4G91C

Ccaat-binding complex from aspergillus nidulans
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
117
structure length
117
Chain Sequence
GTWANVNQGLQGTARDILTTYWQHVINHLESDNHDYKIHQLPLARIKKVMKADPEVKMISAEAPILFAKGCDVFITELTMRAWIHAEDNKRRTLQRSDIAAALSKSDMFDFLIDIVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HAPB protein
publication title DNA Minor Groove Sensing and Widening by the CCAAT-Binding Complex.
pubmed doi rcsb
source organism Emericella nidulans
molecule tags Transcription
total genus 39
structure length 117
sequence length 117
ec nomenclature
pdb deposition date 2012-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00808 CBFD_NFYB_HMF Histone-like transcription factor (CBF/NF-Y) and archaeal histone
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4g91C00
1P3OA 3UTAC 1TZYC 3KXBA 5GT3B 3MGPB 1ID3D 1P3MD 4CSRB 1AOIC 3AN2A 1BH8B 5GSUD 5GT0B 2CV5D 1P34B 2L5AA 3MGSA 3AZJD 2JSSA 5B2JB 1KU5A 5AY8A 3AZJC 2PYOB 4YS3C 1P3BC 3WKJA 3VH5A 4ZBJC 3W99D 3AZMB 3X1VD 3X1UA 3AZKB 3WAAB 5B24B 3X1VC 3LJAA 5AVBC 5JRGB 4X23A 3AZEA 5AV8D 1ZLAC 5B24A 1P3KC 4DRAA 1HQ3B 5FUGB 5AV6B 1P3FC 3NQUA 5B40B 3KUYA 5AV6A 2BYMA 4Z5TB 3REKA 1EQZB 5GXQA 4WU8D 5B40A 1EQZA 5B1LA 3X1TC 5B32D 4J8VC 3W96C 1S32C 5BNVB 5B32C 4JJND 3LZ0B 5BNVA 3AV2D 4KUDD 3B6FD 2HIOA 4WZSB 4J8UB 3AZIA 4H9RA 3UTBD 5B31C 4J8UA 3REHB 1F66D 5CP6A 1N1JB 3LELB 1F66C 4G91B 3LELA 1KX4C 5AVCD 3AV1D 3WTPE 4WNNA 4YM6D 3AZGD 5AVCC 5CPJB 2NQBD 3AZGC 2AROC 5JA4A 3REJD 5CPKB 4J8WB 3RELD 3UT9A 1TAFA 1P3OD 3W97B 1P3GA 4KGCB 5DNNA 3KXBD 2HUEC 5F99B 1M18B 2YFVA 3WTPB 3TU4A 3W97A 1P3AD 3C1CC 2BYKB 4KGCA 3B6GA 2FJ7C 4XZQC 5B0ZC 3AFAA 3MVDC 3AN2D 1P3AC 1KX5B 1AOIB 3MGSD 3WA9C 5DNMC 3LZ1A 4LD9A 4G92B 5AY8D 3AZNC 5CPIB 3WKJD 4ZUXA 4M6BA 5AV5A 5CPIA 3X1UD 1P3BB 3LJAD 5B32G 5E5AC 4X23D 5B33A 4J8XC 3AZED 3LJAC 5B24D 4CAYB 3VH5W 3AYWA 3AZEC 3MGQA 5AVBB 3REIC 4CAYA 3AZFA 3KUYD 5AV6D 5B31G 5CHLB 3R45B 3MGRC 5GXQD 3REKD 3B0CT 5B1MC 1P3KB 1ZLAB 5B40D 1U35A 5AV9A 1KX3A 3X1SA 1EQZD 5B1LD 1P3FB 2NZDA 3AZHB 2F8NG 4KHAA 3X1TB 1Q9CA 4Z66A 2HIOD 4J8VB 3AZLA 3AZID 1M1AB 5B0YA 2HIOC 3KWQA 4J8UD 3O62C 5CP6D 1P3IA 3A6NC 4NE3A 3LELD 5B31B 1P3PC 1P3LA 3MNNB 4H9NA 3W98C 1A7WA 2F8NB 5GT3A 1ID3C 4EO5C 3MGPA 1P3MC 3UT9D 2AROB 4CSRA 4WU9B 5BT1D 3VH6A 1P3GD 5DNND 5GSUC 1BH8A 5GT0A 4WU9A 2CV5C 5BT1C 3TU4D 1P34A 3W97D 5DNNC 4R8PB 4KGCD 3B6GD 4H9QB 3AFAD 1M19B 4R8PA 3B6GC 5B2JA 2PYOA 3AFAC 1M19A 2FJ7B 4XZQB 5B0ZB 3W99C 1BH9B 3LZ1D 3MVDB 3AZMA 4LD9D 5B2IB 3AZKA 3WAAA 1WWIA 3VH6T 5B2IA 4ZUXD 3WA9B 5JRGA 5AV8C 5AV5D 4ZUXC 3V9RB 1HQ3A 5FUGA 5C3IB 3V9RA 5B33D 4Z5TA 4WU8C 3AYWD 3MGQD 5BNXB 3AZFD 5G49B 5E5AB 4AWLC 3AYWC 5BNXA 1U35D 5AV9D 1KX3D 5BS7C 3X1SD 4JJNC 3LZ0A 3AV2C 3REIB 2NZDD 3C1BD 4KUDC 3B6FC 3MGRB 4UUZB 3C1BC 3UTBC 4UUZA 3REHA 4H9OB 4Z66D 1N1JA 3AZLD 4H9SC 5B0YD 3KWQD 3AZLC 3AV1C 4YM6C 1P3ID 5CPJA 4XUJB 2NQBC 4XUJA 2YFWB 3O62B 3REJC 5CPKA 4QLCB 4J8WA 1P3LD 3A6NB 1WWSA 3RELC 1P3OC 3KXBC 5F99A 5GT3D 1M18A 3MGPD 3WTPA 3W98B 3UTAB 1TZYB 2BYKA 3MGPC 3UTAA 3AN2C 4WU9D 5GT0D 1ID3B 1F1EA 1P34D 1P3MB 1KX5A 1P34C 4DRBA 3MGSC 1AOIA 4R8PD 4NFTA 5AY8C 5B2JD 2CV5B 2PYOD 1M19D 3WKJC 5B2JC 3AZJB 4YS3B 1HTAA 3AZMD 3X1UC 3AZKD 4ZBJB 3WAAD 4YS3A 4NE5A 1P3BA 5B2ID 4X23C 5JRGD 3W99B 5B24C 3X1VB 5JRGC 1HQ3D 1H3OB 3X1VA 5AVBA 1HQ3C 3KUYC 5AV6C 3REKC 5AV8B 4Z5TD 1ZLAA 3R45A 5GXQC 1B6WA 5B40C 1P3KA 1EQZC 5B1LC 1P3FA 2RVQD 4Z2MH 3AZHA 1S32B 3W96B 3LZ0D 4AWLB 3X1TA 5B32B 4J8VA 3W96A 1S32A 3AZIC 1M1AA 4J8UC 3REHD 3AV2B 1ULYA 5CP6C 4KUDB 3B6FB 3REHC 5KDMB 3LELC 5B31A 1F66B 4G91C 1KX4B 5CPJD 3MNNA 5CPJC 5AVCB 3AV1B 1KX4A 4XUJD 5CPKD 4YM6B 3AZGB 4J8WD 5AVCA 2F8NA 3UT9C 2AROA 3REJB 2F8NK 1P3GC 5F99D 1M18D 3WTPD 3TU4C 3W97C 4KGCC 3RELB 5BO0B 2HUEB 1P3OB 4H9QA 3UTAD 3KXBB 3C1CB 1P3AB 1KX5D 3C1CA 1AOID 1KX5C 3LZ1C 4XZQA 5B0ZA 3MVDA 1BH9A 3AN2B 1P3AA 2FJ7A 4LD9C 4HGAC 5DNMB 5CPID 4G92C 3MGSB 3AZNB 3WA9A 4E44A 5DNMA 5CPIC 5AV5C 5AY8B 3B0DC 3AZNA 3B0CW 4YS3D 1P3BD 3WKJB 1B67A 5B33C 3X1UB 4J8XB 3MGQC 3LJAB 3NQJB 3AZFC 5AVBD 5G49A 4X23B 5E5AA 4J8XA 3AZEB 1ZLAD 3NQJA 1P3KD 1U35C 5AV9C 1KX3C 3X1SC 3NQUB 1P3FD 5B1MB 3REIA 2NZDC 3KUYB 2BYMB 3MGRA 3REKB 5GXQB 5B1MA 3AZHD 5B1LB 2F8NH 3AZHC 3X1TD 4Z66C 4H9OA 3B0BA 4J8VD 3VH5T 1S32D 3W96D 4H9PB 5B0YC 1M1AD 3KWQC 4Z2MG 4H9PA 1P3IC 1M1AC 2HIOB 3AZIB 4H9RB 2CWEA 5B31D 2YFWA 5CP6B 3O62A 4QLCA 1P3LC 3MNND 3A6NA 1P3PB 2IO5C 1KX4D 3MNNC 4WNNB 1P3PA 2F8ND 5GT3C 3W98A 