4G91C

Ccaat-binding complex from aspergillus nidulans
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
117
structure length
117
Chain Sequence
b'GTWANVNQGLQGTARDILTTYWQHVINHLESDNHDYKIHQLPLARIKKVMKADPEVKMISAEAPILFAKGCDVFITELTMRAWIHAEDNKRRTLQRSDIAAALSKSDMFDFLIDIVP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HAPB protein
publication title DNA Minor Groove Sensing and Widening by the CCAAT-Binding Complex.
pubmed doi rcsb
source organism Emericella nidulans
molecule tags Transcription
total genus 39
structure length 117
sequence length 117
ec nomenclature
pdb deposition date 2012-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00808 CBFD_NFYB_HMF Histone-like transcription factor (CBF/NF-Y) and archaeal histone
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4g91C00
1M1AD 1AOIC 1P3MA 1HQ3D 2F8NB 3KXBA 1M19A 1KU5A 2YFVB 1ZLAA 1P3IC 3B0DB 3REKA 3V9RB 3LZ1B 1BH9A 1KX3C 5E5AA 3R45B 5BNXA 5C3IB 3MGPC 3TU4C 1P3OD 4XUJB 3AV1D 2PYOC 5B0ZB 5CPIB 5GSUC 2CWEA 5DNNA 4H9NA 1EQZC 4R8PB 3AZKA 1A7WA 3AYWA 3W98A 4DRAA 3AZED 3X1VB 4Z66C 4J8UD 5CPKC 4Z2MH 1P3BC 5B32C 4ZBJC 3REIA 4LD9D 4H9SC 4YS3C 5B40B 2HIOB 4H9QB 5AVCA 3AZLC 4J8WC 3REHC 3WKJB 1JFIB 3X1SD 3KUYB 3W99A 3LELD 3O62A 3W97B 5AV5A 5B33C 2NQBB 2NZDC 4J8XC 2RVQD 3AZIA 2AROB 3MGRB 1ULYA 1F66B 2YFWB 5AY8C 5AV6C 1TZYC 1ID3C 3LZ0C 3UTAC 1M18D 3WA9D 4H9PA 4G92C 5AV8A 4AWLC 1P3IA 2IO5B 5AV9D 3C1CC 1HQ3B 1AOID 3AZGD 3WAAB 5B24B 1P3GC 3MVDA 1P3KA 3W96C 1KX5C 3NQJA 3AZMD 1P3MB 1KX3D 4KUDB 2F8NA 1P3OB 3MGPD 3KXBB 5B2IC 1Q9CA 3AV1B 5CPKA 3NQUB 2YFVA 5B32A 4HGAB 4M6BA 4H9SA 4ZUXC 3REKB 3AN2C 3B6FB 5GSUD 1EQZD 3V9RA 3LZ1A 3AZLA 1M1AC 5KDMB 4JJNB 3R45A 5FUGB 1P3PB 4WU9D 4NE6A 3AZHC 5F99C 3MGSC 3AZJC 2HUEB 5B0ZA 5CPIA 3AZFD 3AZNC 3REHD 4QLCB 3X1SB 4EO5B 4G91C 3X1VA 1S32B 1ID3A 3UTAA 5AVBC 5BT1C 5B0YD 5B33D 3A6NB 2CV5D 2NZDD 5B40A 3WTPC 4E44A 1P34D 2HIOA 4H9QA 5B1MB 3WKJA 1P3LB 3REJB 5AY8D 3C1BC 1JFIA 3AZEC 3KUYA 4Z5TB 4J8UC 5GT3D 1M18B 3WA9B 3LZ0D 4LD9C 3W97A 3AZIB 1KX5A 5B31B 2AROA 3MGRA 1AOIB 1F66A 2YFWA 2FJ7C 3LELC 5B2IA 1BH8B 4H9PB 1P3GD 1P3IB 1U35D 1KX3B 5B2JC 1HQ3A 3B0CW 3MGPB 3TU4B 3WAAA 3WA9C 1N1JB 2PYOB 5GSUB 4ZUXD 1EQZB 5AV9C 3AZGC 4KUDA 5DNMD 1P3OA 1TAFB 4Z66B 5CPKB 4NFTA 3AZHD 1P3BB 3AV1A 3NQUA 5F99D 5B32B 4ZBJB 3MGSD 3AZJD 1P3FC 4YS3B 2BYMB 3AZFB 4NE3A 3B6FA 3AZLB 3AZND 4J8WB 3REHB 3AZMC 5KDMA 4JJNA 3AFAC 5FUGA 1P3PA 4KGCC 5AVBD 5BT1D 5B33B 3MNND 2NZDB 4J8XB 5BO0B 3WTPD 3X1UC 5CPJD 4XZQC 1WWIA 4QLCA 5AY8B 3X1SA 1KX4D 3C1BD 5AV6B 3B0CT 4WU9C 1TZYB 1ID3B 3LZ0B 3UTAB 1S32A 4G92B 4X23D 3AZFC 3A6NA 4AWLB 3UT9D 5B1MA 3C1CB 1P3LA 3REJA 2FJ7D 4YM6C 3B6GC 4Z5TA 1M18A 3WA9A 5JRGC 5GT0C 1P3GB 5B0YC 2CV5C 1KX5B 1HTAA 1P34C 3W96B 5B31A 5CP6C 5B2JD 1AOIA 4WZSB 5GT3C 5B2IB 3RELC 1BH8A 2F8NG 4H9RB 5GXQC 4ZUXB 3AN2B 5DNND 3AZKD 1M1AB 3AZMA 4WU8C 1KX3A 5B32G 3W98D 3MGPA 3TU4A 3AZHB 4DRBA 5F99B 3MGSB 3AZJB 1N1JA 1P3AD 1P3FD 2PYOA 1U35C 5GSUA 5AVCD 3AZNB 1EQZA 3AFAD 4G91B 5B1LD 4WU9A 4Z66A 1TAFA 4KGCD 5AVBB 3LJAC 1P3BA 5AV5D 4YS3A 2BYMA 3AZFA 3WTPB 3X1UD 4J8WA 3REHA 4XZQD 1KX4B 5DNMC 3C1BB 3AZEB 4J8UB 4LD9B 5AV8D 5B33A 2NZDA 2BYKB 4J8XA 5BO0A 3KSYA 2FJ7B 5AY8A 3LELB 4YM6D 5AV6A 3X1TD 1TZYA 3B6GD 3LZ0A 3UTBC 5JRGD 5GT0D 3MNNC 1P3KD 5CPJC 3MGQC 3KWQC 5B2JB 3C1CA 5CP6D 1KX4C 3RELD 4X23C 5BS7C 1P3GA 5GXQD 3W96A 4J8VD 3UT9C 5AV9B 3LZ1D 3AZGB 4WU8D 3VH6W 1M19C 4XUJD 1ZLAC 1P3FB 1F1EA 5CPID 4H9RA 4ZUXA 3AN2A 3AV2D 5E5AC 4R8PD 3AZMB 1M1AA 3AFAB 4H9OB 3X1VD 4KGCB 3AZHA 1H3OB 5F99A 3LJAD 3MGSA 3AZJA 4E45A 5DNNC 5B40D 4CAYB 1BFMA 3AZNA 3X1UB 3AZKC 3AYWC 3WKJD 4XZQB 3W98C 3KUYD 4WU9B 5AVBA 3REIC 1P3AC 3W97D 2F8NH 2NQBD 3MNNA 5AVCC 3WTPA 5CPJA 2AROD 3VH6T 1KX4A 3W99C 3C1BA 5B1LC 4YM6B 3X1TB 3AZEA 3B6GB 4J8UA 5BNVB 3O62C 5JRGB 3UTBD 5GT0B 5AV5C 5B0YB 2CV5B 4LD9A 4CSRB 1P34B 2BYKA 4UUZB 3MGQD 3KWQD 5CP6B 2FJ7A 3WAAD 3LELA 5GT3B 5B24D 5B31G 3RELB 5AV8C 5GXQB 4KHAB 4J8VB 4WU8B 5B2JA 1P3MD 4KUDD 2L5AA 3X1TC 3KXBD 1M19D 1ZLAD 3MVDC 1P3KC 3REKD 1U35B 3B6FD 3AV2B 5AV9A 5E5AD 4NE5A 4JJND 3AZGA 1P3PD 5CHLB 3LJAB 1P3AA 1P3FA 4J8VC 3B0DC 3VH6A 3LZ1C 3AYWD 4QLCD 5DNMB 3AFAA 5C3IC 4H9OA 5B1LA 4XUJC 1S32D 4KGCA 4WNNB 1H3OA 3REID 5B0ZC 5CPIC 3A6ND 1R4VA 4CAYA 3AV2C 4R8PC 5B1MD 3X1UA 4XZQA 1P3LD 3REJD 3W99D 3VH5W 3X1VC 1B6WA 4Z5TD 3UTBB 3O62D 3MNNB 5B40C 3AZID 2HIOC 5B31D 5CPJB 3MGQB 3KWQB 3WKJC 3KUYC 5G49B 4YM6A 3X1TA 3B6GA 5JA4B 5BNVA 5JRGA 3W97C 5GT0A 2NQBC 4X23B 