMA 3AZFB 3AYWA 1M1AA 1M1AC 2NZDB 1Z2CB 3REIB 5B2IB 3AZMB 5B24D 1M1AB 2NZDD 3C1BD 5B2ID 3TU4C 3O62D 4H9SA 3TU4A 3MVDD 2NQBD 5GXQC 2AROC 3TU4B 3NQUB 1P3AD 3WA9C 3AZHC 2F8NG 5AV9C 5GXQB 5GSUA 2AROB 3H0RC 3WA9B 3AZHB 3RELA 5GXQD 1W2EA 5AV9B 5GT0C 2AROD 4X23D 3AZKA 3WA9D 3AZHD 2ZY3A 2ZY5A 5FUGB 4CAYA 5B31G 5GT0B 5AV9D 4ZBJC 2RVQC 2ZM5A 2HIOC 5B2JC 3AZLD 3MGQA 5E5AD 4H9OA 4ZBJB 1P34C 5AVBD 2HIOB 5JA4A 5B2JB 3AFAC 3X1VA 2RVQD 4XZQA 1B67A 1P34B 5JA4B 5B2JD 3W96A 2ZY4A 5DNND 3AFAB 4KHAA 3LZ1D 4M6BA 3W96B 3AFAD 4NE5A 3UTAA 4H9QB 1BH8B 1N1JA 4EO5C 1M19A 1ULYA 4DRBA 3X1TA 4EO5B 1P3MA 4HGAC 4J8VA 5CPIA 1P3FA 3AZJA 1P3LC 4HGAB 3KUYA 4UUZA 5F99D 1WWIA 1P3LB 4J8UA 1H3OB 3LELC 5CPJC 2Y2KA 1P3LD 5BT1C 1P3OA 3LELB 4Z5TC 4E45A 5CPJB 4Z5TA 5B32G 1P3GA 3FDDA 5B40C 5G49A 5CPJD 4Z5TB 4ZUXC 4NFTA 4XUJC 5B0ZA 2JSSA 5AVCD 5BT1D 5GT3C 5B40B 3B6FA 4ZUXB 4XUJB 1BFMA 5B40D 2FJ7C 3B0BA 5GT3B 4ZUXD 3KXBA 4XUJD 4WU9A 1R4VA 4J8XC 5GT3D 2FJ7B 3REHC 3B6GD 5AV6A 4JJNC 4J8XB 1PZRA 3REHB 2F8NA 4J8XD 2Y2NA 4JJNB 3AZGA 3C1CD 3NQJA 5KDMB 4JJND 3R45A 1WWSA 5AV5D 1HQ3A 5B1LA 1KX5D 3R45B 5B31A 1P3BC 4WZSB 3W99D 5B1MA 3LZ0A 4G91C 2CV5A 3EPLA 1P3BB 2CWEA 4R8PA 4KUDA 3AZID 4WJ3C 4G91B 2PYOC 1P3BD 2Y2IA 4YS3D 3W97C 4LD9A 2PYOB 3UTBC 4G92C 3UTBA 2F2AC 4DRAA 5B0YD 3W97B 2PYOD 3UTBB 3B0DC 4G92B 1AOIC 1AOIA 4Z66C 3B0DB 4Z66A 5BNVB 1KX3C 1AOIB 3B0CT 5AV8C 2BG1A 4Z66B 3AV1C 1KX3B 3W98A 5CP6A 1M18A 5AV8B 3EPKA 1F66C 4Z2MH 3AV1B 2NQBC 1KX3D 3MGSC 1S32D 1ID3A 3V9RA 5AV8D 3MGRD 5DNMC 3MGPA 1P3PC 1F66B 2NQBB 2G5HC 3MGSB 3UT9A 2DQNC 3AYWC 3A6NA 4KGCA 3REKD 3KWQC 5DNMB 3AZED 1P3PB 3KWQA 5B33A 3AYWB 3VH6W 3AZFD 3REID 5B32A 5DNMD 3KWQB 3AZMD 3AYWD 1M1AD 4H9SC 3X1UA 3AV2C 4H9NA 3AV2A 5GSUC 3AV2B 3TU4D 3WKJA 3RELC 5B24A 4AWLC 1EQZA 3VH5T 5GSUB 5C3IC 3AZKC 4E44A 3RELB 4AWLB 3O62A 5GSUD 3MVDA 5C3IB 1ID3D 3AZKB 2BYKA 3RELD 4CAYB 3MGQC 5GT0D 2XD5A 3MGQB 3X1VC 4H9OB 4XZQC 4WU8A 3AZNA 3W96C 2HIOD 1A7WA 5BNXA 3LJAA 3X1VB 4XZQB 1P34D 3UTAC 4KHAB 3KSYA 3VH6A 4XZQD 1P3KC 3W96D 1P3KA 1M19C 3UTAB 3X1TC 5AVBA 1P3KB 1N1JB 4H9RA 1P3MC 3UTAD 4WNNA 1M19B 3X1TB 4J8VC 5CPIC 5DNNA 1P3FC 1P3MB 2BYMA 3AZJC 3KUYC 4J8VB 5CPIB 1TZYA 1P3MD 1P3FB 3AZJB 3IP4C 2L5AA 4J8UC 3KUYB 5CPID 4UUZB 3AZJD 3A1KA 3KUYD 4J8UB 1P3OC 4NE3A 4YM6A 5BO0A 1P3GC 2YFVA 1P3OB 2YFWA 3LELD 2Y2PA 5BO0B 3MNNC 5B0ZC 2F8NK 5CPKC 3MNNA 2YFVB 5CPKA 1P3GB 5F99A 1P3OD 5G49B 3B6FC 4Z5TD 3MNNB 5B0ZB 5CPKB 3KXBC 3B6FB 5B0ZD 4WU9C 4J8WC 2HUEC 4J8WA 3B6FD 5AV6C 4UPKA 3KXBB 2XD1A 4J8WB 2HUEB 3X1SC 4WU9B 3X1SA 4Z2MG 5AVCA 2FJ7D 2G5IC 5AV6B 1HTAA 1TAFA 3X1SB 3AZGC 3REHD 2F8NB 1TAFB 1P3IA 3AZGB 1BH9A 1HQ3C 5B1LC 3NQJB 4H9PA 5B31C 1ZLAA 3WTPC 1HQ3B 5B1LB 5B1MC 3LZ0C 3WTPA 2CV5C 3B6GA 5B31B 1HQ3D 4R8PC 4KUDC 3WTPB 5B1MB 3LZ0B 2CV5B 5B31D 4LD9C 4R8PB 2CV5D 4KUDB 4DQYB 2Y2OA 4R8PD 1U35A 1KX5A 3WAAA 4KUDD 4LD9B 3AN2C 3P5JB 3AN2A 3W97D 3AN2B 3UTBD 4YS3A 3W98C 1AOID 5CP6C 1M18C 4Z66D 1Q9CA 1ID3C 3W98B 5CP6B 1M18B 3MGPC 3AV1D 3UT9C 3REJA 3A6NC 5CP6D 1ID3B 4KGCC 3V9RB 3KFUG 4QLCA 3MGPB 1F66D 5AY8C 1KX4A 3UT9B 3MGSD 1KU5A 2VQRA 5AY8A 2JE5A 1B6WA 2Y2MA 3A6NB 5B33C 5B32C 4KGCB 4CSRA 1P3PD 5AY8B 3A6ND 5B33B 4KGCD 5B32B 1S32A 3X1UC 3KWQD 5B33D 3MGRA 3X1UB 5JRGA 2Y2HA 4H9NB 3WKJC 3AZEA 5B24C 1EQZC 1F1EA 3C1BC 3AZFA 2NZDA 2RIQA 3C1BA 3REIA 3AV2D 5B2IA 3WKJB 5B24B 1EQZB 3O62C 3C1BB 3MVDC 2Y2LA 3WKJD 1EQZD 5CHLB 3O62B 1P3AC 3MVDB 3H0LC 1P3AA 3AZKD 2BYKB
chains in the Genus database with same CATH topology
