4G91C

Ccaat-binding complex from aspergillus nidulans
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
117
structure length
117
Chain Sequence
GTWANVNQGLQGTARDILTTYWQHVINHLESDNHDYKIHQLPLARIKKVMKADPEVKMISAEAPILFAKGCDVFITELTMRAWIHAEDNKRRTLQRSDIAAALSKSDMFDFLIDIVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords HAPB protein
publication title DNA Minor Groove Sensing and Widening by the CCAAT-Binding Complex.
pubmed doi rcsb
source organism Emericella nidulans
total genus 39
structure length 117
sequence length 117
ec nomenclature
pdb deposition date 2012-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00808 CBFD_NFYB_HMF Histone-like transcription factor (CBF/NF-Y) and archaeal histone
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4g91C00
4R8PA 3O62A 2CV5C 4H9PA 5GXQB 2BYMB 5GXQC 5CPJD 5B0ZD 1WWSA 1P3AB 1P3AC 3MGPC 5DNND 4LD9A 4NE6A 3MNNC 3MNNB 3AFAC 3AFAB 3REHD 4H9QB 5AVCD 3AZEA 5B32G 1P34A 1KX5B 3W98A 5AV8D 1KX4D 1P3MB 1P3MC 3RELA 5B2JB 2PYOD 5E5AD 5B0YC 5B0YB 4WU9D 3LELD 1EQZB 4CSRB 1P3FC 1P3PA 3W97D 3MGRA 4ZUXA 4X23A 2CWEA 1P3OA 3C1BD 5C3IC 4JJND 4KGCA 5AVBA 1M19A 3MVDD 1TZYD 4ZBJC 4ZBJB 5B0ZB 5B0ZC 3UTBA 3W96D 3KUYA 5B1LB 4YS3D 1R4VA 5B33A 4WNNB 3B0DC 3B0DB 1P3ID 1S32B 1S32C 1N1JA 4J8VD 5AVCB 5AVCC 3AN2A 5B31A 1F66A 5AV8B 5AV8C 1KX4B 2JSSA 1KX4C 2PYOC 5DNMD 4WU9B 3AZHD 3AV2D 1KU5A 5BNXB 4WU9C 1JFIA 3AV1B 4H9RB 3AYWD 4CAYA 5BNVB 5JRGA 3W97C 4WV4B 3MGQA 3WA9A 3A6ND 2BYKB 1P3KB 1P3KC 5BT1D 3C1BB 3C1BC 5AV9D 2F8NB 5B2IA 3TU4A 2F8NK 1TZYB 1TZYC 3W96C 3REKD 3KSYA 3MGSD 3UT9A 3R45A 2IO5B 2IO5C 5GSUD 3X1TC 3X1TB 1P3IC 1P3IB 1P3LA 3X1UD 4KHAB 3AZND 5KDMA 3C1CD 4E45A 1AOIA 3AYWB 3AYWC 2FJ7A 5B24A 3B6GB 3AZGB 3A6NC 3A6NB 3B6FA 3B6GC 5B40D 3KWQA 5B1MA 4XZQA 3UTAA 5AV9C 5AV9B 3AZJD 1U35D 4YM6B 4YM6C 1KX3A 3W99A 4E44A 1ID3D 2HIOB 4DRBA 3AZMC 1BH9A 3AZMB 3X1VA 3MGSB 3MGSC 1P3BD 5AV6B 5AV6C 5F99D 5GSUC 3WKJD 3X1UC 3X1UB 5CPIC 3LJAD 3REIA 5CPIB 1M18D 5AY8D 4XUJA 5GT3A 3C1CB 3C1CC 1P3GD 5JA4B 5B32D 3REJB 4R8PD 3O62D 3REJC 5CPKA 2NQBA 4DRAA 5GT0A 3AZKB 3AZKC 2HUEB 2HUEC 4UUZB 4H9OA 3WAAA 3AZJC 3AZJB 5G49B 1U35C 1U35B 4LD9D 3NQUB 3AZIA 1ID3C 3B0BA 2CV5B 2YFWA 3AZED 1ID3B 5FUGB 3VH5T 1P34D 3W98D 4H9SA 3RELD 3WKJC 5GXQA 2BYMA 3LJAB 3LJAC 3MGPB 5BS7C 2AROD 1M18B 1M18C 3AZFA 1P3PD 4G91B 4G91C 5AY8C 3KXBB 3KXBC 3MGRD 4Z2MH 4ZUXD 4X23D 4J8WA 1P3OD 5CP6B 5CP6C 1KX5A 4KGCD 5AVBD 5B2JA 1HQ3C 1HQ3B 1P3FB 5B0YA 3B0CT 1EQZA 4CSRA 3KUYD 5B33D 3AN2D 5C3IB 3W98C 5B31D 1F66D 3RELB 3RELC 5CPJB 5CPJC 1M1AD 5DNNB 5DNNC 2AROC 2AROB 3REHB 3MGQD 4J8UA 3X1SD 3REHC 5B1LA 4H9NB 3MGRC 4X23C 4X23B 4WNNA 1P3OC 1P3OB 1S32A 5AVCA 2PYOB 5E5AC 5E5AB 5B2ID 4KGCB 4KGCC 3TU4D 1KX4A 3LELB 3LELC 3WTPE 3W97B 3UT9D 5BNXA 3KUYB 3KUYC 3AV1A 4H9RA 4NE5A 5B33B 5B33C 5BNVA 3V9RA 4AWLC 4AWLB 1B6WA 1N1JB 4JJNB 4JJNC 2BYKA 5B31C 1P3KA 1F66C 2F8NA 2YFVB 3MVDB 3MVDC 1M1AB 1BH8B 1M1AC 3W96B 4YS3C 4YS3B 4J8XA 4QLCD 1AOID 1TZYA 3X1SB 3X1SC 2FJ7D 1TAFB 2NZDD 5B24D 4J8VC 4J8VB 1ZLAA 3B6FD 1Q9CA 4KUDA 3X1TA 3KWQD 5B1MD 4Z5TD 4XZQD 3UTAD 4KHAA 5DNMC 5B2IC 5B2IB 5DNMB 3TU4C 3TU4B 3AZHB 3AZHC 3AV2B 3AV2C 1KX3D 2F8NG 3W99D 3R45B 3AYWA 3WTPD 4HGAC 5BT1C 3REID 4WZSB 3B6GA 3AZGA 3LZ1A 2L5AA 5KDMB 4XUJD 5GT3D 3REKB 3REKC 4YM6A 5CPKD 4QLCC 4QLCB 5GSUB 2NQBD 2HIOA 3AZMA 3MGSA 5GT0D 2FJ7B 2FJ7C 5AV6A 2NZDC 2NZDB 4WU8D 3B6FB 3B6FC 2RVQD 3AZNB 3AZNC 4Z5TB 4Z5TC 3X1UA 3UTAC 3UTAB 5CPIA 3WAAD 3VH6W 1KX3B 1KX3C 3W99C 3AZID 3VH5W 4NFTA 3REJA 4Z66A 3WTPB 3WTPC 3AZLA 3LZ0A 5B40B 5B40C 5GXQD 3AZKA 5AV5A 3REIB 3REIC 5BO0B 1H3OB 3AZFD 4UUZA 3VH6T 3AZJA 1U35A 5G49A 3NQUA 4J8WD 1P3BB 1P3BC 5F99C 5F99B 2NQBC 2NQBB 4EO5C 4EO5B 2CV5A 1BFMA 3WKJB 5FUGA 1KX5D 3NQJB 1B67A 4WU8B 4WU8C 5B2JD 4M6BA 3B0CW 5AY8B 1P3AA 1EQZD 4H9OB 3MGPA 5BS7A 1P3GB 1P3GC 5B32B 5B32C 3MNNA 2LY8A 3KXBA 3AFAA 4R8PC 4R8PB 3O62C 3O62B 3AZIB 3AZIC 4H9QA 2YFWB 4H9PB 4H9SC 1P3MA 5CP6A 1M19D 1F1EA 1HTAA 3UTBD 4LD9C 1HQ3A 3AZFC 3AZFB 1P3FA 4LD9B 4J8UD 5B1LD 3AZEB 3AZEC 4J8WB 4J8WC 1P34B 1P34C 3W98B 1S32D 1KX5C 5B2JC 5CPJA 5B0ZA 5JRGD 1P3PB 1P3PC 1EQZC 3WA9D 5DNNA 3AV1D 2AROA 3MGRB 4ZUXB 4ZUXC 2F8NH 3REHA 4H9NA 3VH6A 1P3KD 5AV8A 3VH5A 5AVBC 5AVBB 1M19C 1M19B 2F8ND 5E5AA 2PYOA 3UTBB 3UTBC 4WU9A 1ULYA 3LELA 4J8XD 3W97A 4J8UB 4J8UC 1P3LD 5B1LC 1ZLAD 4KUDD 3AN2B 3AN2C 3X1TD 5B31B 1F66B 3C1BA 4JJNA 2YFVA 1JFIB 3MVDA 1M1AA 1BH8A 4CAYB 3W96A 5JRGB 5JRGC 3MGQB 3MGQC 4Z2MG 3WA9B 4YS3A 3WA9C 