5B0YA 2CV5A 4CSRA 1P3ID 1P34A 3UT9B 4UUZA 2AROC 3MGRC 1F66C 5CP6A 3TU4D 1M19B 5GT3A 4Z2MG 3RELA 1ZLAB 2PYOD 3MVDD 5GXQA 4KHAA 4J8VA 1BH9B 2IO5C 5E5AB 1HQ3C 4WU8A 2F8ND 5BNXB 3WAAC 5B24C 3VH5T 4Z66D 5CPKD 4XUJA 1P3BD 2LY8A 5B32D 3B0BA 4YS3D 5DNNB 4H9NB 1U35A 3AZKB 3AZLD 4R8PA 3AYWB 4J8WD 3AV2A 1P3MC 4WV4B 3W98B 4KUDC 1P3OC 3KXBC 3AV1C 3LJAA 3REIB 1P3AB 4HGAC 5B0ZD 3REKC 4J8XD 5AVCB 3B6FC 4JJNC 5DNMA 3W99B 5B1LB 1P3PC 5AV6D 1TZYD 1ID3D 3O62B 3UTAD 4WNNA 5AV5B 2NQBA 2HUEC 2JSSA 2HIOD 3C1CD 4QLCC 3X1SC 4EO5C 1S32C 3UTBA 5AV8B 3A6NC 2RVQC 1KX5D 2F8NK 3W96D 5B1MC 3MGRD 3MGQA 3KWQA 1F66D 3VH5A 1P3LC 3REJC 4Z5TC 5B24A 5G49A 5B2ID 1M18C 5JA4A 3MVDB 1B67A 1P3KB 4X23A 5BS7A 3AZIC 1WWSA 3AN2D 5B31C 3UT9A 3NQJB 3WTPE
chains in the Genus database with same CATH superfamily
1M1AD 1AOIC 3A1IA 1HQ3D 1P3MA 2F8NB 2Y2MA 3KXBA 1M19A 1KU5A 2YFVB 1ZLAA 1P3IC 3B0DB 3REKA 3V9RB 3LZ1B 1BH9A 1KX3C 5E5AA 3R45B 5BNXA 5C3IB 3MGPC 3TU4C 1P3OD 4XUJB 3AV1D 2ZY2A 2PYOC 5B0ZB 5CPIB 5GSUC 2CWEA 5DNNA 4H9NA 1EQZC 4R8PB 3AZKA 1A7WA 3AYWA 3W98A 4DRAA 3AZED 3X1VB 4Z66C 4J8UD 2UWXA 5CPKC 4Z2MH 1P3BC 4WJ3C 5B32C 4ZBJC 3REIA 4LD9D 4H9SC 4YS3C 5B40B 2HIOB 4H9QB 5AVCA 3AZLC 4J8WC 3REHC 3WKJB 1JFIB 3X1SD 3KUYB 3W99A 3LELD 2DQNC 3EG5B 3O62A 3W97B 5AV5A 5B33C 2NQBB 2NZDC 4J8XC 2RVQD 3AZIA 2AROB 3MGRB 1ULYA 3A1KA 1F66B 2YFWB 5AY8C 5AV6C 1TZYC 1ID3C 3LZ0C 3UTAC 1M18D 3WA9D 4H9PA 4G92C 2JE5A 4UPKA 5AV8A 4AWLC 1P3IA 2IO5B 5AV9D 3C1CC 1HQ3B 1AOID 3AZGD 1W2EA 3WAAB 5B24B 1P3GC 3MVDA 1P3KA 3W96C 1KX5C 3NQJA 3AZMD 1P3MB 1KX3D 4KUDB 2BG1A 2F8NA 1P3OB 3MGPD 3KXBB 5B2IC 2Y2OA 1Q9CA 3AV1B 5CPKA 3NQUB 2YFVA 5B32A 4HGAB 4M6BA 4H9SA 4ZUXC 3REKB 3AN2C 3B6FB 5GSUD 1EQZD 3V9RA 3LZ1A 3AZLA 1M1AC 5KDMB 4JJNB 3R45A 5FUGB 1P3PB 4WU9D 2Y2QA 4NE6A 3AZHC 5F99C 2XD1A 3MGSC 3AZJC 2HUEB 5B0ZA 5CPIA 3AZFD 3AZNC 4DQYB 3REHD 4QLCB 3X1SB 4EO5B 4G91C 3X1VA 1S32B 1ID3A 3UTAA 5AVBC 5BT1C 5B0YD 5B33D 3A6NB 2CV5D 2NZDD 5B40A 4E44A 3WTPC 1P34D 2HIOA 4H9QA 5B1MB 3WKJA 1P3LB 3REJB 5AY8D 3C1BC 1JFIA 3AZEC 3KUYA 4Z5TB 4J8UC 5GT3D 2ZY3A 1M18B 3LZ0D 3WA9B 4LD9C 3W97A 3AZIB 1KX5A 5B31B 2AROA 3MGRA 1AOIB 1F66A 2YFWA 2FJ7C 3LELC 5B2IA 1BH8B 1PZRA 4H9PB 1P3GD 1P3IB 1U35D 2G5HC 1KX3B 5B2JC 1HQ3A 3B0CW 3MGPB 3TU4B 3WAAA 3WA9C 1N1JB 2ZY4A 2PYOB 5GSUB 4ZUXD 1EQZB 2Y2PA 5AV9C 3AZGC 4KUDA 5DNMD 2Y2KA 1P3OA 1TAFB 4Z66B 5CPKB 4NFTA 3AZHD 1P3BB 3AV1A 3NQUA 5F99D 5B32B 4ZBJB 3MGSD 3AZJD 1P3FC 4YS3B 2BYMB 3F6TA 3AZFB 4NE3A 3B6FA 3AZLB 3AZND 4J8WB 3REHB 3AZMC 5KDMA 4JJNA 3AFAC 5FUGA 1P3PA 4KGCC 5AVBD 3H0LC 5BT1D 5B33B 3MNND 2NZDB 4J8XB 5BO0B 3WTPD 3X1UC 5CPJD 4XZQC 1WWIA 4QLCA 5AY8B 3X1SA 1KX4D 3C1BD 5AV6B 3B0CT 4WU9C 1TZYB 1ID3B 3LZ0B 3UTAB 1S32A 4G92B 4X23D 3AZFC 3A6NA 4AWLB 3H0RC 3UT9D 5B1MA 3C1CB 1P3LA 3REJA 2FJ7D 4YM6C 2RIQA 3B6GC 4Z5TA 1M18A 3WA9A 5JRGC 5GT0C 1P3GB 5B0YC 2CV5C 1KX5B 1HTAA 1P34C 3W96B 5B31A 5CP6C 5B2JD 1AOIA 4WZSB 5GT3C 5B2IB 3RELC 1BH8A 2F8NG 4H9RB 5GXQC 4ZUXB 3AN2B 5DNND 3AZKD 1M1AB 3AZMA 4WU8C 1KX3A 5B32G 3W98D 3EPJA 3MGPA 3TU4A 3AZHB 4DRBA 5F99B 3MGSB 3AZJB 1N1JA 1P3AD 1P3FD 2PYOA 1U35C 5GSUA 5AVCD 3AZNB 1EQZA 3AFAD 1T3UA 4G91B 5B1LD 4WU9A 1TAFA 4Z66A 4KGCD 5AVBB 3LJAC 1P3BA 5AV5D 4YS3A 2BYMA 3AZFA 3WTPB 3X1UD 4J8WA 3REHA 4XZQD 1KX4B 5DNMC 3C1BB 3AZEB 4J8UB 4LD9B 3AL0C 3FDDA 5AV8D 5B33A 2NZDA 2BYKB 4J8XA 5BO0A 3KSYA 2FJ7B 5AY8A 3LELB 4YM6D 5AV6A 3X1TD 1TZYA 3B6GD 3LZ0A 3UTBC 2XD5A 5JRGD 5GT0D 3MNNC 1P3KD 3EPHA 3IP4C 5CPJC 3MGQC 3KWQC 5B2JB 3C1CA 2Y2JA 5CP6D 1KX4C 3RELD 4X23C 5BS7C 1P3GA 5GXQD 3W96A 4J8VD 3UT9C 5AV9B 3LZ1D 2ZY5A 3AZGB 2G5IC 3VH6W 4WU8D 1M19C 4XUJD 1ZLAC 1P3FB 1F1EA 5CPID 4H9RA 4ZUXA 3AN2A 2Y2IA 3AV2D 5E5AC 4R8PD 3AZMB 1M1AA 3AFAB 4H9OB 3X1VD 4KGCB 3AZHA 1H3OB 5F99A 3LJAD 3MGSA 3AZJA 1Z2CB 4E45A 5DNNC 5B40D 4CAYB 1BFMA 3AZNA 3X1UB 3AZKC 3AYWC 3WKJD 4XZQB 3W98C 3KUYD 4WU9B 2W8SA 5AVBA 3REIC 1P3AC 3EPKA 3W97D 2F8NH 2DF4C 2NQBD 3MNNA 5AVCC 3WTPA 5CPJA 2AROD 3VH6T 1KX4A 3W99C 3C1BA 5B1LC 4YM6B 3X1TB 3AZEA 3B6GB 4J8UA 5BNVB 3O62C 5JRGB 3UTBD 5GT0B 5AV5C 5B0YB 2CV5B 4LD9A 4CSRB 1P34B 2BYKA 4UUZB 3MGQD 2VQRA 5CP6B 3KWQD 2FJ7A 3WAAD 3LELA 5GT3B 5B24D 5B31G 3RELB 2ZM5A 5AV8C 5GXQB 4KHAB 4J8VB 4WU8B 5B2JA 1P3MD 4KUDD 2L5AA 3P5JB 3X1TC 3KXBD 1M19D 1ZLAD 3MVDC 1P3KC 3REKD 1U35B 3B6FD 2FFFB 3AV2B 5AV9A 5E5AD 4NE5A 4JJND 3AZGA 1P3PD 5CHLB 3LJAB 1P3AA 1P3FA 4J8VC 3B0DC 3VH6A 3LZ1C 2JCHA 3AYWD 4QLCD 5DNMB 3AFAA 5C3IC 4H9OA 5B1LA 4XUJC 1S32D 4KGCA 4WNNB 1H3OA 