1P3BA

Crystallographic studies of nucleosome core particles containing histone 'sin' mutants
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
99
structure length
99
Chain Sequence
KPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Palindromic 146bp Human Alpha-Satellite DNA fragment
publication title Crystal structures of histone Sin mutant nucleosomes reveal altered protein-DNA interactions
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 33
structure length 99
sequence length 99
chains with identical sequence E
ec nomenclature
pdb deposition date 2003-04-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1p3bA00
5B2JB 3W96A 1KX4A 1P3AA 3X1VA 5B1MB 5B1LA 2IO5C 4H9NA 3AZED 2F8NK 2BYKA 4XZQB 3AZGC 5C3IB 2YFVB 3B0DC 5CP6D 3X1UA 5F99C 4J8VA 1P3GD 2YFWA 3KUYD 3C1CC 3REIB 3AZNB 4G91B 3O62A 4JJNB 3MVDD 1KX5D 1HQ3A 2CV5C 4AWLC 3AV1C 4J8XA 3LZ0D 3LZ1A 1ID3B 3W96C 1P3BB 1KX4C 3REJD 1P3AC 1AOIA 5BO0A 3R45B 3X1VC 3LJAD 5AV9B 5B1LC 5CHLB 1H3OA 5AVCD 5CPKA 3UT9D 3X1SA 3X1UC 4J8VC 3AYWD 5B2ID 2IO5B 5B0YA 2NZDD 3AZLD 4Z2MH 3O62C 4WU9B 5JA4A 3AZGB 2F8NB 2AROD 4J8WD 3B0DB 4H9SA 5F99B 3MGPB 3REKA 4J8XC 3LZ1C 3C1CB 5GXQD 1P3PD 4KUDB 1AOIC 3B0CT 1U35A 3V9RA 3B6FD 5GT3A 3W96B 1KX4B 5CPKC 2FJ7A 1P3AB 3X1SC 3X1VB 3A6ND 3MGQB 3KSYA 5B1LB 5B0YC 1P3FA 2BYKB 4DRAA 4CAYB 1B6WA 4KGCA 5B33D 3AZEA 1Q9CA 4H9SC 3REHD 3AZKD 3TU4D 2YFWB 3REKC 3VH6W 5BS7A 1B67A 5BNXB 1KU5A 3O62B 1P3GA 3KUYA 4YS3D 3AZID 1U35C 3MVDA 1KX5A 2HIOA 5FUGB 4J8XB 5GT3C 1P3LA 4KHAA 2FJ7C 1AOIB 5GT0D 5BO0B 3REJA 3NQUB 1P3OD 3LJAA 5B32D 4J8UB 4KGCC 5CPKB 3AZEC 2PYOD 3X1SB 4QLCA 4J8VD 5AVCA 4ZUXA 4EO5C 5BS7C 5B0YB 1TAFA 3AYWA 3WA9D 5B2IA 1P3GC 3KUYC 1HQ3D 2NZDA 3AZLA 3MVDC 5B40A 1KX5C 2AROA 2HIOC 4J8WA 3B6GB 5GSUD 5AV6B 3B0BA 1P3LC 4H9RB 5JRGD 3LZ0C 3AV2B 5GXQA 3NQJA 1U35B 1P3PA 3REJC 3V9RB 3LJAC 4DRBA 5GT3B 1M19D 