1P3BA

Crystallographic studies of nucleosome core particles containing histone 'sin' mutants
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
99
structure length
99
Chain Sequence
b'KPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Palindromic 146bp Human Alpha-Satellite DNA fragment
publication title Crystal structures of histone Sin mutant nucleosomes reveal altered protein-DNA interactions
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 33
structure length 99
sequence length 99
chains with identical sequence E
ec nomenclature
pdb deposition date 2003-04-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1p3bA00
1S32C 3LZ0D 3MGRD 1BH9B 1U35C 2HUEB 4J8XA 3W98C 5B33A 1F66B 5AVBD 5DNMD 1KX4A 3X1UA 3WAAB 4J8WA 4J8VA 3W97C 3MGSD 3R45A 3KWQA 2HIOC 2YFVB 3REKD 3X1VB 2NQBD 3AZIA 1S32D 1M19A 5B32C 1U35D 3W98D 1TZYA 5AV9B 1AOIA 3UTAA 3KXBB 3REIB 3B6GB 3W97D 3AZLC 2HIOD 3LJAB 1P3BB 1BH8A 2YFWA 1BFMA 1P3MB 1HTAA 4E44A 3WTPC 3LZ1A 4AWLB 5B32D 1TAFA 5CPIC 3B6FC 4WU9C 5CP6B 3VH6W 1H3OB 3REJC 5F99A 3AZLD 4HGAB 4QLCC 5GT0C 3AZEA 3WTPD 3O62B 5CPID 3B6FD 3C1CC 4H9PB 4WU8C 4WU9D 4J8XB 3AZNA 3UT9B 1EQZB 4X23A 1P34A 5B31G 5B1LC 3C1BB 3REJD 4QLCD 5GT0D 1KX5C 4J8UB 3A6NA 1HQ3B 5B1MA 3AN2A 3MGQB 3MVDC 3MGPA 1KX3C 3C1CD 3AZIB 2PYOA 4WU8D 1M19B 4H9SA 4YS3C 4G92B 5AV8A 4H9NA 3B0CW 1P3OB 5B1LD 1AOIB 5JRGD 4Z66C 3V9RB 5C3IB 5AY8B 3X1SB 1KX5D 1ID3B 3VH6T 4EO5B 2IO5C 3AV1A 1P3KC 2YFWB 5B31B 3MVDD 5JA4A 1P3LB 1KX3D 5AVCB 3MNNC 2FJ7C 4CSRA 2AROB 3WA9C 4YS3D 5B40B 5B2JA 4R8PB 4YM6C 4M6BA 5E5AC 3UTBC 3LELA 4JJNA 4LD9C 5BNVB 5BS7A 1P3IB 4Z66D 3AZJC 4WV4B 1ZLAC 1F1EA 5GT3C 2FJ7D 2NZDA 3MNND 3AV2B 3WA9D 3B0BA 3REHC 1B6WA 4YM6D 5E5AD 3AFAA 3UTBD 4Z5TB 4LD9D 3RELB 5AV6C 5B24C 3AZJD 3AZMC 3B0CT 4KGCB 3AZKA 1ZLAD 3AZHC 5CHLB 3AYWA 3NQJB 5BNXA 1P3GC 4Z2MH 5GT3D 3KUYC 5DNNB 3AZFA 3W99A 3REHD 3WKJC 5GSUB 3KSYA 3TU4B 5AV6D 5B24D 3LZ0A 3MGRA 3AZHD 2HUEC 3W96A 1P3GD 3KUYD 5AVBA 1F66C 3AZMB 1M1AB 3WAAC 2BYKB 3MGSA 3WKJD 3REKA 4H9RA 3X1VC 2NQBA 5CPJB 3LELB 1U35A 3W98A 2CV5D 1F66D 1KU5A 4H9OB 5AV9C 5BO0B 3WAAD 3KXBC 4XUJA 3REIC 3W97A 1M18B 3B6GC 2HIOA 5GXQB 4KHAB 3LJAC 3X1VD 1P3BC 3NQUB 1P3MC 4AWLC 5B32A 5AV9D 5BNXB 5CP6C 3KXBD 3REID 5B0ZB 2F8NG 1P3BD 4HGAC 5G49B 5B2IA 3WTPA 1P3MD 5FUGB 1B67A 3O62C 5CPIA 3B6FA 3AZGB 1P3AB 4J8XC 3W96B 3UT9C 1EQZC 1KX4C 5CP6D 3REJA 3C1BC 5B0YB 4ZUXB 4H9QA 4QLCA 5CPKB 4J8UC 1P3FB 4CAYA 1HQ3C 1P3PB 3O62D 3MGQC 3C1CA 3AZIC 4WU8A 1M19C 2F8NB 5AV5B 4J8XD 3UT9D 1EQZD 4G92C 1P3OC 5B1LA 1WWSA 3C1BD 1AOIC 5JRGA 5B33B 1KX5A 5C3IC 5AY8C 4XUJB 4J8UD 3X1SC 1KX4B 1ID3C 1HQ3D 3X1UB 4J8WB 4EO5C 5B31C 3MVDA 3MGQD 1P3LC 1KX3A 5AVCC 4DRAA 4UUZA 3AZID 4J8VB 2AROC 3R45B 3KWQB 4YS3A 5B40C 4R8PC 1P3OD 3VH5W 2BYMA 1AOID 1P3IC 1TZYB 5AY8D 3X1SD 4DRBA 1ID3D 3UTAB 5B31D 5B2IB 1P3LD 2FJ7A 3MNNA 5AVCD 3AV2C 3WA9A 2AROD 3X1TA 5B40D 1BH8B 4R8PD 4YM6A 3LZ1B 3UTBA 4LD9A 4Z5TC 1TAFB 3RELC 1P3ID 3AZJA 4KGCC 2LY8A 5GT3A 5DNNC 4CAYB 1JFIA 3AV2D 5F99B 3REHA 1P3KD 3AZEB 4H9SC 5GSUC 1N1JA 4Z5TD 3TU4C 3RELD 5KDMA 5B24A 3WTPE 4KGCD 3AZHA 5JRGB 3AZNB 1P3GA 4X23B 3KUYA 1P34B 5DNND 5BT1C 2CWEA 1M1AC 1ULYA 4WNNA 4XZQA 3VH5A 3A6NB 4KUDA 5B1MB 5GSUD 3AN2B 3TU4D 3MGPB 2PYOB 4ZBJB 5CPJC 3LELC 1BH9A 5BS7C 2CV5A 5AV8B 1F66A 4H9NB 3AZMD 5BT1D 1M1AD 3WAAA 5DNMA 1M18C 3X1TB 2YFVA 5GXQC 3AV1B 3X1VA 5JA4B 4CSRB 5CPJD 4NE5A 3LELD 5B2JB 5AV9A 1S32A 4JJNB 3KXBA 3REIA 5B0ZC 1M18D 5GXQD 1P3BA 2NZDB 3AZGC 1P3AC 2F8NK 3AFAB 3W96C 2RVQC 5CP6A 1H3OA 3AZKB 5B0ZD 3AYWB 5B0YC 4XZQB 4ZUXC 4G91B 3AZFB 5CPKC 4KUDB 1P3FC 3B0DB 3W99B 1P3PC 3O62A 3B6GD 3AZLA 3AZGD 1P3AD 1WWIA 3LJAD 4H9PA 5AV5C 2CV5B 3UT9A 1EQZA 3W96D 4WZSB 2RVQD 3LZ0B 3MGRB 3C1BA 2F8NH 4WU9A 1R4VA 5B0YD 4ZUXD 5B33C 5AVBB 5DNMB 5CPKD 4XUJC 4J8UA 1P3FD 1HQ3A 3X1UC 4J8WC 1P3PD 5B32G 3MGQA 5GT0A 3MGSB 4J8VC 2F8ND 3KWQC 5AV5D 3REKB 4H9RB 2NQBB 1P3OA 1S32B 1U35B 3W98B 5B33D 1TZYC 3V9RA 5AY8A 4XUJD 3X1SA 1KX4D 1ID3A 3X1UD 4J8WD 2L5AA 5B31A 3UTAC 5B2IC 1P3LA 5AVCA 3W97B 4J8VD 2AROA 2HIOB 5B40A 3KWQD 4R8PA 3LZ1C 5B32B 1M19D 5BNVA 1P3IA 1TZYD 4Z66A 5B2ID 3UTAD 3AV2A 3AZLB 5F99C 1P3KA 3AZEC 3WTPB 3LZ1D 4Z5TA 3RELA 5CPIB 3B6FB 4KGCA 4E45A 5E5AA 4WU9B 5JRGC 3NQJA 3AZNC 4X23C 1P34C 5DNNA 3REJB 1ZLAA 5F99D 4H9QB 4QLCB 5GT0B 3AZED 3A6NC 5GSUA 5B1MC 3AN2C 3TU4A 3MGPC 3C1CB 2PYOC 4WU8B 1Q9CA 4ZBJC 3AZND 5AV6A 5AV8C 4X23D 1P34D 5B1LB 3AZMA 3VH5T 1M1AA 2BYKA 1KX5B 3A6ND 3X1TC 5B1MD 3AN2D 3AV1C 3VH6A 3MVDB 3MGPD 1KX3B 2PYOD 4UUZB 5CPJA 4YS3B 3WKJA 5B2JC 5AV8D 4H9OA 2BYMB 4JJNC 5BO0A 4Z66B 1M18A 3X1TD 2IO5B 5GXQA 1P3KB 3AV1D 4KHAA 3NQUA 2FJ7B 2NZDC 4Z2MG 3MNNB 3WA9B 5B2JD 4NE3A 4YM6B 5E5AB 3UTBB 3AFAC 4LD9B 4JJND 3AZJB 5B0ZA 3AZKC 1ZLAB 3AYWC 4XZQC 5GT3B 4G91C 5G49A 3AZFC 1JFIB 2NZDD 4KUDC 4NFTA 3B0DC 5FUGA 3B6GA 3W99C 3REHB 3AZGA 1P3AA 3LJAA 2JSSA 1P3MA 3AFAD 1N1JB 2CV5C 5AV6B 5KDMB 5B24B 3LZ0C 3MGRC 3AZHB 3AZKD 5B0YA 3AYWD 4ZUXA 4XZQD 1P3GB 3KUYB 1A7WA 4NE6A 5AVBC 5DNMC 3AZFD 5CPKA 1P3FA 4KUDD 1P3PA 3W99D 4WNNB 3MGSC 2F8NA 3WKJB 5AV5A 3REKC 2NQBC