3NQUA 1P3AB 4WU8C 3AZNC 5GXQA 4X23C 2AROA 3MGQD 4X23A 3LJAC 3WA9A 3AZHA 4WU8B 3AZNB 3VH6T 5AV9A 4X23B 5BNXB 3LJAB 3X1VD 3AZLC 5FUGA 3AZND 4WU8D 3AZLA 5E5AC 5GT0A 5E5AA 3VH5A 3LJAD 5AVBC 2Y2GA 3AZLB 5E5AB 3WTPE 5AVBB 1JFIA 5DNNC 2HIOA 5B2JA 4H9RB 1P3KD 3LZ1C 4WNNB 2Y2QA 1M19D 3LZ1A 1JFIB 1P34A 3X1TD 1TZYC 5DNNB 3AFAA 2BYMB 3LZ1B 4J8VD 1TZYB 4H9QA 1P3FD 1BH8A 1TZYD 4YM6C 4J8UD 2UWXA 4YM6B 5BS7C 5BS7A 2J8PA 5F99C 2YFWB 4YM6D 1P3GD 5F99B 4NE6A 1P3LA 2W8SA 3MNND 1H3OA 5CPKD 2F8NH 2JCHA 3LELA 5CPJA 3A1IA 4WV4B 5AVCC 3KXBD 4WU9D 4J8WD 5AVCB 5AV6D 1P3IC 3X1SD 5B40A 4ZUXA 2ZY2A 4XUJA 2F8ND 1P3IB 3AZGD 1BH9B 3EG5B 5GT3A 1ZLAC 3B6GC 4H9PB 1P3ID 1ZLAB 2FJ7A 3B6GB 5B1LD 4J8XA 3C1CC 1ZLAD 2LY8A 3C1CA 3REHA 3WTPD 5B1MD 3LZ0D 4JJNA 5AV5C 3B0CW 5AV5A 3C1CB 3WAAC 5KDMA 1U35C 1KX5C 2DF4C 5AV5B 3W99C 1U35B 1KX5B 3W99A 3WAAB 4LD9D 3W99B 2Y2JA 2IO5C 3AZIC 1U35D 3WAAD 3AZIA 1P3BA 3AN2D 4YS3C 3AZIB 2IO5B 3EPJA 5B0YC 4YS3B 5B0YA 2PYOA 5B0YB 3W97A 3REJC 3W98D 1M18D 1T3UA 4QLCC 1KX4C 3REJB 3AL0C 5BNVA 4QLCB 3MGPD 3REJD 1KX4B 3EPHA 3UT9D 3VH5W 3F6TA 4QLCD 1S32C 4CSRB 1KX3A 1KX4D 5AY8D 3MGRC 5AV8A 3AV1A 3H0MC 5B32D 1S32B 5JRGC 3REKC 3MGRB 3REKA 3AZEC 1F66A 2NQBA 3MGSA 3AZFC 5JRGB 3X1UD 2NZDC 3REIC 3REKB 5B2IC 5DNMA 3AZEB 2FFFB 3AZMC 5JRGD 1P3PA 3AZMA 3AZFB 3AYWA 1M1AA 1M1AC 2NZDB 1Z2CB 3REIB 5B2IB 3AZMB 5B24D 1M1AB 2NZDD 3C1BD 5B2ID 3TU4C 3O62D 4H9SA 3TU4A 3MVDD 2NQBD 5GXQC 2AROC 3TU4B 3NQUB 1P3AD 3WA9C 3AZHC 2F8NG 5AV9C 5GXQB 5GSUA 2AROB 3H0RC 3WA9B 3AZHB 3RELA 5GXQD 1W2EA 5AV9B 5GT0C 2AROD 4X23D 3AZKA 3WA9D 3AZHD 2ZY3A 2ZY5A 5FUGB 4CAYA 5B31G 5GT0B 5AV9D 4ZBJC 2RVQC 2ZM5A 2HIOC 5B2JC 3AZLD 3MGQA 5E5AD 4H9OA 4ZBJB 1P34C 5AVBD 2HIOB 5JA4A 5B2JB 3AFAC 3X1VA 2RVQD 4XZQA 1B67A 1P34B 5JA4B 5B2JD 3W96A 2ZY4A 5DNND 3AFAB 4KHAA 3LZ1D 4M6BA 3W96B 3AFAD 4NE5A 3UTAA 4H9QB 1BH8B 1N1JA 4EO5C 1M19A 1ULYA 4DRBA 3X1TA 4EO5B 1P3MA 4HGAC 4J8VA 5CPIA 1P3FA 3AZJA 1P3LC 4HGAB 3KUYA 4UUZA 5F99D 1WWIA 1P3LB 4J8UA 1H3OB 3LELC 5CPJC 2Y2KA 1P3LD 5BT1C 1P3OA 3LELB 4Z5TC 4E45A 5CPJB 4Z5TA 5B32G 1P3GA 3FDDA 5B40C 5G49A 5CPJD 4Z5TB 4ZUXC 4NFTA 4XUJC 5B0ZA 2JSSA 5AVCD 5BT1D 5GT3C 5B40B 3B6FA 4ZUXB 4XUJB 1BFMA 5B40D 2FJ7C 3B0BA 5GT3B 4ZUXD 3KXBA 4XUJD 4WU9A 1R4VA 4J8XC 5GT3D 2FJ7B 3REHC 3B6GD 5AV6A 4JJNC 4J8XB 1PZRA 3REHB 2F8NA 4J8XD 2Y2NA 4JJNB 3AZGA 3C1CD 3NQJA 5KDMB 4JJND 3R45A 1WWSA 5AV5D 1HQ3A 5B1LA 1KX5D 3R45B 5B31A 1P3BC 4WZSB 3W99D 5B1MA 3LZ0A 4G91C 2CV5A 3EPLA 1P3BB 2CWEA 4R8PA 4KUDA 3AZID 4WJ3C 4G91B 2PYOC 1P3BD 2Y2IA 4YS3D 3W97C 4LD9A 2PYOB 3UTBC 4G92C 3UTBA 2F2AC 4DRAA 5B0YD 3W97B 2PYOD 3UTBB 3B0DC 4G92B 1AOIC 1AOIA 4Z66C 3B0DB 4Z66A 5BNVB 1KX3C 1AOIB 3B0CT 5AV8C 2BG1A 4Z66B 3AV1C 1KX3B 3W98A 5CP6A 1M18A 5AV8B 3EPKA 1F66C 4Z2MH 3AV1B 2NQBC 1KX3D 3MGSC 1S32D 1ID3A 3V9RA 5AV8D 3MGRD 5DNMC 3MGPA 1P3PC 1F66B 2NQBB 2G5HC 3MGSB 3UT9A 2DQNC 3AYWC 3A6NA 4KGCA 3REKD 3KWQC 5DNMB 3AZED 1P3PB 3KWQA 5B33A 3AYWB 3VH6W 3AZFD 3REID 5B32A 5DNMD 3KWQB 3AZMD 3AYWD 1M1AD 4H9SC 3X1UA 3AV2C 4H9NA 3AV2A 5GSUC 3AV2B 3TU4D 3WKJA 3RELC 5B24A 4AWLC 1EQZA 3VH5T 5GSUB 5C3IC 3AZKC 4E44A 3RELB 4AWLB 3O62A 5GSUD 3MVDA 5C3IB 1ID3D 3AZKB 2BYKA 3RELD 4CAYB 3MGQC 5GT0D 2XD5A 3MGQB 3X1VC 4H9OB 4XZQC 4WU8A 3AZNA 3W96C 2HIOD 1A7WA 5BNXA 3LJAA 3X1VB 4XZQB 1P34D 3UTAC 4KHAB 3KSYA 3VH6A 4XZQD 1P3KC 3W96D 1P3KA 1M19C 3UTAB 3X1TC 5AVBA 1P3KB 1N1JB 4H9RA 1P3MC 3UTAD 4WNNA 1M19B 3X1TB 4J8VC 5CPIC 5DNNA 1P3FC 1P3MB 2BYMA 3AZJC 3KUYC 4J8VB 5CPIB 1TZYA 1P3MD 1P3FB 3AZJB 3IP4C 2L5AA 4J8UC 3KUYB 5CPID 4UUZB 3AZJD 3A1KA 3KUYD 4J8UB 1P3OC 4NE3A 4YM6A 5BO0A 1P3GC 2YFVA 1P3OB 2YFWA 3LELD 2Y2PA 5BO0B 3MNNC 5B0ZC 2F8NK 5CPKC 3MNNA 2YFVB 5CPKA 1P3GB 5F99A 1P3OD 5G49B 3B6FC 4Z5TD 3MNNB 5B0ZB 5CPKB 3KXBC 3B6FB 5B0ZD 4WU9C 4J8WC 2HUEC 4J8WA 3B6FD 5AV6C 4UPKA 3KXBB 2XD1A 