4G91C

Ccaat-binding complex from aspergillus nidulans
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
117
structure length
117
Chain Sequence
GTWANVNQGLQGTARDILTTYWQHVINHLESDNHDYKIHQLPLARIKKVMKADPEVKMISAEAPILFAKGCDVFITELTMRAWIHAEDNKRRTLQRSDIAAALSKSDMFDFLIDIVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HAPB protein
publication title DNA Minor Groove Sensing and Widening by the CCAAT-Binding Complex.
pubmed doi rcsb
source organism Emericella nidulans
molecule tags Transcription
total genus 39
structure length 117
sequence length 117
ec nomenclature
pdb deposition date 2012-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00808 CBFD_NFYB_HMF Histone-like transcription factor (CBF/NF-Y) and archaeal histone
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4g91C00
3WKJC 2AROA 5GT3C 4J8VC 1P3LC 3MNND 5GXQC 3LZ0A 3KXBD 2F8NB 3LZ0D 5JA4A 5DNMA 1KX5C 4DRAA 3AZIC 2AROB 3KUYC 3MNNB 3MGSD 3LZ0B 1BH8A 4WZSB 5B1LD 3REHD 1P3BD 1KX3D 2NZDA 5KDMA 2NZDD 1BH8B 3AZKC 4EO5C 3C1BD 1HTAA 2NZDB 5JRGA 5KDMB 5GT0D 3LJAA 2AROC 3VH6T 5B32G 1KU5A 4WU8A 5CPKC 5BS7C 4WU8D 3W99A 4H9PA 1AOIA 1P3FA 4KUDC 4ZBJB 5DNMC 5JRGB 2L5AA 5AVCA 3LJAB 4WU8B 1F1EA 3W99B 4H9PB 3WTPD 3WA9A 1P3FB 2FJ7A 3B0BA 3W97A 5AVCB 3V9RA 3MGPD 5CPIA 2PYOC 3MGQD 3WA9B 4JJND 3MGRA 2F8NK 1M19A 4ZUXA 3WTPE 4ZUXD 3W97B 1H3OB 3V9RB 5CPJA 5CPIB 3VH6A 4JJNB 5JRGC 3MGRB 5AV5D 5B24A 2HUEC 5BO0A 5B2JA 3LJAC 1M19B 4ZUXB 3W99C 1AOIC 5CPJB 2HIOA 5B32A 5AV5B 5BT1C 5B24B 5BO0B 5B2JB 3C1CA 5B31D 1U35A 3X1SD 3WA9C 4WNNA 2FJ7C 2HIOB 5B32B 5B40D 1M18A 3W97C 5AY8D 5B31B 5CPIC 1U35B 1S32C 5AV9A 3MGRC 4WNNB 3UTAA 1ZLAD 1F66D 1M19C 5B40B 3AZND 1N1JA 1HQ3D 5AY8B 1TAFA 5B0YD 5CPJC 3UT9A 5B33D 5CP6A 5AV9B 5B24C 5B2JC 4YM6D 1N1JB 1HQ3B 1P3AD 5B0YB 3AZMC 3AN2A 1P3OC 3AZJD 5B33B 2HIOC 5B32C 4J8XA 3UT9B 1P3GA 5CP6B 3C1CC 2RVQC 3TU4D 5B2ID 1U35C 5B1MC 3AN2B 3AZJB 1P3GB 4J8XB 1M18C 3TU4B 5AV6C 4LD9D 3AV2D 3X1VA 3MVDD 4Z5TC 2CV5A 5AV9C 3AZEC 4G92B 3UTAC 3B6FD 4J8WA 5GSUD 3A6NA 4LD9B 3A6ND 1KX4A 3REIC 1M1AA 1ID3C 1M1AD 3UT9C 2CV5B 5CP6C 3AV1D 4J8WB 4G91B 3A6NB 1KX4B 3AN2C 1M1AB 3B0CW 3AZLA 4J8XC 1P3GC 3B6GD 3AZLD 5BNVA 4R8PD 4Z66A 5F99A 3O62A 3O62D 3AZFC 4G92C 3AZLB 3LELA 3LELD 5BNVB 2BYMA 3MNNA 3KXBA 1P3KD 4Z66B 5F99B 3X1VC 3O62B 2CV5C 3LELB 4J8WC 3AZHA 3MGSA 3AZHD 2BYMB 3KXBB 4AWLB 3AZKD 3AZHB 5B1LA 3REHA 2IO5B 3MGSB 3UTBA 1P3BA 1KX3A 3UTBD 4NE6A 5AV8D 3X1TD 4WU9D 2NQBD 4H9NA 5CPKD 5B1LB 3REHB 3UTBB 5C3IB 5F99C 4Z66C 3C1BA 1P3BB 1KX3B 5GT0A 4X23A 4H9NB 4YS3D 2BYKA 4X23D 3W98A 3MNNC 3AZGD 3W98D 4KHAA 3KXBC 3LZ0C 3C1BB 5B31G 5GT0B 3X1UA 4X23B 3B0CT 2BYKB 2IO5C 3X1UD 3MGSC 3WTPA 3W98B 4KHAB 1TZYD 3X1UB 4NFTA 1P34A 1H3OA 5B1LC 3MGPA 5C3IC 3REHC 3WTPB 3MGQA 1P34D 4JJNA 1KX3C 2NZDC 3RELD 4KGCD 3VH5W 5E5AD 3REJD 1P34B 3AFAD 3MGPB 3C1BC 3MGQB 4ZBJC 5AV5A 5GT0C 4XUJD 4WU8C 4H9SA 4E45A 5AVBD 1P3FC 4CAYA 4J8UD 1B67A 4XUJB 5AVCC 1R4VA 5B31A 3X1SA 5CHLB 1S32D 4CAYB 5B40A 2YFVB 5B0ZA 5B0ZD 5AY8A 4H9QA 3X1SB 3MGQC 4JJNC 1ZLAA 1F66A 3AZNA 4ZUXC 3NQJB 5B0ZB 1HQ3A 4NE5A 1P3PA 5B0YA 1P3PD 4H9QB 1P3MD 5B33A 5AV5C 1ZLAB 1F66B 3WAAD 4YM6A 3AZNB 1P3AA 4H9SC 1P3PB 3KWQA 3AZJA 3KWQD 3R45A 1EQZA 1EQZD 4YM6B 5G49A 3TU4A 5B2IA 3REKD 5B31C 1P3AB 5AV6D 3X1SC 3KWQB 3W96D 5DNND 3R45B 5B40C 1EQZB 3LZ1D 4LD9A 5G49B 5AY8C 5B2IB 3AV2A 3MVDA 1ZLAC 1F66C 3B6FA 5GSUA 1JFIB 1HQ3C 3AYWD 5B0YC 3AV2B 2JSSA 3MVDB 5B33C 3AV1A 3B6FB 1P3ID 5GSUB 4XZQD 3AZJC 3B6GA 4QLCD 3AZFD 5GT3A 3AV1B 3WKJD 4R8PA 5GT3D 3TU4C 4J8VD 1P3LD 4XZQB 3B0DB 3KSYA 5GXQD 3B6GB 3AZIA 1KX5D 5GT3B 3AZID 4R8PB 4LD9C 3KUYD 1P3KA 1P3LB 3AV2C 5GXQB 3MVDC 1WWSA 3B6FC 5GSUC 1BFMA 3AZIB 4G91C 3A6NC 1KX4C 1P3KB 1M1AC 3AV1C 3AZKA 4UUZA 5FUGA 4WV4B 3B0DC 5AV8A 3X1TA 4WU9A 2F8ND 3B6GC 2NQBA 3AZLC 4R8PC 2AROD 3AZKB 4UUZB 5BS7A 5CPKA 5FUGB 3O62C 4KUDA 5AV8B 4E44A 4EO5B 1A7WA 3X1TB 4WU9B 4KUDD 5DNMD 2NQBB 4YS3A 3LELC 3AZGA 5CPKB 1P3KC 4AWLC 4KUDB 5JA4B 5DNMB 4HGAB 4YS3B 3AZHC 3AZGB 2PYOA 2PYOD 1TZYA 3UTBC 1P3BC 5AV8C 2PYOB 3X1TC 4WU9C 3RELA 1TZYB 2NQBC 5JRGD 4KGCA 5E5AA 1BH9A 3LJAD 3REJA 3AFAA 3W99D 1AOID 1P3FD 4KGCB 3RELB 4HGAC 2HUEB 4XUJA 5BT1D 4YS3C 4X23C 5E5AB 3AZGC 3W98C 1BH9B 5AVCD 3REJB 4H9RA 3AFAB 5AVBA 1AOIB 3WA9D 4J8UA 2YFVA 4CSRA 2FJ7D 3X1UC 3W97D 3WTPC 4H9RB 5AVBB 1S32A 5CPID 1TZYC 2FJ7B 3MGRD 4J8UB 4CSRB 3NQJA 1M19D 1P34C 3MGPC 5CPJD 1S32B 3RELC 4KGCC 5B24D 5E5AC 5B2JD 3REJC 3AFAC 1P3MA 3AZMA 1P3OA 3AZMD 1P3OD 3WAAA 2HIOD 