1TZYA 2AROD 5JA4B 4EO5B 5GT0C 4WU9C 1ID3A 1P3MA 3UT9B 1TAFB 5GSUB 4R8PC 3VH6W 5DNNB 1P3GB 5GSUA 2YFVB 1BFMA 2PYOC 4WV4B 3TU4B 2CV5A 1M19C 3C1CD 3B6GB 3AFAB 3AZJA 5B0ZD 4XZQD 3MVDD 2FJ7D 3AZMC 3AZKC 3WAAC 5B2IC 3WA9D 3LZ1B 5DNMD 3W99A 4LD9B 3AZND 4HGAB 1H3OA 4ZUXB 2LY8A 4NE6A 4Z5TC 5C3IC 5AV8A 5AV5B 3B0DB 3KSYA 4WU8B 2RVQC 5E5AD 5B33B 4J8XD 4WU8A 3AYWB 3MGQB 3LZ0C 3AZFB 3REID 5B32A 3MGRD 4JJNB 5B1MD 1U35B 5AV9B 1KX3B 3X1SB 5BS7A 4JJNA 3AV2A 2NZDB 3C1BB 4KUDA 3B6FA 3UTBB 1R4VA 3C1BA 5KDMA 3UTBA 4KHAB 1F66A 4E45A 4Z66B 3AZLB 4H9SA 5B0YB 3KWQB 3AV1A 4XUJC 2NQBB 3O62D 5CPKC 1P3IB 4YM6A 4J8WC 4QLCD 3AZGA 3A6ND 2NQBA 4QLCC 1JFIB 3REJA 1P3PD 1JFIA 5F99C 1P3LB 4H9NB 1M18C 3WTPC 2IO5B 3W98D 3RELA 5BO0A 1TZYD
chains in the Genus database with same CATH superfamily
1P3OA 3UTAC 1TZYC 3KXBA 5GT3B 3MGPB 1ID3D 1P3MD 4CSRB 1AOIC 3AN2A 1BH8B 5GSUD 5GT0B 2CV5D 1P34B 2L5AA 2Y2GA 3MGSA 3AZJD 2JSSA 3EG5B 5B2JB 1KU5A 5AY8A 3AZJC 2PYOB 4YS3C 1P3BC 3WKJA 3VH5A 4ZBJC 3W99D 3AZMB 3X1VD 3X1UA 3AZKB 3WAAB 5B24B 3X1VC 3LJAA 5AVBC 5JRGB 4X23A 3AZEA 5AV8D 1ZLAC 5B24A 1P3KC 4DRAA 1HQ3B 5FUGB 5AV6B 1P3FC 3NQUA 5B40B 3KUYA 5AV6A 2BYMA 4Z5TB 3REKA 1EQZB 5GXQA 2Y2LA 4WU8D 5B40A 1EQZA 5B1LA 3X1TC 5B32D 4J8VC 3W96C 1S32C 5BNVB 5B32C 4JJND 3LZ0B 5BNVA 3AV2D 4KUDD 3IP4C 3B6FD 2HIOA 4WZSB 4J8UB 3AZIA 4H9RA 3UTBD 5B31C 4J8UA 3REHB 1F66D 5CP6A 1N1JB 3LELB 3FDDA 1F66C 1ZLAB 4G91B 3LELA 1KX4C 5AVCD 3AV1D 3WTPE 4WNNA 2XD1A 4YM6D 3AZGD 3F6TA 5AVCC 5CPJB 2NQBD 3AZGC 2AROC 5JA4A 3REJD 5CPKB 4J8WB 2RIQA 2JCHA 3RELD 3UT9A 1TAFA 1P3OD 3W97B 1P3GA 4KGCB 5DNNA 3KXBD 2HUEC 5F99B 1M18B 2YFVA 3WTPB 3TU4A 3W97A 1P3AD 3C1CC 2BYKB 4KGCA 3B6GA 2FJ7C 4XZQC 5B0ZC 3AFAA 3MVDC 3AN2D 1P3AC 2XD5A 1KX5B 1AOIB 3MGSD 3WA9C 5DNMC 3LZ1A 4LD9A 4G92B 5AY8D 3AZNC 5CPIB 3WKJD 4ZUXA 4M6BA 5AV5A 5CPIA 3X1UD 1P3BB 2F2AC 3LJAD 5B32G 5E5AC 4X23D 5B33A 4J8XC 3AZED 3LJAC 5B24D 4CAYB 3VH5W 3AYWA 2ZY4A 3AZEC 3MGQA 5AVBB 3REIC 4CAYA 3AZFA 3KUYD 5AV6D 5B31G 5CHLB 3R45B 3MGRC 5GXQD 3REKD 2ZY2A 3B0CT 5B1MC 1P3KB 5B40D 1U35A 5AV9A 1KX3A 3X1SA 1EQZD 5B1LD 1P3FB 2NZDA 3AZHB 2F8NG 3EPKA 3H0RC 4KHAA 3X1TB 1Q9CA 4Z66A 2HIOD 3EPJA 4J8VB 3AZLA 3AZID 1M1AB 5B0YA 2HIOC 3KWQA 2Y2MA 4J8UD 3O62C 2Y2PA 5CP6D 1P3IA 3A6NC 3H0MC 4NE3A 3A1IA 3LELD 5B31B 1P3PC 3EPHA 3AL0C 1P3LA 3MNNB 4H9NA 3W98C 1A7WA 2F8NB 5GT3A 1ID3C 4EO5C 3MGPA 1P3MC 3UT9D 2AROB 4CSRA 4WU9B 5BT1D 3VH6A 1P3GD 5DNND 5GSUC 1BH8A 5GT0A 4WU9A 2CV5C 5BT1C 3TU4D 1P34A 3W97D 5DNNC 4R8PB 4KGCD 3B6GD 4H9QB 3AFAD 1M19B 4R8PA 3B6GC 5B2JA 2PYOA 3AFAC 1M19A 2FJ7B 4XZQB 5B0ZB 3W99C 1BH9B 3LZ1D 3MVDB 3AZMA 4LD9D 5B2IB 3AZKA 3WAAA 1WWIA 3VH6T 5B2IA 4ZUXD 3WA9B 5JRGA 5AV8C 5AV5D 4ZUXC 1W2EA 3V9RB 1HQ3A 5FUGA 5C3IB 3V9RA 5B33D 4Z5TA 4WU8C 3A1KA 2Y2OA 3AYWD 3MGQD 5BNXB 3AZFD 5G49B 5E5AB 4AWLC 3AYWC 5BNXA 1U35D 5AV9D 1KX3D 5BS7C 3X1SD 4JJNC 3EPLA 3LZ0A 3AV2C 3REIB 2NZDD 3C1BD 4KUDC 3B6FC 3MGRB 4UUZB 3C1BC 3UTBC 4UUZA 3REHA 4WJ3C 4H9OB 4Z66D 1N1JA 3AZLD 4H9SC 5B0YD 3KWQD 3AZLC 3AV1C 4YM6C 1P3ID 5CPJA 4XUJB 2NQBC 2JE5A 4XUJA 2YFWB 3O62B 3REJC 5CPKA 4QLCB 4J8WA 1P3LD 3A6NB 1WWSA 2BG1A 3RELC 1P3OC 3KXBC 5F99A 5GT3D 1M18A 3MGPD 3WTPA 3W98B 3UTAB 1TZYB 2BYKA 3MGPC 3UTAA 3AN2C 4WU9D 5GT0D 1ID3B 1F1EA 1P34D 1P3MB 1KX5A 2J8PA 2ZY3A 4DRBA 3MGSC 1P34C 4R8PD 1AOIA 4NFTA 5AY8C 5B2JD 2CV5B 2PYOD 1M19D 3WKJC 5B2JC 3AZJB 4YS3B 1HTAA 3AZMD 3X1UC 1Z2CB 3AZKD 4ZBJB 3WAAD 4YS3A 4NE5A 1P3BA 5B2ID 4X23C 5JRGD 3W99B 5B24C 3X1VB 5JRGC 1HQ3D 1H3OB 3X1VA 5AVBA 1HQ3C 3KUYC 5AV6C 3REKC 5AV8B 4Z5TD 1ZLAA 3R45A 5GXQC 1B6WA 5B40C 1P3KA 4DQYB 1EQZC 5B1LC 1P3FA 2RVQD 4Z2MH 3AZHA 1S32B 3W96B 3LZ0D 4AWLB 3X1TA 5B32B 4J8VA 2G5HC 3W96A 1S32A 2DQNC 3AZIC 2UWXA 1M1AA 4J8UC 3REHD 3AV2B 1ULYA 5CP6C 4KUDB 3B6FB 3REHC 5KDMB 3LELC 5B31A 1F66B 4G91C 1KX4B 2FFFB 5CPJD 3MNNA 5CPJC 5AVCB 3AV1B 1KX4A 4XUJD 5CPKD 4YM6B 3AZGB 4J8WD 5AVCA 2F8NA 3UT9C 2AROA 3REJB 2F8NK 1P3GC 5F99D 1M18D 3WTPD 3TU4C 3W97C 4KGCC 3RELB 5BO0B 2HUEB 1P3OB 4H9QA 3UTAD 3KXBB 3C1CB 1P3AB 1KX5D 3C1CA 1AOID 1KX5C 3LZ1C 4XZQA 5B0ZA 3MVDA 1BH9A 3AN2B 1P3AA 2FJ7A 4LD9C 4HGAC 5DNMB 5CPID 4G92C 2ZY5A 3MGSB 3AZNB 3WA9A 4E44A 5DNMA 5CPIC 5AV5C 5AY8B 3B0DC 3AZNA 3B0CW 4YS3D 1P3BD 3WKJB 1B67A 5B33C 3X1UB 4J8XB 3MGQC 3LJAB 3NQJB 3AZFC 5AVBD 5G49A 4X23B 5E5AA 4J8XA 2Y2IA 3AZEB 1ZLAD 3NQJA 1P3KD 1U35C 5AV9C 1KX3C 3X1SC 3NQUB 1P3FD 5B1MB 3REIA 2NZDC 3KUYB 2BYMB 3MGRA 3REKB 5GXQB 5B1MA 3AZHD 5B1LB 2F8NH 3AZHC 3X1TD 4Z66C 4H9OA 