3AV1C 3V9RB 3X1SA 1P3IA 1TAFA 4J8VA 3B6GD 3AZGD 3LZ1D 5CHLB 5DNMA 3X1VD 5B31G 3AZHA 4YM6D 3UT9B 3UT9C 3AV2A 4J8XC 4J8XB 2HIOD 3AZMD 4HGAB 1P3LB 1P3LC 5AV6D 1ZLAC 1ZLAB 3A6NA 4KUDB 4KUDC 5AV9A 5CPID 1AOIB 1AOIC 3REKA 3REJD 1A7WA 4Z66D 5B24C 4QLCA 5B24B 5GSUA 3AZLD 3LZ0D 3KWQC 3KWQB 3AZKD 2NZDA 5B1MB 5B1MC 4XZQB 4XZQC 5AV5D 3AZGC 3LZ1B 3LZ1C 3AZNA 4Z5TA 3W99B 3C1CA 3X1VC 5JA4A 3X1VB 1BH9B 4NE3A 2HIOC 2CV5D 1WWIA 3WTPA 5B40A 1P3AD 4XUJC 5BO0A 5GT3C 5GT3B 4XUJB 3MGPD 4G92B 4G92C 1H3OA 3MNND 3AFAD 3KXBD 5CPKB 5CPKC 1ID3A 5GT0B 5GT0C 1P3BA 4Z66B 5F99A 4Z66C 1P3MD 5CP6D 3AZLB 2RVQC 3LZ0B 3LZ0C 3AZLC 3WKJA 5AV5B 5AV5C 3NQJA 5B0YD 3LJAA 4WU8A 3WAAC 3WAAB 1M18A 1HQ3D 1P3FD 5AY8A 1P3GA 5B32A
chains in the Genus database with same CATH superfamily
4R8PA 3O62A 2CV5C 4H9PA 5GXQB 2BYMB 5GXQC 5CPJD 5B0ZD 1WWSA 1P3AB 1P3AC 3MGPC 5DNND 4LD9A 4NE6A 3MNNC 3MNNB 3AFAC 3AFAB 3REHD 4H9QB 5AVCD 3AZEA 5B32G 1P34A 1KX5B 3W98A 5AV8D 1KX4D 1P3MB 2G5HC 3RELA 5B2JB 1P3MC 2PYOD 5E5AD 5B0YC 5B0YB 4WU9D 3LELD 1EQZB 4CSRB 1P3FC 1P3PA 3W97D 3MGRA 4ZUXA 4X23A 2CWEA 1P3OA 3KFUG 3C1BD 5C3IC 4JJND 4KGCA 5AVBA 1M19A 3MVDD 1TZYD 2XD1A 4ZBJC 4ZBJB 5B0ZB 5B0ZC 3UTBA 3W96D 3KUYA 5B1LB 4YS3D 1R4VA 5B33A 4WNNB 3B0DC 1Z2CB 2Y2KA 3B0DB 1S32B 1S32C 1P3ID 1N1JA 4J8VD 5AVCB 5AVCC 3AN2A 5B31A 1F66A 5AV8B 5AV8C 1KX4B 2JSSA 1KX4C 2PYOC 5DNMD 4WU9B 3AZHD 3AV2D 1KU5A 5BNXB 4WU9C 1JFIA 3AV1B 4H9RB 3AYWD 4CAYA 5BNVB 5JRGA 3W97C 4WV4B 3MGQA 3WA9A 3A6ND 2BYKB 1P3KB 1P3KC 5BT1D 3C1BB 2ZY3A 5AV9D 3C1BC 2F8NB 2F2AC 5B2IA 3TU4A 2F8NK 1TZYB 1TZYC 3W96C 3REKD 3KSYA 3MGSD 3UT9A 3R45A 2IO5B 2IO5C 5GSUD 3X1TC 3X1TB 1P3IC 1P3IB 1P3LA 3X1UD 4KHAB 3AZND 5KDMA 3A1KA 3C1CD 4E45A 1AOIA 3AYWB 3AYWC 2Y2GA 2FJ7A 5B24A 3B6GB 3AZGB 3A6NC 3A6NB 3B6FA 3B6GC 5B40D 3KWQA 5B1MA 4XZQA 3UTAA 5AV9C 5AV9B 3AZJD 1U35D 4YM6B 4YM6C 1KX3A 3W99A 4E44A 1ID3D 2HIOB 4DRBA 3AZMC 1BH9A 3EPLA 3AZMB 3X1VA 3MGSB 3MGSC 1P3BD 5AV6B 5AV6C 5F99D 5GSUC 2RIQA 3WKJD 3X1UC 3X1UB 5CPIC 3LJAD 3REIA 5CPIB 1M18D 2ZM5A 5AY8D 4XUJA 2Y2MA 5GT3A 3C1CB 3C1CC 3AL0C 1P3GD 5JA4B 5B32D 3REJB 4R8PD 3O62D 3REJC 5CPKA 2NQBA 2UWXA 4DRAA 5GT0A 3AZKB 3AZKC 2HUEB 2HUEC 4UUZB 4H9OA 3WAAA 3IP4C 3AZJC 3AZJB 5G49B 1U35C 1U35B 4LD9D 3NQUB 3AZIA 3H0LC 1ID3C 3B0BA 2CV5B 2YFWA 3AZED 1ID3B 5FUGB 3VH5T 1P34D 3W98D 4H9SA 3RELD 3WKJC 5GXQA 2BYMA 3LJAB 3LJAC 4DQYB 3MGPB 5BS7C 2AROD 1M18B 1M18C 3AZFA 1P3PD 2DQNC 4G91B 4G91C 5AY8C 3KXBB 3KXBC 3MGRD 4Z2MH 4ZUXD 4X23D 4J8WA 1P3OD 5CP6B 5CP6C 1KX5A 4KGCD 5AVBD 5B2JA 1HQ3C 1HQ3B 1P3FB 5B0YA 3B0CT 1EQZA 4CSRA 3KUYD 5B33D 3EPHA 2JE5A 3AN2D 5C3IB 3W98C 5B31D 1F66D 3RELB 3RELC 5CPJB 5CPJC 1M1AD 5DNNB 5DNNC 2AROC 2AROB 3REHB 3MGQD 4J8UA 3X1SD 3REHC 5B1LA 4H9NB 4WJ3C 3MGRC 4X23C 4X23B 4WNNA 1P3OC 1P3OB 1S32A 5AVCA 2PYOB 5E5AC 2Y2OA 5E5AB 5B2ID 4KGCB 4KGCC 3TU4D 1KX4A 3LELB 3LELC 2XD5A 3WTPE 2ZY2A 3W97B 3UT9D 5BNXA 3KUYB 3KUYC 2ZY5A 4H9RA 4NE5A 5B33B 5B33C 3AV1A 5BNVA 3V9RA 4AWLC 4AWLB 1B6WA 2Y2LA 1N1JB 2Y2JA 4JJNB 4JJNC 2BYKA 3H0RC 5B31C 1P3KA 1F66C 2F8NA 2YFVB 3MVDB 3MVDC 1M1AB 1BH8B 1M1AC 3W96B 4YS3C 4YS3B 4J8XA 4QLCD 1AOID 4UPKA 1TZYA 3X1SB 3X1SC 2FJ7D 1TAFB 2NZDD 5B24D 4J8VC 4J8VB 1ZLAA 3B6FD 1Q9CA 4KUDA 3X1TA 3KWQD 5B1MD 4Z5TD 4XZQD 3UTAD 4KHAA 5DNMC 5B2IC 5B2IB 5DNMB 3TU4C 3TU4B 3AZHB 3AZHC 3AV2B 3AV2C 1KX3D 2F8NG 3W99D 3R45B 3AYWA 3WTPD 4HGAC 5BT1C 3REID 4WZSB 3B6GA 3AZGA 3LZ1A 2L5AA 2JCHA 5KDMB 4XUJD 5GT3D 3H0MC 3REKB 3REKC 4YM6A 5CPKD 2BG1A 4QLCC 4QLCB 5GSUB 2NQBD 2HIOA 3AZMA 3MGSA 5GT0D 2FJ7B 2VQRA 5AV6A 2FJ7C 2NZDC 2NZDB 4WU8D 3B6FB 3B6FC 2RVQD 3AZNB 3AZNC 4Z5TB 4Z5TC 3X1UA 3UTAC 3UTAB 5CPIA 3WAAD 2DF4C 3VH6W 1KX3B 1KX3C 3W99C 3AZID 3VH5W 2Y2PA 4NFTA 3REJA 4Z66A 3WTPB 3WTPC 3AZLA 3LZ0A 5B40B 5B40C 5GXQD 3AZKA 5AV5A 3REIB 3REIC 5BO0B 1H3OB 3AZFD 2G5IC 4UUZA 3VH6T 3AZJA 1U35A 5G49A 3NQUA 4J8WD 1PZRA 1P3BB 1P3BC 5F99C 5F99B 2NQBC 2NQBB 4EO5C 4EO5B 2CV5A 1BFMA 3WKJB 5FUGA 1KX5D 2W8SA 3NQJB 1B67A 4WU8B 4WU8C 5B2JD 4M6BA 3B0CW 5AY8B 1P3AA 1EQZD 4H9OB 3MGPA 5BS7A 1P3GB 1P3GC 5B32B 5B32C 3MNNA 2LY8A 3KXBA 3AFAA 4R8PC 4R8PB 3O62C 3O62B 3AZIB 3AZIC 4H9QA 2YFWB 4H9PB 4H9SC 1P3MA 5CP6A 1M19D 1F1EA 1HTAA 3UTBD 4LD9C 1HQ3A 3AZFC 3AZFB 1P3FA 4LD9B 3EPJA 4J8UD 5B1LD 3AZEB 3AZEC 4J8WB 4J8WC 1P34B 1P34C 3W98B 1S32D 1KX5C 3A1IA 5B2JC 5CPJA 5B0ZA 1T3UA 5JRGD 1P3PB 1P3PC 1EQZC 3WA9D 5DNNA 2Y2IA 3AV1D 2AROA 3MGRB 4ZUXB 4ZUXC 2F8NH 3REHA 4H9NA 3VH6A 1P3KD 5AV8A 3VH5A 5AVBC 5AVBB 1M19C 1M19B 