4J8WB 2HUEB 3X1SC 4WU9B 3X1SA 4Z2MG 5AVCA 2FJ7D 2G5IC 5AV6B 1HTAA 1TAFA 3X1SB 3AZGC 3REHD 2F8NB 1TAFB 1P3IA 3AZGB 1BH9A 1HQ3C 5B1LC 3NQJB 4H9PA 5B31C 1ZLAA 3WTPC 1HQ3B 5B1LB 5B1MC 3LZ0C 3WTPA 2CV5C 3B6GA 5B31B 1HQ3D 4R8PC 4KUDC 3WTPB 5B1MB 3LZ0B 2CV5B 5B31D 4LD9C 4R8PB 2CV5D 4KUDB 4DQYB 2Y2OA 4R8PD 1U35A 1KX5A 3WAAA 4KUDD 4LD9B 3AN2C 3P5JB 3AN2A 3W97D 3AN2B 3UTBD 4YS3A 3W98C 1AOID 5CP6C 1M18C 4Z66D 1Q9CA 1ID3C 3W98B 5CP6B 1M18B 3MGPC 3AV1D 3UT9C 3REJA 3A6NC 5CP6D 1ID3B 4KGCC 3V9RB 3KFUG 4QLCA 3MGPB 1F66D 5AY8C 1KX4A 3UT9B 3MGSD 1KU5A 2VQRA 5AY8A 2JE5A 1B6WA 2Y2MA 3A6NB 5B33C 5B32C 4KGCB 4CSRA 1P3PD 5AY8B 3A6ND 5B33B 4KGCD 5B32B 1S32A 3X1UC 3KWQD 5B33D 3MGRA 3X1UB 5JRGA 2Y2HA 4H9NB 3WKJC 3AZEA 5B24C 1EQZC 1F1EA 3C1BC 3AZFA 2NZDA 2RIQA 3C1BA 3REIA 3AV2D 5B2IA 3WKJB 5B24B 1EQZB 3O62C 3C1BB 3MVDC 2Y2LA 3WKJD 1EQZD 5CHLB 3O62B 1P3AC 3MVDB 3H0LC 1P3AA 3AZKD 2BYKB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NQU A;  1P3A B;  4WU8 C;  3AZN C;  5GXQ A;  4X23 C;  2ARO A;  3MGQ D;  4X23 A;  3LJA C;  3WA9 A;  3AZH A;  4WU8 B;  3AZN B;  3VH6 T;  5AV9 A;  4X23 B;  5BNX B;  3LJA B;  3X1V D;  3AZL C;  5FUG A;  3AZN D;  4WU8 D;  3AZL A;  5E5A C;  5GT0 A;  5E5A A;  3VH5 A;  3LJA D;  5AVB C;  3AZL B;  5E5A B;  3WTP E;  5AVB B;  1JFI A;  5DNN C;  2HIO A;  5B2J A;  4H9R B;  1P3K D;  3LZ1 C;  4WNN B;  1M19 D;  3LZ1 A;  1JFI B;  1P34 A;  3X1T D;  1TZY C;  5DNN B;  3AFA A;  2BYM B;  3LZ1 B;  4J8V D;  1TZY B;  4H9Q A;  1P3F D;  1BH8 A;  1TZY D;  4YM6 C;  4J8U D;  4YM6 B;  5BS7 C;  5BS7 A;  5F99 C;  2YFW B;  4YM6 D;  1P3G D;  5F99 B;  4NE6 A;  1P3L A;  3MNN D;  1H3O A;  5CPK D;  2F8N H;  3LEL A;  5CPJ A;  5AVC C;  4WV4 B;  3KXB D;  4WU9 D;  4J8W D;  5AVC B;  5AV6 D;  1P3I C;  3X1S D;  5B40 A;  4ZUX A;  4XUJ A;  2F8N D;  1P3I B;  3AZG D;  1BH9 B;  5GT3 A;  1ZLA C;  3B6G C;  4H9P B;  1P3I D;  1ZLA B;  2FJ7 A;  3B6G B;  5B1L D;  4J8X A;  3C1C C;  1ZLA D;  2LY8 A;  3C1C A;  3REH A;  3WTP D;  5B1M D;  3LZ0 D;  4JJN A;  5AV5 C;  3B0C W;  5AV5 A;  3C1C B;  3WAA C;  5KDM A;  1U35 C;  1KX5 C;  5AV5 B;  3W99 C;  1U35 B;  1KX5 B;  3W99 A;  3WAA B;  4LD9 D;  3W99 B;  3AZI C;  2IO5 C;  1U35 D;  3WAA D;  3AZI A;  1P3B A;  3AN2 D;  4YS3 C;  3AZI B;  2IO5 B;  5B0Y C;  4YS3 B;  5B0Y A;  2PYO A;  5B0Y B;  3W97 A;  3REJ C;  3W98 D;  1M18 D;  4QLC C;  1KX4 C;  3REJ B;  5BNV A;  4QLC B;  3MGP D;  3REJ D;  1KX4 B;  3UT9 D;  3VH5 W;  1S32 C;  4QLC D;  4CSR B;  1KX3 A;  1KX4 D;  5AY8 D;  3MGR C;  5AV8 A;  3AV1 A;  5B32 D;  1S32 B;  5JRG C;  3REK C;  3MGR B;  3REK A;  3AZE C;  1F66 A;  2NQB A;  3MGS A;  3AZF C;  5JRG B;  3X1U D;  2NZD C;  3REI C;  3REK B;  5B2I C;  5DNM A;  3AZE B;  3AZM C;  1P3P A;  5JRG D;  1M1A C;  3AZM A;  3AZF B;  3AYW A;  1M1A A;  2NZD B;  3REI B;  5B2I B;  3AZM B;  5B24 D;  1M1A B;  2NZD D;  3C1B D;  5B2I D;  3TU4 C;  3O62 D;  4H9S A;  3TU4 A;  3MVD D;  2NQB D;  5GXQ C;  2ARO C;  3TU4 B;  3NQU B;  1P3A D;  3WA9 C;  3AZH C;  2F8N G;  5AV9 C;  5GXQ B;  5GSU A;  2ARO B;  3WA9 B;  3AZH B;  3REL A;  5GXQ D;  5GT0 C;  5AV9 B;  2ARO D;  4X23 D;  3AZK A;  3WA9 D;  3AZH D;  5FUG B;  4CAY A;  5B31 G;  5AV9 D;  5GT0 B;  4ZBJ C;  2RVQ C;  2HIO C;  5B2J C;  3AZL D;  3MGQ A;  5E5A D;  4H9O A;  4ZBJ B;  1P34 C;  5AVB D;  2HIO B;  5JA4 A;  5B2J B;  3AFA C;  3X1V A;  2RVQ D;  4XZQ A;  1B67 A;  1P34 B;  5JA4 B;  5B2J D;  3W96 A;  5DNN D;  3AFA B;  4KHA A;  3LZ1 D;  4M6B A;  3W96 B;  3AFA D;  4NE5 A;  3UTA A;  4H9Q B;  1BH8 B;  1N1J A;  4EO5 C;  1M19 A;  1ULY A;  4DRB A;  3X1T A;  4EO5 B;  1P3M A;  4HGA C;  4J8V A;  5CPI A;  1P3F A;  3AZJ A;  1P3L