3B6FA 3UTAD 5AVCC 4ZUXC 3WTPD 3UT9C 3VH5W 3AYWC 5B2IC 3A6NA 1HTAA 3AZEB 2NZDC 3AZLC 5B33A 4EO5B 5B40C 2AROC 4J8WC 5CP6B 3REHA 3AZKA 3TU4A 1P3GB 3KUYB 3AZMA 1JFIA 5GXQC 1WWSA 3MVDB 1P3PC 1KX5B 4YS3A 3AZIA 3MNNB 1F1EA 3B6FC 3LZ0B 2FJ7D 2NQBD 5E5AB 3REJB 5GT0A 3LJAB 1P3FD 3A6NC 1P3OA 4KGCD 3RELB 5B32A 5AVCB 5B33C 1S32D 3UT9B 2PYOA 5AVBD 3REHC 1TAFB 5B24D 3TU4C 3AZKC 3AYWB 4H9PB 3WA9A 3AZLB 3AZMC 4NFTA 4YS3C 4J8WB 2HIOD 3AZIC 1P3MD 3AFAD 1P3LD 5KDMA 5GSUA 4UUZA 4H9OA 3NQJB 1BH8A 5JRGA 1P3PB 5DNMD 5GT0C 4R8PD 5B0ZA 1P3OC 3LELD 4QLCD 5B32C 1M19A 2RVQD 4E44A 4ZUXD 4LD9D 2PYOC 3UTAA 3WTPA 2BYMA 3MGSA 3C1BD 3UTBD 1BH9A 3WA9C 5B40D 1HQ3C 1M18A 3REHB 3TU4B 4CSRA 5DNND 5GSUC 1WWIA 3KXBD 3AZJD 5AV8D 2LY8A 5JRGC 1EQZD 3AZIB 2CV5B 4WV4B 5B0ZC 4AWLB 3AV1B 1P3IA 1ULYA 1M19C 4ZBJC 5BNVA 4Z5TA 2NQBA 3UTAC 4NE5A 3WTPC 3MGSC 1KX3A 4H9NB 5B32G 3WTPE 5B32B 4WU8D 2PYOB 1M18C 3X1UB 4J8VB 1S32A 3VH5T 5AVBA 5B24A 3WA9B 3AZMD 1HQ3B 1P3IC 1P3MA 5KDMB 3LZ1B 5GSUB 4UUZB 5CPID 4H9OB 3AFAA 1BH8B 3X1TD 5CPJD 2NQBC 5G49A 3MGRA 1KX3C 5DNMA 4HGAC 1P34D 1P3FC 2JSSA 4R8PA 4WU9D 1M19B 1H3OB 2F8ND 4ZBJB 3WAAD 3LELA 3UTAB 1M1AD 3WKJD 1S32C 3WTPB 2BYMB 3MGPD 1F66D 4LD9A 3AZHD 5AVBC 5BT1D 4XUJD 5B24C 3UTBA 3C1BA 1P3KD 5JA4B 4KUDD 3KWQA 4CSRB 3REKB 1P3MC 3AFAC 5DNNA 3KXBA 3AZJA 5AV8A 3MGQD 5B0ZD 1EQZA 5DNMC 3W98D 4R8PC 2F8NH 3AN2D 2NQBB 2FJ7B 3LELC 4QLCC 2RVQC 4LD9C 3MGSD 4HGAB 1P3FB 3UTBC 3C1BC 4KGCB 3AZNA 3KWQC 1M18D 1BFMA 4JJNA 1S32B 4E45A 4WU8A 5AVBB 5B24B 4G92C 4WZSB 5DNNC 4Z2MG 3KXBC 3AZJC 5AV8C 1EQZC 2HIOB 1P3ID 3R45A 5B31D 3AFAB 4J8UD 1P3LB 4KHAB 5G49B 4Z5TD 5CPIA 3X1TA 5CPJA 5DNMB 1KX3D 4Z66D 3AZFD 1P34A 3LELB 4QLCB 4WU9A 4LD9B 4ZUXB 2F8NA 3WAAA 4WU8C 4YM6D 1M1AA 3B6GD 3WKJA 5AV6D 5B2IB 1F66A 3UTBB 2HUEC 3MGPA 3C1BB 3AZHA 3W99D 4XUJA 2NZDB 1P3KA 4KUDA 5B40B 2AROB 5GT3D 5AV5D 4X23D 5AY8D 3VH6T 4G92B 5DNNB 5CPIC 3KXBB 3MGRD 5AV8B 5GXQB 3AZJB 3X1TC 1EQZB 5CPJC 3MGQA 1A7WA 1TZYD 3W98A 3B6FB 1P34C 4CAYA 4WU9C 3WAAC 3AN2A 1M1AC 3WKJC 3A6NB 1F66C 3MGPC 3AZHC 5BT1C 4XUJC 3W97D 5BNXA 3KWQD 1P3KC 5B33B 4KUDC 4WU8B 3MNND 3AZKB 2HUEB 1ZLAD 1N1JA 5FUGA 5B2JD 3AZMB 5E5AD 1JFIB 4H9QA 4YS3B 5B1MD 3MGQC 3NQUA 3W98C 5B31A 3RELD 5CPIB 4XZQD 4J8UA 3X1TB 3AN2C 5CPJB 5GT0B 1P3OB 1P34B 2F8NG 3REID 3AZND 4JJND 4Z66A 3WAAB 4WNNA 2CWEA 3AZFA 1M1AB 3WKJB 1F66B 3AZHB 4YM6A 3B6GA 4XUJB 5AV6A 1ID3D 1P3KB 4H9RA 1P3BD 3W99A 3AV2A 5AV9D 5AV5A 4X23A 5B31C 5AY8A 4J8UC 5JRGB 4Z5TC 3VH6A 5B0ZB 4NE3A 3W98B 1TZYA 4Z66C 3AZGD 3AN2B 3AZFC 5F99D 3MGSB 5CP6A 4YM6C 1BH9B 3B6GC 5AV6C 3C1CD 3W99C 3AV2C 3W97A 2CV5D 1M18B 4M6BA 3AV1D 1N1JB 3MNNA 5AV5C 4X23C 5AY8C 1ZLAA 3W96D 1KX4D 3LZ0A 4H9QB 5B2JA 1P3AD 3MGRC 3X1VD 5E5AA 5B31G 5B1LD 1P3IB 5B31B 5B1MA 1TZYC 5BNVB 4Z5TB 3RELA 3X1UD 4XZQA 3UT9A 1KX3B 2YFVA 5CP6C 4H9PA 3O62D 4Z66B 4WNNB 3AZFB 3REIA 3W97C 3B0CW 4YM6B 3MNNC 4J8XD 3LZ1D 1ZLAC 3W99B 5B2JC 1AOID 1ID3A 5E5AC 3VH5A 1P3BA 5AV5B 4X23B 1P3MB 1R4VA 5AY8B 5B1MC 5AV9A 5CPKD 3X1SD 3RELC 3MGRB 4XZQC 5C3IC 5B0YD 4R8PB 1TZYB 3REIC 3AZNC 4G91C 4JJNC 3AZGA 3REKD 2L5AA 5F99A 3C1CA 3KWQB 3AV2D 1ID3C 3W97B 1U35D 1P3BC 4NE6A 2CV5A 3AV1A 5AV9C 1ZLAB
chains in the Genus database with same CATH superfamily
5B2JB 3EPLA 3W96A 1KX4A 1P3AA 3X1VA 5B1MB 5B1LA 2IO5C 4H9NA 3AZED 2F8NK 2BYKA 4XZQB 3AZGC 5C3IB 2YFVB 3B0DC 5CP6D 2Y2OA 3X1UA 5F99C 4J8VA 1P3GD 2YFWA 3AL0C 3KUYD 3C1CC 3REIB 3AZNB 4G91B 3O62A 4JJNB 3MVDD 1KX5D 1HQ3A 2CV5C 4AWLC 3AV1C 4J8XA 3LZ0D 3LZ1A 1ID3B 3W96C 1P3BB 1KX4C 3REJD 1P3AC 1AOIA 5BO0A 3R45B 3X1VC 3LJAD 5AV9B 5B1LC 5CHLB 2ZY2A 1H3OA 5AVCD 5CPKA 3UT9D 3X1SA 3X1UC 4J8VC 3AYWD 5B2ID 2IO5B 5B0YA 2NZDD 3AZLD 4Z2MH 3O62C 4WU9B 5JA4A 3AZGB 2F8NB 2AROD 4J8WD 3B0DB 2Y2GA 4H9SA 5F99B 3MGPB 3REKA 4J8XC 3LZ1C 