2F8ND 5E5AA 2PYOA 3UTBB 3UTBC 4WU9A 1ULYA 3LELA 4J8XD 1W2EA 3W97A 3F6TA 4J8UB 4J8UC 1P3LD 5B1LC 1ZLAD 3P5JB 4KUDD 3AN2B 3AN2C 3X1TD 5B31B 1F66B 3C1BA 2FFFB 4JJNA 3EPKA 2YFVA 1JFIB 3MVDA 1M1AA 1BH8A 4CAYB 3W96A 5JRGB 5JRGC 3MGQB 3MGQC 4Z2MG 3WA9B 4YS3A 3WA9C 3AV1C 3V9RB 3X1SA 1P3IA 1TAFA 4J8VA 3B6GD 3AZGD 3LZ1D 5CHLB 5DNMA 3X1VD 5B31G 3AZHA 4YM6D 3UT9B 3UT9C 3AV2A 4J8XC 4J8XB 2HIOD 3AZMD 4HGAB 1P3LB 1P3LC 5AV6D 1ZLAC 1ZLAB 3A6NA 4KUDB 4KUDC 2ZY4A 5AV9A 5CPID 2Y2NA 1AOIB 1AOIC 3REKA 3REJD 1A7WA 4Z66D 5B24C 4QLCA 5B24B 5GSUA 2Y2HA 3AZLD 3LZ0D 3KWQC 3KWQB 3AZKD 2NZDA 5AV5D 5B1MB 5B1MC 4XZQB 4XZQC 3AZGC 3LZ1B 3LZ1C 3AZNA 3FDDA 4Z5TA 3W99B 3C1CA 3X1VC 5JA4A 3X1VB 1BH9B 4NE3A 2HIOC 2CV5D 1WWIA 3WTPA 2Y2QA 5B40A 1P3AD 4XUJC 5BO0A 5GT3C 5GT3B 4XUJB 3MGPD 4G92B 4G92C 1H3OA 2J8PA 3MNND 3AFAD 3KXBD 5CPKB 5CPKC 1ID3A 5GT0B 5GT0C 1P3BA 4Z66B 5F99A 4Z66C 1P3MD 5CP6D 3AZLB 2RVQC 3LZ0B 3LZ0C 3AZLC 3WKJA 5AV5C 5AV5B 5B0YD 3NQJA 3LJAA 4WU8A 3WAAC 3WAAB 1M18A 1HQ3D 1P3FD 5AY8A 1P3GA 3EG5B 5B32A
chains in the Genus database with same CATH topology
4R8PA 3O62A 2CV5C 4H9PA 5GXQB 2BYMB 5GXQC 5CPJD 5B0ZD 1WWSA 1P3AB 1P3AC 3MGPC 5DNND 4LD9A 4NE6A 3MNNC 3MNNB 3AFAC 3AFAB 3REHD 4H9QB 5AVCD 3AZEA 5B32G 1P34A 1KX5B 3W98A 5AV8D 1KX4D 1P3MB 2G5HC 3RELA 5B2JB 1P3MC 2PYOD 5E5AD 5B0YC 5B0YB 4WU9D 3LELD 1EQZB 4CSRB 1P3FC 1P3PA 3W97D 3MGRA 4ZUXA 4X23A 2CWEA 1P3OA 3KFUG 3C1BD 5C3IC 4JJND 4KGCA 5AVBA 1M19A 3MVDD 1TZYD 2XD1A 4ZBJC 4ZBJB 5B0ZB 5B0ZC 3UTBA 3W96D 3KUYA 5B1LB 4YS3D 1R4VA 5B33A 4WNNB 3B0DC 1Z2CB 2Y2KA 3B0DB 1S32B 1S32C 1P3ID 1N1JA 4J8VD 5AVCB 5AVCC 3AN2A 5B31A 1F66A 5AV8B 5AV8C 1KX4B 2JSSA 1KX4C 2PYOC 5DNMD 4WU9B 3AZHD 3AV2D 1KU5A 5BNXB 4WU9C 1JFIA 3AV1B 4H9RB 3AYWD 4CAYA 5BNVB 5JRGA 3W97C 4WV4B 3MGQA 3WA9A 3A6ND 2BYKB 1P3KB 1P3KC 5BT1D 3C1BB 2ZY3A 5AV9D 3C1BC 2F8NB 2F2AC 5B2IA 3TU4A 2F8NK 1TZYB 1TZYC 3W96C 3REKD 3KSYA 3MGSD 3UT9A 3R45A 2IO5B 2IO5C 5GSUD 3X1TC 3X1TB 1P3IC 1P3IB 1P3LA 3X1UD 4KHAB 3AZND 5KDMA 3A1KA 3C1CD 4E45A 1AOIA 3AYWB 3AYWC 2Y2GA 2FJ7A 5B24A 3B6GB 3AZGB 3A6NC 3A6NB 3B6FA 3B6GC 5B40D 3KWQA 5B1MA 4XZQA 3UTAA 5AV9C 5AV9B 3AZJD 1U35D 4YM6B 4YM6C 1KX3A 3W99A 4E44A 1ID3D 2HIOB 4DRBA 3AZMC 1BH9A 3EPLA 3AZMB 3X1VA 3MGSB 3MGSC 1P3BD 5AV6B 5AV6C 5F99D 5GSUC 2RIQA 3WKJD 3X1UC 3X1UB 5CPIC 3LJAD 3REIA 5CPIB 1M18D 2ZM5A 5AY8D 4XUJA 2Y2MA 5GT3A 3C1CB 3C1CC 3AL0C 1P3GD 5JA4B 5B32D 3REJB 4R8PD 3O62D 3REJC 5CPKA 2NQBA 2UWXA 4DRAA 5GT0A 3AZKB 3AZKC 2HUEB 2HUEC 4UUZB 4H9OA 3WAAA 3IP4C 3AZJC 3AZJB 5G49B 1U35C 1U35B 4LD9D 3NQUB 3AZIA 3H0LC 1ID3C 3B0BA 2CV5B 2YFWA 3AZED 1ID3B 5FUGB 3VH5T 1P34D 3W98D 4H9SA 3RELD 3WKJC 5GXQA 2BYMA 3LJAB 3LJAC 4DQYB 3MGPB 5BS7C 2AROD 1M18B 1M18C 3AZFA 1P3PD 2DQNC 4G91B 4G91C 5AY8C 3KXBB 3KXBC 3MGRD 4Z2MH 4ZUXD 4X23D 4J8WA 1P3OD 5CP6B 5CP6C 1KX5A 4KGCD 5AVBD 5B2JA 1HQ3C 1HQ3B 1P3FB 5B0YA 3B0CT 1EQZA 4CSRA 3KUYD 5B33D 3EPHA 2JE5A 3AN2D 5C3IB 3W98C 5B31D 1F66D 3RELB 3RELC 5CPJB 5CPJC 1M1AD 5DNNB 5DNNC 2AROC 2AROB 3REHB 3MGQD 4J8UA 3X1SD 3REHC 5B1LA 4H9NB 4WJ3C 3MGRC 4X23C 4X23B 4WNNA 1P3OC 1P3OB 1S32A 5AVCA 2PYOB 5E5AC 2Y2OA 5E5AB 5B2ID 4KGCB 4KGCC 3TU4D 1KX4A 3LELB 3LELC 2XD5A 3WTPE 2ZY2A 3W97B 3UT9D 5BNXA 3KUYB 3KUYC 2ZY5A 4H9RA 4NE5A 5B33B 5B33C 3AV1A 5BNVA 3V9RA 4AWLC 4AWLB 1B6WA 2Y2LA 1N1JB 2Y2JA 4JJNB 4JJNC 2BYKA 3H0RC 5B31C 1P3KA 1F66C 2F8NA 2YFVB 3MVDB 3MVDC 1M1AB 1BH8B 1M1AC 3W96B 4YS3C 4YS3B 4J8XA 4QLCD 1AOID 4UPKA 1TZYA 3X1SB 3X1SC 2FJ7D 1TAFB 2NZDD 5B24D 4J8VC 4J8VB 1ZLAA 3B6FD 1Q9CA 4KUDA 3X1TA 3KWQD 5B1MD 4Z5TD 4XZQD 3UTAD 4KHAA 5DNMC 5B2IC 5B2IB 5DNMB 3TU4C 3TU4B 3AZHB 3AZHC 3AV2B 3AV2C 1KX3D 2F8NG 3W99D 3R45B 3AYWA 3WTPD 4HGAC 5BT1C 3REID 4WZSB 3B6GA 3AZGA 3LZ1A 2L5AA 2JCHA 5KDMB 4XUJD 5GT3D 3H0MC 3REKB 3REKC 4YM6A 5CPKD 2BG1A 4QLCC 4QLCB 5GSUB 2NQBD 2HIOA 3AZMA 3MGSA 5GT0D 2FJ7B 2VQRA 5AV6A 2FJ7C 2NZDC 2NZDB 4WU8D 3B6FB 3B6FC 2RVQD 3AZNB 3AZNC 4Z5TB 4Z5TC 3X1UA 3UTAC 3UTAB 5CPIA 3WAAD 2DF4C 3VH6W 1KX3B 1KX3C 3W99C 3AZID 3VH5W 2Y2PA 4NFTA 3REJA 4Z66A 3WTPB 3WTPC 3AZLA 3LZ0A 5B40B 5B40C 5GXQD 3AZKA 5AV5A 3REIB 3REIC 5BO0B 1H3OB 3AZFD 2G5IC 4UUZA 3VH6T 3AZJA 1U35A 5G49A 3NQUA 4J8WD 1PZRA 1P3BB 1P3BC 5F99C 5F99B 2NQBC 2NQBB 4EO5C 4EO5B 2CV5A 1BFMA 3WKJB 5FUGA 1KX5D 2W8SA 3NQJB 1B67A 4WU8B 4WU8C 5B2JD 4M6BA 3B0CW 5AY8B 1P3AA 1EQZD 4H9OB 3MGPA 5BS7A 1P3GB 1P3GC 5B32B 5B32C 3MNNA 2LY8A 3KXBA 3AFAA 4R8PC 4R8PB 3O62C 3O62B 3AZIB 3AZIC 4H9QA 2YFWB 4H9PB 4H9SC 1P3MA 5CP6A 