C;  4HGA B;  3KUY A;  4UUZ A;  5F99 D;  1WWI A;  1P3L B;  4J8U A;  1H3O B;  3LEL C;  5CPJ C;  1P3L D;  5BT1 C;  1P3O A;  3LEL B;  4Z5T C;  4E45 A;  5CPJ B;  4Z5T A;  5B32 G;  1P3G A;  5B40 C;  5G49 A;  5CPJ D;  4Z5T B;  4ZUX C;  4NFT A;  4XUJ C;  5B0Z A;  2JSS A;  5AVC D;  5BT1 D;  5GT3 C;  5B40 B;  3B6F A;  4ZUX B;  4XUJ B;  1BFM A;  5B40 D;  2FJ7 C;  3B0B A;  5GT3 B;  4ZUX D;  3KXB A;  4XUJ D;  4WU9 A;  1R4V A;  4J8X C;  5GT3 D;  2FJ7 B;  3REH C;  3B6G D;  5AV6 A;  4JJN C;  4J8X B;  3REH B;  2F8N A;  4J8X D;  4JJN B;  3AZG A;  3C1C D;  3NQJ A;  5KDM B;  4JJN D;  3R45 A;  1WWS A;  5AV5 D;  1HQ3 A;  5B1L A;  1KX5 D;  3R45 B;  5B31 A;  1P3B C;  4WZS B;  3W99 D;  5B1M A;  3LZ0 A;  4G91 C;  2CV5 A;  1P3B B;  2CWE A;  4R8P A;  4KUD A;  3AZI D;  4G91 B;  2PYO C;  1P3B D;  4YS3 D;  3W97 C;  4LD9 A;  2PYO B;  3UTB C;  4G92 C;  3UTB A;  4DRA A;  5B0Y D;  3W97 B;  2PYO D;  3UTB B;  3B0D C;  4G92 B;  1AOI C;  1AOI A;  4Z66 C;  3B0D B;  4Z66 A;  5BNV B;  1KX3 C;  1AOI B;  3B0C T;  5AV8 C;  4Z66 B;  3AV1 C;  1KX3 B;  3W98 A;  5CP6 A;  1M18 A;  5AV8 B;  1F66 C;  4Z2M H;  3AV1 B;  2NQB C;  1KX3 D;  3MGS C;  1S32 D;  1ID3 A;  3V9R A;  5AV8 D;  3MGR D;  5DNM C;  3MGP A;  1P3P C;  1F66 B;  2NQB B;  3MGS B;  3UT9 A;  3AYW C;  3A6N A;  4KGC A;  3REK D;  3KWQ C;  5DNM B;  3AZE D;  1P3P B;  3KWQ A;  5B33 A;  3AYW B;  3VH6 W;  3AZF D;  3REI D;  5B32 A;  5DNM D;  3KWQ B;  3AZM D;  3AYW D;  1M1A D;  4H9S C;  3X1U A;  3AV2 C;  4H9N A;  3AV2 A;  5GSU C;  3AV2 B;  3TU4 D;  3WKJ A;  3REL C;  5B24 A;  4AWL C;  1EQZ A;  3VH5 T;  5GSU B;  5C3I C;  3AZK C;  4E44 A;  3REL B;  4AWL B;  3O62 A;  5GSU D;  3MVD A;  5C3I B;  3AZK B;  2BYK A;  3REL D;  4CAY B;  3MGQ C;  5GT0 D;  3MGQ B;  3X1V C;  4H9O B;  4XZQ C;  4WU8 A;  3AZN A;  3W96 C;  2HIO D;  1A7W A;  5BNX A;  3LJA A;  3X1V B;  4XZQ B;  1P34 D;  3UTA C;  4KHA B;  3KSY A;  3VH6 A;  4XZQ D;  1P3K C;  3W96 D;  1P3K A;  1M19 C;  3UTA B;  3X1T C;  5AVB A;  1P3K B;  1N1J B;  4H9R A;  1P3M C;  3UTA D;  4WNN A;  1M19 B;  3X1T B;  4J8V C;  5CPI C;  5DNN A;  1P3F C;  1P3M B;  2BYM A;  3AZJ C;  3KUY C;  4J8V B;  5CPI B;  1TZY A;  1P3M D;  1P3F B;  3AZJ B;  2L5A A;  4J8U C;  3KUY B;  5CPI D;  4UUZ B;  3AZJ D;  3KUY D;  4J8U B;  1P3O C;  4NE3 A;  4YM6 A;  5BO0 A;  1P3G C;  2YFV A;  1P3O B;  2YFW A;  3LEL D;  5BO0 B;  3MNN C;  5B0Z C;  2F8N K;  5CPK C;  3MNN A;  2YFV B;  5CPK A;  1P3G B;  5F99 A;  1P3O D;  5G49 B;  3B6F C;  4Z5T D;  3MNN B;  5B0Z B;  5CPK B;  3KXB C;  3B6F B;  5B0Z D;  4WU9 C;  4J8W C;  2HUE C;  4J8W A;  3B6F D;  5AV6 C;  3KXB B;  4WU9 B;  4J8W B;  2HUE B;  3X1S C;  3X1S A;  4Z2M G;  5AVC A;  2FJ7 D;  5AV6 B;  1HTA A;  1TAF A;  3X1S B;  3AZG C;  3REH D;  2F8N B;  1TAF B;  1P3I A;  3AZG B;  1BH9 A;  1HQ3 C;  5B1L C;  3NQJ B;  4H9P A;  5B31 C;  1ZLA A;  3WTP C;  1HQ3 B;  5B1L B;  5B1M C;  3LZ0 C;  3WTP A;  2CV5 C;  3B6G A;  5B31 B;  1HQ3 D;  4R8P C;  4KUD C;  3WTP B;  5B1M B;  3LZ0 B;  2CV5 B;  5B31 D;  4LD9 C;  4R8P B;  2CV5 D;  4KUD B;  4R8P D;  1U35 A;  1KX5 A;  3WAA A;  4KUD D;  4LD9 B;  3AN2 C;  3AN2 A;  3W97 D;  3AN2 B;  3UTB D;  4YS3 A;  3W98 C;  1AOI D;  5CP6 C;  1M18 C;  4Z66 D;  1Q9C A;  1ID3 C;  3W98 B;  5CP6 B;  1M18 B;  3MGP C;  3AV1 D;  3UT9 C;  3REJ A;  3A6N C;  5CP6 D;  1ID3 B;  4KGC C;  3V9R B;  4QLC A;  3MGP B;  1F66 D;  5AY8 C;  1KX4 A;  3UT9 B;  3MGS D;  1KU5 A;  5AY8 A;  3A6N B;  5B33 C;  1B6W A;  1ID3 D;  4KGC B;  5B32 C;  4CSR A;  1P3P D;  5AY8 B;  3A6N D;  5B33 B;  4KGC D;  5B32 B;  1S32 A;  3X1U C;  3KWQ D;  5B33 D;  3MGR A;  5JRG A;  3X1U B;  4H9N B;  3WKJ C;  3AZE A;  5B24 C;  1EQZ C;  1F1E A;  3C1B C;  3AZF A;  2NZD A;  3C1B A;  3REI A;  3AV2 D;  5B2I A;  3WKJ B;  5B24 B;  1EQZ B;  3O62 C;  3C1B B;  3MVD C;  3WKJ D;  1EQZ D;  5CHL B;  3O62 B;  1P3A C;  3MVD B;  1P3A A;  3AZK D;  2BYK B; 