3REID 5B0ZC 5CPIC 3A6ND 1R4VA 4CAYA 3AV2C 4R8PC 5B1MD 3X1UA 4XZQA 1P3LD 3REJD 3W99D 3VH5W 3H0MC 3X1VC 1B6WA 4Z5TD 3UTBB 3O62D 3MNNB 5B40C 3AZID 2HIOC 5B31D 5CPJB 3MGQB 3KWQB 3WKJC 3KUYC 5G49B 2Y2NA 4YM6A 3X1TA 3B6GA 5JA4B 5BNVA 5JRGA 3W97C 5GT0A 2NQBC 4X23B 5B0YA 2CV5A 4CSRA 1P3ID 1P34A 3UT9B 4UUZA 2AROC 3MGRC 1F66C 5CP6A 3TU4D 1M19B 5GT3A 4Z2MG 3RELA 1ZLAB 2PYOD 3MVDD 5GXQA 4KHAA 4J8VA 1BH9B 2IO5C 5E5AB 2Y2HA 3EPLA 1HQ3C 4WU8A 2F8ND 5BNXB 3WAAC 5B24C 3VH5T 4Z66D 5CPKD 4XUJA 1P3BD 2LY8A 5B32D 3B0BA 4YS3D 5DNNB 4H9NB 1U35A 3AZKB 3AZLD 4R8PA 3AYWB 4J8WD 3AV2A 1P3MC 4WV4B 3W98B 4KUDC 1P3OC 2Y2LA 3KXBC 3KFUG 2Y2GA 3AV1C 2F2AC 3LJAA 3REIB 1P3AB 4HGAC 5B0ZD 3REKC 4J8XD 5AVCB 3B6FC 4JJNC 5DNMA 3W99B 5B1LB 1P3PC 5AV6D 1TZYD 1ID3D 3O62B 3UTAD 4WNNA 5AV5B 2J8PA 2NQBA 2HUEC 2JSSA 2HIOD 3C1CD 4QLCC 3X1SC 4EO5C 1S32C 3UTBA 5AV8B 3A6NC 2RVQC 1KX5D 2F8NK 3W96D 5B1MC 3MGRD 3MGQA 3KWQA 1F66D 3VH5A 1P3LC 3REJC 4Z5TC 5G49A 5B2ID 5B24A 1M18C 5JA4A 3MVDB 1B67A 1P3KB 4X23A 5BS7A 3AZIC 1WWSA 3AN2D 5B31C 3UT9A 3NQJB 3WTPE
chains in the Genus database with same CATH topology
1M1AD 1AOIC 3A1IA 1HQ3D 1P3MA 2F8NB 2Y2MA 3KXBA 1M19A 1KU5A 2YFVB 1ZLAA 1P3IC 3B0DB 3REKA 3V9RB 3LZ1B 1BH9A 1KX3C 5E5AA 3R45B 5BNXA 5C3IB 3MGPC 3TU4C 1P3OD 4XUJB 3AV1D 2ZY2A 2PYOC 5B0ZB 5CPIB 5GSUC 2CWEA 5DNNA 4H9NA 1EQZC 4R8PB 3AZKA 1A7WA 3AYWA 3W98A 4DRAA 3AZED 3X1VB 4Z66C 4J8UD 2UWXA 5CPKC 4Z2MH 1P3BC 4WJ3C 5B32C 4ZBJC 3REIA 4LD9D 4H9SC 4YS3C 5B40B 2HIOB 4H9QB 5AVCA 3AZLC 4J8WC 3REHC 3WKJB 1JFIB 3X1SD 3KUYB 3W99A 3LELD 2DQNC 3EG5B 3O62A 3W97B 5AV5A 5B33C 2NQBB 2NZDC 4J8XC 2RVQD 3AZIA 2AROB 3MGRB 1ULYA 3A1KA 1F66B 2YFWB 5AY8C 5AV6C 1TZYC 1ID3C 3LZ0C 3UTAC 1M18D 3WA9D 4H9PA 4G92C 2JE5A 4UPKA 5AV8A 4AWLC 1P3IA 2IO5B 5AV9D 3C1CC 1HQ3B 1AOID 3AZGD 1W2EA 3WAAB 5B24B 1P3GC 3MVDA 1P3KA 3W96C 1KX5C 3NQJA 3AZMD 1P3MB 1KX3D 4KUDB 2BG1A 2F8NA 1P3OB 3MGPD 3KXBB 5B2IC 2Y2OA 1Q9CA 3AV1B 5CPKA 3NQUB 2YFVA 5B32A 4HGAB 4M6BA 4H9SA 4ZUXC 3REKB 3AN2C 3B6FB 5GSUD 1EQZD 3V9RA 3LZ1A 3AZLA 1M1AC 5KDMB 4JJNB 3R45A 5FUGB 1P3PB 4WU9D 2Y2QA 4NE6A 3AZHC 5F99C 2XD1A 3MGSC 3AZJC 2HUEB 5B0ZA 5CPIA 3AZFD 3AZNC 4DQYB 3REHD 4QLCB 3X1SB 4EO5B 4G91C 3X1VA 1S32B 1ID3A 3UTAA 5AVBC 5BT1C 5B0YD 5B33D 3A6NB 2CV5D 2NZDD 5B40A 4E44A 3WTPC 1P34D 2HIOA 4H9QA 5B1MB 3WKJA 1P3LB 3REJB 5AY8D 3C1BC 1JFIA 3AZEC 3KUYA 4Z5TB 4J8UC 5GT3D 2ZY3A 1M18B 3LZ0D 3WA9B 4LD9C 3W97A 3AZIB 1KX5A 5B31B 2AROA 3MGRA 1AOIB 1F66A 2YFWA 2FJ7C 3LELC 5B2IA 1BH8B 1PZRA 4H9PB 1P3GD 1P3IB 1U35D 2G5HC 1KX3B 5B2JC 1HQ3A 3B0CW 3MGPB 3TU4B 3WAAA 3WA9C 1N1JB 2ZY4A 2PYOB 5GSUB 4ZUXD 1EQZB 2Y2PA 5AV9C 3AZGC 4KUDA 5DNMD 2Y2KA 1P3OA 1TAFB 4Z66B 5CPKB 4NFTA 3AZHD 1P3BB 3AV1A 3NQUA 5F99D 5B32B 4ZBJB 3MGSD 3AZJD 1P3FC 4YS3B 2BYMB 3F6TA 3AZFB 4NE3A 3B6FA 3AZLB 3AZND 4J8WB 3REHB 3AZMC 5KDMA 4JJNA 3AFAC 5FUGA 1P3PA 4KGCC 5AVBD 3H0LC 5BT1D 5B33B 3MNND 2NZDB 4J8XB 5BO0B 3WTPD 3X1UC 5CPJD 4XZQC 1WWIA 4QLCA 5AY8B 3X1SA 1KX4D 3C1BD 5AV6B 3B0CT 4WU9C 1TZYB 1ID3B 3LZ0B 3UTAB 1S32A 4G92B 4X23D 3AZFC 3A6NA 4AWLB 3H0RC 3UT9D 5B1MA 3C1CB 1P3LA 3REJA 2FJ7D 4YM6C 2RIQA 3B6GC 4Z5TA 1M18A 3WA9A 5JRGC 5GT0C 1P3GB 5B0YC 2CV5C 1KX5B 1HTAA 1P34C 3W96B 5B31A 5CP6C 5B2JD 1AOIA 4WZSB 5GT3C 5B2IB 3RELC 1BH8A 2F8NG 4H9RB 5GXQC 4ZUXB 3AN2B 5DNND 3AZKD 1M1AB 3AZMA 4WU8C 1KX3A 5B32G 3W98D 3EPJA 3MGPA 3TU4A 3AZHB 4DRBA 5F99B 3MGSB 3AZJB 1N1JA 1P3AD 1P3FD 2PYOA 1U35C 5GSUA 5AVCD 3AZNB 1EQZA 3AFAD 1T3UA 4G91B 5B1LD 4WU9A 1TAFA 4Z66A 4KGCD 5AVBB 3LJAC 1P3BA 5AV5D 4YS3A 2BYMA 3AZFA 3WTPB 3X1UD 4J8WA 3REHA 4XZQD 1KX4B 5DNMC 3C1BB 3AZEB 4J8UB 4LD9B 3AL0C 3FDDA 5AV8D 5B33A 2NZDA 2BYKB 4J8XA 5BO0A 3KSYA 2FJ7B 5AY8A 3LELB 4YM6D 5AV6A 3X1TD 1TZYA 3B6GD 3LZ0A 3UTBC 2XD5A 5JRGD 5GT0D 3MNNC 1P3KD 3EPHA 3IP4C 5CPJC 3MGQC 3KWQC 5B2JB 3C1CA 2Y2JA 5CP6D 1KX4C 3RELD 4X23C 5BS7C 1P3GA 5GXQD 3W96A 4J8VD 3UT9C 5AV9B 3LZ1D 2ZY5A 3AZGB 2G5IC 3VH6W 4WU8D 1M19C 4XUJD 1ZLAC 1P3FB 1F1EA 5CPID 4H9RA 4ZUXA 3AN2A 2Y2IA 3AV2D 5E5AC 4R8PD 3AZMB 1M1AA 3AFAB 4H9OB 3X1VD 4KGCB 3AZHA 1H3OB 5F99A 3LJAD 3MGSA 3AZJA 1Z2CB 4E45A 5DNNC 5B40D 4CAYB 1BFMA 3AZNA 3X1UB 3AZKC 3AYWC 3WKJD 4XZQB 3W98C 3KUYD 4WU9B 2W8SA 5AVBA 3REIC 1P3AC 3EPKA 3W97D 2F8NH 2DF4C 2NQBD 3MNNA 5AVCC 3WTPA 5CPJA 2AROD 3VH6T 1KX4A 3W99C 3C1BA 5B1LC 4YM6B 3X1TB 3AZEA 3B6GB 4J8UA 5BNVB 3O62C 5JRGB 3UTBD 5GT0B 5AV5C 5B0YB 2CV5B 4LD9A 4CSRB 1P34B 2BYKA 4UUZB 3MGQD 2VQRA 5CP6B 3KWQD 2FJ7A 3WAAD 3LELA 5GT3B 5B24D 5B31G 3RELB 