5B32D 4XUJC 3C1CD 2RVQD 2F8NH 4Z2MH 5B1MA 1P3MB 5AVBC 1U35D 5B1MD 3AZMB 1P3OB 4NE3A 4J8UC 3WAAB 3REKA 5AV6A 3C1CB 1M18D 3W96A 5B1MB 3VH5T 5DNNA 4Z5TA 3AZEA 4Z5TD 5AV9D 2YFWA 3AZED 4DRBA 3LZ1A 3UTAD 5B0ZC 1JFIA 4H9OA 3REKB 1M18B 5AV6B 3REIA 1WWIA 3REID 1ID3A 3W96B 5DNNB 4Z5TB 1ID3D 3AZEB 3UT9D 1ULYA 5CP6D 2YFWB 3UTAB 3AZNC 3LZ1B 3AYWA 4H9OB 1P3PC 1P3MC 3REIB 1TAFB 3AN2D 1ID3B 3WAAC 2F8NG 4Z2MG 4M6BA 4J8XD 4YM6C 1P3GD 1P3IA 5BNXA 1P3AC 3AYWB 4XZQA 3KWQC 4QLCA 3AZFA 1EQZC 3WKJA 1P3IB 3VH5A 4J8VA 3REKC 5BNXB 1P3LA 5B2IC 5GXQA 2LY8A 3NQUA 3W96C 5DNNC 3X1VD 4QLCB 2CV5D 3AZFB 1KX5A 1B6WA 3LZ1C 3WKJB 3KUYA 4J8WD 4J8VB 1KX4D 1Q9CA 3VH6W 3NQUB 3X1VB 1KX5B 3KUYB 3AYWC 2CWEA 1P3IC 4XZQC 2F8NA 4Z66D 5F99D 4QLCC
chains in the Genus database with same CATH superfamily
3WKJC 2AROA 5GT3C 4J8VC 1P3LC 3MNND 5GXQC 3LZ0A 3KXBD 2F8NB 3LZ0D 5JA4A 5DNMA 1KX5C 4DRAA 3AZIC 2AROB 3KUYC 3MNNB 3MGSD 3LZ0B 4WJ3C 1BH8A 4WZSB 5B1LD 3REHD 1P3BD 1KX3D 2NZDA 5KDMA 2NZDD 1BH8B 3AZKC 4EO5C 3C1BD 1HTAA 2NZDB 5JRGA 5KDMB 1PZRA 5GT0D 2AROC 3VH6T 3LJAA 5B32G 1KU5A 4WU8A 5CPKC 5BS7C 4WU8D 3W99A 4H9PA 1AOIA 1P3FA 4KUDC 4ZBJB 5DNMC 2Y2NA 5JRGB 2L5AA 5AVCA 3LJAB 4WU8B 1F1EA 3W99B 4H9PB 3WTPD 3WA9A 1P3FB 2FJ7A 3A1IA 3B0BA 3W97A 5AVCB 3V9RA 3MGPD 5CPIA 2PYOC 3MGQD 3WA9B 4JJND 3FDDA 3MGRA 2F8NK 1M19A 4ZUXA 3WTPE 4ZUXD 2JE5A 3W97B 1H3OB 3V9RB 5CPJA 5CPIB 3VH6A 4JJNB 5JRGC 3MGRB 5AV5D 5B24A 2HUEC 5BO0A 5B2JA 3LJAC 1M19B 4ZUXB 3W99C 1AOIC 5CPJB 2HIOA 5B32A 2VQRA 5AV5B 5BT1C 5B24B 5BO0B 5B2JB 3C1CA 3IP4C 5B31D 1U35A 3X1SD 3WA9C 4WNNA 2FJ7C 2HIOB 5B32B 5B40D 2ZY5A 1M18A 3W97C 5AY8D 5B31B 5CPIC 1U35B 1S32C 5AV9A 3MGRC 4WNNB 3UTAA 1ZLAD 1F66D 1M19C 5B40B 3AZND 1N1JA 1HQ3D 5AY8B 1TAFA 5B0YD 5CPJC 3UT9A 5B33D 2JCHA 5AV9B 5CP6A 5B24C 5B2JC 4YM6D 1N1JB 1HQ3B 3EG5B 1P3AD 5B0YB 3AZMC 3AN2A 1P3OC 3AZJD 5B33B 2HIOC 2Y2QA 5B32C 4J8XA 3UT9B 1P3GA 5CP6B 3C1CC 2RVQC 3TU4D 5B2ID 1U35C 5B1MC 3AN2B 3AZJB 1P3GB 4J8XB 1M18C 3TU4B 5AV6C 4LD9D 3AV2D 3X1VA 3MVDD 4Z5TC 2CV5A 5AV9C 3AZEC 4G92B 3UTAC 3B6FD 4J8WA 5GSUD 3A6NA 4LD9B 3A6ND 1KX4A 3REIC 1M1AA 1ID3C 1M1AD 3UT9C 2CV5B 5CP6C 3AV1D 4J8WB 4G91B 3A6NB 1KX4B 3AN2C 1M1AB 3B0CW 3AZLA 4J8XC 1P3GC 3B6GD 3AZLD 5BNVA 4R8PD 4Z66A 5F99A 3O62A 3O62D 3AZFC 4G92C 3AZLB 2Y2LA 3LELA 3LELD 5BNVB 2BYMA 3MNNA 3KXBA 1P3KD 4Z66B 5F99B 3X1VC 3O62B 2CV5C 3LELB 4J8WC 3AZHA 3MGSA 3AZHD 2BYMB 3KXBB 4AWLB 2G5IC 3AZKD 2Y2OA 3AZHB 5B1LA 3REHA 2IO5B 3MGSB 3UTBA 1P3BA 1KX3A 3UTBD 4NE6A 2W8SA 5AV8D 3X1TD 4WU9D 2NQBD 4H9NA 5CPKD 5B1LB 3REHB 3UTBB 5C3IB 5F99C 4Z66C 3C1BA 1P3BB 1KX3B 5GT0A 4X23A 4H9NB 2BYKA 4YS3D 4X23D 3W98A 3MNNC 3AZGD 3W98D 2F2AC 4KHAA 3KXBC 3LZ0C 3C1BB 5B31G 5GT0B 3X1UA 4X23B 3B0CT 2BYKB 2IO5C 3X1UD 3MGSC 3WTPA 3W98B 4KHAB 2FFFB 1TZYD 2Y2HA 3X1UB 4NFTA 1P34A 1H3OA 5B1LC 3MGPA 5C3IC 3REHC 3WTPB 3MGQA 1P34D 4JJNA 1KX3C 2NZDC 3RELD 4KGCD 3VH5W 5E5AD 3REJD 1P34B 3AFAD 3MGPB 3C1BC 3MGQB 4ZBJC 5AV5A 5GT0C 2ZY3A 4XUJD 4WU8C 4H9SA 4E45A 5AVBD 1P3FC 4CAYA 4J8UD 1B67A 2UWXA 4XUJB 5AVCC 1R4VA 5B31A 3X1SA 5CHLB 1S32D 4CAYB 5B40A 2YFVB 5B0ZA 5B0ZD 1W2EA 5AY8A 4H9QA 2Y2KA 3X1SB 3MGQC 2XD1A 4JJNC 1ZLAA 1F66A 3AZNA 4ZUXC 3NQJB 5B0ZB 1HQ3A 4NE5A 1P3PA 3KFUG 5B0YA 1P3PD 4H9QB 1P3MD 3P5JB 5B33A 5AV5C 3EPJA 1ZLAB 1F66B 3WAAD 4YM6A 3AZNB 1P3AA 4H9SC 3EPHA 1P3PB 3KWQA 3AZJA 3KWQD 3R45A 1EQZA 1EQZD 4YM6B 5G49A 3TU4A 5B2IA 3REKD 5B31C 1P3AB 5AV6D 3X1SC 3KWQB 3W96D 5DNND 3R45B 5B40C 4UPKA 1EQZB 3LZ1D 4LD9A 5G49B 5AY8C 5B2IB 3AV2A 3MVDA 1ZLAC 1F66C 3B6FA 5GSUA 1JFIB 1HQ3C 3AYWD 5B0YC 3AV2B 2JSSA 3MVDB 5B33C 3AV1A 3B6FB 1P3ID 5GSUB 4XZQD 3AZJC 3B6GA 4QLCD 3AZFD 3AL0C 2DF4C 5GT3A 3AV1B 4R8PA 3WKJD 5GT3D 2ZM5A 3TU4C 4J8VD 1P3LD 4XZQB 3B0DB 3KSYA 2ZY2A 5GXQD 3B6GB 3AZIA 1KX5D 5GT3B 3AZID 4R8PB 2Y2PA 3EPLA 3KUYD 4LD9C 1P3KA 2RIQA 1P3LB 3AV2C 5GXQB 3MVDC 1WWSA 3B6FC 5GSUC 1BFMA 3AZIB 4G91C 3A6NC 1KX4C 1P3KB 1M1AC 3AV1C 3AZKA 4UUZA 5FUGA 4WV4B 3B0DC 5AV8A 3X1TA 4WU9A 2F8ND 3B6GC 2NQBA 3AZLC 4R8PC 2AROD 3AZKB 4UUZB 5BS7A 5CPKA 5FUGB 3O62C 4KUDA 5AV8B 4E44A 4EO5B 1A7WA 2G5HC 3X1TB 4WU9B 4KUDD 3H0RC 5DNMD 2NQBB 4YS3A 3LELC 3H0LC 3AZGA 5CPKB 1P3KC 3A1KA 4AWLC 4KUDB 5JA4B 5DNMB 2Y2IA 4HGAB 4YS3B 3AZHC 3AZGB 2PYOA 2PYOD 1TZYA 3UTBC 1P3BC 5AV8C 2PYOB 3X1TC 4WU9C 3RELA 1TZYB 2NQBC 5JRGD 4KGCA 5E5AA 1BH9A 3LJAD 3REJA 3AFAA 3W99D 1Z2CB 1AOID 1P3FD 4KGCB 3RELB 4HGAC 2HUEB 4XUJA 5BT1D 4YS3C 4X23C 5E5AB 3AZGC 3W98C 1BH9B 5AVCD 3REJB 4H9RA 3AFAB 5AVBA 1AOIB 