1M19D 1F1EA 1HTAA 3UTBD 4LD9C 1HQ3A 3AZFC 3AZFB 1P3FA 4LD9B 3EPJA 4J8UD 5B1LD 3AZEB 3AZEC 4J8WB 4J8WC 1P34B 1P34C 3W98B 1S32D 1KX5C 3A1IA 5B2JC 5CPJA 5B0ZA 1T3UA 5JRGD 1P3PB 1P3PC 1EQZC 3WA9D 5DNNA 2Y2IA 3AV1D 2AROA 3MGRB 4ZUXB 4ZUXC 2F8NH 3REHA 4H9NA 3VH6A 1P3KD 5AV8A 3VH5A 5AVBC 5AVBB 1M19C 1M19B 2F8ND 5E5AA 2PYOA 3UTBB 3UTBC 4WU9A 1ULYA 3LELA 4J8XD 1W2EA 3W97A 3F6TA 4J8UB 4J8UC 1P3LD 5B1LC 1ZLAD 3P5JB 4KUDD 3AN2B 3AN2C 3X1TD 5B31B 1F66B 3C1BA 2FFFB 4JJNA 3EPKA 2YFVA 1JFIB 3MVDA 1M1AA 1BH8A 4CAYB 3W96A 5JRGB 5JRGC 3MGQB 3MGQC 4Z2MG 3WA9B 4YS3A 3WA9C 3AV1C 3V9RB 3X1SA 1P3IA 1TAFA 4J8VA 3B6GD 3AZGD 3LZ1D 5CHLB 5DNMA 3X1VD 5B31G 3AZHA 4YM6D 3UT9B 3UT9C 3AV2A 4J8XC 4J8XB 2HIOD 3AZMD 4HGAB 1P3LB 1P3LC 5AV6D 1ZLAC 1ZLAB 3A6NA 4KUDB 4KUDC 2ZY4A 5AV9A 5CPID 2Y2NA 1AOIB 1AOIC 3REKA 3REJD 1A7WA 4Z66D 5B24C 4QLCA 5B24B 5GSUA 2Y2HA 3AZLD 3LZ0D 3KWQC 3KWQB 3AZKD 2NZDA 5AV5D 5B1MB 5B1MC 4XZQB 4XZQC 3AZGC 3LZ1B 3LZ1C 3AZNA 3FDDA 4Z5TA 3W99B 3C1CA 3X1VC 5JA4A 3X1VB 1BH9B 4NE3A 2HIOC 2CV5D 1WWIA 3WTPA 2Y2QA 5B40A 1P3AD 4XUJC 5BO0A 5GT3C 5GT3B 4XUJB 3MGPD 4G92B 4G92C 1H3OA 2J8PA 3MNND 3AFAD 3KXBD 5CPKB 5CPKC 1ID3A 5GT0B 5GT0C 1P3BA 4Z66B 5F99A 4Z66C 1P3MD 5CP6D 3AZLB 2RVQC 3LZ0B 3LZ0C 3AZLC 3WKJA 5AV5C 5AV5B 5B0YD 3NQJA 3LJAA 4WU8A 3WAAC 3WAAB 1M18A 1HQ3D 1P3FD 5AY8A 1P3GA 3EG5B 5B32A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4R8P A;  3O62 A;  2CV5 C;  4H9P A;  5GXQ B;  2BYM B;  5GXQ C;  5CPJ D;  5B0Z D;  1WWS A;  1P3A B;  1P3A C;  3MGP C;  5DNN D;  4LD9 A;  4NE6 A;  3MNN C;  3MNN B;  3AFA C;  3AFA B;  3REH D;  4H9Q B;  5AVC D;  3AZE A;  5B32 G;  1P34 A;  1KX5 B;  3W98 A;  5AV8 D;  1KX4 D;  1P3M B;  1P3M C;  3REL A;  5B2J B;  2PYO D;  5E5A D;  5B0Y C;  5B0Y B;  4WU9 D;  3LEL D;  1EQZ B;  4CSR B;  1P3F C;  1P3P A;  3W97 D;  3MGR A;  4ZUX A;  4X23 A;  2CWE A;  1P3O A;  3C1B D;  5C3I C;  4JJN D;  4KGC A;  5AVB A;  1M19 A;  3MVD D;  1TZY D;  4ZBJ C;  4ZBJ B;  5B0Z B;  5B0Z C;  3UTB A;  3W96 D;  3KUY A;  5B1L B;  4YS3 D;  1R4V A;  5B33 A;  4WNN B;  3B0D C;  3B0D B;  1P3I D;  1S32 B;  1S32 C;  1N1J A;  4J8V D;  5AVC B;  5AVC C;  3AN2 A;  5B31 A;  1F66 A;  5AV8 B;  5AV8 C;  1KX4 B;  2JSS A;  1KX4 C;  2PYO C;  5DNM D;  4WU9 B;  3AZH D;  3AV2 D;  1KU5 A;  5BNX B;  4WU9 C;  1JFI A;  3AV1 B;  4H9R B;  3AYW D;  4CAY A;  5BNV B;  5JRG A;  3W97 C;  4WV4 B;  3MGQ A;  3WA9 A;  3A6N D;  2BYK B;  1P3K B;  1P3K C;  5BT1 D;  3C1B B;  3C1B C;  5AV9 D;  2F8N B;  5B2I A;  3TU4 A;  2F8N K;  1TZY B;  1TZY C;  3W96 C;  3REK D;  3KSY A;  3MGS D;  3UT9 A;  3R45 A;  2IO5 B;  2IO5 C;  5GSU D;  3X1T C;  3X1T B;  1P3I C;  1P3I B;  1P3L A;  3X1U D;  4KHA B;  3AZN D;  5KDM A;  3C1C D;  4E45 A;  1AOI A;  3AYW B;  3AYW C;  2FJ7 A;  5B24 A;  3B6G B;  3AZG B;  3A6N C;  3A6N B;  3B6F A;  3B6G C;  5B40 D;  3KWQ A;  5B1M A;  4XZQ A;  3UTA A;  5AV9 C;  5AV9 B;  3AZJ D;  1U35 D;  4YM6 B;  4YM6 C;  1KX3 A;  3W99 A;  4E44 A;  1ID3 D;  2HIO B;  4DRB A;  3AZM C;  1BH9 A;  3AZM B;  3X1V A;  3MGS B;  3MGS C;  1P3B D;  5AV6 B;  5AV6 C;  5F99 D;  5GSU C;  3WKJ D;  3X1U C;  3X1U B;  5CPI C;  3LJA D;  3REI A;  5CPI B;  1M18 D;  5AY8 D;  4XUJ A;  5GT3 A;  3C1C B;  3C1C C;  1P3G D;  5JA4 B;  5B32 D;  3REJ B;  4R8P D;  3O62 D;  3REJ C;  5CPK A;  2NQB A;  4DRA A;  5GT0 A;  3AZK B;  3AZK C;  2HUE B;  2HUE C;  4UUZ B;  4H9O A;  3WAA A;  3AZJ C;  3AZJ B;  5G49 B;  1U35 C;  1U35 B;  4LD9 D;  3NQU B;  3AZI A;  1ID3 C;  3B0B A;  2CV5 B;  2YFW A;  3AZE D;  1ID3 B;  5FUG B;  3VH5 T;  1P34 D;  3W98 D;  4H9S A;  3REL D;  3WKJ C;  5GXQ A;  2BYM A;  3LJA B;  3LJA C;  3MGP B;  5BS7 C;  2ARO D;  1M18 B;  1M18 C;  3AZF A;  1P3P D;  4G91 B;  4G91 C;  5AY8 C;  3KXB B;  3KXB C;  3MGR D;  4Z2M H;  4ZUX D;  4X23 D;  4J8W A;  1P3O D;  5CP6 B;  5CP6 C;  1KX5 A;  4KGC D;  5AVB D;  5B2J A;  1HQ3 C;  1HQ3 B;  1P3F B;  5B0Y A;  3B0C T;  1EQZ A;  4CSR A;  3KUY D;  5B33 D;  3AN2 D;  5C3I B;  3W98 C;  5B31 D;  1F66 D;  3REL B;  3REL C;  5CPJ B;  5CPJ C;  1M1A D;  5DNN B;  5DNN C;  2ARO C;  2ARO B;  3REH B;  3MGQ D;  4J8U A;  3X1S D;  3REH C;  5B1L A;  4H9N B;  3MGR C;  4X23 C;  4X23 B;  4WNN A;  1P3O C;  1P3O B;  1S32 A;  5AVC A;  2PYO B;  5E5A C;  5E5A B;  5B2I D;  4KGC B;  4KGC C;  3TU4 D;  1KX4 A;  3LEL B;  3LEL C;  3WTP E;  3W97 B;  3UT9 D;  5BNX A;  3KUY B;  3KUY C;  3AV1 A;  4H9R A;  4NE5 A;  5B33 B;  5B33 C;  5BNV A;  3V9R A;  4AWL C;  4AWL B;  1B6W A;  