2ZM5A 5AV8C 5GXQB 4KHAB 4J8VB 4WU8B 5B2JA 1P3MD 4KUDD 2L5AA 3P5JB 3X1TC 3KXBD 1M19D 1ZLAD 3MVDC 1P3KC 3REKD 1U35B 3B6FD 2FFFB 3AV2B 5AV9A 5E5AD 4NE5A 4JJND 3AZGA 1P3PD 5CHLB 3LJAB 1P3AA 1P3FA 4J8VC 3B0DC 3VH6A 3LZ1C 2JCHA 3AYWD 4QLCD 5DNMB 3AFAA 5C3IC 4H9OA 5B1LA 4XUJC 1S32D 4KGCA 4WNNB 1H3OA 3REID 5B0ZC 5CPIC 3A6ND 1R4VA 4CAYA 3AV2C 4R8PC 5B1MD 3X1UA 4XZQA 1P3LD 3REJD 3W99D 3VH5W 3H0MC 3X1VC 1B6WA 4Z5TD 3UTBB 3O62D 3MNNB 5B40C 3AZID 2HIOC 5B31D 5CPJB 3MGQB 3KWQB 3WKJC 3KUYC 5G49B 2Y2NA 4YM6A 3X1TA 3B6GA 5JA4B 5BNVA 5JRGA 3W97C 5GT0A 2NQBC 4X23B 5B0YA 2CV5A 4CSRA 1P3ID 1P34A 3UT9B 4UUZA 2AROC 3MGRC 1F66C 5CP6A 3TU4D 1M19B 5GT3A 4Z2MG 3RELA 1ZLAB 2PYOD 3MVDD 5GXQA 4KHAA 4J8VA 1BH9B 2IO5C 5E5AB 2Y2HA 3EPLA 1HQ3C 4WU8A 2F8ND 5BNXB 3WAAC 5B24C 3VH5T 4Z66D 5CPKD 4XUJA 1P3BD 2LY8A 5B32D 3B0BA 4YS3D 5DNNB 4H9NB 1U35A 3AZKB 3AZLD 4R8PA 3AYWB 4J8WD 3AV2A 1P3MC 4WV4B 3W98B 4KUDC 1P3OC 2Y2LA 3KXBC 3KFUG 2Y2GA 3AV1C 2F2AC 3LJAA 3REIB 1P3AB 4HGAC 5B0ZD 3REKC 4J8XD 5AVCB 3B6FC 4JJNC 5DNMA 3W99B 5B1LB 1P3PC 5AV6D 1TZYD 1ID3D 3O62B 3UTAD 4WNNA 5AV5B 2J8PA 2NQBA 2HUEC 2JSSA 2HIOD 3C1CD 4QLCC 3X1SC 4EO5C 1S32C 3UTBA 5AV8B 3A6NC 2RVQC 1KX5D 2F8NK 3W96D 5B1MC 3MGRD 3MGQA 3KWQA 1F66D 3VH5A 1P3LC 3REJC 4Z5TC 5G49A 5B2ID 5B24A 1M18C 5JA4A 3MVDB 1B67A 1P3KB 4X23A 5BS7A 3AZIC 1WWSA 3AN2D 5B31C 3UT9A 3NQJB 3WTPE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1M1A D;  1AOI C;  1P3M A;  1HQ3 D;  2F8N B;  3KXB A;  1M19 A;  1KU5 A;  2YFV B;  1ZLA A;  1P3I C;  3B0D B;  3REK A;  3V9R B;  3LZ1 B;  1BH9 A;  1KX3 C;  5E5A A;  3R45 B;  5BNX A;  5C3I B;  3MGP C;  3TU4 C;  1P3O D;  4XUJ B;  3AV1 D;  2PYO C;  5B0Z B;  5CPI B;  5GSU C;  2CWE A;  5DNN A;  4H9N A;  1EQZ C;  4R8P B;  3AZK A;  1A7W A;  3AYW A;  3W98 A;  4DRA A;  3AZE D;  3X1V B;  4Z66 C;  4J8U D;  5CPK C;  4Z2M H;  1P3B C;  5B32 C;  4ZBJ C;  3REI A;  4LD9 D;  4H9S C;  4YS3 C;  5B40 B;  2HIO B;  4H9Q B;  5AVC A;  3AZL C;  4J8W C;  3REH C;  3WKJ B;  1JFI B;  3X1S D;  3KUY B;  3W99 A;  3LEL D;  3O62 A;  3W97 B;  5AV5 A;  5B33 C;  2NQB B;  2NZD C;  4J8X C;  2RVQ D;  3AZI A;  2ARO B;  3MGR B;  1ULY A;  1F66 B;  2YFW B;  5AY8 C;  5AV6 C;  1TZY C;  1ID3 C;  3LZ0 C;  3UTA C;  1M18 D;  3WA9 D;  4H9P A;  4G92 C;  5AV8 A;  4AWL C;  1P3I A;  2IO5 B;  5AV9 D;  3C1C C;  1HQ3 B;  1AOI D;  3AZG D;  3WAA B;  5B24 B;  1P3G C;  3MVD A;  1P3K A;  3W96 C;  1KX5 C;  3NQJ A;  3AZM D;  1P3M B;  1KX3 D;  4KUD B;  2F8N A;  1P3O B;  3MGP D;  3KXB B;  5B2I C;  1Q9C A;  3AV1 B;  5CPK A;  3NQU B;  2YFV A;  5B32 A;  4HGA B;  4M6B A;  4H9S A;  4ZUX C;  3REK B;  3AN2 C;  3B6F B;  5GSU D;  1EQZ D;  3V9R A;  3LZ1 A;  3AZL A;  1M1A C;  5KDM B;  4JJN B;  3R45 A;  5FUG B;  1P3P B;  4WU9 D;  4NE6 A;  3AZH C;  5F99 C;  3MGS C;  3AZJ C;  2HUE B;  5B0Z A;  5CPI A;  3AZF D;  3AZN C;  3REH D;  4QLC B;  3X1S B;  4EO5 B;  4G91 C;  3X1V A;  1S32 B;  1ID3 A;  3UTA A;  5AVB C;  5BT1 C;  5B0Y D;  5B33 D;  3A6N B;  2CV5 D;  2NZD D;  5B40 A;  3WTP C;  4E44 A;  1P34 D;  2HIO A;  4H9Q A;  5B1M B;  3WKJ A;  1P3L B;  3REJ B;  5AY8 D;  3C1B C;  1JFI A;  3AZE C;  3KUY A;  4Z5T B;  4J8U C;  5GT3 D;  1M18 B;  3WA9 B;  3LZ0 D;  4LD9 C;  3W97 A;  3AZI B;  1KX5 A;  5B31 B;  2ARO A;  3MGR A;  1AOI B;  1F66 A;  2YFW A;  2FJ7 C;  3LEL C;  5B2I A;  1BH8 B;  4H9P B;  1P3G D;  1P3I B;  1U35 D;  1KX3 B;  5B2J C;  1HQ3 A;  3B0C W;  3MGP B;  3TU4 B;  3WAA A;  3WA9 C;  1N1J B;  2PYO B;  5GSU B;  4ZUX D;  1EQZ B;  5AV9 C;  3AZG C;  4KUD A;  5DNM D;  1P3O A;  1TAF B;  4Z66 B;  5CPK B;  4NFT A;  3AZH D;  1P3B B;  3AV1 A;  3NQU A;  5F99 D;  5B32 B;  4ZBJ B;  3MGS D;  3AZJ D;  1P3F C;  4YS3 B;  2BYM B;  3AZF B;  4NE3 A;  3B6F A;  3AZL B;  3AZN D;  4J8W B;  3REH B;  3AZM C;  5KDM A;  4JJN A;  3AFA C;  5FUG A;  1P3P A;  4KGC C;  5AVB D;  5BT1 D;  5B33 B;  3MNN D;  2NZD B;  4J8X B;  5BO0 B;  3WTP D;  3X1U C;  5CPJ D;  4XZQ C;  1WWI A;  4QLC A;  5AY8 B;  3X1S A;  1KX4 D;  3C1B D;  5AV6 B;  3B0C T;  4WU9 C;  1TZY B;  1ID3 B;  3LZ0 B;  3UTA B;  1S32 A;  4G92 B;  4X23 D;  3AZF C;  3A6N A;  4AWL B;  3UT9 D;  5B1M A;  3C1C B;  1P3L A;  3REJ A;  2FJ7 D;  4YM6 C;  3B6G C;  4Z5T A;  1M18 A;  3WA9 A;  5JRG C;  5GT0 C;  1P3G B;  5B0Y C;  2CV5 C;  1KX5 B;  1HTA A;  1P34 C;  3W96 B;  5B31 A;  5CP6 C;  5B2J D;  1AOI A;  4WZS B;  5GT3 C;  5B2I B;  3REL C;  1BH8 A;  2F8N G;  4H9R B;  5GXQ C;  4ZUX B;  3AN2 B;  5DNN D;  3AZK D;  1M1A B;  3AZM