3WA9D 4J8UA 3F6TA 2YFVA 4CSRA 2FJ7D 3X1UC 3W97D 3WTPC 4H9RB 5AVBB 1S32A 5CPID 1TZYC 2FJ7B 3MGRD 4J8UB 4CSRB 3NQJA 1M19D 1P34C 2DQNC 3MGPC 5CPJD 1S32B 3RELC 4KGCC 5B24D 5E5AC 5B2JD 3REJC 3AFAC 1P3MA 3AZMA 1P3OA 3AZMD 1P3OD 3WAAA 2HIOD 5B32D 3H0MC 4XUJC 3C1CD 2RVQD 2F8NH 4Z2MH 5B1MA 1P3MB 5AVBC 1U35D 5B1MD 3AZMB 1P3OB 4NE3A 4J8UC 3WAAB 3REKA 5AV6A 3C1CB 1M18D 3W96A 5B1MB 3VH5T 5DNNA 4Z5TA 3AZEA 4Z5TD 5AV9D 2Y2MA 2YFWA 4DRBA 3LZ1A 3UTAD 5B0ZC 3AZED 1JFIA 4H9OA 3REKB 1M18B 5AV6B 3REIA 1WWIA 3REID 2Y2GA 1ID3A 3W96B 5DNNB 4Z5TB 1ID3D 3AZEB 3UT9D 1ULYA 5CP6D 2YFWB 3UTAB 3AZNC 3LZ1B 3AYWA 4H9OB 3EPKA 1P3MC 1P3PC 4DQYB 3REIB 1TAFB 3AN2D 1ID3B 3WAAC 2F8NG 4Z2MG 4M6BA 4J8XD 4YM6C 1P3GD 1P3IA 5BNXA 1P3AC 3AYWB 4XZQA 3KWQC 4QLCA 3AZFA 1EQZC 3WKJA 1P3IB 3VH5A 4J8VA 2Y2JA 5BNXB 3REKC 5B2IC 1P3LA 1T3UA 5GXQA 2J8PA 2LY8A 3NQUA 3W96C 5DNNC 3X1VD 4QLCB 2CV5D 3AZFB 1KX5A 1B6WA 3LZ1C 3WKJB 3KUYA 4J8WD 2ZY4A 4J8VB 2BG1A 1KX4D 1Q9CA 3VH6W 3NQUB 3X1VB 1KX5B 3KUYB 3AYWC 2CWEA 1P3IC 2XD5A 4XZQC 2F8NA 4Z66D 5F99D 4QLCC
chains in the Genus database with same CATH topology
3WKJC 2AROA 5GT3C 4J8VC 1P3LC 3MNND 5GXQC 3LZ0A 3KXBD 2F8NB 3LZ0D 5JA4A 5DNMA 1KX5C 4DRAA 3AZIC 2AROB 3KUYC 3MNNB 3MGSD 3LZ0B 4WJ3C 1BH8A 4WZSB 5B1LD 3REHD 1P3BD 1KX3D 2NZDA 5KDMA 2NZDD 1BH8B 3AZKC 4EO5C 3C1BD 1HTAA 2NZDB 5JRGA 5KDMB 1PZRA 5GT0D 2AROC 3VH6T 3LJAA 5B32G 1KU5A 4WU8A 5CPKC 5BS7C 4WU8D 3W99A 4H9PA 1AOIA 1P3FA 4KUDC 4ZBJB 5DNMC 2Y2NA 5JRGB 2L5AA 5AVCA 3LJAB 4WU8B 1F1EA 3W99B 4H9PB 3WTPD 3WA9A 1P3FB 2FJ7A 3A1IA 3B0BA 3W97A 5AVCB 3V9RA 3MGPD 5CPIA 2PYOC 3MGQD 3WA9B 4JJND 3FDDA 3MGRA 2F8NK 1M19A 4ZUXA 3WTPE 4ZUXD 2JE5A 3W97B 1H3OB 3V9RB 5CPJA 5CPIB 3VH6A 4JJNB 5JRGC 3MGRB 5AV5D 5B24A 2HUEC 5BO0A 5B2JA 3LJAC 1M19B 4ZUXB 3W99C 1AOIC 5CPJB 2HIOA 5B32A 2VQRA 5AV5B 5BT1C 5B24B 5BO0B 5B2JB 3C1CA 3IP4C 5B31D 1U35A 3X1SD 3WA9C 4WNNA 2FJ7C 2HIOB 5B32B 5B40D 2ZY5A 1M18A 3W97C 5AY8D 5B31B 5CPIC 1U35B 1S32C 5AV9A 3MGRC 4WNNB 3UTAA 1ZLAD 1F66D 1M19C 5B40B 3AZND 1N1JA 1HQ3D 5AY8B 1TAFA 5B0YD 5CPJC 3UT9A 5B33D 2JCHA 5AV9B 5CP6A 5B24C 5B2JC 4YM6D 1N1JB 1HQ3B 3EG5B 1P3AD 5B0YB 3AZMC 3AN2A 1P3OC 3AZJD 5B33B 2HIOC 2Y2QA 5B32C 4J8XA 3UT9B 1P3GA 5CP6B 3C1CC 2RVQC 3TU4D 5B2ID 1U35C 5B1MC 3AN2B 3AZJB 1P3GB 4J8XB 1M18C 3TU4B 5AV6C 4LD9D 3AV2D 3X1VA 3MVDD 4Z5TC 2CV5A 5AV9C 3AZEC 4G92B 3UTAC 3B6FD 4J8WA 5GSUD 3A6NA 4LD9B 3A6ND 1KX4A 3REIC 1M1AA 1ID3C 1M1AD 3UT9C 2CV5B 5CP6C 3AV1D 4J8WB 4G91B 3A6NB 1KX4B 3AN2C 1M1AB 3B0CW 3AZLA 4J8XC 1P3GC 3B6GD 3AZLD 5BNVA 4R8PD 4Z66A 5F99A 3O62A 3O62D 3AZFC 4G92C 3AZLB 2Y2LA 3LELA 3LELD 5BNVB 2BYMA 3MNNA 3KXBA 1P3KD 4Z66B 5F99B 3X1VC 3O62B 2CV5C 3LELB 4J8WC 3AZHA 3MGSA 3AZHD 2BYMB 3KXBB 4AWLB 2G5IC 3AZKD 2Y2OA 3AZHB 5B1LA 3REHA 2IO5B 3MGSB 3UTBA 1P3BA 1KX3A 3UTBD 4NE6A 2W8SA 5AV8D 3X1TD 4WU9D 2NQBD 4H9NA 5CPKD 5B1LB 3REHB 3UTBB 5C3IB 5F99C 4Z66C 3C1BA 1P3BB 1KX3B 5GT0A 4X23A 4H9NB 2BYKA 4YS3D 4X23D 3W98A 3MNNC 3AZGD 3W98D 2F2AC 4KHAA 3KXBC 3LZ0C 3C1BB 5B31G 5GT0B 3X1UA 4X23B 3B0CT 2BYKB 2IO5C 3X1UD 3MGSC 3WTPA 3W98B 4KHAB 2FFFB 1TZYD 2Y2HA 3X1UB 4NFTA 1P34A 1H3OA 5B1LC 3MGPA 5C3IC 3REHC 3WTPB 3MGQA 1P34D 4JJNA 1KX3C 2NZDC 3RELD 4KGCD 3VH5W 5E5AD 3REJD 1P34B 3AFAD 3MGPB 3C1BC 3MGQB 4ZBJC 5AV5A 5GT0C 2ZY3A 4XUJD 4WU8C 4H9SA 4E45A 5AVBD 1P3FC 4CAYA 4J8UD 1B67A 2UWXA 4XUJB 5AVCC 1R4VA 5B31A 3X1SA 5CHLB 1S32D 4CAYB 5B40A 2YFVB 5B0ZA 5B0ZD 1W2EA 5AY8A 4H9QA 2Y2KA 3X1SB 3MGQC 2XD1A 4JJNC 1ZLAA 1F66A 3AZNA 4ZUXC 3NQJB 5B0ZB 1HQ3A 4NE5A 1P3PA 3KFUG 5B0YA 1P3PD 4H9QB 1P3MD 3P5JB 5B33A 5AV5C 3EPJA 1ZLAB 1F66B 3WAAD 4YM6A 3AZNB 1P3AA 4H9SC 3EPHA 1P3PB 3KWQA 3AZJA 3KWQD 3R45A 1EQZA 1EQZD 4YM6B 5G49A 3TU4A 5B2IA 3REKD 5B31C 1P3AB 5AV6D 3X1SC 3KWQB 3W96D 5DNND 3R45B 5B40C 4UPKA 1EQZB 3LZ1D 4LD9A 5G49B 5AY8C 5B2IB 3AV2A 3MVDA 1ZLAC 1F66C 3B6FA 5GSUA 1JFIB 1HQ3C 3AYWD 5B0YC 3AV2B 2JSSA 3MVDB 5B33C 3AV1A 3B6FB 1P3ID 5GSUB 4XZQD 3AZJC 3B6GA 4QLCD 3AZFD 3AL0C 2DF4C 5GT3A 3AV1B 4R8PA 3WKJD 5GT3D 2ZM5A 3TU4C 4J8VD 1P3LD 4XZQB 3B0DB 3KSYA 2ZY2A 5GXQD 3B6GB 3AZIA 1KX5D 5GT3B 3AZID 4R8PB 2Y2PA 3EPLA 3KUYD 4LD9C 1P3KA 2RIQA 1P3LB 3AV2C 5GXQB 3MVDC 1WWSA 3B6FC 5GSUC 1BFMA 3AZIB 4G91C 3A6NC 1KX4C 1P3KB 1M1AC 3AV1C 3AZKA 4UUZA 5FUGA 4WV4B 3B0DC 5AV8A 3X1TA 4WU9A 2F8ND 3B6GC 2NQBA 3AZLC 4R8PC 2AROD 3AZKB 4UUZB 5BS7A 5CPKA 5FUGB 3O62C 4KUDA 5AV8B 4E44A 4EO5B 1A7WA 2G5HC 3X1TB 4WU9B 4KUDD 3H0RC 5DNMD 2NQBB 4YS3A 3LELC 3H0LC 3AZGA 5CPKB 1P3KC 3A1KA 