chains in the Genus database with same CATH superfamily
1S32C 3LZ0D 3MGRD 1BH9B 2G5IC 2HUEB 4J8XA 1U35C 5B33A 1F66B 3W98C 5AVBD 5DNMD 1KX4A 3X1UA 3WAAB 4J8WA 2W8SA 4J8VA 3W97C 3MGSD 3R45A 3KWQA 2HIOC 2Y2KA 2YFVB 3REKD 3X1VB 2NQBD 3AZIA 1S32D 1M19A 5B32C 1U35D 3W98D 1TZYA 5AV9B 1AOIA 3UTAA 3KXBB 3REIB 3B6GB 3W97D 3AZLC 2HIOD 3LJAB 1P3BB 1BH8A 2YFWA 1BFMA 1P3MB 1HTAA 4E44A 3WTPC 3LZ1A 4AWLB 5B32D 1TAFA 5CPIC 3B6FC 4WU9C 5CP6B 3VH6W 1H3OB 3REJC 5F99A 3AZLD 4HGAB 4QLCC 5GT0C 3AZEA 3WTPD 3O62B 5CPID 3B6FD 3C1CC 4H9PB 4WU8C 4WU9D 4J8XB 3AZNA 3UT9B 1EQZB 4X23A 2BG1A 1P34A 2Y2LA 5B31G 5B1LC 3C1BB 3REJD 4QLCD 5GT0D 1KX5C 4J8UB 3A6NA 1HQ3B 5B1MA 2G5HC 3AN2A 3MGQB 3MVDC 3MGPA 1KX3C 3C1CD 3AZIB 2PYOA 4WU8D 1M19B 4H9SA 4YS3C 4G92B 5AV8A 4WJ3C 4H9NA 3B0CW 1P3OB 5B1LD 1AOIB 5JRGD 4Z66C 3V9RB 5C3IB 5AY8B 3X1SB 1KX5D 1ID3B 3VH6T 4EO5B 2IO5C 2XD1A 3AV1A 1P3KC 2YFWB 5B31B 3MVDD 5JA4A 1P3LB 1KX3D 5AVCB 3MNNC 2FJ7C 2Y2GA 4CSRA 2AROB 3WA9C 4YS3D 5B40B 5B2JA 4R8PB 4YM6C 4M6BA 5E5AC 3UTBC 3LELA 4JJNA 4LD9C 5BNVB 5BS7A 1P3IB 4Z66D 3AZJC 4WV4B 1ZLAC 1F1EA 5GT3C 2FJ7D 2NZDA 1T3UA 3MNND 3AV2B 3WA9D 3B0BA 3REHC 1B6WA 4YM6D 5E5AD 3AFAA 3UTBD 2Y2PA 4Z5TB 3RELB 4LD9D 5AV6C 5B24C 3AZJD 3AZMC 3B0CT 4KGCB 3AZKA 1ZLAD 3AZHC 5CHLB 3AYWA 3NQJB 5BNXA 1P3GC 4Z2MH 5GT3D 3KUYC 5DNNB 3AZFA 3W99A 3REHD 3WKJC 5GSUB 3KSYA 3TU4B 2Y2NA 5AV6D 5B24D 3LZ0A 3MGRA 3AZHD 2HUEC 3W96A 1P3GD 3KUYD 5AVBA 1F66C 3AZMB 1M1AB 3WAAC 2BYKB 3MGSA 3WKJD 3REKA 4H9RA 3X1VC 2NQBA 5CPJB 3LELB 1U35A 3W98A 2CV5D 1F66D 1KU5A 4H9OB 5AV9C 5BO0B 3WAAD 3KXBC 4XUJA 3REIC 3W97A 1M18B 3B6GC 2HIOA 5GXQB 4KHAB 3LJAC 3X1VD 1P3BC 3NQUB 1P3MC 4AWLC 5B32A 5AV9D 5BNXB 5CP6C 3KXBD 3REID 5B0ZB 2F8NG 1P3BD 4HGAC 5G49B 5B2IA 3WTPA 1P3MD 5FUGB 1B67A 3O62C 5CPIA 3H0LC 3AZGB 1P3AB 3B6FA 3EPHA 4J8XC 3W96B 3UT9C 1EQZC 1KX4C 5CP6D 3REJA 3C1BC 2VQRA 5B0YB 4ZUXB 4H9QA 4QLCA 5CPKB 4J8UC 1P3FB 4CAYA 1HQ3C 1P3PB 3O62D 3MGQC 3C1CA 3AZIC 4WU8A 1M19C 2F8NB 5AV5B 4J8XD 3UT9D 1EQZD 4G92C 1P3OC 5B1LA 1WWSA 3C1BD 3AL0C 1AOIC 5JRGA 5B33B 3P5JB 5C3IC 5AY8C 4XUJB 4J8UD 3X1SC 1KX4B 1KX5A 1ID3C 1HQ3D 3X1UB 4J8WB 4EO5C 5B31C 3MVDA 3MGQD 1P3LC 3EPLA 1KX3A 5AVCC 4DRAA 4UUZA 3AZID 4J8VB 2AROC 3A1KA 3R45B 3KWQB 5B40C 4YS3A 4R8PC 1P3OD 3VH5W 2BYMA 1AOID 1P3IC 1TZYB 5AY8D 3X1SD 4DRBA 1ID3D 3UTAB 5B31D 5B2IB 1P3LD 2FJ7A 3MNNA 5AVCD 3AV2C 3WA9A 2AROD 3X1TA 5B40D 1BH8B 4R8PD 4YM6A 3LZ1B 1Z2CB 3UTBA 4LD9A 2F2AC 4Z5TC 1TAFB 3RELC 1P3ID 3AZJA 4KGCC 3KFUG 2LY8A 2DF4C 5GT3A 5DNNC 4CAYB 1JFIA 3AV2D 5F99B 2ZY3A 3REHA 1P3KD 3AZEB 4H9SC 5GSUC 1N1JA 4Z5TD 3TU4C 3RELD 5KDMA 5B24A 3WTPE 4KGCD 3AZHA 5JRGB 3AZNB 1P3GA 4X23B 3KUYA 1P34B 3F6TA 5DNND 5BT1C 2CWEA 1M1AC 2Y2MA 1ULYA 4WNNA 4XZQA 3VH5A 3A6NB 4KUDA 5B1MB 5GSUD 3AN2B 3TU4D 3MGPB 2PYOB 4ZBJB 5CPJC 3LELC 1BH9A 5BS7C 2CV5A 5AV8B 1F66A 4H9NB 3AZMD 5BT1D 1M1AD 3WAAA 5DNMA 1M18C 3X1TB 2YFVA 5GXQC 3AV1B 3X1VA 3EG5B 5JA4B 4CSRB 5CPJD 2ZY2A 4NE5A 3LELD 5B2JB 3H0RC 3IP4C 5AV9A 1S32A 4JJNB 3KXBA 3REIA 5B0ZC 1M18D 5GXQD 1P3BA 2NZDB 3AZGC 1P3AC 2F8NK 3AFAB 3W96C 2ZY4A 2RVQC 5CP6A 1H3OA 3AZKB 5B0ZD 3AYWB 5B0YC 4XZQB 4ZUXC 4G91B 3AZFB 5CPKC 4KUDB 1P3FC 2Y2QA 3B0DB 3W99B 1P3PC 3O62A 3B6GD 3AZLA 3AZGD 1P3AD 1WWIA 3LJAD 4H9PA 5AV5C 2CV5B 3UT9A 1EQZA 3W96D 4WZSB 2RVQD 3LZ0B 3MGRB 3C1BA 2F8NH 4WU9A 1R4VA 5B0YD 4ZUXD 5B33C 5AVBB 5DNMB 5CPKD 4UPKA 4XUJC 4J8UA 1P3FD 1HQ3A 3X1UC 4J8WC 1P3PD 5B32G 3MGQA 5GT0A 3MGSB 4J8VC 2F8ND 2Y2OA 3KWQC 5AV5D 3REKB 3H0MC 4H9RB 2NQBB 1P3OA 1S32B 1U35B 3W98B 5B33D 1TZYC 3V9RA 5AY8A 4XUJD 3X1SA 1KX4D 1ID3A 3X1UD 4J8WD 2L5AA 5B31A 3UTAC 5B2IC 1P3LA 5AVCA 3W97B 4J8VD 2AROA 2HIOB 5B40A 3KWQD 4R8PA 3LZ1C 5B32B 1M19D 5BNVA 1P3IA 1TZYD 4Z66A 5B2ID 3UTAD 3AV2A 3AZLB 5F99C 1P3KA 3AZEC 3WTPB 3LZ1D 4Z5TA 3RELA 5CPIB 3B6FB 2UWXA 2Y2JA 4KGCA 4E45A 5E5AA 4WU9B 3A1IA 5JRGC 3NQJA 