2XD1A 3C1CB 5GXQD 1P3PD 4KUDB 1AOIC 3B0CT 2Y2QA 1U35A 3V9RA 3B6FD 2JCHA 5GT3A 3W96B 1KX4B 5CPKC 2FJ7A 1P3AB 3X1SC 3X1VB 3A6ND 3MGQB 3KSYA 5B1LB 5B0YC 1P3FA 2BYKB 4DRAA 4CAYB 2Y2HA 1B6WA 4KGCA 5B33D 3AZEA 1Q9CA 4H9SC 3REHD 3AZKD 3TU4D 2YFWB 3REKC 3VH6W 5BS7A 1B67A 5BNXB 1KU5A 3O62B 1P3GA 3KUYA 4YS3D 3AZID 1U35C 3MVDA 1KX5A 2HIOA 5FUGB 4J8XB 5GT3C 1P3LA 2ZY4A 4KHAA 2FJ7C 1AOIB 5GT0D 5BO0B 3REJA 3NQUB 1P3OD 3LJAA 5B32D 4J8UB 4KGCC 5CPKB 3AZEC 2PYOD 3X1SB 4QLCA 2BG1A 4J8VD 5AVCA 4ZUXA 4EO5C 5BS7C 5B0YB 1TAFA 3AYWA 3WA9D 5B2IA 4DQYB 1P3GC 3KUYC 1HQ3D 2NZDA 3AZLA 3MVDC 5B40A 1KX5C 2AROA 2HIOC 4J8WA 3P5JB 3B6GB 3A1IA 5GSUD 5AV6B 3B0BA 1P3LC 4H9RB 5JRGD 3LZ0C 3AV2B 3NQJA 5GXQA 1U35B 1P3PA 3REJC 3V9RB 3LJAC 4DRBA 5GT3B 1M19D 3B6FA 3UTAD 5AVCC 4ZUXC 3WTPD 3UT9C 3VH5W 3AYWC 5B2IC 3A6NA 1HTAA 3AZEB 2NZDC 3AZLC 5B33A 4EO5B 5B40C 2AROC 4J8WC 5CP6B 3REHA 3AZKA 3TU4A 1P3GB 2Y2JA 3KUYB 2FFFB 3AZMA 1JFIA 5GXQC 1WWSA 3MVDB 1P3PC 1KX5B 4YS3A 3AZIA 3MNNB 2G5HC 1F1EA 3B6FC 3LZ0B 2FJ7D 2NQBD 5E5AB 3REJB 5GT0A 2JE5A 2Y2PA 3LJAB 1P3FD 3A6NC 1P3OA 4KGCD 3RELB 5B32A 5AVCB 5B33C 1S32D 3UT9B 2PYOA 1W2EA 5AVBD 3REHC 1TAFB 5B24D 3TU4C 3AZKC 3AYWB 4H9PB 3WA9A 3AZLB 3AZMC 4NFTA 4YS3C 4J8WB 2HIOD 3AZIC 1P3MD 3AFAD 1P3LD 5KDMA 5GSUA 4UUZA 4H9OA 3NQJB 1BH8A 5JRGA 1P3PB 5DNMD 5GT0C 4R8PD 5B0ZA 1P3OC 3LELD 4QLCD 5B32C 1PZRA 1M19A 2RVQD 4E44A 4ZUXD 4LD9D 2PYOC 3UTAA 3WTPA 2BYMA 3MGSA 3C1BD 3UTBD 1BH9A 3WA9C 5B40D 1HQ3C 1M18A 3REHB 3TU4B 4CSRA 2DQNC 5DNND 5GSUC 1WWIA 3KXBD 3AZJD 5AV8D 2LY8A 5JRGC 1EQZD 2F2AC 3AZIB 2CV5B 4WV4B 5B0ZC 4AWLB 3AV1B 1P3IA 1ULYA 1M19C 4ZBJC 5BNVA 4Z5TA 2NQBA 3UTAC 4NE5A 3WTPC 3MGSC 1KX3A 4H9NB 5B32G 3WTPE 5B32B 4WU8D 2PYOB 1M18C 3X1UB 4J8VB 1S32A 3VH5T 5AVBA 2W8SA 5B24A 3WA9B 3AZMD 1HQ3B 2Y2KA 1P3IC 1P3MA 5KDMB 3LZ1B 5GSUB 4UUZB 5CPID 4H9OB 3AFAA 1BH8B 3X1TD 5CPJD 2NQBC 5G49A 