4AWLC 4KUDB 5JA4B 5DNMB 2Y2IA 4HGAB 4YS3B 3AZHC 3AZGB 2PYOA 2PYOD 1TZYA 3UTBC 1P3BC 5AV8C 2PYOB 3X1TC 4WU9C 3RELA 1TZYB 2NQBC 5JRGD 4KGCA 5E5AA 1BH9A 3LJAD 3REJA 3AFAA 3W99D 1Z2CB 1AOID 1P3FD 4KGCB 3RELB 4HGAC 2HUEB 4XUJA 5BT1D 4YS3C 4X23C 5E5AB 3AZGC 3W98C 1BH9B 5AVCD 3REJB 4H9RA 3AFAB 5AVBA 1AOIB 3WA9D 4J8UA 3F6TA 2YFVA 4CSRA 2FJ7D 3X1UC 3W97D 3WTPC 4H9RB 5AVBB 1S32A 5CPID 1TZYC 2FJ7B 3MGRD 4J8UB 4CSRB 3NQJA 1M19D 1P34C 2DQNC 3MGPC 5CPJD 1S32B 3RELC 4KGCC 5B24D 5E5AC 5B2JD 3REJC 3AFAC 1P3MA 3AZMA 1P3OA 3AZMD 1P3OD 3WAAA 2HIOD 5B32D 3H0MC 4XUJC 3C1CD 2RVQD 2F8NH 4Z2MH 5B1MA 1P3MB 5AVBC 1U35D 5B1MD 3AZMB 1P3OB 4NE3A 4J8UC 3WAAB 3REKA 5AV6A 3C1CB 1M18D 3W96A 5B1MB 3VH5T 5DNNA 4Z5TA 3AZEA 4Z5TD 5AV9D 2Y2MA 2YFWA 4DRBA 3LZ1A 3UTAD 5B0ZC 3AZED 1JFIA 4H9OA 3REKB 1M18B 5AV6B 3REIA 1WWIA 3REID 2Y2GA 1ID3A 3W96B 5DNNB 4Z5TB 1ID3D 3AZEB 3UT9D 1ULYA 5CP6D 2YFWB 3UTAB 3AZNC 3LZ1B 3AYWA 4H9OB 3EPKA 1P3MC 1P3PC 4DQYB 3REIB 1TAFB 3AN2D 1ID3B 3WAAC 2F8NG 4Z2MG 4M6BA 4J8XD 4YM6C 1P3GD 1P3IA 5BNXA 1P3AC 3AYWB 4XZQA 3KWQC 4QLCA 3AZFA 1EQZC 3WKJA 1P3IB 3VH5A 4J8VA 2Y2JA 5BNXB 3REKC 5B2IC 1P3LA 1T3UA 5GXQA 2J8PA 2LY8A 3NQUA 3W96C 5DNNC 3X1VD 4QLCB 2CV5D 3AZFB 1KX5A 1B6WA 3LZ1C 3WKJB 3KUYA 4J8WD 2ZY4A 4J8VB 2BG1A 1KX4D 1Q9CA 3VH6W 3NQUB 3X1VB 1KX5B 3KUYB 3AYWC 2CWEA 1P3IC 2XD5A 4XZQC 2F8NA 4Z66D 5F99D 4QLCC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WKJ C;  2ARO A;  5GT3 C;  4J8V C;  1P3L C;  3MNN D;  5GXQ C;  3LZ0 A;  3KXB D;  2F8N B;  3LZ0 D;  5JA4 A;  5DNM A;  1KX5 C;  4DRA A;  3AZI C;  2ARO B;  3KUY C;  3MNN B;  3MGS D;  3LZ0 B;  1BH8 A;  4WZS B;  5B1L D;  3REH D;  1P3B D;  1KX3 D;  2NZD A;  5KDM A;  2NZD D;  1BH8 B;  3AZK C;  4EO5 C;  3C1B D;  1HTA A;  2NZD B;  5JRG A;  5KDM B;  5GT0 D;  3LJA A;  2ARO C;  3VH6 T;  5B32 G;  1KU5 A;  4WU8 A;  5CPK C;  5BS7 C;  4WU8 D;  3W99 A;  4H9P A;  1AOI A;  1P3F A;  4KUD C;  4ZBJ B;  5DNM C;  5JRG B;  2L5A A;  5AVC A;  3LJA B;  4WU8 B;  1F1E A;  3W99 B;  4H9P B;  3WTP D;  3WA9 A;  1P3F B;  2FJ7 A;  3B0B A;  3W97 A;  5AVC B;  3V9R A;  3MGP D;  5CPI A;  2PYO C;  3MGQ D;  3WA9 B;  4JJN D;  3MGR A;  2F8N K;  1M19 A;  4ZUX A;  3WTP E;  4ZUX D;  3W97 B;  1H3O B;  3V9R B;  5CPJ A;  5CPI B;  3VH6 A;  4JJN B;  5JRG C;  3MGR B;  5AV5 D;  5B24 A;  2HUE C;  5BO0 A;  5B2J A;  3LJA C;  1M19 B;  4ZUX B;  3W99 C;  1AOI C;  5CPJ B;  2HIO A;  5B32 A;  5AV5 B;  5BT1 C;  5B24 B;  5BO0 B;  5B2J B;  3C1C A;  5B31 D;  1U35 A;  3X1S D;  3WA9 C;  4WNN A;  2FJ7 C;  2HIO B;  5B32 B;  5B40 D;  1M18 A;  3W97 C;  5AY8 D;  5B31 B;  5CPI C;  1U35 B;  1S32 C;  5AV9 A;  3MGR C;  4WNN B;  3UTA A;  1ZLA D;  1F66 D;  1M19 C;  5B40 B;  3AZN D;  1N1J A;  1HQ3 D;  5AY8 B;  1TAF A;  5B0Y D;  5CPJ C;  3UT9 A;  5B33 D;  5CP6 A;  5AV9 B;  5B24 C;  5B2J C;  4YM6 D;  1N1J B;  1HQ3 B;  1P3A D;  5B0Y B;  3AZM C;  3AN2 A;  1P3O C;  3AZJ D;  5B33 B;  2HIO C;  5B32 C;  4J8X A;  3UT9 B;  1P3G A;  5CP6 B;  3C1C C;  2RVQ C;  3TU4 D;  5B2I D;  1U35 C;  5B1M C;  3AN2 B;  3AZJ B;  1P3G B;  4J8X B;  1M18 C;  3TU4 B;  5AV6 C;  4LD9 D;  3AV2 D;  3X1V A;  3MVD D;  4Z5T C;  2CV5 A;  5AV9 C;  3AZE C;  4G92 B;  3UTA C;  3B6F D;  4J8W A;  5GSU D;  3A6N A;  4LD9 B;  3A6N D;  1KX4 A;  3REI C;  1M1A A;  1ID3 C;  1M1A D;  3UT9 C;  2CV5 B;  5CP6 C;  3AV1 D;  4J8W B;  4G91 B;  3A6N B;  1KX4 B;  3AN2 C;  1M1A B;  3B0C W;  3AZL A;  4J8X C;  1P3G C;  3B6G D;  3AZL D;  5BNV A;  4R8P D;  4Z66 A;  5F99 A;  3O62 A;  3O62 D;  3AZF C;  4G92 C;  3AZL B;  3LEL A;  3LEL D;  5BNV B;  2BYM A;  3MNN A;  3KXB A;  1P3K D;  4Z66 B;  5F99 B;  3X1V C;  3O62 B;  2CV5 C;  3LEL B;  4J8W C;  3AZH A;  3MGS A;  3AZH D;  2BYM B;  3KXB B;  4AWL B;  3AZK D;  3AZH B;  5B1L A;  3REH A;  2IO5 B;  3MGS B;  3UTB A;  1P3B A;  1KX3 A;  3UTB D;  4NE6 A;  5AV8 D;  3X1T D;  4WU9 D;  2NQB D;  4H9N A;  5CPK D;  5B1L B;  3REH B;  3UTB B;  5C3I B;  5F99 C;  4Z66 C;  3C1B A;  1P3B B;  1KX3 B;  5GT0 A;  4X23 A;  4H9N B;  4YS3 D;  2BYK A;  4X23 D;  3W98 A;  3MNN C;  3AZG D;  3W98 D;  4KHA A;  3KXB C;  3LZ0 C;  3C1B B;  5B31 G;  5GT0 B;  3X1U A;  4X23 B;  3B0C T;  2BYK B;  2IO5 C;  3X1U D;  3MGS C;  3WTP A;  3W98 B;  4KHA B;  1TZY D;  3X1U B;  4NFT A;  1P34 A;  1H3O A;  5B1L C;  3MGP A;  5C3I C;  3REH C;  3WTP B;  3MGQ A;  1P34 D;  4JJN A;  1KX3 C;  2NZD C;  3REL D;  4KGC D;  3VH5 W;  5E5A D;  3REJ D;  1P34 B;  3AFA D;  3MGP B;  3C1B C;  3MGQ B;  4ZBJ C;  5AV5 A;  