3AZNC 4X23C 1P34C 5DNNA 3EPJA 3REJB 1ZLAA 5F99D 4H9QB 4QLCB 5GT0B 3AZED 2J8PA 3A6NC 5GSUA 5B1MC 3AN2C 3TU4A 3MGPC 3C1CB 2PYOC 4WU8B 1Q9CA 4ZBJC 3AZND 5AV6A 5AV8C 4X23D 1P34D 5B1LB 3AZMA 3VH5T 2JE5A 1M1AA 2BYKA 2Y2HA 1KX5B 3A6ND 3X1TC 5B1MD 3AN2D 3AV1C 3VH6A 3MVDB 3MGPD 1KX3B 2PYOD 4UUZB 5CPJA 4YS3B 3WKJA 5B2JC 2RIQA 2FFFB 1PZRA 5AV8D 4H9OA 2DQNC 2BYMB 4JJNC 5BO0A 3FDDA 4Z66B 1M18A 3X1TD 2IO5B 5GXQA 1P3KB 3AV1D 4KHAA 3NQUA 2FJ7B 2NZDC 4Z2MG 3MNNB 3WA9B 2JCHA 5B2JD 4NE3A 4YM6B 5E5AB 3UTBB 3AFAC 2ZM5A 4JJND 4LD9B 3AZJB 2Y2IA 5B0ZA 3AZKC 1ZLAB 3AYWC 4XZQC 5GT3B 4G91C 5G49A 3AZFC 1JFIB 2NZDD 4KUDC 4NFTA 3B0DC 5FUGA 3EPKA 3B6GA 3W99C 3REHB 2ZY5A 3AZGA 4DQYB 1P3AA 3LJAA 2JSSA 1P3MA 3AFAD 1N1JB 2XD5A 2CV5C 5AV6B 5KDMB 5B24B 3LZ0C 3MGRC 3AZHB 3AZKD 5B0YA 3AYWD 4ZUXA 4XZQD 1P3GB 3KUYB 1A7WA 4NE6A 5AVBC 5DNMC 3AZFD 5CPKA 1P3FA 4KUDD 1P3PA 3W99D 4WNNB 1W2EA 3MGSC 2F8NA 3WKJB 5AV5A 3REKC 2NQBC
chains in the Genus database with same CATH topology
1S32C 3LZ0D 3MGRD 1BH9B 2G5IC 2HUEB 4J8XA 1U35C 5B33A 1F66B 3W98C 5AVBD 5DNMD 1KX4A 3X1UA 3WAAB 4J8WA 2W8SA 4J8VA 3W97C 3MGSD 3R45A 3KWQA 2HIOC 2Y2KA 2YFVB 3REKD 3X1VB 2NQBD 3AZIA 1S32D 1M19A 5B32C 1U35D 3W98D 1TZYA 5AV9B 1AOIA 3UTAA 3KXBB 3REIB 3B6GB 3W97D 3AZLC 2HIOD 3LJAB 1P3BB 1BH8A 2YFWA 1BFMA 1P3MB 1HTAA 4E44A 3WTPC 3LZ1A 4AWLB 5B32D 1TAFA 5CPIC 3B6FC 4WU9C 5CP6B 3VH6W 1H3OB 3REJC 5F99A 3AZLD 4HGAB 4QLCC 5GT0C 3AZEA 3WTPD 3O62B 5CPID 3B6FD 3C1CC 4H9PB 4WU8C 4WU9D 4J8XB 3AZNA 3UT9B 1EQZB 4X23A 2BG1A 1P34A 2Y2LA 5B31G 5B1LC 3C1BB 3REJD 4QLCD 5GT0D 1KX5C 4J8UB 3A6NA 1HQ3B 5B1MA 2G5HC 3AN2A 3MGQB 3MVDC 3MGPA 1KX3C 3C1CD 3AZIB 2PYOA 4WU8D 1M19B 4H9SA 4YS3C 4G92B 5AV8A 4WJ3C 4H9NA 3B0CW 1P3OB 5B1LD 1AOIB 5JRGD 4Z66C 3V9RB 5C3IB 5AY8B 3X1SB 1KX5D 1ID3B 3VH6T 4EO5B 2IO5C 2XD1A 3AV1A 1P3KC 2YFWB 5B31B 3MVDD 5JA4A 1P3LB 1KX3D 5AVCB 3MNNC 2FJ7C 2Y2GA 4CSRA 2AROB 3WA9C 4YS3D 5B40B 5B2JA 4R8PB 4YM6C 4M6BA 5E5AC 3UTBC 3LELA 4JJNA 4LD9C 5BNVB 5BS7A 1P3IB 4Z66D 3AZJC 4WV4B 1ZLAC 1F1EA 5GT3C 2FJ7D 2NZDA 1T3UA 3MNND 3AV2B 3WA9D 3B0BA 3REHC 1B6WA 4YM6D 5E5AD 3AFAA 3UTBD 2Y2PA 4Z5TB 3RELB 4LD9D 5AV6C 5B24C 3AZJD 3AZMC 3B0CT 4KGCB 3AZKA 1ZLAD 3AZHC 5CHLB 3AYWA 3NQJB 5BNXA 1P3GC 4Z2MH 5GT3D 3KUYC 5DNNB 3AZFA 3W99A 3REHD 3WKJC 5GSUB 3KSYA 3TU4B 2Y2NA 5AV6D 5B24D 3LZ0A 3MGRA 3AZHD 2HUEC 3W96A 1P3GD 3KUYD 5AVBA 1F66C 3AZMB 1M1AB 3WAAC 2BYKB 3MGSA 3WKJD 3REKA 4H9RA 3X1VC 2NQBA 5CPJB 3LELB 1U35A 3W98A 2CV5D 1F66D 1KU5A 4H9OB 5AV9C 5BO0B 3WAAD 3KXBC 4XUJA 3REIC 3W97A 1M18B 3B6GC 2HIOA 5GXQB 4KHAB 3LJAC 3X1VD 1P3BC 3NQUB 1P3MC 4AWLC 5B32A 5AV9D 5BNXB 5CP6C 3KXBD 3REID 5B0ZB 2F8NG 1P3BD 4HGAC 5G49B 5B2IA 3WTPA 1P3MD 5FUGB 1B67A 3O62C 5CPIA 3H0LC 3AZGB 1P3AB 3B6FA 3EPHA 4J8XC 3W96B 3UT9C 1EQZC 1KX4C 5CP6D 3REJA 3C1BC 2VQRA 5B0YB 4ZUXB 4H9QA 4QLCA 5CPKB 4J8UC 1P3FB 4CAYA 1HQ3C 1P3PB 3O62D 3MGQC 3C1CA 3AZIC 4WU8A 1M19C 2F8NB 5AV5B 4J8XD 3UT9D 1EQZD 4G92C 1P3OC 5B1LA 1WWSA 3C1BD 3AL0C 1AOIC 5JRGA 5B33B 3P5JB 5C3IC 5AY8C 4XUJB 4J8UD 3X1SC 1KX4B 1KX5A 1ID3C 1HQ3D 3X1UB 4J8WB 4EO5C 5B31C 3MVDA 3MGQD 1P3LC 3EPLA 1KX3A 5AVCC 4DRAA 4UUZA 3AZID 4J8VB 2AROC 3A1KA 3R45B 3KWQB 5B40C 4YS3A 4R8PC 1P3OD 3VH5W 2BYMA 1AOID 1P3IC 1TZYB 5AY8D 3X1SD 4DRBA 1ID3D 3UTAB 5B31D 5B2IB 1P3LD 2FJ7A 3MNNA 5AVCD 3AV2C 3WA9A 2AROD 3X1TA 5B40D 1BH8B 4R8PD 4YM6A 3LZ1B 1Z2CB 3UTBA 4LD9A 2F2AC 4Z5TC 1TAFB 3RELC 1P3ID 3AZJA 4KGCC 3KFUG 2LY8A 2DF4C 5GT3A 5DNNC 4CAYB 1JFIA 3AV2D 5F99B 2ZY3A 3REHA 1P3KD 3AZEB 4H9SC 5GSUC 1N1JA 4Z5TD 3TU4C 3RELD 5KDMA 5B24A 3WTPE 4KGCD 3AZHA 5JRGB 3AZNB 1P3GA 4X23B 3KUYA 1P34B 3F6TA 5DNND 5BT1C 2CWEA 1M1AC 2Y2MA 1ULYA 4WNNA 4XZQA 3VH5A 3A6NB 4KUDA 5B1MB 5GSUD 3AN2B 3TU4D 3MGPB 2PYOB 4ZBJB 5CPJC 3LELC 1BH9A 5BS7C 2CV5A 5AV8B 1F66A 4H9NB 3AZMD 5BT1D 1M1AD 3WAAA 5DNMA 1M18C 3X1TB 2YFVA 5GXQC 3AV1B 3X1VA 3EG5B 5JA4B 4CSRB 5CPJD 2ZY2A 4NE5A 3LELD 5B2JB 3H0RC 3IP4C 5AV9A 1S32A 4JJNB 3KXBA 3REIA 5B0ZC 1M18D 5GXQD 1P3BA 2NZDB 3AZGC 1P3AC 2F8NK 3AFAB 3W96C 2ZY4A 2RVQC 5CP6A 1H3OA 3AZKB 5B0ZD 3AYWB 5B0YC 4XZQB 4ZUXC 4G91B 3AZFB 5CPKC 4KUDB 1P3FC 2Y2QA 3B0DB 3W99B 1P3PC 3O62A 3B6GD 3AZLA 3AZGD 1P3AD 1WWIA 3LJAD 4H9PA 5AV5C 2CV5B 3UT9A 1EQZA 3W96D 4WZSB 2RVQD 3LZ0B 3MGRB 3C1BA 2F8NH 4WU9A 1R4VA 5B0YD 4ZUXD 5B33C 5AVBB 5DNMB 5CPKD 4UPKA 4XUJC 4J8UA 1P3FD 1HQ3A 3X1UC 4J8WC 1P3PD 5B32G 3MGQA 5GT0A 3MGSB 4J8VC 2F8ND 2Y2OA 3KWQC 5AV5D 3REKB 3H0MC 4H9RB 2NQBB 1P3OA 1S32B 1U35B 