1N1J B;  4JJN B;  4JJN C;  2BYK A;  5B31 C;  1P3K A;  1F66 C;  2F8N A;  2YFV B;  3MVD B;  3MVD C;  1M1A B;  1BH8 B;  1M1A C;  3W96 B;  4YS3 C;  4YS3 B;  4J8X A;  4QLC D;  1AOI D;  1TZY A;  3X1S B;  3X1S C;  2FJ7 D;  1TAF B;  2NZD D;  5B24 D;  4J8V C;  4J8V B;  1ZLA A;  3B6F D;  1Q9C A;  4KUD A;  3X1T A;  3KWQ D;  5B1M D;  4Z5T D;  4XZQ D;  3UTA D;  4KHA A;  5DNM C;  5B2I C;  5B2I B;  5DNM B;  3TU4 C;  3TU4 B;  3AZH B;  3AZH C;  3AV2 B;  3AV2 C;  1KX3 D;  2F8N G;  3W99 D;  3R45 B;  3AYW A;  3WTP D;  4HGA C;  5BT1 C;  3REI D;  4WZS B;  3B6G A;  3AZG A;  3LZ1 A;  2L5A A;  5KDM B;  4XUJ D;  5GT3 D;  3REK B;  3REK C;  4YM6 A;  5CPK D;  4QLC C;  4QLC B;  5GSU B;  2NQB D;  2HIO A;  3AZM A;  3MGS A;  5GT0 D;  2FJ7 B;  2FJ7 C;  5AV6 A;  2NZD C;  2NZD B;  4WU8 D;  3B6F B;  3B6F C;  2RVQ D;  3AZN B;  3AZN C;  4Z5T B;  4Z5T C;  3X1U A;  3UTA C;  3UTA B;  5CPI A;  3WAA D;  3VH6 W;  1KX3 B;  1KX3 C;  3W99 C;  3AZI D;  3VH5 W;  4NFT A;  3REJ A;  4Z66 A;  3WTP B;  3WTP C;  3AZL A;  3LZ0 A;  5B40 B;  5B40 C;  5GXQ D;  3AZK A;  5AV5 A;  3REI B;  3REI C;  5BO0 B;  1H3O B;  3AZF D;  4UUZ A;  3VH6 T;  3AZJ A;  1U35 A;  5G49 A;  3NQU A;  4J8W D;  1P3B B;  1P3B C;  5F99 C;  5F99 B;  2NQB C;  2NQB B;  4EO5 C;  4EO5 B;  2CV5 A;  1BFM A;  3WKJ B;  5FUG A;  1KX5 D;  3NQJ B;  1B67 A;  4WU8 B;  4WU8 C;  5B2J D;  4M6B A;  3B0C W;  5AY8 B;  1P3A A;  1EQZ D;  4H9O B;  3MGP A;  5BS7 A;  1P3G B;  1P3G C;  5B32 B;  5B32 C;  3MNN A;  2LY8 A;  3KXB A;  3AFA A;  4R8P C;  4R8P B;  3O62 C;  3O62 B;  3AZI B;  3AZI C;  4H9Q A;  2YFW B;  4H9P B;  4H9S C;  1P3M A;  5CP6 A;  1M19 D;  1F1E A;  1HTA A;  3UTB D;  4LD9 C;  1HQ3 A;  3AZF C;  3AZF B;  1P3F A;  4LD9 B;  4J8U D;  5B1L D;  3AZE B;  3AZE C;  4J8W B;  4J8W C;  1P34 B;  1P34 C;  3W98 B;  1S32 D;  1KX5 C;  5B2J C;  5CPJ A;  5B0Z A;  5JRG D;  1P3P B;  1P3P C;  1EQZ C;  3WA9 D;  5DNN A;  3AV1 D;  2ARO A;  3MGR B;  4ZUX B;  4ZUX C;  2F8N H;  3REH A;  4H9N A;  3VH6 A;  1P3K D;  5AV8 A;  3VH5 A;  5AVB C;  5AVB B;  1M19 C;  1M19 B;  2F8N D;  5E5A A;  2PYO A;  3UTB B;  3UTB C;  4WU9 A;  1ULY A;  3LEL A;  4J8X D;  3W97 A;  4J8U B;  4J8U C;  1P3L D;  5B1L C;  1ZLA D;  4KUD D;  3AN2 B;  3AN2 C;  3X1T D;  5B31 B;  1F66 B;  3C1B A;  4JJN A;  2YFV A;  1JFI B;  3MVD A;  1M1A A;  1BH8 A;  4CAY B;  3W96 A;  5JRG B;  5JRG C;  3MGQ B;  3MGQ C;  4Z2M G;  3WA9 B;  4YS3 A;  3WA9 C;  3AV1 C;  3V9R B;  3X1S A;  1P3I A;  1TAF A;  4J8V A;  3B6G D;  3AZG D;  3LZ1 D;  5CHL B;  5DNM A;  3X1V D;  5B31 G;  3AZH A;  4YM6 D;  3UT9 B;  3UT9 C;  3AV2 A;  4J8X C;  4J8X B;  2HIO D;  3AZM D;  4HGA B;  1P3L B;  1P3L C;  5AV6 D;  1ZLA C;  1ZLA B;  3A6N A;  4KUD B;  4KUD C;  5AV9 A;  5CPI D;  1AOI B;  1AOI C;  3REK A;  3REJ D;  1A7W A;  4Z66 D;  5B24 C;  4QLC A;  5B24 B;  5GSU A;  3AZL D;  3LZ0 D;  3KWQ C;  3KWQ B;  3AZK D;  2NZD A;  5B1M B;  5B1M C;  4XZQ B;  4XZQ C;  5AV5 D;  3AZG C;  3LZ1 B;  3LZ1 C;  3AZN A;  4Z5T A;  3W99 B;  3C1C A;  3X1V C;  5JA4 A;  3X1V B;  1BH9 B;  4NE3 A;  2HIO C;  2CV5 D;  1WWI A;  3WTP A;  5B40 A;  1P3A D;  4XUJ C;  5BO0 A;  5GT3 C;  5GT3 B;  4XUJ B;  3MGP D;  4G92 B;  4G92 C;  1H3O A;  3MNN D;  3AFA D;  3KXB D;  5CPK B;  5CPK C;  1ID3 A;  5GT0 B;  5GT0 C;  1P3B A;  4Z66 B;  5F99 A;  4Z66 C;  1P3M D;  5CP6 D;  3AZL B;  2RVQ C;  3LZ0 B;  3LZ0 C;  3AZL C;  3WKJ A;  5AV5 B;  5AV5 C;  3NQJ A;  5B0Y D;  3LJA A;  4WU8 A;  3WAA C;  3WAA B;  1M18 A;  1HQ3 D;  1P3F D;  5AY8 A;  1P3G A;  5B32 A; 
#chains in the Genus database with same CATH topology
 4R8P A;  3O62 A;  2CV5 C;  4H9P A;  5GXQ B;  2BYM B;  5GXQ C;  5CPJ D;  5B0Z D;  1WWS A;  1P3A B;  1P3A C;  3MGP C;  5DNN D;  4LD9 A;  4NE6 A;  3MNN C;  3MNN B;  3AFA C;  3AFA B;  3REH D;  4H9Q B;  5AVC D;  3AZE A;  5B32 G;  1P34 A;  1KX5 B;  3W98 A;  5AV8 D;  1KX4 D;  1P3M B;  2G5H C;  3REL A;  5B2J B;  1P3M C;  2PYO D;  5E5A D;  5B0Y C;  5B0Y B;  4WU9 D;  3LEL D;  1EQZ B;  4CSR B;  1P3F C;  1P3P A;  3W97 D;  3MGR A;  4ZUX A;  4X23 A;  2CWE A;  1P3O A;  3KFU G;  3C1B D;  5C3I C;  4JJN D;  4KGC A;  5AVB A;  1M19 A;  3MVD D;  1TZY D;  2XD1 A;  4ZBJ C;  4ZBJ B;  5B0Z B;  5B0Z C;  3UTB A;  3W96 D;  3KUY A;  5B1L B;  4YS3 D;  1R4V A;  5B33 A;  4WNN B;  3B0D C;  1Z2C B;  2Y2K A;  3B0D B;  1S32 B;  1S32 C;  1P3I D;  1N1J A;  4J8V D;  5AVC B;  5AVC C;  3AN2 A;  5B31 A;  1F66 A;  5AV8 B;  5AV8 C;  1KX4 B;  2JSS A;  1KX4 C;  2PYO C;  5DNM D;  4WU9 