A;  4WU8 C;  1KX3 A;  5B32 G;  3W98 D;  3MGP A;  3TU4 A;  3AZH B;  4DRB A;  5F99 B;  3MGS B;  3AZJ B;  1N1J A;  1P3A D;  1P3F D;  2PYO A;  1U35 C;  5GSU A;  5AVC D;  3AZN B;  1EQZ A;  3AFA D;  4G91 B;  5B1L D;  4WU9 A;  4Z66 A;  1TAF A;  4KGC D;  5AVB B;  3LJA C;  1P3B A;  5AV5 D;  4YS3 A;  2BYM A;  3AZF A;  3WTP B;  3X1U D;  4J8W A;  3REH A;  4XZQ D;  1KX4 B;  5DNM C;  3C1B B;  3AZE B;  4J8U B;  4LD9 B;  5AV8 D;  5B33 A;  2NZD A;  2BYK B;  4J8X A;  5BO0 A;  3KSY A;  2FJ7 B;  5AY8 A;  3LEL B;  4YM6 D;  5AV6 A;  3X1T D;  1TZY A;  3B6G D;  3LZ0 A;  3UTB C;  5JRG D;  5GT0 D;  3MNN C;  1P3K D;  5CPJ C;  3MGQ C;  3KWQ C;  5B2J B;  3C1C A;  5CP6 D;  1KX4 C;  3REL D;  4X23 C;  5BS7 C;  1P3G A;  5GXQ D;  3W96 A;  4J8V D;  3UT9 C;  5AV9 B;  3LZ1 D;  3AZG B;  4WU8 D;  3VH6 W;  1M19 C;  4XUJ D;  1ZLA C;  1P3F B;  1F1E A;  5CPI D;  4H9R A;  4ZUX A;  3AN2 A;  3AV2 D;  5E5A C;  4R8P D;  3AZM B;  1M1A A;  3AFA B;  4H9O B;  3X1V D;  4KGC B;  3AZH A;  1H3O B;  5F99 A;  3LJA D;  3MGS A;  3AZJ A;  4E45 A;  5DNN C;  5B40 D;  4CAY B;  1BFM A;  3AZN A;  3X1U B;  3AZK C;  3AYW C;  3WKJ D;  4XZQ B;  3W98 C;  3KUY D;  4WU9 B;  5AVB A;  3REI C;  1P3A C;  3W97 D;  2F8N H;  2NQB D;  3MNN A;  5AVC C;  3WTP A;  5CPJ A;  2ARO D;  3VH6 T;  1KX4 A;  3W99 C;  3C1B A;  5B1L C;  4YM6 B;  3X1T B;  3AZE A;  3B6G B;  4J8U A;  5BNV B;  3O62 C;  5JRG B;  3UTB D;  5GT0 B;  5AV5 C;  5B0Y B;  2CV5 B;  4LD9 A;  4CSR B;  1P34 B;  2BYK A;  4UUZ B;  3MGQ D;  3KWQ D;  5CP6 B;  2FJ7 A;  3WAA D;  3LEL A;  5GT3 B;  5B24 D;  5B31 G;  3REL B;  5AV8 C;  5GXQ B;  4KHA B;  4J8V B;  4WU8 B;  5B2J A;  1P3M D;  4KUD D;  2L5A A;  3X1T C;  3KXB D;  1M19 D;  1ZLA D;  3MVD C;  1P3K C;  3REK D;  1U35 B;  3B6F D;  3AV2 B;  5AV9 A;  5E5A D;  4NE5 A;  4JJN D;  3AZG A;  1P3P D;  5CHL B;  3LJA B;  1P3A A;  1P3F A;  4J8V C;  3B0D C;  3VH6 A;  3LZ1 C;  3AYW D;  4QLC D;  5DNM B;  3AFA A;  5C3I C;  4H9O A;  5B1L A;  4XUJ C;  1S32 D;  4KGC A;  4WNN B;  1H3O A;  3REI D;  5B0Z C;  5CPI C;  3A6N D;  1R4V A;  4CAY A;  3AV2 C;  4R8P C;  5B1M D;  3X1U A;  4XZQ A;  1P3L D;  3REJ D;  3W99 D;  3VH5 W;  3X1V C;  1B6W A;  4Z5T D;  3UTB B;  3O62 D;  3MNN B;  5B40 C;  3AZI D;  2HIO C;  5B31 D;  5CPJ B;  3MGQ B;  3KWQ B;  3WKJ C;  3KUY C;  5G49 B;  4YM6 A;  3X1T A;  3B6G A;  5JA4 B;  5BNV A;  5JRG A;  3W97 C;  5GT0 A;  2NQB C;  4X23 B;  5B0Y A;  2CV5 A;  4CSR A;  1P3I D;  1P34 A;  3UT9 B;  4UUZ A;  2ARO C;  3MGR C;  1F66 C;  5CP6 A;  3TU4 D;  1M19 B;  5GT3 A;  4Z2M G;  3REL A;  1ZLA B;  2PYO D;  3MVD D;  5GXQ A;  4KHA A;  4J8V A;  1BH9 B;  2IO5 C;  5E5A B;  1HQ3 C;  4WU8 A;  2F8N D;  5BNX B;  3WAA C;  5B24 C;  3VH5 T;  4Z66 D;  5CPK D;  4XUJ A;  1P3B D;  2LY8 A;  5B32 D;  3B0B A;  4YS3 D;  5DNN B;  4H9N B;  1U35 A;  3AZK B;  3AZL D;  4R8P A;  3AYW B;  4J8W D;  3AV2 A;  1P3M C;  4WV4 B;  3W98 B;  4KUD C;  1P3O C;  3KXB C;  3AV1 C;  3LJA A;  3REI B;  1P3A B;  4HGA C;  5B0Z D;  3REK C;  4J8X D;  5AVC B;  3B6F C;  4JJN C;  5DNM A;  3W99 B;  5B1L B;  1P3P C;  5AV6 D;  1TZY D;  1ID3 D;  3O62 B;  3UTA D;  4WNN A;  5AV5 B;  2NQB A;  2HUE C;  2JSS A;  2HIO D;  3C1C D;  4QLC C;  3X1S C;  4EO5 C;  1S32 C;  3UTB A;  5AV8 B;  3A6N C;  2RVQ C;  1KX5 D;  2F8N K;  3W96 D;  5B1M C;  3MGR D;  3MGQ A;  3KWQ A;  1F66 D;  3VH5 A;  1P3L C;  3REJ C;  4Z5T C;  5B24 A;  5G49 A;  5B2I D;  1M18 C;  5JA4 A;  3MVD B;  1B67 A;  1P3K B;  4X23 A;  5BS7 A;  3AZI C;  1WWS A;  3AN2 D;  5B31 C;  3UT9 A;  3NQJ B;  3WTP E; 
#chains in the Genus database with same CATH topology
 1M1A D;  1AOI C;  3A1I A;  1HQ3 D;  1P3M A;  2F8N B;  2Y2M A;  3KXB A;  1M19 A;  1KU5 A;  2YFV B;  1ZLA A;  1P3I C;  3B0D B;  3REK A;  3V9R B;  3LZ1 B;  1BH9 A;  1KX3 C;  5E5A A;  3R45 B;  5BNX A;  5C3I B;  3MGP C;  3TU4 C;  1P3O D;  4XUJ B;  3AV1 D;  2ZY2 A;  2PYO C;  5B0Z B;  5CPI B;  5GSU C;  2CWE A;  5DNN A;  4H9N A;  1EQZ C;  4R8P B;  3AZK A;  1A7W A;  3AYW A;  3W98 A;  4DRA A;  3AZE D;  3X1V B;  4Z66 C;  4J8U D;  2UWX A;  5CPK C;  4Z2M H;  1P3B C;  4WJ3 C;  5B32 C;  4ZBJ C;  3REI A;  4LD9 D;  4H9S C;  4YS3 C;  5B40 B;  2HIO B;  4H9Q B;  5AVC A;  3AZL C;  4J8W C;  3REH C;  3WKJ B;  1JFI B;  3X1S D;  3KUY B;  3W99 A;  3LEL D;  2DQN C;  3EG5 B;  3O62 A;  3W97 B;  5AV5 A;  5B33 C;  2NQB B;  2NZD C;  4J8X C;  2RVQ D;  3AZI A;  2ARO B;  3MGR B;  1ULY A;  3A1K A;  1F66 B;  2YFW B;  5AY8 C;  5AV6 C;  1TZY C;  1ID3 C;  3LZ0 C;  3UTA