3W98B 5B33D 1TZYC 3V9RA 5AY8A 4XUJD 3X1SA 1KX4D 1ID3A 3X1UD 4J8WD 2L5AA 5B31A 3UTAC 5B2IC 1P3LA 5AVCA 3W97B 4J8VD 2AROA 2HIOB 5B40A 3KWQD 4R8PA 3LZ1C 5B32B 1M19D 5BNVA 1P3IA 1TZYD 4Z66A 5B2ID 3UTAD 3AV2A 3AZLB 5F99C 1P3KA 3AZEC 3WTPB 3LZ1D 4Z5TA 3RELA 5CPIB 3B6FB 2UWXA 2Y2JA 4KGCA 4E45A 5E5AA 4WU9B 3A1IA 5JRGC 3NQJA 3AZNC 4X23C 1P34C 5DNNA 3EPJA 3REJB 1ZLAA 5F99D 4H9QB 4QLCB 5GT0B 3AZED 2J8PA 3A6NC 5GSUA 5B1MC 3AN2C 3TU4A 3MGPC 3C1CB 2PYOC 4WU8B 1Q9CA 4ZBJC 3AZND 5AV6A 5AV8C 4X23D 1P34D 5B1LB 3AZMA 3VH5T 2JE5A 1M1AA 2BYKA 2Y2HA 1KX5B 3A6ND 3X1TC 5B1MD 3AN2D 3AV1C 3VH6A 3MVDB 3MGPD 1KX3B 2PYOD 4UUZB 5CPJA 4YS3B 3WKJA 5B2JC 2RIQA 2FFFB 1PZRA 5AV8D 4H9OA 2DQNC 2BYMB 4JJNC 5BO0A 3FDDA 4Z66B 1M18A 3X1TD 2IO5B 5GXQA 1P3KB 3AV1D 4KHAA 3NQUA 2FJ7B 2NZDC 4Z2MG 3MNNB 3WA9B 2JCHA 5B2JD 4NE3A 4YM6B 5E5AB 3UTBB 3AFAC 2ZM5A 4JJND 4LD9B 3AZJB 2Y2IA 5B0ZA 3AZKC 1ZLAB 3AYWC 4XZQC 5GT3B 4G91C 5G49A 3AZFC 1JFIB 2NZDD 4KUDC 4NFTA 3B0DC 5FUGA 3EPKA 3B6GA 3W99C 3REHB 2ZY5A 3AZGA 4DQYB 1P3AA 3LJAA 2JSSA 1P3MA 3AFAD 1N1JB 2XD5A 2CV5C 5AV6B 5KDMB 5B24B 3LZ0C 3MGRC 3AZHB 3AZKD 5B0YA 3AYWD 4ZUXA 4XZQD 1P3GB 3KUYB 1A7WA 4NE6A 5AVBC 5DNMC 3AZFD 5CPKA 1P3FA 4KUDD 1P3PA 3W99D 4WNNB 1W2EA 3MGSC 2F8NA 3WKJB 5AV5A 3REKC 2NQBC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1S32 C;  3LZ0 D;  3MGR D;  1BH9 B;  1U35 C;  2HUE B;  4J8X A;  3W98 C;  5B33 A;  1F66 B;  5AVB D;  5DNM D;  1KX4 A;  3X1U A;  3WAA B;  4J8W A;  4J8V A;  3W97 C;  3MGS D;  3R45 A;  3KWQ A;  2HIO C;  2YFV B;  3REK D;  3X1V B;  2NQB D;  3AZI A;  1S32 D;  1M19 A;  5B32 C;  1U35 D;  3W98 D;  1TZY A;  5AV9 B;  1AOI A;  3UTA A;  3KXB B;  3REI B;  3B6G B;  3W97 D;  3AZL C;  2HIO D;  3LJA B;  1P3B B;  1BH8 A;  2YFW A;  1BFM A;  1P3M B;  1HTA A;  4E44 A;  3WTP C;  3LZ1 A;  4AWL B;  5B32 D;  1TAF A;  5CPI C;  3B6F C;  4WU9 C;  5CP6 B;  3VH6 W;  1H3O B;  3REJ C;  5F99 A;  3AZL D;  4HGA B;  4QLC C;  5GT0 C;  3AZE A;  3WTP D;  3O62 B;  5CPI D;  3B6F D;  3C1C C;  4H9P B;  4WU8 C;  4WU9 D;  4J8X B;  3AZN A;  3UT9 B;  1EQZ B;  4X23 A;  1P34 A;  5B31 G;  5B1L C;  3C1B B;  3REJ D;  4QLC D;  5GT0 D;  1KX5 C;  4J8U B;  3A6N A;  1HQ3 B;  5B1M A;  3AN2 A;  3MGQ B;  3MVD C;  3MGP A;  1KX3 C;  3C1C D;  3AZI B;  2PYO A;  4WU8 D;  1M19 B;  4H9S A;  4YS3 C;  4G92 B;  5AV8 A;  4H9N A;  3B0C W;  1P3O B;  5B1L D;  1AOI B;  5JRG D;  4Z66 C;  3V9R B;  5C3I B;  5AY8 B;  3X1S B;  1KX5 D;  1ID3 B;  3VH6 T;  4EO5 B;  2IO5 C;  3AV1 A;  1P3K C;  2YFW B;  5B31 B;  3MVD D;  5JA4 A;  1P3L B;  1KX3 D;  5AVC B;  3MNN C;  2FJ7 C;  4CSR A;  2ARO B;  3WA9 C;  4YS3 D;  5B40 B;  5B2J A;  4R8P B;  4YM6 C;  4M6B A;  5E5A C;  3UTB C;  3LEL A;  4JJN A;  4LD9 C;  5BNV B;  5BS7 A;  1P3I B;  4Z66 D;  3AZJ C;  4WV4 B;  1ZLA C;  1F1E A;  5GT3 C;  2FJ7 D;  2NZD A;  3MNN D;  3AV2 B;  3WA9 D;  3B0B A;  3REH C;  1B6W A;  4YM6 D;  5E5A D;  3AFA A;  3UTB D;  4Z5T B;  4LD9 D;  3REL B;  5AV6 C;  5B24 C;  3AZJ D;  3AZM C;  3B0C T;  4KGC B;  3AZK A;  1ZLA D;  3AZH C;  5CHL B;  3AYW A;  3NQJ B;  5BNX A;  1P3G C;  4Z2M H;  5GT3 D;  3KUY C;  5DNN B;  3AZF A;  3W99 A;  3REH D;  3WKJ C;  5GSU B;  3KSY A;  3TU4 B;  5AV6 D;  5B24 D;  3LZ0 A;  3MGR A;  3AZH D;  2HUE C;  3W96 A;  1P3G D;  3KUY D;  5AVB A;  1F66 C;  3AZM B;  1M1A B;  3WAA C;  2BYK B;  3MGS A;  3WKJ D;  3REK A;  4H9R A;  3X1V C;  2NQB A;  5CPJ B;  3LEL B;  1U35 A;  3W98 A;  2CV5 D;  1F66 D;  1KU5 A;  4H9O B;  5AV9 C;  5BO0 B;  3WAA D;  3KXB C;  4XUJ A;  3REI C;  3W97 A;  1M18 B;  3B6G C;  2HIO A;  5GXQ B;  4KHA B;  3LJA C;  3X1V D;  1P3B C;  3NQU B;  1P3M C;  4AWL C;  5B32 A;  5AV9 D;  5BNX B;  5CP6 C;  3KXB D;  3REI D;  5B0Z B;  2F8N G;  1P3B D;  4HGA C;  5G49 B;  5B2I A;  3WTP A;  1P3M D;  5FUG B;  1B67 A;  3O62 C;  5CPI A;  3B6F A;  3AZG B;  1P3A B;  4J8X C;  3W96 B;  3UT9 C;  1EQZ C;  1KX4 C;  5CP6 D;  3REJ A;  3C1B C;  5B0Y B;  4ZUX B;  4H9Q A;  4QLC A;  5CPK B;  4J8U C;  1P3F B;  4CAY A;  1HQ3 C;  1P3P B;  3O62 D;  3MGQ C;  3C1C A;  3AZI C;  4WU8 A;  1M19 C;  2F8N B;  5AV5 B;  4J8X D;  3UT9 D;  1EQZ D;  4G92 C;  1P3O C;  5B1L A;  1WWS A;  3C1B D;  1AOI C;  5JRG A;  5B33 B;  1KX5 A;  5C3I C;  5AY8 C;  4XUJ B;  4J8U D;  3X1S C;  1KX4 B;  1ID3 C;  1HQ3 D;  3X1U B;  4J8W B;  4EO5 C;  5B31 C;  3MVD A;  3MGQ D;  1P3L C;  1KX3 A;  5AVC C;  4DRA A;  4UUZ A;  3AZI D;  4J8V B;  2ARO C;  3R45 B;  3KWQ B;  4YS3 A;  5B40 C;  4R8P C;  1P3O