5GT0 C;  4XUJ D;  4WU8 C;  4H9S A;  4E45 A;  5AVB D;  1P3F C;  4CAY A;  4J8U D;  1B67 A;  4XUJ B;  5AVC C;  1R4V A;  5B31 A;  3X1S A;  5CHL B;  1S32 D;  4CAY B;  5B40 A;  2YFV B;  5B0Z A;  5B0Z D;  5AY8 A;  4H9Q A;  3X1S B;  3MGQ C;  4JJN C;  1ZLA A;  1F66 A;  3AZN A;  4ZUX C;  3NQJ B;  5B0Z B;  1HQ3 A;  4NE5 A;  1P3P A;  5B0Y A;  1P3P D;  4H9Q B;  1P3M D;  5B33 A;  5AV5 C;  1ZLA B;  1F66 B;  3WAA D;  4YM6 A;  3AZN B;  1P3A A;  4H9S C;  1P3P B;  3KWQ A;  3AZJ A;  3KWQ D;  3R45 A;  1EQZ A;  1EQZ D;  4YM6 B;  5G49 A;  3TU4 A;  5B2I A;  3REK D;  5B31 C;  1P3A B;  5AV6 D;  3X1S C;  3KWQ B;  3W96 D;  5DNN D;  3R45 B;  5B40 C;  1EQZ B;  3LZ1 D;  4LD9 A;  5G49 B;  5AY8 C;  5B2I B;  3AV2 A;  3MVD A;  1ZLA C;  1F66 C;  3B6F A;  5GSU A;  1JFI B;  1HQ3 C;  3AYW D;  5B0Y C;  3AV2 B;  2JSS A;  3MVD B;  5B33 C;  3AV1 A;  3B6F B;  1P3I D;  5GSU B;  4XZQ D;  3AZJ C;  3B6G A;  4QLC D;  3AZF D;  5GT3 A;  3AV1 B;  3WKJ D;  4R8P A;  5GT3 D;  3TU4 C;  4J8V D;  1P3L D;  4XZQ B;  3B0D B;  3KSY A;  5GXQ D;  3B6G B;  3AZI A;  1KX5 D;  5GT3 B;  3AZI D;  4R8P B;  4LD9 C;  3KUY D;  1P3K A;  1P3L B;  3AV2 C;  5GXQ B;  3MVD C;  1WWS A;  3B6F C;  5GSU C;  1BFM A;  3AZI B;  4G91 C;  3A6N C;  1KX4 C;  1P3K B;  1M1A C;  3AV1 C;  3AZK A;  4UUZ A;  5FUG A;  4WV4 B;  3B0D C;  5AV8 A;  3X1T A;  4WU9 A;  2F8N D;  3B6G C;  2NQB A;  3AZL C;  4R8P C;  2ARO D;  3AZK B;  4UUZ B;  5BS7 A;  5CPK A;  5FUG B;  3O62 C;  4KUD A;  5AV8 B;  4E44 A;  4EO5 B;  1A7W A;  3X1T B;  4WU9 B;  4KUD D;  5DNM D;  2NQB B;  4YS3 A;  3LEL C;  3AZG A;  5CPK B;  1P3K C;  4AWL C;  4KUD B;  5JA4 B;  5DNM B;  4HGA B;  4YS3 B;  3AZH C;  3AZG B;  2PYO A;  2PYO D;  1TZY A;  3UTB C;  1P3B C;  5AV8 C;  2PYO B;  3X1T C;  4WU9 C;  3REL A;  1TZY B;  2NQB C;  5JRG D;  4KGC A;  5E5A A;  1BH9 A;  3LJA D;  3REJ A;  3AFA A;  3W99 D;  1AOI D;  1P3F D;  4KGC B;  3REL B;  4HGA C;  2HUE B;  4XUJ A;  5BT1 D;  4YS3 C;  4X23 C;  5E5A B;  3AZG C;  3W98 C;  1BH9 B;  5AVC D;  3REJ B;  4H9R A;  3AFA B;  5AVB A;  1AOI B;  3WA9 D;  4J8U A;  2YFV A;  4CSR A;  2FJ7 D;  3X1U C;  3W97 D;  3WTP C;  4H9R B;  5AVB B;  1S32 A;  5CPI D;  1TZY C;  2FJ7 B;  3MGR D;  4J8U B;  4CSR B;  3NQJ A;  1M19 D;  1P34 C;  3MGP C;  5CPJ D;  1S32 B;  3REL C;  4KGC C;  5B24 D;  5E5A C;  5B2J D;  3REJ C;  3AFA C;  1P3M A;  3AZM A;  1P3O A;  3AZM D;  1P3O D;  3WAA A;  2HIO D;  5B32 D;  4XUJ C;  3C1C D;  2RVQ D;  2F8N H;  4Z2M H;  5B1M A;  1P3M B;  5AVB C;  1U35 D;  5B1M D;  3AZM B;  1P3O B;  4NE3 A;  4J8U C;  3WAA B;  3REK A;  5AV6 A;  3C1C B;  1M18 D;  3W96 A;  5B1M B;  3VH5 T;  5DNN A;  4Z5T A;  3AZE A;  4Z5T D;  5AV9 D;  2YFW A;  3AZE D;  4DRB A;  3LZ1 A;  3UTA D;  5B0Z C;  1JFI A;  4H9O A;  3REK B;  1M18 B;  5AV6 B;  3REI A;  1WWI A;  3REI D;  1ID3 A;  3W96 B;  5DNN B;  4Z5T B;  1ID3 D;  3AZE B;  3UT9 D;  1ULY A;  5CP6 D;  2YFW B;  3UTA B;  3AZN C;  3LZ1 B;  3AYW A;  4H9O B;  1P3P C;  1P3M C;  3REI B;  1TAF B;  3AN2 D;  1ID3 B;  3WAA C;  2F8N G;  4Z2M G;  4M6B A;  4J8X D;  4YM6 C;  1P3G D;  1P3I A;  5BNX A;  1P3A C;  3AYW B;  4XZQ A;  3KWQ C;  4QLC A;  3AZF A;  1EQZ C;  3WKJ A;  1P3I B;  3VH5 A;  4J8V A;  3REK C;  5BNX B;  1P3L A;  5B2I C;  5GXQ A;  2LY8 A;  3NQU A;  3W96 C;  5DNN C;  3X1V D;  4QLC B;  2CV5 D;  3AZF B;  1KX5 A;  1B6W A;  3LZ1 C;  3WKJ B;  3KUY A;  4J8W D;  4J8V B;  1KX4 D;  1Q9C A;  3VH6 W;  3NQU B;  3X1V B;  1KX5 B;  3KUY B;  3AYW C;  2CWE A;  1P3I C;  4XZQ C;  2F8N A;  4Z66 D;  5F99 D;  4QLC C; 
#chains in the Genus database with same CATH topology
 3WKJ C;  2ARO A;  5GT3 C;  4J8V C;  1P3L C;  3MNN D;  5GXQ C;  3LZ0 A;  3KXB D;  2F8N B;  3LZ0 D;  5JA4 A;  5DNM A;  1KX5 C;  4DRA A;  3AZI C;  2ARO B;  3KUY C;  3MNN B;  3MGS D;  3LZ0 B;  4WJ3 C;  1BH8 A;  4WZS B;  5B1L D;  3REH D;  1P3B D;  1KX3 D;  2NZD A;  5KDM A;  2NZD D;  1BH8 B;  3AZK C;  4EO5 C;  3C1B D;  1HTA A;  2NZD B;  5JRG A;  5KDM B;  1PZR A;  5GT0 D;  2ARO C;  3VH6 T;  3LJA A;  5B32 G;  1KU5 A;  4WU8 A;  5CPK C;  5BS7 C;  4WU8 D;  3W99 A;  4H9P A;  1AOI A;  1P3F A;  4KUD C;  4ZBJ B;  5DNM C;  2Y2N A;  5JRG B;  2L5A A;  5AVC A;  3LJA B;  4WU8 B;  1F1E A;  3W99 B;  4H9P B;  3WTP D;  3WA9 A;  1P3F B;  2FJ7 A;  3A1I A;  3B0B A;  3W97 A;  5AVC B;  3V9R A;  3MGP D;  5CPI A;  2PYO C;  3MGQ D;  3WA9 B;  4JJN D;  3FDD A;  3MGR A;  2F8N K;  1M19 A;  4ZUX A;  3WTP E;  4ZUX D;  2JE5 A;  3W97 B;  1H3O B;  3V9R B;  5CPJ A;  5CPI