3B0BA 4J8VD 3VH5T 1S32D 3W96D 4H9PB 5B0YC 1M1AD 3KWQC 4Z2MG 2ZM5A 4H9PA 1P3IC 1M1AC 2HIOB 3AZIB 4H9RB 1T3UA 2CWEA 5B31D 2YFWA 5CP6B 3O62A 4QLCA 1P3LC 3MNND 3A6NA 1P3PB 2IO5C 3P5JB 1KX4D 3MNNC 4WNNB 1P3PA 2F8ND 5GT3C 3W98A 1TZYA 2AROD 5JA4B 4EO5B 5GT0C 4WU9C 1ID3A 1P3MA 3KFUG 3UT9B 1TAFB 5GSUB 4R8PC 3VH6W 5DNNB 1P3GB 5GSUA 2W8SA 2YFVB 1BFMA 2PYOC 4WV4B 3TU4B 2CV5A 1M19C 3C1CD 3B6GB 2VQRA 3AFAB 3AZJA 5B0ZD 4XZQD 3MVDD 2FJ7D 3AZMC 2Y2KA 3AZKC 3WAAC 5B2IC 3WA9D 3LZ1B 5DNMD 3W99A 4LD9B 3AZND 4HGAB 1H3OA 4ZUXB 2Y2QA 2LY8A 4NE6A 4Z5TC 5C3IC 5AV8A 5AV5B 3B0DB 2DF4C 3KSYA 4WU8B 2RVQC 5E5AD 5B33B 4J8XD 2G5IC 4WU8A 3AYWB 3MGQB 3LZ0C 3AZFB 3REID 5B32A 3MGRD 4JJNB 5B1MD 1U35B 5AV9B 1KX3B 3X1SB 5BS7A 4JJNA 3AV2A 2NZDB 3C1BB 4UPKA 4KUDA 3B6FA 3UTBB 1R4VA 3C1BA 5KDMA 3UTBA 4KHAB 1F66A 4E45A 4Z66B 3AZLB 4H9SA 2Y2HA 5B0YB 2Y2JA 3KWQB 3AV1A 4XUJC 2NQBB 3O62D 5CPKC 1P3IB 4YM6A 4J8WC 4QLCD 3AZGA 3A6ND 2NQBA 2Y2NA 4QLCC 1JFIB 3REJA 1P3PD 1JFIA 3H0LC 5F99C 1PZRA 4H9NB 1P3LB 1M18C 3WTPC 2IO5B 3W98D 3RELA 5BO0A 1TZYD
chains in the Genus database with same CATH topology
1P3OA 3UTAC 1TZYC 3KXBA 5GT3B 3MGPB 1ID3D 1P3MD 4CSRB 1AOIC 3AN2A 1BH8B 5GSUD 5GT0B 2CV5D 1P34B 2L5AA 2Y2GA 3MGSA 3AZJD 2JSSA 3EG5B 5B2JB 1KU5A 5AY8A 3AZJC 2PYOB 4YS3C 1P3BC 3WKJA 3VH5A 4ZBJC 3W99D 3AZMB 3X1VD 3X1UA 3AZKB 3WAAB 5B24B 3X1VC 3LJAA 5AVBC 5JRGB 4X23A 3AZEA 5AV8D 1ZLAC 5B24A 1P3KC 4DRAA 1HQ3B 5FUGB 5AV6B 1P3FC 3NQUA 5B40B 3KUYA 5AV6A 2BYMA 4Z5TB 3REKA 1EQZB 5GXQA 2Y2LA 4WU8D 5B40A 1EQZA 5B1LA 3X1TC 5B32D 4J8VC 3W96C 1S32C 5BNVB 5B32C 4JJND 3LZ0B 5BNVA 3AV2D 4KUDD 3IP4C 3B6FD 2HIOA 4WZSB 4J8UB 3AZIA 4H9RA 3UTBD 5B31C 4J8UA 3REHB 1F66D 5CP6A 1N1JB 3LELB 3FDDA 1F66C 1ZLAB 4G91B 3LELA 1KX4C 5AVCD 3AV1D 3WTPE 4WNNA 2XD1A 4YM6D 3AZGD 3F6TA 5AVCC 5CPJB 2NQBD 3AZGC 2AROC 5JA4A 3REJD 5CPKB 4J8WB 2RIQA 2JCHA 3RELD 3UT9A 1TAFA 1P3OD 3W97B 1P3GA 4KGCB 5DNNA 3KXBD 2HUEC 5F99B 1M18B 2YFVA 3WTPB 3TU4A 3W97A 1P3AD 3C1CC 2BYKB 4KGCA 3B6GA 2FJ7C 4XZQC 5B0ZC 3AFAA 3MVDC 3AN2D 1P3AC 2XD5A 1KX5B 1AOIB 3MGSD 3WA9C 5DNMC 3LZ1A 4LD9A 4G92B 5AY8D 3AZNC 5CPIB 3WKJD 4ZUXA 4M6BA 5AV5A 5CPIA 3X1UD 1P3BB 2F2AC 3LJAD 5B32G 5E5AC 4X23D 5B33A 4J8XC 3AZED 3LJAC 5B24D 4CAYB 3VH5W 3AYWA 2ZY4A 3AZEC 3MGQA 5AVBB 3REIC 4CAYA 3AZFA 3KUYD 5AV6D 5B31G 5CHLB 3R45B 3MGRC 5GXQD 3REKD 2ZY2A 3B0CT 5B1MC 1P3KB 5B40D 1U35A 5AV9A 1KX3A 3X1SA 1EQZD 5B1LD 1P3FB 2NZDA 3AZHB 2F8NG 3EPKA 3H0RC 4KHAA 3X1TB 1Q9CA 4Z66A 2HIOD 3EPJA 4J8VB 3AZLA 3AZID 1M1AB 5B0YA 2HIOC 3KWQA 2Y2MA 4J8UD 3O62C 2Y2PA 5CP6D 1P3IA 3A6NC 3H0MC 4NE3A 3A1IA 3LELD 5B31B 1P3PC 3EPHA 3AL0C 1P3LA 3MNNB 4H9NA 3W98C 1A7WA 2F8NB 5GT3A 1ID3C 4EO5C 3MGPA 1P3MC 3UT9D 2AROB 4CSRA 4WU9B 5BT1D 3VH6A 1P3GD 5DNND 5GSUC 1BH8A 5GT0A 4WU9A 2CV5C 5BT1C 3TU4D 1P34A 3W97D 5DNNC 4R8PB 4KGCD 3B6GD 4H9QB 3AFAD 1M19B 4R8PA 3B6GC 5B2JA 2PYOA 3AFAC 1M19A 2FJ7B 4XZQB 5B0ZB 3W99C 1BH9B 3LZ1D 3MVDB 3AZMA 4LD9D 5B2IB 3AZKA 3WAAA 1WWIA 3VH6T 5B2IA 4ZUXD 3WA9B 5JRGA 5AV8C 5AV5D 4ZUXC 1W2EA 3V9RB 1HQ3A 5FUGA 5C3IB 3V9RA 5B33D 4Z5TA 4WU8C 3A1KA 2Y2OA 3AYWD 3MGQD 5BNXB 3AZFD 5G49B 5E5AB 4AWLC 3AYWC 5BNXA 1U35D 5AV9D 1KX3D 5BS7C 3X1SD 4JJNC 3EPLA 3LZ0A 3AV2C 3REIB 2NZDD 3C1BD 4KUDC 3B6FC 3MGRB 4UUZB 3C1BC 3UTBC 4UUZA 3REHA 4WJ3C 4H9OB 4Z66D 1N1JA 3AZLD 4H9SC 5B0YD 3KWQD 3AZLC 3AV1C 4YM6C 1P3ID 5CPJA 4XUJB 2NQBC 2JE5A 4XUJA 2YFWB 3O62B 3REJC 5CPKA 4QLCB 4J8WA 1P3LD 3A6NB 1WWSA 2BG1A 3RELC 1P3OC 3KXBC 5F99A 5GT3D 1M18A 3MGPD 3WTPA 3W98B 3UTAB 1TZYB 2BYKA 3MGPC 3UTAA 3AN2C 4WU9D 5GT0D 1ID3B 1F1EA 1P34D 1P3MB 1KX5A 2J8PA 2ZY3A 4DRBA 3MGSC 1P34C 4R8PD 1AOIA 4NFTA 5AY8C 5B2JD 2CV5B 2PYOD 1M19D 3WKJC 5B2JC 3AZJB 4YS3B 1HTAA 3AZMD 3X1UC 1Z2CB 3AZKD 4ZBJB 3WAAD 4YS3A 4NE5A 1P3BA 5B2ID 4X23C 5JRGD 3W99B 5B24C 3X1VB 5JRGC 1HQ3D 1H3OB 3X1VA 5AVBA 1HQ3C 3KUYC 5AV6C 3REKC 5AV8B 4Z5TD 1ZLAA 3R45A 5GXQC 1B6WA 5B40C 1P3KA 4DQYB 1EQZC 5B1LC 1P3FA 2RVQD 4Z2MH 3AZHA 1S32B 3W96B 3LZ0D 4AWLB 3X1TA 5B32B 4J8VA 2G5HC 3W96A 1S32A 2DQNC 3AZIC 2UWXA 1M1AA 4J8UC 3REHD 3AV2B 1ULYA 5CP6C 4KUDB 3B6FB 3REHC 5KDMB 3LELC 5B31A 1F66B 4G91C 1KX4B 2FFFB 5CPJD 3MNNA 5CPJC 5AVCB 3AV1B 1KX4A 4XUJD 5CPKD 4YM6B 3AZGB 4J8WD 5AVCA 2F8NA 3UT9C 2AROA 3REJB 2F8NK 1P3GC 5F99D 1M18D 3WTPD 3TU4C 3W97C 4KGCC 3RELB 5BO0B 2HUEB 1P3OB 4H9QA 3UTAD 3KXBB 3C1CB 1P3AB 1KX5D 3C1CA 1AOID 1KX5C 3LZ1C 4XZQA 5B0ZA 3MVDA 1BH9A 3AN2B 1P3AA 2FJ7A 4LD9C 4HGAC 5DNMB 5CPID 4G92C 2ZY5A 3MGSB 3AZNB 3WA9A 4E44A 