D;  3VH5 W;  2BYM A;  1AOI D;  1P3I C;  1TZY B;  5AY8 D;  3X1S D;  4DRB A;  1ID3 D;  3UTA B;  5B31 D;  5B2I B;  1P3L D;  2FJ7 A;  3MNN A;  5AVC D;  3AV2 C;  3WA9 A;  2ARO D;  3X1T A;  5B40 D;  1BH8 B;  4R8P D;  4YM6 A;  3LZ1 B;  3UTB A;  4LD9 A;  4Z5T C;  1TAF B;  3REL C;  1P3I D;  3AZJ A;  4KGC C;  2LY8 A;  5GT3 A;  5DNN C;  4CAY B;  1JFI A;  3AV2 D;  5F99 B;  3REH A;  1P3K D;  3AZE B;  4H9S C;  5GSU C;  1N1J A;  4Z5T D;  3TU4 C;  3REL D;  5KDM A;  5B24 A;  3WTP E;  4KGC D;  3AZH A;  5JRG B;  3AZN B;  1P3G A;  4X23 B;  3KUY A;  1P34 B;  5DNN D;  5BT1 C;  2CWE A;  1M1A C;  1ULY A;  4WNN A;  4XZQ A;  3VH5 A;  3A6N B;  4KUD A;  5B1M B;  5GSU D;  3AN2 B;  3TU4 D;  3MGP B;  2PYO B;  4ZBJ B;  5CPJ C;  3LEL C;  1BH9 A;  5BS7 C;  2CV5 A;  5AV8 B;  1F66 A;  4H9N B;  3AZM D;  5BT1 D;  1M1A D;  3WAA A;  5DNM A;  1M18 C;  3X1T B;  2YFV A;  5GXQ C;  3AV1 B;  3X1V A;  5JA4 B;  4CSR B;  5CPJ D;  4NE5 A;  3LEL D;  5B2J B;  5AV9 A;  1S32 A;  4JJN B;  3KXB A;  3REI A;  5B0Z C;  1M18 D;  5GXQ D;  1P3B A;  2NZD B;  3AZG C;  1P3A C;  2F8N K;  3AFA B;  3W96 C;  2RVQ C;  5CP6 A;  1H3O A;  3AZK B;  5B0Z D;  3AYW B;  5B0Y C;  4XZQ B;  4ZUX C;  4G91 B;  3AZF B;  5CPK C;  4KUD B;  1P3F C;  3B0D B;  3W99 B;  1P3P C;  3O62 A;  3B6G D;  3AZL A;  3AZG D;  1P3A D;  1WWI A;  3LJA D;  4H9P A;  5AV5 C;  2CV5 B;  3UT9 A;  1EQZ A;  3W96 D;  4WZS B;  2RVQ D;  3LZ0 B;  3MGR B;  3C1B A;  2F8N H;  4WU9 A;  1R4V A;  5B0Y D;  4ZUX D;  5B33 C;  5AVB B;  5DNM B;  5CPK D;  4XUJ C;  4J8U A;  1P3F D;  1HQ3 A;  3X1U C;  4J8W C;  1P3P D;  5B32 G;  3MGQ A;  5GT0 A;  3MGS B;  4J8V C;  2F8N D;  3KWQ C;  5AV5 D;  3REK B;  4H9R B;  2NQB B;  1P3O A;  1S32 B;  1U35 B;  3W98 B;  5B33 D;  1TZY C;  3V9R A;  5AY8 A;  4XUJ D;  3X1S A;  1KX4 D;  1ID3 A;  3X1U D;  4J8W D;  2L5A A;  5B31 A;  3UTA C;  5B2I C;  1P3L A;  5AVC A;  3W97 B;  4J8V D;  2ARO A;  2HIO B;  5B40 A;  3KWQ D;  4R8P A;  3LZ1 C;  5B32 B;  1M19 D;  5BNV A;  1P3I A;  1TZY D;  4Z66 A;  5B2I D;  3UTA D;  3AV2 A;  3AZL B;  5F99 C;  1P3K A;  3AZE C;  3WTP B;  3LZ1 D;  4Z5T A;  3REL A;  5CPI B;  3B6F B;  4KGC A;  4E45 A;  5E5A A;  4WU9 B;  5JRG C;  3NQJ A;  3AZN C;  4X23 C;  1P34 C;  5DNN A;  3REJ B;  1ZLA A;  5F99 D;  4H9Q B;  4QLC B;  5GT0 B;  3AZE D;  3A6N C;  5GSU A;  5B1M C;  3AN2 C;  3TU4 A;  3MGP C;  3C1C B;  2PYO C;  4WU8 B;  1Q9C A;  4ZBJ C;  3AZN D;  5AV6 A;  5AV8 C;  4X23 D;  1P34 D;  5B1L B;  3AZM A;  3VH5 T;  1M1A A;  2BYK A;  1KX5 B;  3A6N D;  3X1T C;  5B1M D;  3AN2 D;  3AV1 C;  3VH6 A;  3MVD B;  3MGP D;  1KX3 B;  2PYO D;  4UUZ B;  5CPJ A;  4YS3 B;  3WKJ A;  5B2J C;  5AV8 D;  4H9O A;  2BYM B;  4JJN C;  5BO0 A;  4Z66 B;  1M18 A;  3X1T D;  2IO5 B;  5GXQ A;  1P3K B;  3AV1 D;  4KHA A;  3NQU A;  2FJ7 B;  2NZD C;  4Z2M G;  3MNN B;  3WA9 B;  5B2J D;  4NE3 A;  4YM6 B;  5E5A B;  3UTB B;  3AFA C;  4LD9 B;  4JJN D;  3AZJ B;  5B0Z A;  3AZK C;  1ZLA B;  3AYW C;  4XZQ C;  5GT3 B;  4G91 C;  5G49 A;  3AZF C;  1JFI B;  2NZD D;  4KUD C;  4NFT A;  3B0D C;  5FUG A;  3B6G A;  3W99 C;  3REH B;  3AZG A;  1P3A A;  3LJA A;  2JSS A;  1P3M A;  3AFA D;  1N1J B;  2CV5 C;  5AV6 B;  5KDM B;  5B24 B;  3LZ0 C;  3MGR C;  3AZH B;  3AZK D;  5B0Y A;  3AYW D;  4ZUX A;  4XZQ D;  1P3G B;  3KUY B;  1A7W A;  4NE6 A;  5AVB C;  5DNM C;  3AZF D;  5CPK A;  1P3F A;  4KUD D;  1P3P A;  3W99 D;  4WNN B;  3MGS C;  2F8N A;  3WKJ B;  5AV5 A;  3REK C;  2NQB C; 
#chains in the Genus database with same CATH topology
 1S32 C;  3LZ0 D;  3MGR D;  1BH9 B;  2G5I C;  2HUE B;  4J8X A;  1U35 C;  5B33 A;  1F66 B;  3W98 C;  5AVB D;  5DNM D;  1KX4 A;  3X1U A;  3WAA B;  4J8W A;  2W8S A;  4J8V A;  3W97 C;  3MGS D;  3R45 A;  3KWQ A;  2HIO C;  2Y2K A;  2YFV B;  3REK D;  3X1V B;  2NQB D;  3AZI A;  1S32 D;  1M19 A;  5B32 C;  1U35 D;  3W98 D;  1TZY A;  5AV9 B;  1AOI A;  3UTA A;  3KXB B;  3REI B;  3B6G B;  3W97 D;  3AZL C;  2HIO D;  3LJA B;  1P3B B;  1BH8 A;  2YFW A;  1BFM A;  1P3M B;  1HTA A;  4E44 A;  3WTP C;  3LZ1 A;  4AWL B;  5B32 D;  1TAF A;  5CPI C;  3B6F C;  4WU9 C;  5CP6 B;  3VH6 W;  1H3O B;  3REJ C;  5F99 A;  3AZL D;  4HGA B;  4QLC C;  5GT0 C;  3AZE A;  3WTP D;  3O62 B;  5CPI D;  3B6F D;  3C1C C;  4H9P B;  4WU8 C;  4WU9 D;  4J8X B;  3AZN A;  3UT9 B;  1EQZ B;  4X23 A;  2BG1 A;  1P34 A;  2Y2L A;  5B31 G;  5B1L C;  3C1B B;  3REJ D;  4QLC D;  5GT0 D;  1KX5 C;  4J8U B;  3A6N A;  1HQ3 B;  5B1M A;  2G5H C;  3AN2 A;  