B;  3VH6 A;  4JJN B;  5JRG C;  3MGR B;  5AV5 D;  5B24 A;  2HUE C;  5BO0 A;  5B2J A;  3LJA C;  1M19 B;  4ZUX B;  3W99 C;  1AOI C;  5CPJ B;  2HIO A;  5B32 A;  2VQR A;  5AV5 B;  5BT1 C;  5B24 B;  5BO0 B;  5B2J B;  3C1C A;  3IP4 C;  5B31 D;  1U35 A;  3X1S D;  3WA9 C;  4WNN A;  2FJ7 C;  2HIO B;  5B32 B;  5B40 D;  2ZY5 A;  1M18 A;  3W97 C;  5AY8 D;  5B31 B;  5CPI C;  1U35 B;  1S32 C;  5AV9 A;  3MGR C;  4WNN B;  3UTA A;  1ZLA D;  1F66 D;  1M19 C;  5B40 B;  3AZN D;  1N1J A;  1HQ3 D;  5AY8 B;  1TAF A;  5B0Y D;  5CPJ C;  3UT9 A;  5B33 D;  2JCH A;  5AV9 B;  5CP6 A;  5B24 C;  5B2J C;  4YM6 D;  1N1J B;  1HQ3 B;  3EG5 B;  1P3A D;  5B0Y B;  3AZM C;  3AN2 A;  1P3O C;  3AZJ D;  5B33 B;  2HIO C;  2Y2Q A;  5B32 C;  4J8X A;  3UT9 B;  1P3G A;  5CP6 B;  3C1C C;  2RVQ C;  3TU4 D;  5B2I D;  1U35 C;  5B1M C;  3AN2 B;  3AZJ B;  1P3G B;  4J8X B;  1M18 C;  3TU4 B;  5AV6 C;  4LD9 D;  3AV2 D;  3X1V A;  3MVD D;  4Z5T C;  2CV5 A;  5AV9 C;  3AZE C;  4G92 B;  3UTA C;  3B6F D;  4J8W A;  5GSU D;  3A6N A;  4LD9 B;  3A6N D;  1KX4 A;  3REI C;  1M1A A;  1ID3 C;  1M1A D;  3UT9 C;  2CV5 B;  5CP6 C;  3AV1 D;  4J8W B;  4G91 B;  3A6N B;  1KX4 B;  3AN2 C;  1M1A B;  3B0C W;  3AZL A;  4J8X C;  1P3G C;  3B6G D;  3AZL D;  5BNV A;  4R8P D;  4Z66 A;  5F99 A;  3O62 A;  3O62 D;  3AZF C;  4G92 C;  3AZL B;  2Y2L A;  3LEL A;  3LEL D;  5BNV B;  2BYM A;  3MNN A;  3KXB A;  1P3K D;  4Z66 B;  5F99 B;  3X1V C;  3O62 B;  2CV5 C;  3LEL B;  4J8W C;  3AZH A;  3MGS A;  3AZH D;  2BYM B;  3KXB B;  4AWL B;  2G5I C;  3AZK D;  2Y2O A;  3AZH B;  5B1L A;  3REH A;  2IO5 B;  3MGS B;  3UTB A;  1P3B A;  1KX3 A;  3UTB D;  4NE6 A;  2W8S A;  5AV8 D;  3X1T D;  4WU9 D;  2NQB D;  4H9N A;  5CPK D;  5B1L B;  3REH B;  3UTB B;  5C3I B;  5F99 C;  4Z66 C;  3C1B A;  1P3B B;  1KX3 B;  5GT0 A;  4X23 A;  4H9N B;  2BYK A;  4YS3 D;  4X23 D;  3W98 A;  3MNN C;  3AZG D;  3W98 D;  2F2A C;  4KHA A;  3KXB C;  3LZ0 C;  3C1B B;  5B31 G;  5GT0 B;  3X1U A;  4X23 B;  3B0C T;  2BYK B;  2IO5 C;  3X1U D;  3MGS C;  3WTP A;  3W98 B;  4KHA B;  2FFF B;  1TZY D;  2Y2H A;  3X1U B;  4NFT A;  1P34 A;  1H3O A;  5B1L C;  3MGP A;  5C3I C;  3REH C;  3WTP B;  3MGQ A;  1P34 D;  4JJN A;  1KX3 C;  2NZD C;  3REL D;  4KGC D;  3VH5 W;  5E5A D;  3REJ D;  1P34 B;  3AFA D;  3MGP B;  3C1B C;  3MGQ B;  4ZBJ C;  5AV5 A;  5GT0 C;  2ZY3 A;  4XUJ D;  4WU8 C;  4H9S A;  4E45 A;  5AVB D;  1P3F C;  4CAY A;  4J8U D;  1B67 A;  2UWX A;  4XUJ B;  5AVC C;  1R4V A;  5B31 A;  3X1S A;  5CHL B;  1S32 D;  4CAY B;  5B40 A;  2YFV B;  5B0Z A;  5B0Z D;  1W2E A;  5AY8 A;  4H9Q A;  2Y2K A;  3X1S B;  3MGQ C;  2XD1 A;  4JJN C;  1ZLA A;  1F66 A;  3AZN A;  4ZUX C;  3NQJ B;  5B0Z B;  1HQ3 A;  4NE5 A;  1P3P A;  3KFU G;  5B0Y A;  1P3P D;  4H9Q B;  1P3M D;  3P5J B;  5B33 A;  5AV5 C;  3EPJ A;  1ZLA B;  1F66 B;  3WAA D;  4YM6 A;  3AZN B;  1P3A A;  4H9S C;  3EPH A;  1P3P B;  3KWQ A;  3AZJ A;  3KWQ D;  3R45 A;  1EQZ A;  1EQZ D;  4YM6 B;  5G49 A;  3TU4 A;  5B2I A;  3REK D;  5B31 C;  1P3A B;  5AV6 D;  3X1S C;  3KWQ B;  3W96 D;  5DNN D;  3R45 B;  5B40 C;  4UPK A;  1EQZ B;  3LZ1 D;  4LD9 A;  5G49 B;  5AY8 C;  5B2I B;  3AV2 A;  3MVD A;  1ZLA C;  1F66 C;  3B6F A;  5GSU A;  1JFI B;  1HQ3 C;  3AYW D;  5B0Y C;  3AV2 B;  2JSS A;  3MVD B;  5B33 C;  3AV1 A;  3B6F B;  1P3I D;  5GSU B;  4XZQ D;  3AZJ C;  3B6G A;  4QLC D;  3AZF D;  3AL0 C;  2DF4 C;  5GT3 A;  3AV1 B;  4R8P A;  3WKJ D;  5GT3 D;  2ZM5 A;  3TU4 C;  4J8V D;  1P3L D;  4XZQ B;  3B0D B;  3KSY A;  2ZY2 A;  5GXQ D;  3B6G B;  3AZI A;  1KX5 D;  5GT3 B;  3AZI D;  4R8P B;  2Y2P A;  3EPL A;  3KUY D;  4LD9 C;  1P3K A;  2RIQ A;  1P3L B;  3AV2 C;  5GXQ B;  3MVD C;  1WWS A;  3B6F C;  5GSU C;  1BFM A;  3AZI B;  4G91 C;  3A6N C;  1KX4 C;  1P3K B;  1M1A C;  3AV1 C;  3AZK A;  4UUZ A;  5FUG A;  4WV4 B;  3B0D C;  5AV8 A;  3X1T A;  4WU9 A;  2F8N D;  3B6G C;  2NQB A;  3AZL C;  4R8P C;  2ARO D;  3AZK B;  4UUZ B;  5BS7 A;  5CPK A;  5FUG B;  3O62 C;  4KUD A;  5AV8 B;  4E44 A;  4EO5 B;  1A7W A;  2G5H C;  3X1T B;  4WU9 B;  4KUD D;  3H0R C;  5DNM D;  2NQB B;  4YS3 A;  3LEL C;  3H0L C;  3AZG A;  5CPK B;  1P3K C;  3A1K A;  4AWL C;  4KUD B;  5JA4 B;  5DNM B;  2Y2I A;  4HGA B;  4YS3 B;  3AZH C;  3AZG B;  2PYO A;  2PYO D;  1TZY A;  3UTB C;  1P3B C;  5AV8 C;  2PYO B;  3X1T C;  4WU9 C;  3REL A;  1TZY B;  2NQB C;  5JRG D;  4KGC A;  5E5A A;  1BH9 A;  3LJA D;  3REJ A;  3AFA A;  3W99 D;  1Z2C B;  1AOI D;  1P3F D;  4KGC B;  3REL B;  4HGA