5DNMA 5CPIC 5AV5C 5AY8B 3B0DC 3AZNA 3B0CW 4YS3D 1P3BD 3WKJB 1B67A 5B33C 3X1UB 4J8XB 3MGQC 3LJAB 3NQJB 3AZFC 5AVBD 5G49A 4X23B 5E5AA 4J8XA 2Y2IA 3AZEB 1ZLAD 3NQJA 1P3KD 1U35C 5AV9C 1KX3C 3X1SC 3NQUB 1P3FD 5B1MB 3REIA 2NZDC 3KUYB 2BYMB 3MGRA 3REKB 5GXQB 5B1MA 3AZHD 5B1LB 2F8NH 3AZHC 3X1TD 4Z66C 4H9OA 3B0BA 4J8VD 3VH5T 1S32D 3W96D 4H9PB 5B0YC 1M1AD 3KWQC 4Z2MG 2ZM5A 4H9PA 1P3IC 1M1AC 2HIOB 3AZIB 4H9RB 1T3UA 2CWEA 5B31D 2YFWA 5CP6B 3O62A 4QLCA 1P3LC 3MNND 3A6NA 1P3PB 2IO5C 3P5JB 1KX4D 3MNNC 4WNNB 1P3PA 2F8ND 5GT3C 3W98A 1TZYA 2AROD 5JA4B 4EO5B 5GT0C 4WU9C 1ID3A 1P3MA 3KFUG 3UT9B 1TAFB 5GSUB 4R8PC 3VH6W 5DNNB 1P3GB 5GSUA 2W8SA 2YFVB 1BFMA 2PYOC 4WV4B 3TU4B 2CV5A 1M19C 3C1CD 3B6GB 2VQRA 3AFAB 3AZJA 5B0ZD 4XZQD 3MVDD 2FJ7D 3AZMC 2Y2KA 3AZKC 3WAAC 5B2IC 3WA9D 3LZ1B 5DNMD 3W99A 4LD9B 3AZND 4HGAB 1H3OA 4ZUXB 2Y2QA 2LY8A 4NE6A 4Z5TC 5C3IC 5AV8A 5AV5B 3B0DB 2DF4C 3KSYA 4WU8B 2RVQC 5E5AD 5B33B 4J8XD 2G5IC 4WU8A 3AYWB 3MGQB 3LZ0C 3AZFB 3REID 5B32A 3MGRD 4JJNB 5B1MD 1U35B 5AV9B 1KX3B 3X1SB 5BS7A 4JJNA 3AV2A 2NZDB 3C1BB 4UPKA 4KUDA 3B6FA 3UTBB 1R4VA 3C1BA 5KDMA 3UTBA 4KHAB 1F66A 4E45A 4Z66B 3AZLB 4H9SA 2Y2HA 5B0YB 2Y2JA 3KWQB 3AV1A 4XUJC 2NQBB 3O62D 5CPKC 1P3IB 4YM6A 4J8WC 4QLCD 3AZGA 3A6ND 2NQBA 2Y2NA 4QLCC 1JFIB 3REJA 1P3PD 1JFIA 3H0LC 5F99C 1PZRA 4H9NB 1P3LB 1M18C 3WTPC 2IO5B 3W98D 3RELA 5BO0A 1TZYD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1P3O A;  3UTA C;  1TZY C;  3KXB A;  5GT3 B;  3MGP B;  1ID3 D;  1P3M D;  4CSR B;  1AOI C;  3AN2 A;  1BH8 B;  5GSU D;  5GT0 B;  2CV5 D;  1P34 B;  2L5A A;  3MGS A;  3AZJ D;  2JSS A;  5B2J B;  1KU5 A;  5AY8 A;  3AZJ C;  2PYO B;  4YS3 C;  1P3B C;  3WKJ A;  3VH5 A;  4ZBJ C;  3W99 D;  3AZM B;  3X1V D;  3X1U A;  3AZK B;  3WAA B;  5B24 B;  3X1V C;  3LJA A;  5AVB C;  5JRG B;  4X23 A;  3AZE A;  5AV8 D;  1ZLA C;  5B24 A;  1P3K C;  4DRA A;  1HQ3 B;  5FUG B;  5AV6 B;  1P3F C;  3NQU A;  5B40 B;  3KUY A;  5AV6 A;  2BYM A;  4Z5T B;  3REK A;  1EQZ B;  5GXQ A;  4WU8 D;  5B40 A;  1EQZ A;  5B1L A;  3X1T C;  5B32 D;  4J8V C;  3W96 C;  1S32 C;  5BNV B;  5B32 C;  4JJN D;  3LZ0 B;  5BNV A;  3AV2 D;  4KUD D;  3B6F D;  2HIO A;  4WZS B;  4J8U B;  3AZI A;  4H9R A;  3UTB D;  5B31 C;  4J8U A;  3REH B;  1F66 D;  5CP6 A;  1N1J B;  3LEL B;  1F66 C;  4G91 B;  3LEL A;  1KX4 C;  5AVC D;  3AV1 D;  3WTP E;  4WNN A;  4YM6 D;  3AZG D;  5AVC C;  5CPJ B;  2NQB D;  3AZG C;  2ARO C;  5JA4 A;  3REJ D;  5CPK B;  4J8W B;  3REL D;  3UT9 A;  1TAF A;  1P3O D;  3W97 B;  1P3G A;  4KGC B;  5DNN A;  3KXB D;  2HUE C;  5F99 B;  1M18 B;  2YFV A;  3WTP B;  3TU4 A;  3W97 A;  1P3A D;  3C1C C;  2BYK B;  4KGC A;  3B6G A;  2FJ7 C;  4XZQ C;  5B0Z C;  3AFA A;  3MVD C;  3AN2 D;  1P3A C;  1KX5 B;  1AOI B;  3MGS D;  3WA9 C;  5DNM C;  3LZ1 A;  4LD9 A;  4G92 B;  5AY8 D;  3AZN C;  5CPI B;  3WKJ D;  4ZUX A;  4M6B A;  5AV5 A;  5CPI A;  3X1U D;  1P3B B;  3LJA D;  5B32 G;  5E5A C;  4X23 D;  5B33 A;  4J8X C;  3AZE D;  3LJA C;  5B24 D;  4CAY B;  3VH5 W;  3AYW A;  3AZE C;  3MGQ A;  5AVB B;  3REI C;  4CAY A;  3AZF A;  3KUY D;  5AV6 D;  5B31 G;  5CHL B;  3R45 B;  3MGR C;  5GXQ D;  3REK D;  3B0C T;  5B1M C;  1P3K B;  1ZLA B;  5B40 D;  1U35 A;  5AV9 A;  1KX3 A;  3X1S A;  1EQZ D;  5B1L D;  1P3F B;  2NZD A;  3AZH B;  2F8N G;  4KHA A;  3X1T B;  1Q9C A;  4Z66 A;  2HIO D;  4J8V B;  3AZL A;  3AZI D;  1M1A B;  5B0Y A;  2HIO C;  3KWQ A;  4J8U D;  3O62 C;  5CP6 D;  1P3I A;  3A6N C;  4NE3 A;  3LEL D;  5B31 B;  1P3P C;  1P3L A;  3MNN B;  4H9N A;  3W98 C;  1A7W A;  2F8N B;  5GT3 A;  1ID3 C;  4EO5 C;  3MGP A;  1P3M C;  3UT9 D;  2ARO B;  4CSR A;  4WU9 B;  5BT1 D;  3VH6 A;  1P3G D;  5DNN D;  5GSU C;  1BH8 A;  5GT0 A;  4WU9 A;  2CV5 C;  5BT1 C;  3TU4 D;  1P34 A;  3W97 D;  5DNN C;  4R8P B;  4KGC D;  3B6G D;  4H9Q B;  3AFA D;  1M19 B;  4R8P A;  3B6G C;  5B2J A;  2PYO A;  3AFA C;  1M19 A;  2FJ7 B;  4XZQ B;  5B0Z B;  3W99 C;  1BH9 B;  3LZ1 D;  3MVD B;  3AZM A;  4LD9 D;  5B2I B;  3AZK A;  3WAA A;  1WWI A;  3VH6 T;  5B2I A;  4ZUX D;  3WA9 B;  5JRG A;  5AV8 C;  5AV5 D;  4ZUX C;  3V9R B;  1HQ3 A;  5FUG A;  5C3I B;  3V9R A;  5B33 D;  4Z5T A;  4WU8 C;  3AYW D;  3MGQ D;  5BNX B;  3AZF D;  5G49 B;  5E5A B;  4AWL C;  3AYW C;  5BNX A;  1U35 D;  5AV9 D;  1KX3 D;  5BS7 C;  3X1S D;  4JJN C;  3LZ0 A;  3AV2 C;  3REI B;  2NZD D;  3C1B D;  4KUD C;  3B6F C;  3MGR B;  4UUZ B;  3C1B C;  3UTB C;  4UUZ A;  3REH A;  4H9O B;  4Z66 D;  1N1J A;  3AZL D;  4H9S C;  5B0Y D;  