C;  1M18 D;  3WA9 D;  4H9P A;  4G92 C;  2JE5 A;  4UPK A;  5AV8 A;  4AWL C;  1P3I A;  2IO5 B;  5AV9 D;  3C1C C;  1HQ3 B;  1AOI D;  3AZG D;  1W2E A;  3WAA B;  5B24 B;  1P3G C;  3MVD A;  1P3K A;  3W96 C;  1KX5 C;  3NQJ A;  3AZM D;  1P3M B;  1KX3 D;  4KUD B;  2BG1 A;  2F8N A;  1P3O B;  3MGP D;  3KXB B;  5B2I C;  2Y2O A;  1Q9C A;  3AV1 B;  5CPK A;  3NQU B;  2YFV A;  5B32 A;  4HGA B;  4M6B A;  4H9S A;  4ZUX C;  3REK B;  3AN2 C;  3B6F B;  5GSU D;  1EQZ D;  3V9R A;  3LZ1 A;  3AZL A;  1M1A C;  5KDM B;  4JJN B;  3R45 A;  5FUG B;  1P3P B;  4WU9 D;  2Y2Q A;  4NE6 A;  3AZH C;  5F99 C;  2XD1 A;  3MGS C;  3AZJ C;  2HUE B;  5B0Z A;  5CPI A;  3AZF D;  3AZN C;  4DQY B;  3REH D;  4QLC B;  3X1S B;  4EO5 B;  4G91 C;  3X1V A;  1S32 B;  1ID3 A;  3UTA A;  5AVB C;  5BT1 C;  5B0Y D;  5B33 D;  3A6N B;  2CV5 D;  2NZD D;  5B40 A;  4E44 A;  3WTP C;  1P34 D;  2HIO A;  4H9Q A;  5B1M B;  3WKJ A;  1P3L B;  3REJ B;  5AY8 D;  3C1B C;  1JFI A;  3AZE C;  3KUY A;  4Z5T B;  4J8U C;  5GT3 D;  2ZY3 A;  1M18 B;  3LZ0 D;  3WA9 B;  4LD9 C;  3W97 A;  3AZI B;  1KX5 A;  5B31 B;  2ARO A;  3MGR A;  1AOI B;  1F66 A;  2YFW A;  2FJ7 C;  3LEL C;  5B2I A;  1BH8 B;  1PZR A;  4H9P B;  1P3G D;  1P3I B;  1U35 D;  2G5H C;  1KX3 B;  5B2J C;  1HQ3 A;  3B0C W;  3MGP B;  3TU4 B;  3WAA A;  3WA9 C;  1N1J B;  2ZY4 A;  2PYO B;  5GSU B;  4ZUX D;  1EQZ B;  2Y2P A;  5AV9 C;  3AZG C;  4KUD A;  5DNM D;  2Y2K A;  1P3O A;  1TAF B;  4Z66 B;  5CPK B;  4NFT A;  3AZH D;  1P3B B;  3AV1 A;  3NQU A;  5F99 D;  5B32 B;  4ZBJ B;  3MGS D;  3AZJ D;  1P3F C;  4YS3 B;  2BYM B;  3F6T A;  3AZF B;  4NE3 A;  3B6F A;  3AZL B;  3AZN D;  4J8W B;  3REH B;  3AZM C;  5KDM A;  4JJN A;  3AFA C;  5FUG A;  1P3P A;  4KGC C;  5AVB D;  3H0L C;  5BT1 D;  5B33 B;  3MNN D;  2NZD B;  4J8X B;  5BO0 B;  3WTP D;  3X1U C;  5CPJ D;  4XZQ C;  1WWI A;  4QLC A;  5AY8 B;  3X1S A;  1KX4 D;  3C1B D;  5AV6 B;  3B0C T;  4WU9 C;  1TZY B;  1ID3 B;  3LZ0 B;  3UTA B;  1S32 A;  4G92 B;  4X23 D;  3AZF C;  3A6N A;  4AWL B;  3H0R C;  3UT9 D;  5B1M A;  3C1C B;  1P3L A;  3REJ A;  2FJ7 D;  4YM6 C;  2RIQ A;  3B6G C;  4Z5T A;  1M18 A;  3WA9 A;  5JRG C;  5GT0 C;  1P3G B;  5B0Y C;  2CV5 C;  1KX5 B;  1HTA A;  1P34 C;  3W96 B;  5B31 A;  5CP6 C;  5B2J D;  1AOI A;  4WZS B;  5GT3 C;  5B2I B;  3REL C;  1BH8 A;  2F8N G;  4H9R B;  5GXQ C;  4ZUX B;  3AN2 B;  5DNN D;  3AZK D;  1M1A B;  3AZM A;  4WU8 C;  1KX3 A;  5B32 G;  3W98 D;  3EPJ A;  3MGP A;  3TU4 A;  3AZH B;  4DRB A;  5F99 B;  3MGS B;  3AZJ B;  1N1J A;  1P3A D;  1P3F D;  2PYO A;  1U35 C;  5GSU A;  5AVC D;  3AZN B;  1EQZ A;  3AFA D;  1T3U A;  4G91 B;  5B1L D;  4WU9 A;  1TAF A;  4Z66 A;  4KGC D;  5AVB B;  3LJA C;  1P3B A;  5AV5 D;  4YS3 A;  2BYM A;  3AZF A;  3WTP B;  3X1U D;  4J8W A;  3REH A;  4XZQ D;  1KX4 B;  5DNM C;  3C1B B;  3AZE B;  4J8U B;  4LD9 B;  3AL0 C;  3FDD A;  5AV8 D;  5B33 A;  2NZD A;  2BYK B;  4J8X A;  5BO0 A;  3KSY A;  2FJ7 B;  5AY8 A;  3LEL B;  4YM6 D;  5AV6 A;  3X1T D;  1TZY A;  3B6G D;  3LZ0 A;  3UTB C;  2XD5 A;  5JRG D;  5GT0 D;  3MNN C;  1P3K D;  3EPH A;  3IP4 C;  5CPJ C;  3MGQ C;  3KWQ C;  5B2J B;  3C1C A;  2Y2J A;  5CP6 D;  1KX4 C;  3REL D;  4X23 C;  5BS7 C;  1P3G A;  5GXQ D;  3W96 A;  4J8V D;  3UT9 C;  5AV9 B;  3LZ1 D;  2ZY5 A;  3AZG B;  2G5I C;  3VH6 W;  4WU8 D;  1M19 C;  4XUJ D;  1ZLA C;  1P3F B;  1F1E A;  5CPI D;  4H9R A;  4ZUX A;  3AN2 A;  2Y2I A;  3AV2 D;  5E5A C;  4R8P D;  3AZM B;  1M1A A;  3AFA B;  4H9O B;  3X1V D;  4KGC B;  3AZH A;  1H3O B;  5F99 A;  3LJA D;  3MGS A;  3AZJ A;  1Z2C B;  4E45 A;  5DNN C;  5B40 D;  4CAY B;  1BFM A;  3AZN A;  3X1U B;  3AZK C;  3AYW C;  3WKJ D;  4XZQ B;  3W98 C;  3KUY D;  4WU9 B;  2W8S A;  5AVB A;  3REI C;  1P3A C;  3EPK A;  3W97 D;  2F8N H;  2DF4 C;  2NQB D;  3MNN A;  5AVC C;  3WTP A;  5CPJ A;  2ARO D;  3VH6 T;  1KX4 A;  3W99 C;  3C1B A;  5B1L C;  4YM6 B;  3X1T B;  3AZE A;  3B6G B;  4J8U A;  5BNV B;  3O62 C;  5JRG B;  3UTB D;  5GT0 B;  5AV5 C;  5B0Y B;  2CV5 B;  4LD9 A;  4CSR B;  1P34 B;  2BYK A;  4UUZ B;  3MGQ D;  2VQR A;  5CP6 B;  3KWQ D;  2FJ7 A;  3WAA D;  3LEL A;  5GT3 B;  5B24 D;  5B31 G;  3REL B;  2ZM5 A;  5AV8 C;  5GXQ B;  4KHA B;  4J8V B;  4WU8 B;  5B2J A;  1P3M D;  4KUD D;  2L5A A;  3P5J B;  3X1T C;  3KXB D;  1M19 D;  1ZLA D;  3MVD C;  1P3K C;  3REK D;  1U35 B;  3B6F D;  2FFF B;  3AV2 B;  5AV9 A;  5E5A D;  4NE5 A;  4JJN D;  3AZG A;  1P3P D;  5CHL B;  3LJA B;  1P3A A;  1P3F A;  4J8V C;  3B0D C;  3VH6 A;  3LZ1 C;  2JCH A;  3AYW D;  4QLC D;  5DNM B;  3AFA A;  5C3I C;  4H9O A;  5B1L A;  4XUJ C;  1S32 D;  4KGC A;  4WNN B;  1H3O A;  3REI D;  5B0Z C;  5CPI C;  3A6N D;  1R4V A;  4CAY A;  3AV2 C;  4R8P C;  5B1M D;  3X1U A;  4XZQ A;  1P3L D;  3REJ D;  3W99 D;  3VH5 W;  3H0M C;  3X1V C;  1B6W A;  4Z5T D;  3UTB B;  3O62 D;  3MNN B;  5B40 C;  3AZI D;  2HIO C;  5B31 D;  5CPJ B;  3MGQ B;  3KWQ B;  3WKJ C;  3KUY C;  5G49 B;  2Y2N A;  4YM6 A;  3X1T A;  3B6G A;  5JA4 B;  5BNV A;  5JRG A;  3W97 C;  5GT0 A;  2NQB C;  4X23 B;  5B0Y A;  2CV5 A;  4CSR A;  1P3I D;  1P34 A;  3UT9 B;  4UUZ A;  2ARO C;  3MGR C;  1F66 C;  5CP6 A;  3TU4 D;  1M19 B;  5GT3 A;  4Z2M G;  3REL A;  1ZLA B;  2PYO D;  3MVD D;  5GXQ A;  4KHA A;  4J8V A;  1BH9 B;  2IO5 C;  5E5A B;  2Y2H A;  3EPL A;  1HQ3 C;  4WU8 A;  2F8N D;  5BNX B;  3WAA C;  5B24 C;  3VH5 T;  4Z66 D;  5CPK D;  4XUJ A;  1P3B D;  2LY8 A;  5B32 D;  3B0B A;  4YS3 D;  5DNN B;  4H9N B;  1U35 A;  3AZK B;  3AZL D;  4R8P A;  3AYW B;  4J8W D;  3AV2 A;  1P3M C;  4WV4 B;  3W98 B;  4KUD C;  1P3O C;  2Y2L A;  3KXB C;  3KFU G;  2Y2G A;  3AV1 C;  2F2A C;  3LJA A;  3REI B;  1P3A B;  4HGA C;  5B0Z D;  3REK C;  4J8X D;  5AVC B;  3B6F C;  4JJN C;  5DNM A;  3W99 B;  5B1L B;  1P3P C;  5AV6 D;  1TZY D;  1ID3 D;  3O62 B;  3UTA D;  4WNN A;  5AV5 B;  2J8P A;  2NQB A;  2HUE C;  2JSS A;  2HIO D;  3C1C D;  4QLC C;  3X1S C;  4EO5 C;  1S32 C;  3UTB A;  5AV8 B;  3A6N C;  2RVQ C;  1KX5 D;  2F8N K;  3W96 D;  5B1M C;  3MGR D;  3MGQ A;  3KWQ A;  1F66 D;  3VH5 A;  1P3L C;  3REJ C;  4Z5T C;  5G49 A;  5B2I D;  5B24 A;  1M18 C;  5JA4 A;  3MVD B;  1B67 A;  1P3K B;  4X23 A;  5BS7 A;  3AZI C;  1WWS A;  3AN2 D;  5B31 C;  3UT9 A;  3NQJ B;  3WTP E; 
#chains in the Genus database with same CATH homology
 1M1A D;  1AOI C;  3A1I A;  1HQ3 D;  1P3M A;  2F8N B;  2Y2M A;  3KXB A;  1M19 A;  1KU5 A;  2YFV B;  1ZLA A;  1P3I C;  3B0D B;  3REK A;  3V9R B;  3LZ1 B;  1BH9 A;  1KX3 C;  5E5A A;  3R45 B;  5BNX A;  5C3I B;  3MGP C;  3TU4 C;  1P3O D;  4XUJ B;  3AV1 D;  2ZY2 A;  2PYO C;  5B0Z B;  5CPI B;  5GSU C;  2CWE A;  5DNN A;  4H9N A;  1EQZ C;  4R8P B;  3AZK A;  1A7W A;  3AYW A;  3W98 A;  4DRA A;  3AZE D;  3X1V B;  4Z66 C;  4J8U D;  2UWX A;  5CPK C;  4Z2M H;  1P3B C;  4WJ3 C;  5B32 C;  4ZBJ C;  3REI A;  4LD9 D;  4H9S C;  4YS3 C;  5B40 B;  2HIO B;  4H9Q B;  5AVC A;  3AZL C;  4J8W C;  3REH C;  3WKJ B;  1JFI B;  3X1S D;  3KUY B;  3W99 A;  3LEL D;  2DQN C;  3EG5 B;  3O62 A;  3W97 B;  5AV5 A;  5B33 C;  2NQB B;  2NZD C;  4J8X C;  2RVQ D;  3AZI A;  2ARO B;  3MGR B;  1ULY A;  3A1K A;  1F66 B;  2YFW B;  5AY8 C;  5AV6 C;  1TZY C;  1ID3 C;  3LZ0 C;  3UTA C;  1M18 D;  3WA9 D;  4H9P A;  4G92 C;  2JE5 A;  4UPK A;  5AV8 A;  4AWL C;  1P3I A;  2IO5 B;  5AV9 D;  3C1C C;  1HQ3 B;  1AOI D;  3AZG D;  1W2E A;  3WAA B;  5B24 B;  1P3G C;  3MVD A;  1P3K A;  3W96 C;  1KX5 C;  3NQJ A;  3AZM D;  1P3M B;  1KX3 D;  4KUD B;  2BG1 A;  2F8N A;  1P3O B;  3MGP D;  3KXB B;  5B2I C;  2Y2O A;  1Q9C A;  3AV1 B;  5CPK A;  3NQU B;  2YFV A;  5B32 A;  4HGA B;  4M6B A;  4H9S A;  4ZUX C;  3REK B;  3AN2 C;  3B6F B;  5GSU D;  1EQZ D;  3V9R A;  3LZ1 A;  3AZL A;  1M1A C;  5KDM B;  4JJN B;  3R45 A;  5FUG B;  1P3P B;  4WU9 D;  2Y2Q A;  4NE6 A;  3AZH C;  5F99 C;  2XD1 A;  3MGS C;  3AZJ C;  2HUE B;  5B0Z A;  5CPI A;  3AZF D;  3AZN C;  4DQY B;  3REH D;  4QLC B;  3X1S B;  4EO5 B;  4G91 C;  3X1V A;  1S32 B;  1ID3 A;  3UTA A;  5AVB C;  5BT1 C;  5B0Y D;  5B33 D;  3A6N B;  2CV5 D;  2NZD D;  5B40 A;  4E44 A;  3WTP C;  1P34 D;  2HIO A;  4H9Q A;  5B1M B;  3WKJ A;  1P3L B;  3REJ B;  5AY8 D;  3C1B C;  1JFI A;  3AZE C;  3KUY A;  4Z5T B;  4J8U C;  5GT3 D;  2ZY3 A;  1M18 B;  3LZ0 D;  3WA9 B;  4LD9 C;  3W97 A;  3AZI B;  1KX5 A;  5B31 B;  2ARO A;  3MGR A;  1AOI B;  1F66 A;  2YFW A;  2FJ7 C;  3LEL C;  5B2I A;  1BH8 B;  1PZR A;  4H9P B;  1P3G D;  1P3I B;  1U35 D;  2G5H C;  1KX3 B;  5B2J C;  1HQ3 A;  3B0C W;  3MGP B;  3TU4 B;  3WAA A;  3WA9 C;  1N1J B;  2ZY4 A;  2PYO B;  5GSU B;  4ZUX D;  1EQZ B;  2Y2P A;  5AV9 C;  3AZG C;  4KUD A;  5DNM D;  2Y2K A;  1P3O A;  1TAF B;  4Z66 B;  5CPK B;  4NFT A;  3AZH D;  1P3B B;  3AV1 A;  3NQU A;  5F99 D;  5B32 B;  4ZBJ B;  3MGS D;  3AZJ D;  1P3F C;  4YS3 B;  2BYM B;  3F6T A;  3AZF B;  4NE3 A;  3B6F A;  3AZL B;  3AZN D;  4J8W B;  3REH B;  3AZM C;  5KDM A;  4JJN A;  3AFA C;  5FUG A;  1P3P A;  4KGC C;  5AVB D;  3H0L C;  5BT1 D;  5B33 B;  3MNN D;  2NZD B;  