#chains in the Genus database with same CATH topology
 3NQU A;  1P3A B;  4WU8 C;  3AZN C;  5GXQ A;  4X23 C;  2ARO A;  3MGQ D;  4X23 A;  3LJA C;  3WA9 A;  3AZH A;  4WU8 B;  3AZN B;  3VH6 T;  5AV9 A;  4X23 B;  5BNX B;  3LJA B;  3X1V D;  3AZL C;  5FUG A;  3AZN D;  4WU8 D;  3AZL A;  5E5A C;  5GT0 A;  5E5A A;  3VH5 A;  3LJA D;  5AVB C;  2Y2G A;  3AZL B;  5E5A B;  3WTP E;  5AVB B;  1JFI A;  5DNN C;  2HIO A;  5B2J A;  4H9R B;  1P3K D;  3LZ1 C;  4WNN B;  2Y2Q A;  1M19 D;  3LZ1 A;  1JFI B;  1P34 A;  3X1T D;  1TZY C;  5DNN B;  3AFA A;  2BYM B;  3LZ1 B;  4J8V D;  1TZY B;  4H9Q A;  1P3F D;  1BH8 A;  1TZY D;  4YM6 C;  4J8U D;  2UWX A;  4YM6 B;  5BS7 C;  5BS7 A;  2J8P A;  5F99 C;  2YFW B;  4YM6 D;  1P3G D;  5F99 B;  4NE6 A;  1P3L A;  2W8S A;  3MNN D;  1H3O A;  5CPK D;  2F8N H;  2JCH A;  3LEL A;  5CPJ A;  3A1I A;  4WV4 B;  5AVC C;  3KXB D;  4WU9 D;  4J8W D;  5AVC B;  5AV6 D;  1P3I C;  3X1S D;  5B40 A;  4ZUX A;  2ZY2 A;  4XUJ A;  2F8N D;  1P3I B;  3AZG D;  1BH9 B;  3EG5 B;  5GT3 A;  1ZLA C;  3B6G C;  4H9P B;  1P3I D;  1ZLA B;  2FJ7 A;  3B6G B;  5B1L D;  4J8X A;  3C1C C;  1ZLA D;  2LY8 A;  3C1C A;  3REH A;  3WTP D;  5B1M D;  3LZ0 D;  4JJN A;  5AV5 C;  3B0C W;  5AV5 A;  3C1C B;  3WAA C;  5KDM A;  1U35 C;  1KX5 C;  2DF4 C;  5AV5 B;  3W99 C;  1U35 B;  1KX5 B;  3W99 A;  3WAA B;  4LD9 D;  3W99 B;  2Y2J A;  2IO5 C;  3AZI C;  1U35 D;  3WAA D;  3AZI A;  1P3B A;  3AN2 D;  4YS3 C;  3AZI B;  2IO5 B;  3EPJ A;  5B0Y C;  4YS3 B;  5B0Y A;  2PYO A;  5B0Y B;  3W97 A;  3REJ C;  3W98 D;  1M18 D;  1T3U A;  4QLC C;  1KX4 C;  3REJ B;  3AL0 C;  5BNV A;  4QLC B;  3MGP D;  3REJ D;  1KX4 B;  3EPH A;  3UT9 D;  3VH5 W;  3F6T A;  4QLC D;  1S32 C;  4CSR B;  1KX3 A;  1KX4 D;  5AY8 D;  3MGR C;  5AV8 A;  3AV1 A;  3H0M C;  5B32 D;  1S32 B;  5JRG C;  3REK C;  3MGR B;  3REK A;  3AZE C;  1F66 A;  2NQB A;  3MGS A;  3AZF C;  5JRG B;  3X1U D;  2NZD C;  3REI C;  3REK B;  5B2I C;  5DNM A;  3AZE B;  2FFF B;  3AZM C;  5JRG D;  1P3P A;  3AZM A;  3AZF B;  3AYW A;  1M1A A;  1M1A C;  2NZD B;  1Z2C B;  3REI B;  5B2I B;  3AZM B;  5B24 D;  1M1A B;  2NZD D;  3C1B D;  5B2I D;  3TU4 C;  3O62 D;  4H9S A;  3TU4 A;  3MVD D;  2NQB D;  5GXQ C;  2ARO C;  3TU4 B;  3NQU B;  1P3A D;  3WA9 C;  3AZH C;  2F8N G;  5AV9 C;  5GXQ B;  5GSU A;  2ARO B;  3H0R C;  3WA9 B;  3AZH B;  3REL A;  5GXQ D;  1W2E A;  5AV9 B;  5GT0 C;  2ARO D;  4X23 D;  3AZK A;  3WA9 D;  3AZH D;  2ZY3 A;  2ZY5 A;  5FUG B;  4CAY A;  5B31 G;  5GT0 B;  5AV9 D;  4ZBJ C;  2RVQ C;  2ZM5 A;  2HIO C;  5B2J C;  3AZL D;  3MGQ A;  5E5A D;  4H9O A;  4ZBJ B;  1P34 C;  5AVB D;  2HIO B;  5JA4 A;  5B2J B;  3AFA C;  3X1V A;  2RVQ D;  4XZQ A;  1B67 A;  1P34 B;  5JA4 B;  5B2J D;  3W96 A;  2ZY4 A;  5DNN D;  3AFA B;  4KHA A;  3LZ1 D;  4M6B A;  3W96 B;  3AFA D;  4NE5 A;  3UTA A;  4H9Q B;  1BH8 B;  1N1J A;  4EO5 C;  1M19 A;  1ULY A;  4DRB A;  3X1T A;  4EO5 B;  1P3M A;  4HGA C;  4J8V A;  5CPI A;  1P3F A;  3AZJ A;  1P3L C;  4HGA B;  3KUY A;  4UUZ A;  5F99 D;  1WWI A;  1P3L B;  4J8U A;  1H3O B;  3LEL C;  5CPJ C;  2Y2K A;  1P3L D;  5BT1 C;  1P3O A;  3LEL B;  4Z5T C;  4E45 A;  5CPJ B;  4Z5T A;  5B32 G;  1P3G A;  3FDD A;  5B40 C;  5G49 A;  5CPJ D;  4Z5T B;  4ZUX C;  4NFT A;  4XUJ C;  5B0Z A;  2JSS A;  5AVC D;  5BT1 D;  5GT3 C;  5B40 B;  3B6F A;  4ZUX B;  4XUJ B;  1BFM A;  5B40 D;  2FJ7 C;  3B0B A;  5GT3 B;  4ZUX D;  3KXB A;  4XUJ D;  4WU9 A;  1R4V A;  4J8X C;  5GT3 D;  2FJ7 B;  3REH C;  3B6G D;  5AV6 A;  4JJN C;  4J8X B;  1PZR A;  3REH B;  2F8N A;  4J8X D;  2Y2N A;  4JJN B;  3AZG A;  3C1C D;  3NQJ A;  5KDM B;  4JJN D;  3R45 A;  1WWS A;  5AV5 D;  1HQ3 A;  5B1L A;  1KX5 D;  3R45 B;  5B31 A;  1P3B C;  4WZS B;  3W99 D;  5B1M A;  3LZ0 A;  4G91 C;  2CV5 A;  3EPL A;  1P3B B;  2CWE A;  4R8P A;  4KUD A;  3AZI D;  4WJ3 C;  4G91 B;  2PYO C;  1P3B D;  2Y2I A;  4YS3 D;  3W97 C;  4LD9 A;  2PYO B;  3UTB C;  4G92 C;  3UTB A;  2F2A C;  4DRA A;  5B0Y D;  3W97 B;  2PYO D;  3UTB B;  3B0D C;  4G92 B;  1AOI C;  1AOI A;  4Z66 C;  3B0D B;  4Z66 A;  5BNV B;  1KX3 C;  1AOI B;  3B0C T;  5AV8 C;  2BG1 A;  4Z66 B;  3AV1 C;  1KX3 B;  3W98 A;  5CP6 A;  1M18 A;  5AV8 B;  3EPK A;  1F66 C;  4Z2M H;  3AV1 B;  2NQB C;  1KX3 D;  3MGS C;  1S32 D;  1ID3 A;  3V9R A;  5AV8 D;  3MGR D;  5DNM C;  3MGP A;  1P3P C;  1F66 B;  2NQB B;  2G5H C;  3MGS B;  3UT9 A;  2DQN C;  3AYW C;  3A6N A;  4KGC A;  3REK D;  3KWQ C;  5DNM B;  3AZE D;  1P3P B;  3KWQ A;  5B33 A;  3AYW B;  3VH6 W;  3AZF D;  3REI D;  5B32 A;  5DNM D;  3KWQ B;  3AZM D;  3AYW D;  1M1A D;  4H9S C;  3X1U A;  3AV2 C;  4H9N A;  3AV2 A;  5GSU C;  3AV2 B;  3TU4 D;  3WKJ A;  3REL C;  5B24 A;  4AWL C;  1EQZ A;  3VH5 T;  5GSU B;  5C3I C;  3AZK C;  4E44 A;  3REL B;  4AWL B;  3O62 A;  5GSU D;  3MVD A;  5C3I B;  1ID3 D;  3AZK B;  2BYK A;  3REL D;  4CAY B;  3MGQ C;  5GT0 D;  2XD5 A;  3MGQ B;  3X1V C;  4H9O B;  4XZQ C;  4WU8 A;  3AZN A;  3W96 C;  2HIO D;  1A7W A;  5BNX A;  3LJA A;  3X1V B;  4XZQ B;  1P34 D;  3UTA C;  4KHA B;  3KSY A;  3VH6 A;  4XZQ D;  1P3K C;  3W96 D;  1P3K A;  1M19 C;  3UTA B;  3X1T C;  5AVB A;  1P3K B;  1N1J B;  4H9R A;  1P3M C;  3UTA D;  4WNN A;  1M19 B;  3X1T B;  4J8V C;  5CPI C;  5DNN A;  1P3F C;  1P3M B;  2BYM A;  3AZJ C;  3KUY C;  4J8V B;  5CPI B;  1TZY A;  1P3M D;  1P3F B;  3AZJ B;  3IP4 C;  2L5A A;  4J8U C;  3KUY B;  5CPI D;  4UUZ B;  3AZJ D;  3A1K A;  3KUY D;  4J8U B;  1P3O C;  4NE3 A;  4YM6 A;  5BO0 A;  1P3G C;  2YFV A;  1P3O B;  2YFW A;  3LEL D;  2Y2P A;  5BO0 B;  3MNN C;  5B0Z C;  2F8N K;  5CPK C;  3MNN A;  2YFV B;  5CPK A;  1P3G B;  5F99 A;  1P3O D;  5G49 B;  3B6F C;  4Z5T D;  3MNN B;  5B0Z B;  5CPK B;  3KXB C;  3B6F B;  5B0Z D;  4WU9 C;  4J8W C;  2HUE C;  4J8W A;  3B6F D;  5AV6 C;  4UPK A;  3KXB B;  2XD1 A;  4J8W B;  2HUE B;  3X1S C;  4WU9 B;  3X1S A;  4Z2M G;  5AVC A;  2FJ7 D;  2G5I C;  5AV6 B;  1HTA A;  1TAF A;  3X1S B;  3AZG C;  3REH D;  2F8N B;  1TAF B;  1P3I A;  3AZG B;  1BH9 A;  1HQ3 C;  5B1L C;  3NQJ B;  4H9P A;  5B31 C;  1ZLA A;  3WTP C;  1HQ3 B;  5B1L B;  5B1M C;  3LZ0 C;  3WTP A;  2CV5 C;  3B6G A;  5B31 B;  1HQ3 D;  4R8P C;  4KUD C;  3WTP B;  5B1M B;  3LZ0 B;  2CV5 B;  5B31 D;  4LD9 C;  4R8P B;  2CV5 D;  4KUD B;  4DQY B;  2Y2O A;  4R8P D;  1U35 A;  1KX5 A;  3WAA A;  4KUD D;  4LD9 B;  3AN2 C;  3P5J B;  3AN2 A;  3W97 D;  3AN2 B;  3UTB D;  4YS3 A;  3W98 C;  1AOI D;  5CP6 C;  1M18 C;  4Z66 D;  1Q9C A;  1ID3 C;  3W98 B;  5CP6 B;  1M18 B;  3MGP C;  3AV1 D;  3UT9 C;  3REJ A;  3A6N C;  5CP6 D;  1ID3 B;  4KGC C;  3V9R B;  3KFU G;  4QLC A;  3MGP B;  1F66 D;  5AY8 C;  1KX4 A;  3UT9 B;  3MGS D;  1KU5 A;  2VQR A;  5AY8 A;  2JE5 A;  1B6W A;  2Y2M A;  3A6N B;  5B33 C;  5B32 C;  4KGC B;  4CSR A;  1P3P D;  5AY8 B;  3A6N D;  5B33 B;  4KGC D;  5B32 B;  1S32 A;  3X1U C;  3KWQ D;  5B33 D;  3MGR A;  3X1U B;  5JRG A;  2Y2H A;  4H9N B;  3WKJ C;  3AZE A;  5B24 C;  1EQZ C;  1F1E A;  3C1B C;  3AZF A;  2NZD A;  2RIQ A;  3C1B A;  3REI A;  3AV2 D;  5B2I A;  3WKJ B;  5B24 B;  1EQZ B;  3O62 C;  3C1B B;  3MVD C;  2Y2L A;  3WKJ D;  1EQZ D;  5CHL B;  3O62 B;  1P3A C;  3MVD B;  3H0L C;  1P3A A;  3AZK D;  2BYK B; 
#chains in the Genus database with same CATH homology
 3NQU A;  1P3A B;  4WU8 C;  3AZN C;  5GXQ A;  4X23 C;  2ARO A;  3MGQ D;  4X23 A;  3LJA C;  3WA9 A;  3AZH A;  4WU8 B;  3AZN B;  3VH6 T;  5AV9 A;  4X23 B;  5BNX B;  3LJA B;  3X1V D;  3AZL C;  5FUG A;  3AZN D;  4WU8 D;  3AZL A;  5E5A C;  5GT0 A;  5E5A A;  3VH5 A;  3LJA D;  5AVB C;  2Y2G A;  3AZL B;  5E5A B;  3WTP E;  5AVB B;  1JFI A;  5DNN C;  2HIO A;  5B2J A;  4H9R B;  1P3K D;  3LZ1 C;  4WNN B;  2Y2Q A;  1M19 D;  3LZ1 A;  1JFI B;  1P34 A;  3X1T D;  1TZY C;  5DNN B;  3AFA A;  2BYM B;  3LZ1 B;  4J8V D;  1TZY B;  4H9Q A;  1P3F D;  1BH8 A;  1TZY D;  4YM6 C;  4J8U D;  2UWX A;  4YM6 B;  5BS7 C;  5BS7 A;  2J8P A;  5F99 C;  2YFW B;  4YM6 D;  1P3G D;  5F99 B;  4NE6 A;  1P3L A;  2W8S A;  3MNN D;  1H3O A;  5CPK D;  2F8N H;  2JCH A;  3LEL A;  5CPJ A;  3A1I A;  4WV4 B;  5AVC C;  3KXB D;  4WU9 D;  4J8W D;  5AVC B;  5AV6 D;  1P3I C;  3X1S D;  5B40 A;  4ZUX A;  2ZY2 A;  4XUJ A;  2F8N D;  1P3I B;  3AZG D;  1BH9 B;  3EG5 B;  5GT3 A;  1ZLA C;  3B6G C;  4H9P B;  1P3I D;  1ZLA B;  2FJ7 A;  3B6G B;  5B1L D;  4J8X A;  3C1C C;  1ZLA D;  2LY8 A;  3C1C A;  3REH A;  3WTP D;  5B1M D;  3LZ0 D;  4JJN A;  5AV5 C;  3B0C W;  5AV5 A;  3C1C B;  3WAA C;  5KDM A;  1U35 C;  1KX5 C;  2DF4 C;  5AV5 B;  3W99 C;  1U35 B;  1KX5 B;  3W99 A;  3WAA B;  4LD9 D;  3W99 B;  2Y2J A;  2IO5 C;  3AZI C;  1U35 D;  3WAA D;  3AZI A;  1P3B A;  3AN2 D;  4YS3 C;  3AZI B;  2IO5 B;  3EPJ A;  5B0Y C;  4YS3 B;  5B0Y A;  2PYO A;  5B0Y B;  3W97 A;  3REJ C;  3W98 D;  1M18 D;  1T3U A;  4QLC C;  1KX4 C;  3REJ B;  3AL0 C;  5BNV A;  4QLC B;  3MGP D;  3REJ D;  1KX4 B;  3EPH A;  3UT9 D;  3VH5 W;  3F6T A;  4QLC D;  1S32 C;  4CSR B;  1KX3 A;  1KX4 D;  5AY8 D;  3MGR C;  5AV8 A;  3AV1 A;  3H0M C;  5B32 D;  1S32 B;  5JRG C;  3REK C;  3MGR B;  3REK A;  3AZE C;  1F66 A;  2NQB A;  3MGS A;  3AZF C;  5JRG B;  3X1U D;  2NZD C;  3REI C;  3REK B;  5B2I C;  5DNM A;  3AZE B;  2FFF B;  3AZM C;  5JRG D;  1P3P A;  3AZM A;  3AZF B;  3AYW A;  1M1A A;  1M1A C;  2NZD B;  1Z2C B;  3REI B;  5B2I B;  3AZM B;  5B24 D;  1M1A B;  2NZD D;  3C1B D;  5B2I D;  3TU4 C;  3O62 D;  4H9S A;  3TU4 A;  3MVD D;  2NQB D;  5GXQ C;  2ARO C;  3TU4 B;  3NQU B;  1P3A D;  3WA9 C;  3AZH C;  2F8N G;  5AV9 C;  5GXQ B;  5GSU A;  2ARO B;  3H0R C;  3WA9 B;  3AZH B;  3REL A;  5GXQ D;  1W2E A;  5AV9 B;  5GT0 C;  2ARO D;  4X23 D;  3AZK A;  3WA9 D;  3AZH D;  2ZY3 A;  2ZY5 A;  5FUG B;  4CAY A;  5B31 G;  5GT0 B;  5AV9 D;  4ZBJ C;  2RVQ C;  2ZM5 A;  2HIO C;  5B2J C;  3AZL D;  3MGQ A;  5E5A D;  4H9O A;  4ZBJ B;  1P34 C;  5AVB D;  2HIO B;  5JA4 A;  5B2J B;  3AFA C;  3X1V A;  2RVQ D;  4XZQ A;  1B67 A;  1P34 B;  5JA4 B;  5B2J D;  3W96 A;  2ZY4 A;  5DNN D;  3AFA B;  4KHA A;  3LZ1 D;  4M6B A;  3W96 B;  3AFA D;  4NE5 A;  3UTA A;  4H9Q B;  1BH8 B;  1N1J A;  4EO5 C;  1M19 A;  1ULY A;  4DRB A;  3X1T A;  4EO5 B;  1P3M A;  4HGA C;  4J8V A;  5CPI A;  1P3F A;  3AZJ A;  1P3L C;  4HGA B;  3KUY A;  4UUZ A;  5F99 D;  1WWI A;  1P3L B;  4J8U A;  1H3O B;  3LEL C;  5CPJ C;  2Y2K A;  1P3L D;  5BT1 C;  1P3O A;  3LEL B;  4Z5T C;  4E45 A;  5CPJ B;  4Z5T A;  5B32 G;  1P3G A;  3FDD A;  5B40 C;  5G49 A;  5CPJ D;  4Z5T B;  4ZUX C;  4NFT A;  4XUJ C;  5B0Z A;  2JSS A;  5AVC D;  5BT1 D;  5GT3 C;  5B40 B;  3B6F A;  4ZUX B;  4XUJ B;  1BFM A;  5B40 D;  2FJ7 C;  3B0B A;  5GT3 B;  4ZUX D;  3KXB A;  4XUJ D;  4WU9 A;  1R4V A;  4J8X C;  5GT3 D;  2FJ7 B;  3REH C;  3B6G D;  5AV6 A;  4JJN C;  4J8X B;  1PZR A;  3REH B;  2F8N A;  4J8X D;  2Y2N A;  