3KWQ D;  3AZL C;  3AV1 C;  4YM6 C;  1P3I D;  5CPJ A;  4XUJ B;  2NQB C;  4XUJ A;  2YFW B;  3O62 B;  3REJ C;  5CPK A;  4QLC B;  4J8W A;  1P3L D;  3A6N B;  1WWS A;  3REL C;  1P3O C;  3KXB C;  5F99 A;  5GT3 D;  1M18 A;  3MGP D;  3WTP A;  3W98 B;  3UTA B;  1TZY B;  2BYK A;  3MGP C;  3UTA A;  3AN2 C;  4WU9 D;  5GT0 D;  1ID3 B;  1F1E A;  1P34 D;  1P3M B;  1KX5 A;  1P34 C;  4DRB A;  3MGS C;  1AOI A;  4R8P D;  4NFT A;  5AY8 C;  5B2J D;  2CV5 B;  2PYO D;  1M19 D;  3WKJ C;  5B2J C;  3AZJ B;  4YS3 B;  1HTA A;  3AZM D;  3X1U C;  3AZK D;  4ZBJ B;  3WAA D;  4YS3 A;  4NE5 A;  1P3B A;  5B2I D;  4X23 C;  5JRG D;  3W99 B;  5B24 C;  3X1V B;  5JRG C;  1HQ3 D;  1H3O B;  3X1V A;  5AVB A;  1HQ3 C;  3KUY C;  5AV6 C;  3REK C;  5AV8 B;  4Z5T D;  1ZLA A;  3R45 A;  5GXQ C;  1B6W A;  5B40 C;  1P3K A;  1EQZ C;  5B1L C;  1P3F A;  2RVQ D;  4Z2M H;  3AZH A;  1S32 B;  3W96 B;  3LZ0 D;  4AWL B;  3X1T A;  5B32 B;  4J8V A;  3W96 A;  1S32 A;  3AZI C;  1M1A A;  4J8U C;  3REH D;  3AV2 B;  1ULY A;  5CP6 C;  4KUD B;  3B6F B;  3REH C;  5KDM B;  3LEL C;  5B31 A;  1F66 B;  4G91 C;  1KX4 B;  5CPJ D;  3MNN A;  5CPJ C;  5AVC B;  3AV1 B;  1KX4 A;  4XUJ D;  5CPK D;  4YM6 B;  3AZG B;  4J8W D;  5AVC A;  2F8N A;  3UT9 C;  2ARO A;  3REJ B;  2F8N K;  1P3G C;  5F99 D;  1M18 D;  3WTP D;  3TU4 C;  3W97 C;  4KGC C;  3REL B;  5BO0 B;  2HUE B;  1P3O B;  4H9Q A;  3UTA D;  3KXB B;  3C1C B;  1P3A B;  1KX5 D;  3C1C A;  1AOI D;  1KX5 C;  3LZ1 C;  4XZQ A;  5B0Z A;  3MVD A;  1BH9 A;  3AN2 B;  1P3A A;  2FJ7 A;  4LD9 C;  4HGA C;  5DNM B;  5CPI D;  4G92 C;  3MGS B;  3AZN B;  3WA9 A;  4E44 A;  5DNM A;  5CPI C;  5AV5 C;  5AY8 B;  3B0D C;  3AZN A;  3B0C W;  4YS3 D;  1P3B D;  3WKJ B;  1B67 A;  5B33 C;  3X1U B;  4J8X B;  3MGQ C;  3LJA B;  3NQJ B;  3AZF C;  5AVB D;  5G49 A;  4X23 B;  5E5A A;  4J8X A;  3AZE B;  1ZLA D;  3NQJ A;  1P3K D;  1U35 C;  5AV9 C;  1KX3 C;  3X1S C;  3NQU B;  1P3F D;  5B1M B;  3REI A;  2NZD C;  3KUY B;  2BYM B;  3MGR A;  3REK B;  5GXQ B;  5B1M A;  3AZH D;  5B1L B;  2F8N H;  3AZH C;  3X1T D;  4Z66 C;  4H9O A;  3B0B A;  4J8V D;  3VH5 T;  1S32 D;  3W96 D;  4H9P B;  5B0Y C;  1M1A D;  3KWQ C;  4Z2M G;  4H9P A;  1P3I C;  1M1A C;  2HIO B;  3AZI B;  4H9R B;  2CWE A;  5B31 D;  2YFW A;  5CP6 B;  3O62 A;  4QLC A;  1P3L C;  3MNN D;  3A6N A;  1P3P B;  2IO5 C;  1KX4 D;  3MNN C;  4WNN B;  1P3P A;  2F8N D;  5GT3 C;  3W98 A;  1TZY A;  2ARO D;  5JA4 B;  4EO5 B;  5GT0 C;  4WU9 C;  1ID3 A;  1P3M A;  3UT9 B;  1TAF B;  5GSU B;  4R8P C;  3VH6 W;  5DNN B;  1P3G B;  5GSU A;  2YFV B;  1BFM A;  2PYO C;  4WV4 B;  3TU4 B;  2CV5 A;  1M19 C;  3C1C D;  3B6G B;  3AFA B;  3AZJ A;  5B0Z D;  4XZQ D;  3MVD D;  2FJ7 D;  3AZM C;  3AZK C;  3WAA C;  5B2I C;  3WA9 D;  3LZ1 B;  5DNM D;  3W99 A;  4LD9 B;  3AZN D;  4HGA B;  1H3O A;  4ZUX B;  2LY8 A;  4NE6 A;  4Z5T C;  5C3I C;  5AV8 A;  5AV5 B;  3B0D B;  3KSY A;  4WU8 B;  2RVQ C;  5E5A D;  5B33 B;  4J8X D;  4WU8 A;  3AYW B;  3MGQ B;  3LZ0 C;  3AZF B;  3REI D;  5B32 A;  3MGR D;  4JJN B;  5B1M D;  1U35 B;  5AV9 B;  1KX3 B;  3X1S B;  5BS7 A;  4JJN A;  3AV2 A;  2NZD B;  3C1B B;  4KUD A;  3B6F A;  3UTB B;  1R4V A;  3C1B A;  5KDM A;  3UTB A;  4KHA B;  1F66 A;  4E45 A;  4Z66 B;  3AZL B;  4H9S A;  5B0Y B;  3KWQ B;  3AV1 A;  4XUJ C;  2NQB B;  3O62 D;  5CPK C;  1P3I B;  4YM6 A;  4J8W C;  4QLC D;  3AZG A;  3A6N D;  2NQB A;  4QLC C;  1JFI B;  3REJ A;  1P3P D;  1JFI A;  5F99 C;  1P3L B;  4H9N B;  1M18 C;  3WTP C;  2IO5 B;  3W98 D;  3REL A;  5BO0 A;  1TZY D; 
#chains in the Genus database with same CATH topology
 1P3O A;  3UTA C;  1TZY C;  3KXB A;  5GT3 B;  3MGP B;  1ID3 D;  1P3M D;  4CSR B;  1AOI C;  3AN2 A;  1BH8 B;  5GSU D;  5GT0 B;  2CV5 D;  1P34 B;  2L5A A;  2Y2G A;  3MGS A;  3AZJ D;  2JSS A;  3EG5 B;  5B2J B;  1KU5 A;  5AY8 A;  3AZJ C;  2PYO B;  4YS3 C;  1P3B C;  3WKJ A;  3VH5 A;  4ZBJ C;  3W99 D;  3AZM B;  3X1V D;  3X1U A;  3AZK B;  3WAA B;  5B24 B;  3X1V C;  3LJA A;  5AVB C;  5JRG B;  4X23 A;  3AZE A;  5AV8 D;  1ZLA C;  5B24 A;  1P3K C;  4DRA A;  1HQ3 B;  5FUG B;  5AV6 B;  1P3F C;  3NQU A;  5B40 B;  3KUY A;  5AV6 A;  2BYM A;  4Z5T B;  3REK A;  1EQZ B;  5GXQ A;  2Y2L A;  4WU8 D;  5B40 A;  1EQZ A;  5B1L A;  3X1T C;  5B32 D;  4J8V C;  3W96 C;  1S32 C;  5BNV B;  5B32 C;  4JJN D;  3LZ0 B;  5BNV A;  3AV2 D;  4KUD D;  3IP4 C;  3B6F D;  2HIO A;  4WZS B;  4J8U B;  3AZI A;  4H9R A;  3UTB D;  5B31 C;  4J8U A;  3REH B;  1F66 D;  5CP6 A;  1N1J