4J8X B;  5BO0 B;  3WTP D;  3X1U C;  5CPJ D;  4XZQ C;  1WWI A;  4QLC A;  5AY8 B;  3X1S A;  1KX4 D;  3C1B D;  5AV6 B;  3B0C T;  4WU9 C;  1TZY B;  1ID3 B;  3LZ0 B;  3UTA B;  1S32 A;  4G92 B;  4X23 D;  3AZF C;  3A6N A;  4AWL B;  3H0R C;  3UT9 D;  5B1M A;  3C1C B;  1P3L A;  3REJ A;  2FJ7 D;  4YM6 C;  2RIQ A;  3B6G C;  4Z5T A;  1M18 A;  3WA9 A;  5JRG C;  5GT0 C;  1P3G B;  5B0Y C;  2CV5 C;  1KX5 B;  1HTA A;  1P34 C;  3W96 B;  5B31 A;  5CP6 C;  5B2J D;  1AOI A;  4WZS B;  5GT3 C;  5B2I B;  3REL C;  1BH8 A;  2F8N G;  4H9R B;  5GXQ C;  4ZUX B;  3AN2 B;  5DNN D;  3AZK D;  1M1A B;  3AZM A;  4WU8 C;  1KX3 A;  5B32 G;  3W98 D;  3EPJ A;  3MGP A;  3TU4 A;  3AZH B;  4DRB A;  5F99 B;  3MGS B;  3AZJ B;  1N1J A;  1P3A D;  1P3F D;  2PYO A;  1U35 C;  5GSU A;  5AVC D;  3AZN B;  1EQZ A;  3AFA D;  1T3U A;  4G91 B;  5B1L D;  4WU9 A;  1TAF A;  4Z66 A;  4KGC D;  5AVB B;  3LJA C;  1P3B A;  5AV5 D;  4YS3 A;  2BYM A;  3AZF A;  3WTP B;  3X1U D;  4J8W A;  3REH A;  4XZQ D;  1KX4 B;  5DNM C;  3C1B B;  3AZE B;  4J8U B;  4LD9 B;  3AL0 C;  3FDD A;  5AV8 D;  5B33 A;  2NZD A;  2BYK B;  4J8X A;  5BO0 A;  3KSY A;  2FJ7 B;  5AY8 A;  3LEL B;  4YM6 D;  5AV6 A;  3X1T D;  1TZY A;  3B6G D;  3LZ0 A;  3UTB C;  2XD5 A;  5JRG D;  5GT0 D;  3MNN C;  1P3K D;  3EPH A;  3IP4 C;  5CPJ C;  3MGQ C;  3KWQ C;  5B2J B;  3C1C A;  2Y2J A;  5CP6 D;  1KX4 C;  3REL D;  4X23 C;  5BS7 C;  1P3G A;  5GXQ D;  3W96 A;  4J8V D;  3UT9 C;  5AV9 B;  3LZ1 D;  2ZY5 A;  3AZG B;  2G5I C;  3VH6 W;  4WU8 D;  1M19 C;  4XUJ D;  1ZLA C;  1P3F B;  1F1E A;  5CPI D;  4H9R A;  4ZUX A;  3AN2 A;  2Y2I A;  3AV2 D;  5E5A C;  4R8P D;  3AZM B;  1M1A A;  3AFA B;  4H9O B;  3X1V D;  4KGC B;  3AZH A;  1H3O B;  5F99 A;  3LJA D;  3MGS A;  3AZJ A;  1Z2C B;  4E45 A;  5DNN C;  5B40 D;  4CAY B;  1BFM A;  3AZN A;  3X1U B;  3AZK C;  3AYW C;  3WKJ D;  4XZQ B;  3W98 C;  3KUY D;  4WU9 B;  2W8S A;  5AVB A;  3REI C;  1P3A C;  3EPK A;  3W97 D;  2F8N H;  2DF4 C;  2NQB D;  3MNN A;  5AVC C;  3WTP A;  5CPJ A;  2ARO D;  3VH6 T;  1KX4 A;  3W99 C;  3C1B A;  5B1L C;  4YM6 B;  3X1T B;  3AZE A;  3B6G B;  4J8U A;  5BNV B;  3O62 C;  5JRG B;  3UTB D;  5GT0 B;  5AV5 C;  5B0Y B;  2CV5 B;  4LD9 A;  4CSR B;  1P34 B;  2BYK A;  4UUZ B;  3MGQ D;  2VQR A;  5CP6 B;  3KWQ D;  2FJ7 A;  3WAA D;  3LEL A;  5GT3 B;  5B24 D;  5B31 G;  3REL B;  2ZM5 A;  5AV8 C;  5GXQ B;  4KHA B;  4J8V B;  4WU8 B;  5B2J A;  1P3M D;  4KUD D;  2L5A A;  3P5J B;  3X1T C;  3KXB D;  1M19 D;  1ZLA D;  3MVD C;  1P3K C;  3REK D;  1U35 B;  3B6F D;  2FFF B;  3AV2 B;  5AV9 A;  5E5A D;  4NE5 A;  4JJN D;  3AZG A;  1P3P D;  5CHL B;  3LJA B;  1P3A A;  1P3F A;  4J8V C;  3B0D C;  3VH6 A;  3LZ1 C;  2JCH A;  3AYW D;  4QLC D;  5DNM B;  3AFA A;  5C3I C;  4H9O A;  5B1L A;  4XUJ C;  1S32 D;  4KGC A;  4WNN B;  1H3O A;  3REI D;  5B0Z C;  5CPI C;  3A6N D;  1R4V A;  4CAY A;  3AV2 C;  4R8P C;  5B1M D;  3X1U A;  4XZQ A;  1P3L D;  3REJ D;  3W99 D;  3VH5 W;  3H0M C;  3X1V C;  1B6W A;  4Z5T D;  3UTB B;  3O62 D;  3MNN B;  5B40 C;  3AZI D;  2HIO C;  5B31 D;  5CPJ B;  3MGQ B;  3KWQ B;  3WKJ C;  3KUY C;  5G49 B;  2Y2N A;  4YM6 A;  3X1T A;  3B6G A;  5JA4 B;  5BNV A;  5JRG A;  3W97 C;  5GT0 A;  2NQB C;  4X23 B;  5B0Y A;  2CV5 A;  4CSR A;  1P3I D;  1P34 A;  3UT9 B;  4UUZ A;  2ARO C;  3MGR C;  1F66 C;  5CP6 A;  3TU4 D;  1M19 B;  5GT3 A;  4Z2M G;  3REL A;  1ZLA B;  2PYO D;  3MVD D;  5GXQ A;  4KHA A;  4J8V A;  1BH9 B;  2IO5 C;  5E5A B;  2Y2H A;  3EPL A;  1HQ3 C;  4WU8 A;  2F8N D;  5BNX B;  3WAA C;  5B24 C;  3VH5 T;  4Z66 D;  5CPK D;  4XUJ A;  1P3B D;  2LY8 A;  5B32 D;  3B0B A;  4YS3 D;  5DNN B;  4H9N B;  1U35 A;  3AZK B;  3AZL D;  4R8P A;  3AYW B;  4J8W D;  3AV2 A;  1P3M C;  4WV4 B;  3W98 B;  4KUD C;  1P3O C;  2Y2L A;  3KXB C;  3KFU G;  2Y2G A;  3AV1 C;  2F2A C;  3LJA A;  3REI B;  1P3A B;  4HGA C;  5B0Z D;  3REK C;  4J8X D;  5AVC B;  3B6F C;  4JJN C;  5DNM A;  3W99 B;  5B1L B;  1P3P C;  5AV6 D;  1TZY D;  1ID3 D;  3O62 B;  3UTA D;  4WNN A;  5AV5 B;  2J8P A;  2NQB A;  2HUE C;  2JSS A;  2HIO D;  3C1C D;  4QLC C;  3X1S C;  4EO5 C;  1S32 C;  3UTB A;  5AV8 B;  3A6N C;  2RVQ C;  1KX5 D;  2F8N K;  3W96 D;  5B1M C;  3MGR D;  3MGQ A;  3KWQ A;  1F66 D;  3VH5 A;  1P3L C;  3REJ C;  4Z5T C;  5G49 A;  5B2I D;  5B24 A;  1M18 C;  5JA4 A;  3MVD B;  1B67 A;  1P3K B;  4X23 A;  5BS7 A;  3AZI C;  1WWS A;  3AN2 D;  5B31 C;  3UT9 A;  3NQJ B;  3WTP E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...