C;  2HUE B;  4XUJ A;  5BT1 D;  4YS3 C;  4X23 C;  5E5A B;  3AZG C;  3W98 C;  1BH9 B;  5AVC D;  3REJ B;  4H9R A;  3AFA B;  5AVB A;  1AOI B;  3WA9 D;  4J8U A;  3F6T A;  2YFV A;  4CSR A;  2FJ7 D;  3X1U C;  3W97 D;  3WTP C;  4H9R B;  5AVB B;  1S32 A;  5CPI D;  1TZY C;  2FJ7 B;  3MGR D;  4J8U B;  4CSR B;  3NQJ A;  1M19 D;  1P34 C;  2DQN C;  3MGP C;  5CPJ D;  1S32 B;  3REL C;  4KGC C;  5B24 D;  5E5A C;  5B2J D;  3REJ C;  3AFA C;  1P3M A;  3AZM A;  1P3O A;  3AZM D;  1P3O D;  3WAA A;  2HIO D;  5B32 D;  3H0M C;  4XUJ C;  3C1C D;  2RVQ D;  2F8N H;  4Z2M H;  5B1M A;  1P3M B;  5AVB C;  1U35 D;  5B1M D;  3AZM B;  1P3O B;  4NE3 A;  4J8U C;  3WAA B;  3REK A;  5AV6 A;  3C1C B;  1M18 D;  3W96 A;  5B1M B;  3VH5 T;  5DNN A;  4Z5T A;  3AZE A;  4Z5T D;  5AV9 D;  2Y2M A;  2YFW A;  4DRB A;  3LZ1 A;  3UTA D;  5B0Z C;  3AZE D;  1JFI A;  4H9O A;  3REK B;  1M18 B;  5AV6 B;  3REI A;  1WWI A;  3REI D;  2Y2G A;  1ID3 A;  3W96 B;  5DNN B;  4Z5T B;  1ID3 D;  3AZE B;  3UT9 D;  1ULY A;  5CP6 D;  2YFW B;  3UTA B;  3AZN C;  3LZ1 B;  3AYW A;  4H9O B;  3EPK A;  1P3M C;  1P3P C;  4DQY B;  3REI B;  1TAF B;  3AN2 D;  1ID3 B;  3WAA C;  2F8N G;  4Z2M G;  4M6B A;  4J8X D;  4YM6 C;  1P3G D;  1P3I A;  5BNX A;  1P3A C;  3AYW B;  4XZQ A;  3KWQ C;  4QLC A;  3AZF A;  1EQZ C;  3WKJ A;  1P3I B;  3VH5 A;  4J8V A;  2Y2J A;  5BNX B;  3REK C;  5B2I C;  1P3L A;  1T3U A;  5GXQ A;  2J8P A;  2LY8 A;  3NQU A;  3W96 C;  5DNN C;  3X1V D;  4QLC B;  2CV5 D;  3AZF B;  1KX5 A;  1B6W A;  3LZ1 C;  3WKJ B;  3KUY A;  4J8W D;  2ZY4 A;  4J8V B;  2BG1 A;  1KX4 D;  1Q9C A;  3VH6 W;  3NQU B;  3X1V B;  1KX5 B;  3KUY B;  3AYW C;  2CWE A;  1P3I C;  2XD5 A;  4XZQ C;  2F8N A;  4Z66 D;  5F99 D;  4QLC C; 
#chains in the Genus database with same CATH homology
 3WKJ C;  2ARO A;  5GT3 C;  4J8V C;  1P3L C;  3MNN D;  5GXQ C;  3LZ0 A;  3KXB D;  2F8N B;  3LZ0 D;  5JA4 A;  5DNM A;  1KX5 C;  4DRA A;  3AZI C;  2ARO B;  3KUY C;  3MNN B;  3MGS D;  3LZ0 B;  4WJ3 C;  1BH8 A;  4WZS B;  5B1L D;  3REH D;  1P3B D;  1KX3 D;  2NZD A;  5KDM A;  2NZD D;  1BH8 B;  3AZK C;  4EO5 C;  3C1B D;  1HTA A;  2NZD B;  5JRG A;  5KDM B;  1PZR A;  5GT0 D;  2ARO C;  3VH6 T;  3LJA A;  5B32 G;  1KU5 A;  4WU8 A;  5CPK C;  5BS7 C;  4WU8 D;  3W99 A;  4H9P A;  1AOI A;  1P3F A;  4KUD C;  4ZBJ B;  5DNM C;  2Y2N A;  5JRG B;  2L5A A;  5AVC A;  3LJA B;  4WU8 B;  1F1E A;  3W99 B;  4H9P B;  3WTP D;  3WA9 A;  1P3F B;  2FJ7 A;  3A1I A;  3B0B A;  3W97 A;  5AVC B;  3V9R A;  3MGP D;  5CPI A;  2PYO C;  3MGQ D;  3WA9 B;  4JJN D;  3FDD A;  3MGR A;  2F8N K;  1M19 A;  4ZUX A;  3WTP E;  4ZUX D;  2JE5 A;  3W97 B;  1H3O B;  3V9R B;  5CPJ A;  5CPI B;  3VH6 A;  4JJN B;  5JRG C;  3MGR B;  5AV5 D;  5B24 A;  2HUE C;  5BO0 A;  5B2J A;  3LJA C;  1M19 B;  4ZUX B;  3W99 C;  1AOI C;  5CPJ B;  2HIO A;  5B32 A;  2VQR A;  5AV5 B;  5BT1 C;  5B24 B;  5BO0 B;  5B2J B;  3C1C A;  3IP4 C;  5B31 D;  1U35 A;  3X1S D;  3WA9 C;  4WNN A;  2FJ7 C;  2HIO B;  5B32 B;  5B40 D;  2ZY5 A;  1M18 A;  3W97 C;  5AY8 D;  5B31 B;  5CPI C;  1U35 B;  1S32 C;  5AV9 A;  3MGR C;  4WNN B;  3UTA A;  1ZLA D;  1F66 D;  1M19 C;  5B40 B;  3AZN D;  1N1J A;  1HQ3 D;  5AY8 B;  1TAF A;  5B0Y D;  5CPJ C;  3UT9 A;  5B33 D;  2JCH A;  5AV9 B;  5CP6 A;  5B24 C;  5B2J C;  4YM6 D;  1N1J B;  1HQ3 B;  3EG5 B;  1P3A D;  5B0Y B;  3AZM C;  3AN2 A;  1P3O C;  3AZJ D;  5B33 B;  2HIO C;  2Y2Q A;  5B32 C;  4J8X A;  3UT9 B;  1P3G A;  5CP6 B;  3C1C C;  2RVQ C;  3TU4 D;  5B2I D;  1U35 C;  5B1M C;  3AN2 B;  3AZJ B;  1P3G B;  4J8X B;  1M18 C;  3TU4 B;  5AV6 C;  4LD9 D;  3AV2 D;  3X1V A;  3MVD D;  4Z5T C;  2CV5 A;  5AV9 C;  3AZE C;  4G92 B;  3UTA C;  3B6F D;  4J8W A;  5GSU D;  3A6N A;  4LD9 B;  3A6N D;  1KX4 A;  3REI C;  1M1A A;  1ID3 C;  1M1A D;  3UT9 C;  2CV5 B;  5CP6 C;  3AV1 D;  4J8W B;  4G91 B;  3A6N B;  1KX4 B;  3AN2 C;  1M1A B;  3B0C W;  3AZL A;  4J8X C;  1P3G C;  3B6G D;  3AZL D;  5BNV A;  4R8P D;  4Z66 A;  5F99 A;  3O62 A;  3O62 D;  3AZF C;  4G92 C;  3AZL B;  2Y2L A;  3LEL A;  3LEL D;  5BNV B;  2BYM A;  3MNN A;  3KXB A;  1P3K D;  4Z66 B;  5F99 B;  3X1V C;  3O62 B;  2CV5 C;  3LEL B;  4J8W C;  3AZH A;  3MGS A;  3AZH D;  2BYM B;  3KXB B;  4AWL B;  2G5I C;  3AZK D;  2Y2O A;  3AZH B;  5B1L A;  3REH A;  2IO5 B;  3MGS B;  3UTB A;  1P3B A;  1KX3 A;  3UTB D;  4NE6 A;  2W8S A;  5AV8 D;  3X1T D;  4WU9 D;  2NQB D;  4H9N A;  5CPK D;  5B1L B;  3REH B;  3UTB B;  5C3I B;  5F99 C;  4Z66 C;  3C1B A;  