B;  3LEL B;  3FDD A;  1F66 C;  1ZLA B;  4G91 B;  3LEL A;  1KX4 C;  5AVC D;  3AV1 D;  3WTP E;  4WNN A;  2XD1 A;  4YM6 D;  3AZG D;  3F6T A;  5AVC C;  5CPJ B;  2NQB D;  3AZG C;  2ARO C;  5JA4 A;  3REJ D;  5CPK B;  4J8W B;  2RIQ A;  2JCH A;  3REL D;  3UT9 A;  1TAF A;  1P3O D;  3W97 B;  1P3G A;  4KGC B;  5DNN A;  3KXB D;  2HUE C;  5F99 B;  1M18 B;  2YFV A;  3WTP B;  3TU4 A;  3W97 A;  1P3A D;  3C1C C;  2BYK B;  4KGC A;  3B6G A;  2FJ7 C;  4XZQ C;  5B0Z C;  3AFA A;  3MVD C;  3AN2 D;  1P3A C;  2XD5 A;  1KX5 B;  1AOI B;  3MGS D;  3WA9 C;  5DNM C;  3LZ1 A;  4LD9 A;  4G92 B;  5AY8 D;  3AZN C;  5CPI B;  3WKJ D;  4ZUX A;  4M6B A;  5AV5 A;  5CPI A;  3X1U D;  1P3B B;  2F2A C;  3LJA D;  5B32 G;  5E5A C;  4X23 D;  5B33 A;  4J8X C;  3AZE D;  3LJA C;  5B24 D;  4CAY B;  3VH5 W;  3AYW A;  2ZY4 A;  3AZE C;  3MGQ A;  5AVB B;  3REI C;  4CAY A;  3AZF A;  3KUY D;  5AV6 D;  5B31 G;  5CHL B;  3R45 B;  3MGR C;  5GXQ D;  3REK D;  2ZY2 A;  3B0C T;  5B1M C;  1P3K B;  5B40 D;  1U35 A;  5AV9 A;  1KX3 A;  3X1S A;  1EQZ D;  5B1L D;  1P3F B;  2NZD A;  3AZH B;  2F8N G;  3EPK A;  3H0R C;  4KHA A;  3X1T B;  1Q9C A;  4Z66 A;  2HIO D;  3EPJ A;  4J8V B;  3AZL A;  3AZI D;  1M1A B;  5B0Y A;  2HIO C;  3KWQ A;  2Y2M A;  4J8U D;  3O62 C;  2Y2P A;  5CP6 D;  1P3I A;  3A6N C;  3H0M C;  4NE3 A;  3A1I A;  3LEL D;  5B31 B;  1P3P C;  3EPH A;  3AL0 C;  1P3L A;  3MNN B;  4H9N A;  3W98 C;  1A7W A;  2F8N B;  5GT3 A;  1ID3 C;  4EO5 C;  3MGP A;  1P3M C;  3UT9 D;  2ARO B;  4CSR A;  4WU9 B;  5BT1 D;  3VH6 A;  1P3G D;  5DNN D;  5GSU C;  1BH8 A;  5GT0 A;  4WU9 A;  2CV5 C;  5BT1 C;  3TU4 D;  1P34 A;  3W97 D;  5DNN C;  4R8P B;  4KGC D;  3B6G D;  4H9Q B;  3AFA D;  1M19 B;  4R8P A;  3B6G C;  5B2J A;  2PYO A;  3AFA C;  1M19 A;  2FJ7 B;  4XZQ B;  5B0Z B;  3W99 C;  1BH9 B;  3LZ1 D;  3MVD B;  3AZM A;  4LD9 D;  5B2I B;  3AZK A;  3WAA A;  1WWI A;  3VH6 T;  5B2I A;  4ZUX D;  3WA9 B;  5JRG A;  5AV8 C;  5AV5 D;  4ZUX C;  1W2E A;  3V9R B;  1HQ3 A;  5FUG A;  5C3I B;  3V9R A;  5B33 D;  4Z5T A;  4WU8 C;  3A1K A;  2Y2O A;  3AYW D;  3MGQ D;  5BNX B;  3AZF D;  5G49 B;  5E5A B;  4AWL C;  3AYW C;  5BNX A;  1U35 D;  5AV9 D;  1KX3 D;  5BS7 C;  3X1S D;  4JJN C;  3EPL A;  3LZ0 A;  3AV2 C;  3REI B;  2NZD D;  3C1B D;  4KUD C;  3B6F C;  3MGR B;  4UUZ B;  3C1B C;  3UTB C;  4UUZ A;  3REH A;  4WJ3 C;  4H9O B;  4Z66 D;  1N1J A;  3AZL D;  4H9S C;  5B0Y D;  3KWQ D;  3AZL C;  3AV1 C;  4YM6 C;  1P3I D;  5CPJ A;  4XUJ B;  2NQB C;  2JE5 A;  4XUJ A;  2YFW B;  3O62 B;  3REJ C;  5CPK A;  4QLC B;  4J8W A;  1P3L D;  3A6N B;  1WWS A;  2BG1 A;  3REL C;  1P3O C;  3KXB C;  5F99 A;  5GT3 D;  1M18 A;  3MGP D;  3WTP A;  3W98 B;  3UTA B;  1TZY B;  2BYK A;  3MGP C;  3UTA A;  3AN2 C;  4WU9 D;  5GT0 D;  1ID3 B;  1F1E A;  1P34 D;  1P3M B;  1KX5 A;  2J8P A;  2ZY3 A;  4DRB A;  3MGS C;  1P34 C;  4R8P D;  1AOI A;  4NFT A;  5AY8 C;  5B2J D;  2CV5 B;  2PYO D;  1M19 D;  3WKJ C;  5B2J C;  3AZJ B;  4YS3 B;  1HTA A;  3AZM D;  3X1U C;  1Z2C B;  3AZK D;  4ZBJ B;  3WAA D;  4YS3 A;  4NE5 A;  1P3B A;  5B2I D;  4X23 C;  5JRG D;  3W99 B;  5B24 C;  3X1V B;  5JRG C;  1HQ3 D;  1H3O B;  3X1V A;  5AVB A;  1HQ3 C;  3KUY C;  5AV6 C;  3REK C;  5AV8 B;  4Z5T D;  1ZLA A;  3R45 A;  5GXQ C;  1B6W A;  5B40 C;  1P3K A;  4DQY B;  1EQZ C;  5B1L C;  1P3F A;  2RVQ D;  4Z2M H;  3AZH A;  1S32 B;  3W96 B;  3LZ0 D;  4AWL B;  3X1T A;  5B32 B;  4J8V A;  2G5H C;  3W96 A;  1S32 A;  2DQN C;  3AZI C;  2UWX A;  1M1A A;  4J8U C;  3REH D;  3AV2 B;  1ULY A;  5CP6 C;  4KUD B;  3B6F B;  3REH C;  5KDM B;  3LEL C;  5B31 A;  1F66 B;  4G91 C;  1KX4 B;  2FFF B;  5CPJ D;  3MNN A;  5CPJ C;  5AVC B;  3AV1 B;  1KX4 A;  4XUJ D;  5CPK D;  4YM6 B;  3AZG B;  4J8W D;  5AVC A;  2F8N A;  3UT9 C;  2ARO A;  3REJ B;  2F8N K;  1P3G C;  5F99 D;  1M18 D;  3WTP D;  3TU4 C;  3W97 C;  4KGC C;  3REL B;  5BO0 B;  2HUE B;  1P3O B;  4H9Q A;  3UTA D;  3KXB B;  3C1C B;  1P3A B;  1KX5 D;  3C1C A;  1AOI D;  1KX5 C;  3LZ1 C;  4XZQ A;  5B0Z A;  3MVD A;  1BH9 A;  3AN2 B;  1P3A A;  2FJ7 A;  4LD9 C;  4HGA C;  5DNM B;  5CPI D;  4G92 C;  2ZY5 A;  3MGS B;  3AZN B;  3WA9 A;  4E44 A;  5DNM A;  5CPI C;  5AV5 C;  5AY8 B;  3B0D C;  3AZN A;  3B0C W;  4YS3 D;  1P3B D;  3WKJ B;  1B67 A;  5B33 C;  3X1U B;  4J8X B;  3MGQ C;  3LJA B;  3NQJ B;  3AZF C;  5AVB D;  5G49 A;  4X23 B;  5E5A A;  4J8X A;  2Y2I A;  3AZE B;  1ZLA D;  3NQJ A;  1P3K D;  1U35 C;  5AV9 C;  1KX3 C;  3X1S C;  3NQU B;  1P3F D;  5B1M