3MGQ B;  3MVD C;  3MGP A;  1KX3 C;  3C1C D;  3AZI B;  2PYO A;  4WU8 D;  1M19 B;  4H9S A;  4YS3 C;  4G92 B;  5AV8 A;  4WJ3 C;  4H9N A;  3B0C W;  1P3O B;  5B1L D;  1AOI B;  5JRG D;  4Z66 C;  3V9R B;  5C3I B;  5AY8 B;  3X1S B;  1KX5 D;  1ID3 B;  3VH6 T;  4EO5 B;  2IO5 C;  2XD1 A;  3AV1 A;  1P3K C;  2YFW B;  5B31 B;  3MVD D;  5JA4 A;  1P3L B;  1KX3 D;  5AVC B;  3MNN C;  2FJ7 C;  2Y2G A;  4CSR A;  2ARO B;  3WA9 C;  4YS3 D;  5B40 B;  5B2J A;  4R8P B;  4YM6 C;  4M6B A;  5E5A C;  3UTB C;  3LEL A;  4JJN A;  4LD9 C;  5BNV B;  5BS7 A;  1P3I B;  4Z66 D;  3AZJ C;  4WV4 B;  1ZLA C;  1F1E A;  5GT3 C;  2FJ7 D;  2NZD A;  1T3U A;  3MNN D;  3AV2 B;  3WA9 D;  3B0B A;  3REH C;  1B6W A;  4YM6 D;  5E5A D;  3AFA A;  3UTB D;  2Y2P A;  4Z5T B;  3REL B;  4LD9 D;  5AV6 C;  5B24 C;  3AZJ D;  3AZM C;  3B0C T;  4KGC B;  3AZK A;  1ZLA D;  3AZH C;  5CHL B;  3AYW A;  3NQJ B;  5BNX A;  1P3G C;  4Z2M H;  5GT3 D;  3KUY C;  5DNN B;  3AZF A;  3W99 A;  3REH D;  3WKJ C;  5GSU B;  3KSY A;  3TU4 B;  2Y2N A;  5AV6 D;  5B24 D;  3LZ0 A;  3MGR A;  3AZH D;  2HUE C;  3W96 A;  1P3G D;  3KUY D;  5AVB A;  1F66 C;  3AZM B;  1M1A B;  3WAA C;  2BYK B;  3MGS A;  3WKJ D;  3REK A;  4H9R A;  3X1V C;  2NQB A;  5CPJ B;  3LEL B;  1U35 A;  3W98 A;  2CV5 D;  1F66 D;  1KU5 A;  4H9O B;  5AV9 C;  5BO0 B;  3WAA D;  3KXB C;  4XUJ A;  3REI C;  3W97 A;  1M18 B;  3B6G C;  2HIO A;  5GXQ B;  4KHA B;  3LJA C;  3X1V D;  1P3B C;  3NQU B;  1P3M C;  4AWL C;  5B32 A;  5AV9 D;  5BNX B;  5CP6 C;  3KXB D;  3REI D;  5B0Z B;  2F8N G;  1P3B D;  4HGA C;  5G49 B;  5B2I A;  3WTP A;  1P3M D;  5FUG B;  1B67 A;  3O62 C;  5CPI A;  3H0L C;  3AZG B;  1P3A B;  3B6F A;  3EPH A;  4J8X C;  3W96 B;  3UT9 C;  1EQZ C;  1KX4 C;  5CP6 D;  3REJ A;  3C1B C;  2VQR A;  5B0Y B;  4ZUX B;  4H9Q A;  4QLC A;  5CPK B;  4J8U C;  1P3F B;  4CAY A;  1HQ3 C;  1P3P B;  3O62 D;  3MGQ C;  3C1C A;  3AZI C;  4WU8 A;  1M19 C;  2F8N B;  5AV5 B;  4J8X D;  3UT9 D;  1EQZ D;  4G92 C;  1P3O C;  5B1L A;  1WWS A;  3C1B D;  3AL0 C;  1AOI C;  5JRG A;  5B33 B;  3P5J B;  5C3I C;  5AY8 C;  4XUJ B;  4J8U D;  3X1S C;  1KX4 B;  1KX5 A;  1ID3 C;  1HQ3 D;  3X1U B;  4J8W B;  4EO5 C;  5B31 C;  3MVD A;  3MGQ D;  1P3L C;  3EPL A;  1KX3 A;  5AVC C;  4DRA A;  4UUZ A;  3AZI D;  4J8V B;  2ARO C;  3A1K A;  3R45 B;  3KWQ B;  5B40 C;  4YS3 A;  4R8P C;  1P3O D;  3VH5 W;  2BYM A;  1AOI D;  1P3I C;  1TZY B;  5AY8 D;  3X1S D;  4DRB A;  1ID3 D;  3UTA B;  5B31 D;  5B2I B;  1P3L D;  2FJ7 A;  3MNN A;  5AVC D;  3AV2 C;  3WA9 A;  2ARO D;  3X1T A;  5B40 D;  1BH8 B;  4R8P D;  4YM6 A;  3LZ1 B;  1Z2C B;  3UTB A;  4LD9 A;  2F2A C;  4Z5T C;  1TAF B;  3REL C;  1P3I D;  3AZJ A;  4KGC C;  3KFU G;  2LY8 A;  2DF4 C;  5GT3 A;  5DNN C;  4CAY B;  1JFI A;  3AV2 D;  5F99 B;  2ZY3 A;  3REH A;  1P3K D;  3AZE B;  4H9S C;  5GSU C;  1N1J A;  4Z5T D;  3TU4 C;  3REL D;  5KDM A;  5B24 A;  3WTP E;  4KGC D;  3AZH A;  5JRG B;  3AZN B;  1P3G A;  4X23 B;  3KUY A;  1P34 B;  3F6T A;  5DNN D;  5BT1 C;  2CWE A;  1M1A C;  2Y2M A;  1ULY A;  4WNN A;  4XZQ A;  3VH5 A;  3A6N B;  4KUD A;  5B1M B;  5GSU D;  3AN2 B;  3TU4 D;  3MGP B;  2PYO B;  4ZBJ B;  5CPJ C;  3LEL C;  1BH9 A;  5BS7 C;  2CV5 A;  5AV8 B;  1F66 A;  4H9N B;  3AZM D;  5BT1 D;  1M1A D;  3WAA A;  5DNM A;  1M18 C;  3X1T B;  2YFV A;  5GXQ C;  3AV1 B;  3X1V A;  3EG5 B;  5JA4 B;  4CSR B;  5CPJ D;  2ZY2 A;  4NE5 A;  3LEL D;  5B2J B;  3H0R C;  3IP4 C;  5AV9 A;  1S32 A;  4JJN B;  3KXB A;  3REI A;  5B0Z C;  1M18 D;  5GXQ D;  1P3B A;  2NZD B;  3AZG C;  1P3A C;  2F8N K;  3AFA B;  3W96 C;  2ZY4 A;  2RVQ C;  5CP6 A;  1H3O A;  3AZK B;  5B0Z D;  3AYW B;  5B0Y C;  4XZQ B;  4ZUX C;  4G91 B;  3AZF B;  5CPK C;  4KUD B;  1P3F C;  2Y2Q A;  3B0D B;  3W99 B;  1P3P C;  3O62 A;  3B6G D;  3AZL A;  3AZG D;  1P3A D;  1WWI A;  3LJA D;  4H9P A;  5AV5 C;  2CV5 B;  3UT9 A;  1EQZ A;  3W96 D;  4WZS B;  2RVQ D;  3LZ0 B;  3MGR B;  3C1B A;  2F8N H;  4WU9 A;  1R4V A;  5B0Y D;  4ZUX D;  5B33 C;  5AVB B;  5DNM B;  5CPK D;  4UPK A;  4XUJ C;  4J8U A;  1P3F D;  1HQ3 A;  3X1U C;  4J8W C;  1P3P D;  5B32 G;  3MGQ A;  5GT0 A;  3MGS B;  4J8V C;  2F8N D;  2Y2O A;  3KWQ C;  5AV5 D;  3REK B;  3H0M C;  4H9R B;  2NQB B;  1P3O A;  1S32 B;  1U35 B;  3W98 B;  5B33 D;  1TZY C;  3V9R A;  5AY8 A;  4XUJ D;  3X1S A;  1KX4 D;  1ID3 A;  3X1U D;  4J8W D;  2L5A A;  5B31 A;  3UTA C;  5B2I C;  1P3L A;  5AVC A;  3W97 B;  4J8V D;  2ARO A;  2HIO B;  5B40 A;  3KWQ D;  4R8P A;  3LZ1 C;  5B32 B;  1M19 D;  5BNV A;  1P3I A;  1TZY D;  4Z66 A;  5B2I D;  3UTA D;  3AV2 A;  3AZL B;  5F99 C;  1P3K A;  3AZE C;  3WTP B;  3LZ1 D;  4Z5T A;  3REL A;  5CPI B;  3B6F B;  2UWX A;  2Y2J A;  4KGC A;  4E45 A;  5E5A A;  4WU9 B;  3A1I A;  5JRG C;  3NQJ A;  3AZN C;  4X23 C;  1P34 C;  5DNN A;  3EPJ A;  3REJ B;  1ZLA A;  5F99 D;  4H9Q B;  4QLC B;  5GT0 B;  3AZE D;  2J8P A;  3A6N C;  5GSU A;  5B1M C;  3AN2 C;  3TU4 A;  3MGP C;  3C1C B;  2PYO C;  4WU8 B;  1Q9C A;  4ZBJ C;  3AZN D;  5AV6 A;  5AV8 C;  4X23 D;  1P34 D;  5B1L B;  3AZM A;  3VH5 T;  2JE5 A;  1M1A A;  2BYK A;  2Y2H A;  1KX5 B;  3A6N D;  3X1T C;  5B1M D;  3AN2 D;  3AV1 C;  3VH6 A;  3MVD B;  3MGP D;  1KX3 B;  2PYO D;  4UUZ B;  5CPJ A;  4YS3 B;  3WKJ A;  5B2J C;  2RIQ A;  2FFF B;  1PZR A;  5AV8 D;  4H9O A;  2DQN C;  2BYM B;  4JJN C;  5BO0 A;  3FDD A;  4Z66 B;  1M18 A;  3X1T D;  2IO5 B;  5GXQ A;  1P3K B;  3AV1 D;  4KHA A;  3NQU A;  2FJ7 B;  2NZD C;  4Z2M G;  3MNN B;  3WA9 B;  2JCH A;  5B2J D;  4NE3 A;  4YM6 B;  5E5A B;  3UTB B;  3AFA C;  2ZM5 A;  4JJN D;  4LD9 B;  3AZJ B;  2Y2I A;  5B0Z A;  3AZK C;  1ZLA B;  3AYW C;  4XZQ C;  5GT3 B;  4G91 C;  5G49 A;  3AZF C;  1JFI B;  2NZD D;  4KUD C;  4NFT A;  3B0D C;  5FUG A;  3EPK A;  3B6G A;  3W99 C;  3REH B;  2ZY5 A;  3AZG A;  4DQY B;  1P3A A;  3LJA A;  2JSS A;  1P3M A;  3AFA D;  1N1J B;  2XD5 A;  2CV5 C;  5AV6 B;  5KDM B;  5B24 B;  3LZ0 C;  3MGR C;  3AZH B;  3AZK D;  5B0Y A;  3AYW D;  4ZUX A;  4XZQ D;  1P3G B;  3KUY B;  1A7W A;  4NE6 A;  5AVB C;  5DNM C;  3AZF D;  5CPK A;  1P3F A;  4KUD D;  1P3P A;  3W99 D;  4WNN B;  1W2E A;  3MGS C;  2F8N A;  3WKJ B;  5AV5 A;  3REK C;  2NQB C; 
#chains in the Genus database with same CATH homology
 1S32 C;  3LZ0 D;  3MGR D;  1BH9 B;  2G5I C;  2HUE B;  4J8X A;  1U35 C;  5B33 A;  1F66 B;  3W98 C;  5AVB D;  5DNM D;  1KX4 A;  3X1U A;  3WAA B;  4J8W A;  2W8S A;  4J8V A;  3W97 C;  3MGS D;  3R45 A;  3KWQ A;  2HIO C;  2Y2K A;  2YFV B;  3REK D;  3X1V B;  2NQB D;  3AZI A;  1S32 D;  1M19 A;  5B32 C;  1U35 D;  3W98 D;  1TZY A;  5AV9 B;  1AOI A;  3UTA A;  3KXB B;  3REI B;  3B6G B;  3W97 D;  3AZL C;  2HIO D;  3LJA B;  1P3B B;  1BH8 A;  2YFW A;  1BFM A;  1P3M B;  1HTA A;  4E44 A;  3WTP C;  3LZ1 A;  4AWL B;  5B32 D;  1TAF A;  5CPI C;  3B6F C;  4WU9 C;  5CP6 B;  3VH6 W;  1H3O B;  3REJ C;  5F99 A;  3AZL D;  4HGA B;  4QLC C;  5GT0 C;  3AZE A;  3WTP D;  3O62 B;  5CPI D;  3B6F D;  3C1C C;  4H9P B;  4WU8 C;  4WU9 D;  4J8X B;  3AZN A;  3UT9 B;  1EQZ B;  4X23 A;  2BG1 A;  1P34 A;  2Y2L A;  5B31 G;  5B1L C;  3C1B B;  3REJ D;  4QLC D;  5GT0 D;  1KX5 C;  4J8U B;  3A6N A;  1HQ3 B;  5B1M A;  2G5H C;  3AN2 A;  3MGQ B;  3MVD C;  3MGP A;  1KX3 C;  3C1C D;  3AZI B;  2PYO A;  4WU8 D;  1M19 B;  4H9S A;  4YS3 C;  4G92 B;  5AV8 A;  4WJ3 C;  4H9N A;  3B0C W;  1P3O B;  5B1L D;  1AOI B;  5JRG D;  4Z66 C;  3V9R B;  5C3I B;  5AY8 B;  3X1S B;  1KX5 D;  1ID3 B;  3VH6 T;  4EO5 B;  2IO5 C;  2XD1 A;  3AV1 A;  1P3K C;  2YFW B;  5B31 B;  3MVD D;  5JA4 A;  1P3L B;  1KX3 D;  5AVC B;  3MNN C;  2FJ7 C;  2Y2G A;  4CSR A;  2ARO B;  3WA9 C;  4YS3 D;  5B40 B;  5B2J A;  4R8P B;  4YM6 C;  4M6B A;  5E5A C;  3UTB C;  3LEL A;  4JJN A;  4LD9 C;  5BNV B;  5BS7 A;  1P3I B;  4Z66 D;  3AZJ C;  4WV4 B;  1ZLA C;  1F1E A;  5GT3 C;  2FJ7 D;  2NZD A;  1T3U A;  3MNN D;  3AV2 B;  3WA9 D;  3B0B A;  3REH C;  1B6W A;  4YM6 D;  5E5A D;  3AFA A;  3UTB D;  2Y2P A;  4Z5T B;  3REL B;  4LD9 D;  5AV6 C;  5B24 C;  3AZJ D;  3AZM C;  3B0C T;  4KGC B;  3AZK A;  1ZLA D;  3AZH C;  5CHL B;  3AYW A;  3NQJ B;  5BNX A;  1P3G C;  4Z2M H;  5GT3 D;  3KUY C;  5DNN B;  3AZF A;  3W99 A;  3REH D;  3WKJ C;  5GSU B;  3KSY A;  3TU4 B;  2Y2N A;  5AV6 D;  5B24 D;  3LZ0 A;  3MGR A;  3AZH D;  2HUE C;  3W96 A;  1P3G D;  3KUY D;  5AVB A;  1F66 C;  3AZM B;  1M1A B;  3WAA C;  2BYK B;  3MGS A;  3WKJ D;  3REK A;  4H9R A;  3X1V C;  2NQB A;  5CPJ B;  3LEL B;  1U35 A;  3W98 A;  2CV5 D;  1F66 D;  1KU5 A;  4H9O B;  5AV9 C;  5BO0 B;  3WAA D;  3KXB C;  4XUJ A;  3REI C;  3W97 A;  1M18 B;  3B6G C;  2HIO A;  5GXQ B;  4KHA B;  3LJA C;  3X1V D;  1P3B C;  3NQU B;  1P3M C;  4AWL C;  5B32 A;  5AV9 D;  5BNX B;  5CP6 C;  3KXB D;  3REI D;  5B0Z B;  2F8N G;  1P3B D;  4HGA C;  5G49 B;  5B2I A;  3WTP A;  1P3M D;  5FUG B;  1B67 A;  3O62 C;  5CPI A;  3H0L C;  3AZG B;  1P3A B;  3B6F A;  3EPH A;  4J8X C;  3W96 B;  3UT9 C;  1EQZ C;  1KX4 C;  5CP6 D;  