3MGRA 1KX3C 5DNMA 3EPHA 4HGAC 1P34D 1P3FC 2JSSA 4R8PA 4WU9D 1M19B 1H3OB 2F8ND 4ZBJB 3WAAD 3LELA 3UTAB 1M1AD 3WKJD 1S32C 3WTPB 2BYMB 3MGPD 1F66D 4LD9A 3AZHD 5AVBC 3H0RC 5BT1D 4XUJD 5B24C 3UTBA 3C1BA 1P3KD 5JA4B 4KUDD 3KWQA 2ZY3A 4CSRB 3REKB 1P3MC 3AFAC 2RIQA 5DNNA 3KXBA 3AZJA 5AV8A 3MGQD 5B0ZD 4UPKA 1EQZA 5DNMC 3W98D 4R8PC 2VQRA 2F8NH 3KFUG 3AN2D 2NQBB 2FJ7B 3LELC 4QLCC 2RVQC 4LD9C 3MGSD 4HGAB 1P3FB 3UTBC 3C1BC 4KGCB 2ZM5A 3AZNA 3KWQC 1M18D 1BFMA 4JJNA 1S32B 4E45A 4WU8A 5AVBB 5B24B 4G92C 4WZSB 5DNNC 4Z2MG 3KXBC 3AZJC 5AV8C 1EQZC 2G5IC 2HIOB 1P3ID 3R45A 5B31D 3H0LC 3AFAB 4J8UD 1P3LB 4KHAB 5G49B 4Z5TD 5CPIA 3X1TA 5CPJA 5DNMB 1KX3D 3F6TA 3EPJA 4Z66D 3AZFD 2UWXA 1P34A 3LELB 4QLCB 4WU9A 4LD9B 4ZUXB 2F8NA 3WAAA 4WU8C 4YM6D 1M1AA 3B6GD 3WKJA 5AV6D 5B2IB 1F66A 2DF4C 2HUEC 3MGPA 3C1BB 3UTBB 3W99D 3AZHA 4XUJA 2NZDB 1P3KA 4KUDA 5B40B 2AROB 5GT3D 5AV5D 4X23D 5AY8D 3VH6T 4G92B 2Y2MA 2Y2IA 5DNNB 5CPIC 3KXBB 3MGRD 5AV8B 5GXQB 3AZJB 3X1TC 1EQZB 5CPJC 2Y2LA 3MGQA 1A7WA 1TZYD 3W98A 2XD5A 3B6FB 1P34C 4CAYA 4WU9C 3WAAC 3AN2A 4WJ3C 1M1AC 3WKJC 3A6NB 1F66C 3MGPC 3AZHC 5BT1C 4XUJC 3W97D 5BNXA 3KWQD 1P3KC 2ZY5A 5B33B 4KUDC 4WU8B 3MNND 3AZKB 1T3UA 3A1KA 2HUEB 1ZLAD 1N1JA 5FUGA 5B2JD 3AZMB 5E5AD 1JFIB 4H9QA 4YS3B 5B1MD 3MGQC 3NQUA 3W98C 3EG5B 5B31A 3RELD 5CPIB 4XZQD 4J8UA 3X1TB 3AN2C 5CPJB 5GT0B 1P3OB 1P34B 2F8NG 3REID 3AZND 4JJND 4Z66A 3WAAB 4WNNA 2CWEA 3AZFA 1M1AB 3WKJB 1F66B 3EPKA 3AZHB 4YM6A 3B6GA 4XUJB 5AV6A 1ID3D 1P3KB 1Z2CB 3FDDA 4H9RA 1P3BD 3W99A 3AV2A 5AV9D 5AV5A 4X23A 5B31C 5AY8A 4J8UC 5JRGB 4Z5TC 3VH6A 5B0ZB 4NE3A 3W98B 1TZYA 4Z66C 3AZGD 3AN2B 3AZFC 5F99D 3MGSB 5CP6A 4YM6C 1BH9B 3B6GC 5AV6C 3C1CD 3W99C 3AV2C 3W97A 2CV5D 1M18B 4M6BA 3AV1D 1N1JB 3MNNA 5AV5C 4X23C 5AY8C 1ZLAA 3W96D 1KX4D 3LZ0A 4H9QB 5B2JA 1P3AD 3MGRC 3X1VD 5E5AA 5B31G 5B1LD 1P3IB 5B31B 5B1MA 1TZYC 5BNVB 4Z5TB 3RELA 3X1UD 