B;  3AZH D;  3AV2 D;  1KU5 A;  5BNX B;  4WU9 C;  1JFI A;  3AV1 B;  4H9R B;  3AYW D;  4CAY A;  5BNV B;  5JRG A;  3W97 C;  4WV4 B;  3MGQ A;  3WA9 A;  3A6N D;  2BYK B;  1P3K B;  1P3K C;  5BT1 D;  3C1B B;  2ZY3 A;  5AV9 D;  3C1B C;  2F8N B;  2F2A C;  5B2I A;  3TU4 A;  2F8N K;  1TZY B;  1TZY C;  3W96 C;  3REK D;  3KSY A;  3MGS D;  3UT9 A;  3R45 A;  2IO5 B;  2IO5 C;  5GSU D;  3X1T C;  3X1T B;  1P3I C;  1P3I B;  1P3L A;  3X1U D;  4KHA B;  3AZN D;  5KDM A;  3A1K A;  3C1C D;  4E45 A;  1AOI A;  3AYW B;  3AYW C;  2Y2G A;  2FJ7 A;  5B24 A;  3B6G B;  3AZG B;  3A6N C;  3A6N B;  3B6F A;  3B6G C;  5B40 D;  3KWQ A;  5B1M A;  4XZQ A;  3UTA A;  5AV9 C;  5AV9 B;  3AZJ D;  1U35 D;  4YM6 B;  4YM6 C;  1KX3 A;  3W99 A;  4E44 A;  1ID3 D;  2HIO B;  4DRB A;  3AZM C;  1BH9 A;  3EPL A;  3AZM B;  3X1V A;  3MGS B;  3MGS C;  1P3B D;  5AV6 B;  5AV6 C;  5F99 D;  5GSU C;  2RIQ A;  3WKJ D;  3X1U C;  3X1U B;  5CPI C;  3LJA D;  3REI A;  5CPI B;  1M18 D;  2ZM5 A;  5AY8 D;  4XUJ A;  2Y2M A;  5GT3 A;  3C1C B;  3C1C C;  3AL0 C;  1P3G D;  5JA4 B;  5B32 D;  3REJ B;  4R8P D;  3O62 D;  3REJ C;  5CPK A;  2NQB A;  2UWX A;  4DRA A;  5GT0 A;  3AZK B;  3AZK C;  2HUE B;  2HUE C;  4UUZ B;  4H9O A;  3WAA A;  3IP4 C;  3AZJ C;  3AZJ B;  5G49 B;  1U35 C;  1U35 B;  4LD9 D;  3NQU B;  3AZI A;  3H0L C;  1ID3 C;  3B0B A;  2CV5 B;  2YFW A;  3AZE D;  1ID3 B;  5FUG B;  3VH5 T;  1P34 D;  3W98 D;  4H9S A;  3REL D;  3WKJ C;  5GXQ A;  2BYM A;  3LJA B;  3LJA C;  4DQY B;  3MGP B;  5BS7 C;  2ARO D;  1M18 B;  1M18 C;  3AZF A;  1P3P D;  2DQN C;  4G91 B;  4G91 C;  5AY8 C;  3KXB B;  3KXB C;  3MGR D;  4Z2M H;  4ZUX D;  4X23 D;  4J8W A;  1P3O D;  5CP6 B;  5CP6 C;  1KX5 A;  4KGC D;  5AVB D;  5B2J A;  1HQ3 C;  1HQ3 B;  1P3F B;  5B0Y A;  3B0C T;  1EQZ A;  4CSR A;  3KUY D;  5B33 D;  3EPH A;  2JE5 A;  3AN2 D;  5C3I B;  3W98 C;  5B31 D;  1F66 D;  3REL B;  3REL C;  5CPJ B;  5CPJ C;  1M1A D;  5DNN B;  5DNN C;  2ARO C;  2ARO B;  3REH B;  3MGQ D;  4J8U A;  3X1S D;  3REH C;  5B1L A;  4H9N B;  4WJ3 C;  3MGR C;  4X23 C;  4X23 B;  4WNN A;  1P3O C;  1P3O B;  1S32 A;  5AVC A;  2PYO B;  5E5A C;  2Y2O A;  5E5A B;  5B2I D;  4KGC B;  4KGC C;  3TU4 D;  1KX4 A;  3LEL B;  3LEL C;  2XD5 A;  3WTP E;  2ZY2 A;  3W97 B;  3UT9 D;  5BNX A;  3KUY B;  3KUY C;  2ZY5 A;  4H9R A;  4NE5 A;  5B33 B;  5B33 C;  3AV1 A;  5BNV A;  3V9R A;  4AWL C;  4AWL B;  1B6W A;  2Y2L A;  1N1J B;  2Y2J A;  4JJN B;  4JJN C;  2BYK A;  3H0R C;  5B31 C;  1P3K A;  1F66 C;  2F8N A;  2YFV B;  3MVD B;  3MVD C;  1M1A B;  1BH8 B;  1M1A C;  3W96 B;  4YS3 C;  4YS3 B;  4J8X A;  4QLC D;  1AOI D;  4UPK A;  1TZY A;  3X1S B;  3X1S C;  2FJ7 D;  1TAF B;  2NZD D;  5B24 D;  4J8V C;  4J8V B;  1ZLA A;  3B6F D;  1Q9C A;  4KUD A;  3X1T A;  3KWQ D;  5B1M D;  4Z5T D;  4XZQ D;  3UTA D;  4KHA A;  5DNM C;  5B2I C;  5B2I B;  5DNM B;  3TU4 C;  3TU4 B;  3AZH B;  3AZH C;  3AV2 B;  3AV2 C;  1KX3 D;  2F8N G;  3W99 D;  3R45 B;  3AYW A;  3WTP D;  4HGA C;  5BT1 C;  3REI D;  4WZS B;  3B6G A;  3AZG A;  3LZ1 A;  2L5A A;  2JCH A;  5KDM B;  4XUJ D;  5GT3 D;  3H0M C;  3REK B;  3REK C;  4YM6 A;  5CPK D;  2BG1 A;  4QLC C;  4QLC B;  5GSU B;  2NQB D;  2HIO A;  3AZM A;  3MGS A;  5GT0 D;  2FJ7 B;  2VQR A;  5AV6 A;  2FJ7 C;  2NZD C;  2NZD B;  4WU8 D;  3B6F B;  3B6F C;  2RVQ D;  3AZN B;  3AZN C;  4Z5T B;  4Z5T C;  3X1U A;  3UTA C;  3UTA B;  5CPI A;  3WAA D;  2DF4 C;  3VH6 W;  1KX3 B;  1KX3 C;  3W99 C;  3AZI D;  3VH5 W;  2Y2P A;  4NFT A;  3REJ A;  4Z66 A;  3WTP B;  3WTP C;  3AZL A;  3LZ0 A;  5B40 B;  5B40 C;  5GXQ D;  3AZK A;  5AV5 A;  3REI B;  3REI C;  5BO0 B;  1H3O B;  3AZF D;  2G5I C;  4UUZ A;  3VH6 T;  3AZJ A;  1U35 A;  5G49 A;  3NQU A;  4J8W D;  1PZR A;  1P3B B;  1P3B C;  5F99 C;  5F99 B;  2NQB C;  2NQB B;  4EO5 C;  4EO5 B;  2CV5 A;  1BFM A;  3WKJ B;  5FUG A;  1KX5 D;  2W8S A;  3NQJ B;  1B67 A;  4WU8 B;  4WU8 C;  5B2J D;  4M6B A;  3B0C W;  5AY8 B;  1P3A A;  1EQZ D;  4H9O B;  3MGP A;  5BS7 A;  1P3G B;  1P3G C;  5B32 B;  5B32 C;  3MNN A;  2LY8 A;  3KXB A;  3AFA A;  4R8P C;  4R8P B;  3O62 C;  3O62 B;  3AZI B;  3AZI C;  4H9Q A;  2YFW B;  4H9P B;  4H9S C;  1P3M A;  5CP6 A;  1M19 D;  1F1E A;  1HTA A;  3UTB D;  4LD9 C;  1HQ3 A;  3AZF C;  3AZF B;  1P3F A;  4LD9 B;  3EPJ A;  4J8U D;  5B1L D;  3AZE B;  3AZE C;  4J8W B;  4J8W C;  1P34 B;  1P34 C;  3W98 B;  1S32 D;  1KX5 C;  3A1I A;  5B2J C;  5CPJ A;  5B0Z A;  1T3U A;  5JRG D;  1P3P B;  1P3P C;  1EQZ C;  3WA9 D;  