3REJ A;  3C1B C;  2VQR A;  5B0Y B;  4ZUX B;  4H9Q A;  4QLC A;  5CPK B;  4J8U C;  1P3F B;  4CAY A;  1HQ3 C;  1P3P B;  3O62 D;  3MGQ C;  3C1C A;  3AZI C;  4WU8 A;  1M19 C;  2F8N B;  5AV5 B;  4J8X D;  3UT9 D;  1EQZ D;  4G92 C;  1P3O C;  5B1L A;  1WWS A;  3C1B D;  3AL0 C;  1AOI C;  5JRG A;  5B33 B;  3P5J B;  5C3I C;  5AY8 C;  4XUJ B;  4J8U D;  3X1S C;  1KX4 B;  1KX5 A;  1ID3 C;  1HQ3 D;  3X1U B;  4J8W B;  4EO5 C;  5B31 C;  3MVD A;  3MGQ D;  1P3L C;  3EPL A;  1KX3 A;  5AVC C;  4DRA A;  4UUZ A;  3AZI D;  4J8V B;  2ARO C;  3A1K A;  3R45 B;  3KWQ B;  5B40 C;  4YS3 A;  4R8P C;  1P3O D;  3VH5 W;  2BYM A;  1AOI D;  1P3I C;  1TZY B;  5AY8 D;  3X1S D;  4DRB A;  1ID3 D;  3UTA B;  5B31 D;  5B2I B;  1P3L D;  2FJ7 A;  3MNN A;  5AVC D;  3AV2 C;  3WA9 A;  2ARO D;  3X1T A;  5B40 D;  1BH8 B;  4R8P D;  4YM6 A;  3LZ1 B;  1Z2C B;  3UTB A;  4LD9 A;  2F2A C;  4Z5T C;  1TAF B;  3REL C;  1P3I D;  3AZJ A;  4KGC C;  3KFU G;  2LY8 A;  2DF4 C;  5GT3 A;  5DNN C;  4CAY B;  1JFI A;  3AV2 D;  5F99 B;  2ZY3 A;  3REH A;  1P3K D;  3AZE B;  4H9S C;  5GSU C;  1N1J A;  4Z5T D;  3TU4 C;  3REL D;  5KDM A;  5B24 A;  3WTP E;  4KGC D;  3AZH A;  5JRG B;  3AZN B;  1P3G A;  4X23 B;  3KUY A;  1P34 B;  3F6T A;  5DNN D;  5BT1 C;  2CWE A;  1M1A C;  2Y2M A;  1ULY A;  4WNN A;  4XZQ A;  3VH5 A;  3A6N B;  4KUD A;  5B1M B;  5GSU D;  3AN2 B;  3TU4 D;  3MGP B;  2PYO B;  4ZBJ B;  5CPJ C;  3LEL C;  1BH9 A;  5BS7 C;  2CV5 A;  5AV8 B;  1F66 A;  4H9N B;  3AZM D;  5BT1 D;  1M1A D;  3WAA A;  5DNM A;  1M18 C;  3X1T B;  2YFV A;  5GXQ C;  3AV1 B;  3X1V A;  3EG5 B;  5JA4 B;  4CSR B;  5CPJ D;  2ZY2 A;  4NE5 A;  3LEL D;  5B2J B;  3H0R C;  3IP4 C;  5AV9 A;  1S32 A;  4JJN B;  3KXB A;  3REI A;  5B0Z C;  1M18 D;  5GXQ D;  1P3B A;  2NZD B;  3AZG C;  1P3A C;  2F8N K;  3AFA B;  3W96 C;  2ZY4 A;  2RVQ C;  5CP6 A;  1H3O A;  3AZK B;  5B0Z D;  3AYW B;  5B0Y C;  4XZQ B;  4ZUX C;  4G91 B;  3AZF B;  5CPK C;  4KUD B;  1P3F C;  2Y2Q A;  3B0D B;  3W99 B;  1P3P C;  3O62 A;  3B6G D;  3AZL A;  3AZG D;  1P3A D;  1WWI A;  3LJA D;  4H9P A;  5AV5 C;  2CV5 B;  3UT9 A;  1EQZ A;  3W96 D;  4WZS B;  2RVQ D;  3LZ0 B;  3MGR B;  3C1B A;  2F8N H;  4WU9 A;  1R4V A;  5B0Y D;  4ZUX D;  5B33 C;  5AVB B;  5DNM B;  5CPK D;  4UPK A;  4XUJ C;  4J8U A;  1P3F D;  1HQ3 A;  3X1U C;  4J8W C;  1P3P D;  5B32 G;  3MGQ A;  5GT0 A;  3MGS B;  4J8V C;  2F8N D;  2Y2O A;  3KWQ C;  5AV5 D;  3REK B;  3H0M C;  4H9R B;  2NQB B;  1P3O A;  1S32 B;  1U35 B;  3W98 B;  5B33 D;  1TZY C;  3V9R A;  5AY8 A;  4XUJ D;  3X1S A;  1KX4 D;  1ID3 A;  3X1U D;  4J8W D;  2L5A A;  5B31 A;  3UTA C;  5B2I C;  1P3L A;  5AVC A;  3W97 B;  4J8V D;  2ARO A;  2HIO B;  5B40 A;  3KWQ D;  4R8P A;  3LZ1 C;  5B32 B;  1M19 D;  5BNV A;  1P3I A;  1TZY D;  4Z66 A;  5B2I D;  3UTA D;  3AV2 A;  3AZL B;  5F99 C;  1P3K A;  3AZE C;  3WTP B;  3LZ1 D;  4Z5T A;  3REL A;  5CPI B;  3B6F B;  2UWX A;  2Y2J A;  4KGC A;  4E45 A;  5E5A A;  4WU9 B;  3A1I A;  5JRG C;  3NQJ A;  3AZN C;  4X23 C;  1P34 C;  5DNN A;  3EPJ A;  3REJ B;  1ZLA A;  5F99 D;  4H9Q B;  4QLC B;  5GT0 B;  3AZE D;  2J8P A;  3A6N C;  5GSU A;  5B1M C;  3AN2 C;  3TU4 A;  3MGP C;  3C1C B;  2PYO C;  4WU8 B;  1Q9C A;  4ZBJ C;  3AZN D;  5AV6 A;  5AV8 C;  4X23 D;  1P34 D;  5B1L B;  3AZM A;  3VH5 T;  2JE5 A;  1M1A A;  2BYK A;  2Y2H A;  1KX5 B;  3A6N D;  3X1T C;  5B1M D;  3AN2 D;  3AV1 C;  3VH6 A;  3MVD B;  3MGP D;  1KX3 B;  2PYO D;  4UUZ B;  5CPJ A;  4YS3 B;  3WKJ A;  5B2J C;  2RIQ A;  2FFF B;  1PZR A;  5AV8 D;  4H9O A;  2DQN C;  2BYM B;  4JJN C;  5BO0 A;  3FDD A;  4Z66 B;  1M18 A;  3X1T D;  2IO5 B;  5GXQ A;  1P3K B;  3AV1 D;  4KHA A;  3NQU A;  2FJ7 B;  2NZD C;  4Z2M G;  3MNN B;  3WA9 B;  2JCH A;  5B2J D;  4NE3 A;  4YM6 B;  5E5A B;  3UTB B;  3AFA C;  2ZM5 A;  4JJN D;  4LD9 B;  3AZJ B;  2Y2I A;  5B0Z A;  3AZK C;  1ZLA B;  3AYW C;  4XZQ C;  5GT3 B;  4G91 C;  5G49 A;  3AZF C;  1JFI B;  2NZD D;  4KUD C;  4NFT A;  3B0D C;  5FUG A;  3EPK A;  3B6G A;  3W99 C;  3REH B;  2ZY5 A;  3AZG A;  4DQY B;  1P3A A;  3LJA A;  2JSS A;  1P3M A;  3AFA D;  1N1J B;  2XD5 A;  2CV5 C;  5AV6 B;  5KDM B;  5B24 B;  3LZ0 C;  3MGR C;  3AZH B;  3AZK D;  5B0Y A;  3AYW D;  4ZUX A;  4XZQ D;  1P3G B;  3KUY B;  1A7W A;  4NE6 A;  5AVB C;  5DNM C;  3AZF D;  5CPK A;  1P3F A;  4KUD D;  1P3P A;  3W99 D;  4WNN B;  1W2E A;  3MGS C;  2F8N A;  3WKJ B;  5AV5 A;  3REK C;  2NQB C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...