1P3B B;  1KX3 B;  5GT0 A;  4X23 A;  4H9N B;  2BYK A;  4YS3 D;  4X23 D;  3W98 A;  3MNN C;  3AZG D;  3W98 D;  2F2A C;  4KHA A;  3KXB C;  3LZ0 C;  3C1B B;  5B31 G;  5GT0 B;  3X1U A;  4X23 B;  3B0C T;  2BYK B;  2IO5 C;  3X1U D;  3MGS C;  3WTP A;  3W98 B;  4KHA B;  2FFF B;  1TZY D;  2Y2H A;  3X1U B;  4NFT A;  1P34 A;  1H3O A;  5B1L C;  3MGP A;  5C3I C;  3REH C;  3WTP B;  3MGQ A;  1P34 D;  4JJN A;  1KX3 C;  2NZD C;  3REL D;  4KGC D;  3VH5 W;  5E5A D;  3REJ D;  1P34 B;  3AFA D;  3MGP B;  3C1B C;  3MGQ B;  4ZBJ C;  5AV5 A;  5GT0 C;  2ZY3 A;  4XUJ D;  4WU8 C;  4H9S A;  4E45 A;  5AVB D;  1P3F C;  4CAY A;  4J8U D;  1B67 A;  2UWX A;  4XUJ B;  5AVC C;  1R4V A;  5B31 A;  3X1S A;  5CHL B;  1S32 D;  4CAY B;  5B40 A;  2YFV B;  5B0Z A;  5B0Z D;  1W2E A;  5AY8 A;  4H9Q A;  2Y2K A;  3X1S B;  3MGQ C;  2XD1 A;  4JJN C;  1ZLA A;  1F66 A;  3AZN A;  4ZUX C;  3NQJ B;  5B0Z B;  1HQ3 A;  4NE5 A;  1P3P A;  3KFU G;  5B0Y A;  1P3P D;  4H9Q B;  1P3M D;  3P5J B;  5B33 A;  5AV5 C;  3EPJ A;  1ZLA B;  1F66 B;  3WAA D;  4YM6 A;  3AZN B;  1P3A A;  4H9S C;  3EPH A;  1P3P B;  3KWQ A;  3AZJ A;  3KWQ D;  3R45 A;  1EQZ A;  1EQZ D;  4YM6 B;  5G49 A;  3TU4 A;  5B2I A;  3REK D;  5B31 C;  1P3A B;  5AV6 D;  3X1S C;  3KWQ B;  3W96 D;  5DNN D;  3R45 B;  5B40 C;  4UPK A;  1EQZ B;  3LZ1 D;  4LD9 A;  5G49 B;  5AY8 C;  5B2I B;  3AV2 A;  3MVD A;  1ZLA C;  1F66 C;  3B6F A;  5GSU A;  1JFI B;  1HQ3 C;  3AYW D;  5B0Y C;  3AV2 B;  2JSS A;  3MVD B;  5B33 C;  3AV1 A;  3B6F B;  1P3I D;  5GSU B;  4XZQ D;  3AZJ C;  3B6G A;  4QLC D;  3AZF D;  3AL0 C;  2DF4 C;  5GT3 A;  3AV1 B;  4R8P A;  3WKJ D;  5GT3 D;  2ZM5 A;  3TU4 C;  4J8V D;  1P3L D;  4XZQ B;  3B0D B;  3KSY A;  2ZY2 A;  5GXQ D;  3B6G B;  3AZI A;  1KX5 D;  5GT3 B;  3AZI D;  4R8P B;  2Y2P A;  3EPL A;  3KUY D;  4LD9 C;  1P3K A;  2RIQ A;  1P3L B;  3AV2 C;  5GXQ B;  3MVD C;  1WWS A;  3B6F C;  5GSU C;  1BFM A;  3AZI B;  4G91 C;  3A6N C;  1KX4 C;  1P3K B;  1M1A C;  3AV1 C;  3AZK A;  4UUZ A;  5FUG A;  4WV4 B;  3B0D C;  5AV8 A;  3X1T A;  4WU9 A;  2F8N D;  3B6G C;  2NQB A;  3AZL C;  4R8P C;  2ARO D;  3AZK B;  4UUZ B;  5BS7 A;  5CPK A;  5FUG B;  3O62 C;  4KUD A;  5AV8 B;  4E44 A;  4EO5 B;  1A7W A;  2G5H C;  3X1T B;  4WU9 B;  4KUD D;  3H0R C;  5DNM D;  2NQB B;  4YS3 A;  3LEL C;  3H0L C;  3AZG A;  5CPK B;  1P3K C;  3A1K A;  4AWL C;  4KUD B;  5JA4 B;  5DNM B;  2Y2I A;  4HGA B;  4YS3 B;  3AZH C;  3AZG B;  2PYO A;  2PYO D;  1TZY A;  3UTB C;  1P3B C;  5AV8 C;  2PYO B;  3X1T C;  4WU9 C;  3REL A;  1TZY B;  2NQB C;  5JRG D;  4KGC A;  5E5A A;  1BH9 A;  3LJA D;  3REJ A;  3AFA A;  3W99 D;  1Z2C B;  1AOI D;  1P3F D;  4KGC B;  3REL B;  4HGA C;  2HUE B;  4XUJ A;  5BT1 D;  4YS3 C;  4X23 C;  5E5A B;  3AZG C;  3W98 C;  1BH9 B;  5AVC D;  3REJ B;  4H9R A;  3AFA B;  5AVB A;  1AOI B;  3WA9 D;  4J8U A;  3F6T A;  2YFV A;  4CSR A;  2FJ7 D;  3X1U C;  3W97 D;  3WTP C;  4H9R B;  5AVB B;  1S32 A;  5CPI D;  1TZY C;  2FJ7 B;  3MGR D;  4J8U B;  4CSR B;  3NQJ A;  1M19 D;  1P34 C;  2DQN C;  3MGP C;  5CPJ D;  1S32 B;  3REL C;  4KGC C;  5B24 D;  5E5A C;  5B2J D;  3REJ C;  3AFA C;  1P3M A;  3AZM A;  1P3O A;  3AZM D;  1P3O D;  3WAA A;  2HIO D;  5B32 D;  3H0M C;  4XUJ C;  3C1C D;  2RVQ D;  2F8N H;  4Z2M H;  5B1M A;  1P3M B;  5AVB C;  1U35 D;  5B1M D;  3AZM B;  1P3O B;  4NE3 A;  4J8U C;  3WAA B;  3REK A;  5AV6 A;  3C1C B;  1M18 D;  3W96 A;  5B1M B;  3VH5 T;  5DNN A;  4Z5T A;  3AZE A;  4Z5T D;  5AV9 D;  2Y2M A;  2YFW A;  4DRB A;  3LZ1 A;  3UTA D;  5B0Z C;  3AZE D;  1JFI A;  4H9O A;  3REK B;  1M18 B;  5AV6 B;  3REI A;  1WWI A;  3REI D;  2Y2G A;  1ID3 A;  3W96 B;  5DNN B;  4Z5T B;  1ID3 D;  3AZE B;  3UT9 D;  1ULY A;  5CP6 D;  2YFW B;  3UTA B;  3AZN C;  3LZ1 B;  3AYW A;  4H9O B;  3EPK A;  1P3M C;  1P3P C;  4DQY B;  3REI B;  1TAF B;  3AN2 D;  1ID3 B;  3WAA C;  2F8N G;  4Z2M G;  4M6B A;  4J8X D;  4YM6 C;  1P3G D;  1P3I A;  5BNX A;  1P3A C;  3AYW B;  4XZQ A;  3KWQ C;  4QLC A;  3AZF A;  1EQZ C;  3WKJ A;  1P3I B;  3VH5 A;  4J8V A;  2Y2J A;  5BNX B;  3REK C;  5B2I C;  1P3L A;  1T3U A;  5GXQ A;  2J8P A;  2LY8 A;  3NQU A;  3W96 C;  5DNN C;  3X1V D;  4QLC B;  2CV5 D;  3AZF B;  1KX5 A;  1B6W A;  3LZ1 C;  3WKJ B;  3KUY A;  4J8W D;  2ZY4 A;  4J8V B;  2BG1 A;  1KX4 D;  1Q9C A;  3VH6 W;  3NQU B;  3X1V B;  1KX5 B;  3KUY B;  3AYW C;  2CWE A;  1P3I C;  2XD5 A;  4XZQ C;  2F8N A;  4Z66 D;  5F99 D;  4QLC C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...