5DNN A;  2Y2I A;  3AV1 D;  2ARO A;  3MGR B;  4ZUX B;  4ZUX C;  2F8N H;  3REH A;  4H9N A;  3VH6 A;  1P3K D;  5AV8 A;  3VH5 A;  5AVB C;  5AVB B;  1M19 C;  1M19 B;  2F8N D;  5E5A A;  2PYO A;  3UTB B;  3UTB C;  4WU9 A;  1ULY A;  3LEL A;  4J8X D;  1W2E A;  3W97 A;  3F6T A;  4J8U B;  4J8U C;  1P3L D;  5B1L C;  1ZLA D;  3P5J B;  4KUD D;  3AN2 B;  3AN2 C;  3X1T D;  5B31 B;  1F66 B;  3C1B A;  2FFF B;  4JJN A;  3EPK A;  2YFV A;  1JFI B;  3MVD A;  1M1A A;  1BH8 A;  4CAY B;  3W96 A;  5JRG B;  5JRG C;  3MGQ B;  3MGQ C;  4Z2M G;  3WA9 B;  4YS3 A;  3WA9 C;  3AV1 C;  3V9R B;  3X1S A;  1P3I A;  1TAF A;  4J8V A;  3B6G D;  3AZG D;  3LZ1 D;  5CHL B;  5DNM A;  3X1V D;  5B31 G;  3AZH A;  4YM6 D;  3UT9 B;  3UT9 C;  3AV2 A;  4J8X C;  4J8X B;  2HIO D;  3AZM D;  4HGA B;  1P3L B;  1P3L C;  5AV6 D;  1ZLA C;  1ZLA B;  3A6N A;  4KUD B;  4KUD C;  2ZY4 A;  5AV9 A;  5CPI D;  2Y2N A;  1AOI B;  1AOI C;  3REK A;  3REJ D;  1A7W A;  4Z66 D;  5B24 C;  4QLC A;  5B24 B;  5GSU A;  2Y2H A;  3AZL D;  3LZ0 D;  3KWQ C;  3KWQ B;  3AZK D;  2NZD A;  5AV5 D;  5B1M B;  5B1M C;  4XZQ B;  4XZQ C;  3AZG C;  3LZ1 B;  3LZ1 C;  3AZN A;  3FDD A;  4Z5T A;  3W99 B;  3C1C A;  3X1V C;  5JA4 A;  3X1V B;  1BH9 B;  4NE3 A;  2HIO C;  2CV5 D;  1WWI A;  3WTP A;  2Y2Q A;  5B40 A;  1P3A D;  4XUJ C;  5BO0 A;  5GT3 C;  5GT3 B;  4XUJ B;  3MGP D;  4G92 B;  4G92 C;  1H3O A;  2J8P A;  3MNN D;  3AFA D;  3KXB D;  5CPK B;  5CPK C;  1ID3 A;  5GT0 B;  5GT0 C;  1P3B A;  4Z66 B;  5F99 A;  4Z66 C;  1P3M D;  5CP6 D;  3AZL B;  2RVQ C;  3LZ0 B;  3LZ0 C;  3AZL C;  3WKJ A;  5AV5 C;  5AV5 B;  5B0Y D;  3NQJ A;  3LJA A;  4WU8 A;  3WAA C;  3WAA B;  1M18 A;  1HQ3 D;  1P3F D;  5AY8 A;  1P3G A;  3EG5 B;  5B32 A; 
#chains in the Genus database with same CATH homology
 4R8P A;  3O62 A;  2CV5 C;  4H9P A;  5GXQ B;  2BYM B;  5GXQ C;  5CPJ D;  5B0Z D;  1WWS A;  1P3A B;  1P3A C;  3MGP C;  5DNN D;  4LD9 A;  4NE6 A;  3MNN C;  3MNN B;  3AFA C;  3AFA B;  3REH D;  4H9Q B;  5AVC D;  3AZE A;  5B32 G;  1P34 A;  1KX5 B;  3W98 A;  5AV8 D;  1KX4 D;  1P3M B;  2G5H C;  3REL A;  5B2J B;  1P3M C;  2PYO D;  5E5A D;  5B0Y C;  5B0Y B;  4WU9 D;  3LEL D;  1EQZ B;  4CSR B;  1P3F C;  1P3P A;  3W97 D;  3MGR A;  4ZUX A;  4X23 A;  2CWE A;  1P3O A;  3KFU G;  3C1B D;  5C3I C;  4JJN D;  4KGC A;  5AVB A;  1M19 A;  3MVD D;  1TZY D;  2XD1 A;  4ZBJ C;  4ZBJ B;  5B0Z B;  5B0Z C;  3UTB A;  3W96 D;  3KUY A;  5B1L B;  4YS3 D;  1R4V A;  5B33 A;  4WNN B;  3B0D C;  1Z2C B;  2Y2K A;  3B0D B;  1S32 B;  1S32 C;  1P3I D;  1N1J A;  4J8V D;  5AVC B;  5AVC C;  3AN2 A;  5B31 A;  1F66 A;  5AV8 B;  5AV8 C;  1KX4 B;  2JSS A;  1KX4 C;  2PYO C;  5DNM D;  4WU9 B;  3AZH D;  3AV2 D;  1KU5 A;  5BNX B;  4WU9 C;  1JFI A;  3AV1 B;  4H9R B;  3AYW D;  4CAY A;  5BNV B;  5JRG A;  3W97 C;  4WV4 B;  3MGQ A;  3WA9 A;  3A6N D;  2BYK B;  1P3K B;  1P3K C;  5BT1 D;  3C1B B;  2ZY3 A;  5AV9 D;  3C1B C;  2F8N B;  2F2A C;  5B2I A;  3TU4 A;  2F8N K;  1TZY B;  1TZY C;  3W96 C;  3REK D;  3KSY A;  3MGS D;  3UT9 A;  3R45 A;  2IO5 B;  2IO5 C;  5GSU D;  3X1T C;  3X1T B;  1P3I C;  1P3I B;  1P3L A;  3X1U D;  4KHA B;  3AZN D;  5KDM A;  3A1K A;  3C1C D;  4E45 A;  1AOI A;  3AYW B;  3AYW C;  2Y2G A;  2FJ7 A;  5B24 A;  3B6G B;  3AZG B;  3A6N C;  3A6N B;  3B6F A;  3B6G C;  5B40 D;  3KWQ A;  5B1M A;  4XZQ A;  3UTA A;  5AV9 C;  5AV9 B;  3AZJ D;  1U35 D;  4YM6 B;  4YM6 C;  1KX3 A;  3W99 A;  4E44 A;  1ID3 D;  2HIO B;  4DRB A;  3AZM C;  1BH9 A;  3EPL A;  3AZM B;  3X1V A;  3MGS B;  3MGS C;  1P3B D;  5AV6 B;  5AV6 C;  5F99 D;  5GSU C;  2RIQ A;  3WKJ D;  3X1U C;  3X1U B;  5CPI C;  3LJA D;  3REI A;  5CPI B;  1M18 D;  2ZM5 A;  5AY8 D;  4XUJ A;  2Y2M A;  5GT3 A;  3C1C B;  3C1C C;  3AL0 C;  1P3G D;  5JA4 B;  5B32 D;  3REJ B;  4R8P D;  3O62 D;  3REJ C;  5CPK A;  2NQB A;  2UWX A;  4DRA A;  5GT0 A;  3AZK B;  3AZK C;  2HUE B;  2HUE C;  4UUZ B;  4H9O A;  3WAA A;  3IP4 C;  3AZJ C;  3AZJ B;  5G49 B;  1U35 C;  1U35 B;  4LD9 D;  3NQU B;  3AZI A;  3H0L C;  1ID3 C;  3B0B A;  2CV5 B;  2YFW A;  3AZE D;  1ID3 B;  5FUG B;  3VH5 T;  1P34 D;  3W98 D;  4H9S A;  3REL D;  3WKJ C;  5GXQ A;  2BYM A;  3LJA B;  3LJA C;  4DQY B;  3MGP B;  5BS7 C;  2ARO D;  1M18 B;  1M18 C;  3AZF A;  1P3P D;  2DQN C;  4G91 B;  4G91 C;  5AY8 C;  3KXB B;  3KXB C;  3MGR D;  4Z2M H;  4ZUX D;  4X23 D;  4J8W A;  1P3O D;  5CP6 B;  5CP6 C;  1KX5 A;  4KGC D;  5AVB D;  5B2J A;  1HQ3 C;  1HQ3 B;  1P3F B;  5B0Y A;  3B0C T;  1EQZ A;  4CSR A;  3KUY D;  5B33 D;  3EPH A;  2JE5 A;  3AN2 D;  5C3I B;  3W98 C;  5B31 D;  1F66 D;  3REL B;  3REL C;  5CPJ B;  5CPJ C;  1M1A D;  5DNN B;  5DNN C;  2ARO C;  2ARO B;  3REH B;  3MGQ D;  4J8U A;  3X1S D;  3REH C;  5B1L A;  4H9N B;  4WJ3 C;  3MGR C;  4X23 C;  4X23 B;  4WNN A;  1P3O C;  1P3O B;  1S32 A;  5AVC A;  2PYO B;  5E5A C;  2Y2O A;  5E5A B;  5B2I D;  4KGC B;  4KGC C;  3TU4 D;  1KX4 A;  3LEL B;  3LEL C;  2XD5 A;  3WTP E;  2ZY2 A;  3W97 B;  3UT9 D;  5BNX A;  3KUY B;  3KUY C;  2ZY5 A;  4H9R A;  4NE5 A;  5B33 B;  5B33 C;  3AV1 A;  5BNV A;  3V9R A;  4AWL C;  4AWL B;  1B6W A;  2Y2L A;  1N1J B;  2Y2J A;  4JJN B;  4JJN C;  2BYK A;  3H0R C;  5B31 C;  1P3K A;  1F66 C;  2F8N A;  2YFV B;  3MVD B;  3MVD C;  1M1A B;  1BH8 B;  1M1A C;  3W96 B;  4YS3 C;  4YS3 B;  4J8X A;  4QLC D;  1AOI D;  4UPK A;  1TZY A;  3X1S B;  3X1S C;  2FJ7 D;  1TAF B;  2NZD D;  5B24 D;  4J8V C;  4J8V B;  1ZLA A;  3B6F D;  1Q9C A;  4KUD A;  3X1T A;  3KWQ D;  5B1M D;  4Z5T D;  4XZQ D;  3UTA D;  4KHA A;  5DNM C;  5B2I C;  5B2I B;  5DNM B;  3TU4 C;  3TU4 B;  3AZH B;  3AZH C;  3AV2 B;  3AV2 C;  1KX3 D;  2F8N G;  3W99 D;  3R45 B;  3AYW A;  3WTP D;  4HGA C;  5BT1 C;  3REI D;  4WZS B;  3B6G A;  3AZG A;  3LZ1 A;  2L5A A;  2JCH A;  5KDM B;  4XUJ D;  5GT3 D;  3H0M C;  3REK B;  3REK C;  4YM6 A;  5CPK D;  2BG1 A;  4QLC C;  4QLC B;  5GSU B;  2NQB D;  2HIO A;  3AZM A;  3MGS A;  5GT0 D;  2FJ7 B;  2VQR A;  5AV6 A;  2FJ7 C;  2NZD C;  2NZD B;  4WU8 D;  3B6F B;  3B6F C;  2RVQ D;  3AZN B;  3AZN C;  4Z5T B;  4Z5T C;  3X1U A;  3UTA C;  3UTA B;  5CPI A;  3WAA D;  2DF4 C;  3VH6 W;  1KX3 B;  1KX3 C;  3W99 C;  3AZI D;  3VH5 W;  2Y2P A;  4NFT A;  3REJ A;  4Z66 A;  3WTP B;  3WTP C;  3AZL A;  3LZ0 A;  5B40 B;  5B40 C;  5GXQ D;  3AZK A;  5AV5 A;  3REI B;  3REI C;  5BO0 B;  1H3O B;  3AZF D;  2G5I C;  4UUZ A;  3VH6 T;  3AZJ A;  1U35 A;  5G49 A;  3NQU A;  4J8W D;  1PZR A;  1P3B B;  1P3B C;  5F99 C;  5F99 B;  2NQB C;  2NQB B;  4EO5 C;  4EO5 B;  2CV5 A;  1BFM A;  3WKJ B;  5FUG A;  1KX5 D;  2W8S A;  3NQJ B;  1B67 A;  4WU8 B;  4WU8 C;  5B2J D;  4M6B A;  3B0C W;  5AY8 B;  1P3A A;  1EQZ D;  4H9O B;  3MGP A;  5BS7 A;  1P3G B;  1P3G C;  5B32 B;  5B32 C;  3MNN A;  2LY8 A;  3KXB A;  3AFA A;  4R8P C;  4R8P B;  3O62 C;  3O62 B;  3AZI B;  3AZI C;  4H9Q A;  2YFW B;  4H9P B;  4H9S C;  1P3M A;  5CP6 A;  1M19 D;  1F1E A;  1HTA A;  3UTB D;  4LD9 C;  1HQ3 A;  3AZF C;  3AZF B;  1P3F A;  4LD9 B;  3EPJ A;  4J8U D;  5B1L D;  3AZE B;  3AZE C;  4J8W B;  4J8W C;  1P34 B;  1P34 C;  3W98 B;  1S32 D;  1KX5 C;  3A1I A;  5B2J C;  5CPJ A;  5B0Z A;  1T3U A;  5JRG D;  1P3P B;  1P3P C;  1EQZ C;  3WA9 D;  5DNN A;  2Y2I A;  3AV1 D;  2ARO A;  3MGR B;  4ZUX B;  4ZUX C;  2F8N H;  3REH A;  4H9N A;  3VH6 A;  1P3K D;  5AV8 A;  3VH5 A;  5AVB C;  5AVB B;  1M19 C;  1M19 B;  2F8N D;  5E5A A;  2PYO A;  3UTB B;  3UTB C;  4WU9 A;  1ULY A;  3LEL A;  4J8X D;  1W2E A;  3W97 A;  3F6T A;  4J8U B;  4J8U C;  1P3L D;  5B1L C;  1ZLA D;  3P5J B;  4KUD D;  3AN2 B;  3AN2 C;  3X1T D;  5B31 B;  1F66 B;  3C1B A;  2FFF B;  4JJN A;  3EPK A;  2YFV A;  1JFI B;  3MVD A;  1M1A A;  1BH8 A;  4CAY B;  3W96 A;  5JRG B;  5JRG C;  3MGQ B;  3MGQ C;  4Z2M G;  3WA9 B;  4YS3 A;  3WA9 C;  3AV1 C;  3V9R B;  3X1S A;  1P3I A;  1TAF A;  4J8V A;  3B6G D;  3AZG D;  3LZ1 D;  5CHL B;  5DNM A;  3X1V D;  5B31 G;  3AZH A;  4YM6 D;  3UT9 B;  3UT9 C;  3AV2 A;  4J8X C;  4J8X B;  2HIO D;  3AZM D;  4HGA B;  1P3L B;  1P3L C;  5AV6 D;  1ZLA C;  1ZLA B;  3A6N A;  4KUD B;  4KUD C;  2ZY4 A;  5AV9 A;  5CPI D;  2Y2N A;  1AOI B;  1AOI C;  3REK A;  3REJ D;  1A7W A;  4Z66 D;  5B24 C;  4QLC A;  5B24 B;  5GSU A;  2Y2H A;  3AZL D;  3LZ0 D;  3KWQ C;  3KWQ B;  3AZK D;  2NZD A;  5AV5 D;  5B1M B;  5B1M C;  4XZQ B;  4XZQ C;  3AZG C;  3LZ1 B;  3LZ1 C;  3AZN A;  3FDD A;  4Z5T A;  3W99 B;  3C1C A;  3X1V C;  5JA4 A;  3X1V B;  1BH9 B;  4NE3 A;  2HIO C;  2CV5 D;  1WWI A;  3WTP A;  2Y2Q A;  5B40 A;  1P3A D;  4XUJ C;  5BO0 A;  5GT3 C;  5GT3 B;  4XUJ B;  3MGP D;  4G92 B;  4G92 C;  1H3O A;  2J8P A;  3MNN D;  3AFA D;  3KXB D;  5CPK B;  5CPK C;  1ID3 A;  5GT0 B;  5GT0 C;  1P3B A;  4Z66 B;  5F99 A;  4Z66 C;  1P3M D;  5CP6 D;  3AZL B;  2RVQ C;  3LZ0 B;  3LZ0 C;  3AZL C;  3WKJ A;  5AV5 C;  5AV5 B;  5B0Y D;  3NQJ A;  3LJA A;  4WU8 A;  3WAA C;  3WAA B;  1M18 A;  1HQ3 D;  1P3F D;  5AY8 A;  1P3G A;  3EG5 B;  5B32 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...