4JJN B;  3AZG A;  3C1C D;  3NQJ A;  5KDM B;  4JJN D;  3R45 A;  1WWS A;  5AV5 D;  1HQ3 A;  5B1L A;  1KX5 D;  3R45 B;  5B31 A;  1P3B C;  4WZS B;  3W99 D;  5B1M A;  3LZ0 A;  4G91 C;  2CV5 A;  3EPL A;  1P3B B;  2CWE A;  4R8P A;  4KUD A;  3AZI D;  4WJ3 C;  4G91 B;  2PYO C;  1P3B D;  2Y2I A;  4YS3 D;  3W97 C;  4LD9 A;  2PYO B;  3UTB C;  4G92 C;  3UTB A;  2F2A C;  4DRA A;  5B0Y D;  3W97 B;  2PYO D;  3UTB B;  3B0D C;  4G92 B;  1AOI C;  1AOI A;  4Z66 C;  3B0D B;  4Z66 A;  5BNV B;  1KX3 C;  1AOI B;  3B0C T;  5AV8 C;  2BG1 A;  4Z66 B;  3AV1 C;  1KX3 B;  3W98 A;  5CP6 A;  1M18 A;  5AV8 B;  3EPK A;  1F66 C;  4Z2M H;  3AV1 B;  2NQB C;  1KX3 D;  3MGS C;  1S32 D;  1ID3 A;  3V9R A;  5AV8 D;  3MGR D;  5DNM C;  3MGP A;  1P3P C;  1F66 B;  2NQB B;  2G5H C;  3MGS B;  3UT9 A;  2DQN C;  3AYW C;  3A6N A;  4KGC A;  3REK D;  3KWQ C;  5DNM B;  3AZE D;  1P3P B;  3KWQ A;  5B33 A;  3AYW B;  3VH6 W;  3AZF D;  3REI D;  5B32 A;  5DNM D;  3KWQ B;  3AZM D;  3AYW D;  1M1A D;  4H9S C;  3X1U A;  3AV2 C;  4H9N A;  3AV2 A;  5GSU C;  3AV2 B;  3TU4 D;  3WKJ A;  3REL C;  5B24 A;  4AWL C;  1EQZ A;  3VH5 T;  5GSU B;  5C3I C;  3AZK C;  4E44 A;  3REL B;  4AWL B;  3O62 A;  5GSU D;  3MVD A;  5C3I B;  1ID3 D;  3AZK B;  2BYK A;  3REL D;  4CAY B;  3MGQ C;  5GT0 D;  2XD5 A;  3MGQ B;  3X1V C;  4H9O B;  4XZQ C;  4WU8 A;  3AZN A;  3W96 C;  2HIO D;  1A7W A;  5BNX A;  3LJA A;  3X1V B;  4XZQ B;  1P34 D;  3UTA C;  4KHA B;  3KSY A;  3VH6 A;  4XZQ D;  1P3K C;  3W96 D;  1P3K A;  1M19 C;  3UTA B;  3X1T C;  5AVB A;  1P3K B;  1N1J B;  4H9R A;  1P3M C;  3UTA D;  4WNN A;  1M19 B;  3X1T B;  4J8V C;  5CPI C;  5DNN A;  1P3F C;  1P3M B;  2BYM A;  3AZJ C;  3KUY C;  4J8V B;  5CPI B;  1TZY A;  1P3M D;  1P3F B;  3AZJ B;  3IP4 C;  2L5A A;  4J8U C;  3KUY B;  5CPI D;  4UUZ B;  3AZJ D;  3A1K A;  3KUY D;  4J8U B;  1P3O C;  4NE3 A;  4YM6 A;  5BO0 A;  1P3G C;  2YFV A;  1P3O B;  2YFW A;  3LEL D;  2Y2P A;  5BO0 B;  3MNN C;  5B0Z C;  2F8N K;  5CPK C;  3MNN A;  2YFV B;  5CPK A;  1P3G B;  5F99 A;  1P3O D;  5G49 B;  3B6F C;  4Z5T D;  3MNN B;  5B0Z B;  5CPK B;  3KXB C;  3B6F B;  5B0Z D;  4WU9 C;  4J8W C;  2HUE C;  4J8W A;  3B6F D;  5AV6 C;  4UPK A;  3KXB B;  2XD1 A;  4J8W B;  2HUE B;  3X1S C;  4WU9 B;  3X1S A;  4Z2M G;  5AVC A;  2FJ7 D;  2G5I C;  5AV6 B;  1HTA A;  1TAF A;  3X1S B;  3AZG C;  3REH D;  2F8N B;  1TAF B;  1P3I A;  3AZG B;  1BH9 A;  1HQ3 C;  5B1L C;  3NQJ B;  4H9P A;  5B31 C;  1ZLA A;  3WTP C;  1HQ3 B;  5B1L B;  5B1M C;  3LZ0 C;  3WTP A;  2CV5 C;  3B6G A;  5B31 B;  1HQ3 D;  4R8P C;  4KUD C;  3WTP B;  5B1M B;  3LZ0 B;  2CV5 B;  5B31 D;  4LD9 C;  4R8P B;  2CV5 D;  4KUD B;  4DQY B;  2Y2O A;  4R8P D;  1U35 A;  1KX5 A;  3WAA A;  4KUD D;  4LD9 B;  3AN2 C;  3P5J B;  3AN2 A;  3W97 D;  3AN2 B;  3UTB D;  4YS3 A;  3W98 C;  1AOI D;  5CP6 C;  1M18 C;  4Z66 D;  1Q9C A;  1ID3 C;  3W98 B;  5CP6 B;  1M18 B;  3MGP C;  3AV1 D;  3UT9 C;  3REJ A;  3A6N C;  5CP6 D;  1ID3 B;  4KGC C;  3V9R B;  3KFU G;  4QLC A;  3MGP B;  1F66 D;  5AY8 C;  1KX4 A;  3UT9 B;  3MGS D;  1KU5 A;  2VQR A;  5AY8 A;  2JE5 A;  1B6W A;  2Y2M A;  3A6N B;  5B33 C;  5B32 C;  4KGC B;  4CSR A;  1P3P D;  5AY8 B;  3A6N D;  5B33 B;  4KGC D;  5B32 B;  1S32 A;  3X1U C;  3KWQ D;  5B33 D;  3MGR A;  3X1U B;  5JRG A;  2Y2H A;  4H9N B;  3WKJ C;  3AZE A;  5B24 C;  1EQZ C;  1F1E A;  3C1B C;  3AZF A;  2NZD A;  2RIQ A;  3C1B A;  3REI A;  3AV2 D;  5B2I A;  3WKJ B;  5B24 B;  1EQZ B;  3O62 C;  3C1B B;  3MVD C;  2Y2L A;  3WKJ D;  1EQZ D;  5CHL B;  3O62 B;  1P3A C;  3MVD B;  3H0L C;  1P3A A;  3AZK D;  2BYK B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...