B;  3REI A;  2NZD C;  3KUY B;  2BYM B;  3MGR A;  3REK B;  5GXQ B;  5B1M A;  3AZH D;  5B1L B;  2F8N H;  3AZH C;  3X1T D;  4Z66 C;  4H9O A;  3B0B A;  4J8V D;  3VH5 T;  1S32 D;  3W96 D;  4H9P B;  5B0Y C;  1M1A D;  3KWQ C;  4Z2M G;  2ZM5 A;  4H9P A;  1P3I C;  1M1A C;  2HIO B;  3AZI B;  4H9R B;  1T3U A;  2CWE A;  5B31 D;  2YFW A;  5CP6 B;  3O62 A;  4QLC A;  1P3L C;  3MNN D;  3A6N A;  1P3P B;  2IO5 C;  3P5J B;  1KX4 D;  3MNN C;  4WNN B;  1P3P A;  2F8N D;  5GT3 C;  3W98 A;  1TZY A;  2ARO D;  5JA4 B;  4EO5 B;  5GT0 C;  4WU9 C;  1ID3 A;  1P3M A;  3KFU G;  3UT9 B;  1TAF B;  5GSU B;  4R8P C;  3VH6 W;  5DNN B;  1P3G B;  5GSU A;  2W8S A;  2YFV B;  1BFM A;  2PYO C;  4WV4 B;  3TU4 B;  2CV5 A;  1M19 C;  3C1C D;  3B6G B;  2VQR A;  3AFA B;  3AZJ A;  5B0Z D;  4XZQ D;  3MVD D;  2FJ7 D;  3AZM C;  2Y2K A;  3AZK C;  3WAA C;  5B2I C;  3WA9 D;  3LZ1 B;  5DNM D;  3W99 A;  4LD9 B;  3AZN D;  4HGA B;  1H3O A;  4ZUX B;  2Y2Q A;  2LY8 A;  4NE6 A;  4Z5T C;  5C3I C;  5AV8 A;  5AV5 B;  3B0D B;  2DF4 C;  3KSY A;  4WU8 B;  2RVQ C;  5E5A D;  5B33 B;  4J8X D;  2G5I C;  4WU8 A;  3AYW B;  3MGQ B;  3LZ0 C;  3AZF B;  3REI D;  5B32 A;  3MGR D;  4JJN B;  5B1M D;  1U35 B;  5AV9 B;  1KX3 B;  3X1S B;  5BS7 A;  4JJN A;  3AV2 A;  2NZD B;  3C1B B;  4UPK A;  4KUD A;  3B6F A;  3UTB B;  1R4V A;  3C1B A;  5KDM A;  3UTB A;  4KHA B;  1F66 A;  4E45 A;  4Z66 B;  3AZL B;  4H9S A;  2Y2H A;  5B0Y B;  2Y2J A;  3KWQ B;  3AV1 A;  4XUJ C;  2NQB B;  3O62 D;  5CPK C;  1P3I B;  4YM6 A;  4J8W C;  4QLC D;  3AZG A;  3A6N D;  2NQB A;  2Y2N A;  4QLC C;  1JFI B;  3REJ A;  1P3P D;  1JFI A;  3H0L C;  5F99 C;  1PZR A;  4H9N B;  1P3L B;  1M18 C;  3WTP C;  2IO5 B;  3W98 D;  3REL A;  5BO0 A;  1TZY D; 
#chains in the Genus database with same CATH homology
 1P3O A;  3UTA C;  1TZY C;  3KXB A;  5GT3 B;  3MGP B;  1ID3 D;  1P3M D;  4CSR B;  1AOI C;  3AN2 A;  1BH8 B;  5GSU D;  5GT0 B;  2CV5 D;  1P34 B;  2L5A A;  2Y2G A;  3MGS A;  3AZJ D;  2JSS A;  3EG5 B;  5B2J B;  1KU5 A;  5AY8 A;  3AZJ C;  2PYO B;  4YS3 C;  1P3B C;  3WKJ A;  3VH5 A;  4ZBJ C;  3W99 D;  3AZM B;  3X1V D;  3X1U A;  3AZK B;  3WAA B;  5B24 B;  3X1V C;  3LJA A;  5AVB C;  5JRG B;  4X23 A;  3AZE A;  5AV8 D;  1ZLA C;  5B24 A;  1P3K C;  4DRA A;  1HQ3 B;  5FUG B;  5AV6 B;  1P3F C;  3NQU A;  5B40 B;  3KUY A;  5AV6 A;  2BYM A;  4Z5T B;  3REK A;  1EQZ B;  5GXQ A;  2Y2L A;  4WU8 D;  5B40 A;  1EQZ A;  5B1L A;  3X1T C;  5B32 D;  4J8V C;  3W96 C;  1S32 C;  5BNV B;  5B32 C;  4JJN D;  3LZ0 B;  5BNV A;  3AV2 D;  4KUD D;  3IP4 C;  3B6F D;  2HIO A;  4WZS B;  4J8U B;  3AZI A;  4H9R A;  3UTB D;  5B31 C;  4J8U A;  3REH B;  1F66 D;  5CP6 A;  1N1J B;  3LEL B;  3FDD A;  1F66 C;  1ZLA B;  4G91 B;  3LEL A;  1KX4 C;  5AVC D;  3AV1 D;  3WTP E;  4WNN A;  2XD1 A;  4YM6 D;  3AZG D;  3F6T A;  5AVC C;  5CPJ B;  2NQB D;  3AZG C;  2ARO C;  5JA4 A;  3REJ D;  5CPK B;  4J8W B;  2RIQ A;  2JCH A;  3REL D;  3UT9 A;  1TAF A;  1P3O D;  3W97 B;  1P3G A;  4KGC B;  5DNN A;  3KXB D;  2HUE C;  5F99 B;  1M18 B;  2YFV A;  3WTP B;  3TU4 A;  3W97 A;  1P3A D;  3C1C C;  2BYK B;  4KGC A;  3B6G A;  2FJ7 C;  4XZQ C;  5B0Z C;  3AFA A;  3MVD C;  3AN2 D;  1P3A C;  2XD5 A;  1KX5 B;  1AOI B;  3MGS D;  3WA9 C;  5DNM C;  3LZ1 A;  4LD9 A;  4G92 B;  5AY8 D;  3AZN C;  5CPI B;  3WKJ D;  4ZUX A;  4M6B A;  5AV5 A;  5CPI A;  3X1U D;  1P3B B;  2F2A C;  3LJA D;  5B32 G;  5E5A C;  4X23 D;  5B33 A;  4J8X C;  3AZE D;  3LJA C;  5B24 D;  4CAY B;  3VH5 W;  3AYW A;  2ZY4 A;  3AZE C;  3MGQ A;  5AVB B;  3REI C;  4CAY A;  3AZF A;  3KUY D;  5AV6 D;  5B31 G;  5CHL B;  3R45 B;  3MGR C;  5GXQ D;  3REK D;  2ZY2 A;  3B0C T;  5B1M C;  1P3K B;  5B40 D;  1U35 A;  5AV9 A;  1KX3 A;  3X1S A;  1EQZ D;  5B1L D;  1P3F B;  2NZD A;  3AZH B;  2F8N G;  3EPK A;  3H0R C;  4KHA A;  3X1T B;  1Q9C A;  4Z66 A;  2HIO D;  3EPJ A;  4J8V B;  3AZL A;  3AZI D;  1M1A B;  5B0Y A;  2HIO C;  3KWQ A;  2Y2M A;  4J8U D;  3O62 C;  2Y2P A;  5CP6 D;  1P3I A;  3A6N C;  3H0M C;  4NE3 A;  3A1I A;  3LEL D;  5B31 B;  1P3P C;  3EPH A;  3AL0 C;  1P3L A;  3MNN B;  4H9N A;  3W98 C;  1A7W A;  2F8N B;  5GT3 A;  1ID3 C;  4EO5 C;  3MGP A;  1P3M C;  3UT9 D;  2ARO B;  4CSR A;  4WU9 B;  5BT1 D;  3VH6 A;  1P3G D;  5DNN D;  5GSU C;  1BH8 A;  5GT0 A;  4WU9 A;  2CV5 C;  5BT1 C;  3TU4 D;  1P34 A;  3W97 D;  5DNN C;  4R8P B;  4KGC D;  3B6G D;  4H9Q B;  3AFA D;  1M19 B;  4R8P A;  3B6G C;  5B2J A;  2PYO A;  3AFA C;  1M19 A;  2FJ7 B;  4XZQ B;  5B0Z B;  3W99 C;  1BH9 B;  3LZ1 D;  3MVD B;  3AZM A;  4LD9 D;  5B2I B;  3AZK A;  3WAA A;  1WWI A;  3VH6 T;  5B2I A;  4ZUX D;  3WA9 B;  5JRG A;  5AV8 C;  5AV5 D;  4ZUX C;  1W2E A;  3V9R B;  1HQ3 A;  5FUG A;  5C3I B;  3V9R A;  5B33 D;  4Z5T A;  4WU8 C;  3A1K A;  2Y2O A;  3AYW D;  3MGQ D;  5BNX B;  3AZF D;  5G49 B;  5E5A B;  4AWL C;  3AYW C;  5BNX A;  1U35 D;  5AV9 D;  1KX3 D;  5BS7 C;  3X1S D;  4JJN C;  3EPL A;  3LZ0 A;  3AV2 C;  3REI B;  2NZD D;  3C1B D;  4KUD C;  3B6F C;  3MGR B;  4UUZ B;  3C1B C;  3UTB C;  4UUZ A;  3REH A;  4WJ3 C;  4H9O B;  4Z66 D;  1N1J A;  3AZL D;  4H9S C;  5B0Y D;  3KWQ D;  3AZL C;  3AV1 C;  4YM6 C;  1P3I D;  5CPJ A;  4XUJ B;  2NQB C;  2JE5 A;  4XUJ A;  2YFW B;  3O62 B;  3REJ C;  5CPK A;  4QLC B;  4J8W A;  1P3L D;  3A6N B;  1WWS A;  2BG1 A;  3REL C;  1P3O C;  3KXB C;  5F99 A;  5GT3 D;  1M18 A;  3MGP D;  3WTP A;  3W98 B;  3UTA B;  1TZY B;  2BYK A;  3MGP C;  3UTA A;  3AN2 C;  4WU9 D;  5GT0 D;  1ID3 B;  1F1E A;  1P34 D;  1P3M B;  1KX5 A;  2J8P A;  2ZY3 A;  4DRB A;  3MGS C;  1P34 C;  4R8P D;  1AOI A;  4NFT A;  5AY8 C;  5B2J D;  2CV5 B;  2PYO D;  1M19 D;  3WKJ C;  5B2J C;  3AZJ B;  4YS3 B;  1HTA A;  3AZM D;  3X1U C;  1Z2C B;  3AZK D;  4ZBJ B;  3WAA D;  4YS3 A;  4NE5 A;  1P3B A;  5B2I D;  4X23 C;  5JRG D;  3W99 B;  5B24 C;  3X1V B;  5JRG C;  1HQ3 D;  1H3O B;  3X1V A;  5AVB A;  1HQ3 C;  3KUY C;  5AV6 C;  3REK C;  5AV8 B;  4Z5T D;  1ZLA A;  3R45 A;  5GXQ C;  1B6W A;  5B40 C;  1P3K A;  4DQY B;  1EQZ C;  5B1L C;  1P3F A;  2RVQ D;  4Z2M H;  3AZH A;  1S32 B;  3W96 B;  3LZ0 D;  4AWL B;  3X1T A;  5B32 B;  4J8V A;  2G5H C;  3W96 A;  1S32 A;  2DQN C;  3AZI C;  2UWX A;  1M1A A;  4J8U C;  3REH D;  3AV2 B;  1ULY A;  5CP6 C;  4KUD B;  3B6F B;  3REH C;  5KDM B;  3LEL C;  5B31 A;  1F66 B;  4G91 C;  1KX4 B;  2FFF B;  5CPJ D;  3MNN A;  5CPJ C;  5AVC B;  3AV1 B;  1KX4 A;  4XUJ D;  5CPK D;  4YM6 B;  3AZG B;  4J8W D;  5AVC A;  2F8N A;  3UT9 C;  2ARO A;  3REJ B;  2F8N K;  1P3G C;  5F99 D;  1M18 D;  3WTP D;  3TU4 C;  3W97 C;  4KGC C;  3REL B;  5BO0 B;  2HUE B;  1P3O B;  4H9Q A;  3UTA D;  3KXB B;  3C1C B;  1P3A B;  1KX5 D;  3C1C A;  1AOI D;  1KX5 C;  3LZ1 C;  4XZQ A;  5B0Z A;  3MVD A;  1BH9 A;  3AN2 B;  1P3A A;  2FJ7 A;  4LD9 C;  4HGA C;  5DNM B;  5CPI D;  4G92 C;  2ZY5 A;  3MGS B;  3AZN B;  3WA9 A;  4E44 A;  5DNM A;  5CPI C;  5AV5 C;  5AY8 B;  3B0D C;  3AZN A;  3B0C W;  4YS3 D;  1P3B D;  3WKJ B;  1B67 A;  5B33 C;  3X1U B;  4J8X B;  3MGQ C;  3LJA B;  3NQJ B;  3AZF C;  5AVB D;  5G49 A;  4X23 B;  5E5A A;  4J8X A;  2Y2I A;  3AZE B;  1ZLA D;  3NQJ A;  1P3K D;  1U35 C;  5AV9 C;  1KX3 C;  3X1S C;  3NQU B;  1P3F D;  5B1M B;  3REI A;  2NZD C;  3KUY B;  2BYM B;  3MGR A;  3REK B;  5GXQ B;  5B1M A;  3AZH D;  5B1L B;  2F8N H;  3AZH C;  3X1T D;  4Z66 C;  4H9O A;  3B0B A;  4J8V D;  3VH5 T;  1S32 D;  3W96 D;  4H9P B;  5B0Y C;  1M1A D;  3KWQ C;  4Z2M G;  2ZM5 A;  4H9P A;  1P3I C;  1M1A C;  2HIO B;  3AZI B;  4H9R B;  1T3U A;  2CWE A;  5B31 D;  2YFW A;  5CP6 B;  3O62 A;  4QLC A;  1P3L C;  3MNN D;  3A6N A;  1P3P B;  2IO5 C;  3P5J B;  1KX4 D;  3MNN C;  4WNN B;  1P3P A;  2F8N D;  5GT3 C;  3W98 A;  1TZY A;  2ARO D;  5JA4 B;  4EO5 B;  5GT0 C;  4WU9 C;  1ID3 A;  1P3M A;  3KFU G;  3UT9 B;  1TAF B;  5GSU B;  4R8P C;  3VH6 W;  5DNN B;  1P3G B;  5GSU A;  2W8S A;  2YFV B;  1BFM A;  2PYO C;  4WV4 B;  3TU4 B;  2CV5 A;  1M19 C;  3C1C D;  3B6G B;  2VQR A;  3AFA B;  3AZJ A;  5B0Z D;  4XZQ D;  3MVD D;  2FJ7 D;  3AZM C;  2Y2K A;  3AZK C;  3WAA C;  5B2I C;  3WA9 D;  3LZ1 B;  5DNM D;  3W99 A;  4LD9 B;  3AZN D;  4HGA B;  1H3O A;  4ZUX B;  2Y2Q A;  2LY8 A;  4NE6 A;  4Z5T C;  5C3I C;  5AV8 A;  5AV5 B;  3B0D B;  2DF4 C;  3KSY A;  4WU8 B;  2RVQ C;  5E5A D;  5B33 B;  4J8X D;  2G5I C;  4WU8 A;  3AYW B;  3MGQ B;  3LZ0 C;  3AZF B;  3REI D;  5B32 A;  3MGR D;  4JJN B;  5B1M D;  1U35 B;  5AV9 B;  1KX3 B;  3X1S B;  5BS7 A;  4JJN A;  3AV2 A;  2NZD B;  3C1B B;  4UPK A;  4KUD A;  3B6F A;  3UTB B;  1R4V A;  3C1B A;  5KDM A;  3UTB A;  4KHA B;  1F66 A;  4E45 A;  4Z66 B;  3AZL B;  4H9S A;  2Y2H A;  5B0Y B;  2Y2J A;  3KWQ B;  3AV1 A;  4XUJ C;  2NQB B;  3O62 D;  5CPK C;  1P3I B;  4YM6 A;  4J8W C;  4QLC D;  3AZG A;  3A6N D;  2NQB A;  2Y2N A;  4QLC C;  1JFI B;  3REJ A;  1P3P D;  1JFI A;  3H0L C;  5F99 C;  1PZR A;  4H9N B;  1P3L B;  1M18 C;  3WTP C;  2IO5 B;  3W98 D;  3REL A;  5BO0 A;  1TZY D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...