4XZQA 3UT9A 1KX3B 2YFVA 5CP6C 4H9PA 3O62D 4Z66B 4WNNB 3AZFB 3REIA 3W97C 3B0CW 4YM6B 3MNNC 4J8XD 3LZ1D 1ZLAC 2J8PA 3W99B 5B2JC 1AOID 1ID3A 5E5AC 3VH5A 1P3BA 3H0MC 5AV5B 4X23B 1P3MB 1R4VA 5AY8B 5B1MC 5AV9A 5CPKD 3X1SD 3RELC 3MGRB 4XZQC 5C3IC 5B0YD 4R8PB 1TZYB 3REIC 3AZNC 4G91C 3IP4C 4JJNC 3AZGA 3REKD 2L5AA 5F99A 2Y2NA 3C1CA 3KWQB 3AV2D 1ID3C 3W97B 1U35D 1P3BC 4NE6A 2CV5A 3AV1A 5AV9C 1ZLAB
chains in the Genus database with same CATH topology
5B2JB 3EPLA 3W96A 1KX4A 1P3AA 3X1VA 5B1MB 5B1LA 2IO5C 4H9NA 3AZED 2F8NK 2BYKA 4XZQB 3AZGC 5C3IB 2YFVB 3B0DC 5CP6D 2Y2OA 3X1UA 5F99C 4J8VA 1P3GD 2YFWA 3AL0C 3KUYD 3C1CC 3REIB 3AZNB 4G91B 3O62A 4JJNB 3MVDD 1KX5D 1HQ3A 2CV5C 4AWLC 3AV1C 4J8XA 3LZ0D 3LZ1A 1ID3B 3W96C 1P3BB 1KX4C 3REJD 1P3AC 1AOIA 5BO0A 3R45B 3X1VC 3LJAD 5AV9B 5B1LC 5CHLB 2ZY2A 1H3OA 5AVCD 5CPKA 3UT9D 3X1SA 3X1UC 4J8VC 3AYWD 5B2ID 2IO5B 5B0YA 2NZDD 3AZLD 4Z2MH 3O62C 4WU9B 5JA4A 3AZGB 2F8NB 2AROD 4J8WD 3B0DB 2Y2GA 4H9SA 5F99B 3MGPB 3REKA 4J8XC 3LZ1C 2XD1A 3C1CB 5GXQD 1P3PD 4KUDB 1AOIC 3B0CT 2Y2QA 1U35A 3V9RA 3B6FD 2JCHA 5GT3A 3W96B 1KX4B 5CPKC 2FJ7A 1P3AB 3X1SC 3X1VB 3A6ND 3MGQB 3KSYA 5B1LB 5B0YC 1P3FA 2BYKB 4DRAA 4CAYB 2Y2HA 1B6WA 4KGCA 5B33D 3AZEA 1Q9CA 4H9SC 3REHD 3AZKD 3TU4D 2YFWB 3REKC 3VH6W 5BS7A 1B67A 5BNXB 1KU5A 3O62B 1P3GA 3KUYA 4YS3D 3AZID 1U35C 3MVDA 1KX5A 2HIOA 5FUGB 4J8XB 5GT3C 1P3LA 2ZY4A 4KHAA 2FJ7C 1AOIB 5GT0D 5BO0B 3REJA 3NQUB 1P3OD 3LJAA 5B32D 4J8UB 4KGCC 5CPKB 3AZEC 2PYOD 3X1SB 4QLCA 2BG1A 4J8VD 5AVCA 4ZUXA 4EO5C 5BS7C 5B0YB 1TAFA 3AYWA 3WA9D 5B2IA 4DQYB 1P3GC 3KUYC 1HQ3D 2NZDA 3AZLA 3MVDC 5B40A 1KX5C 2AROA 2HIOC 4J8WA 3P5JB 3B6GB 3A1IA 5GSUD 5AV6B 3B0BA 1P3LC 4H9RB 5JRGD 3LZ0C 3AV2B 3NQJA 5GXQA 1U35B 1P3PA 3REJC 3V9RB 3LJAC 4DRBA 5GT3B 1M19D 3B6FA 3UTAD 5AVCC 4ZUXC 3WTPD 3UT9C 3VH5W 3AYWC 5B2IC 3A6NA 1HTAA 3AZEB 2NZDC 3AZLC 5B33A 4EO5B 5B40C 2AROC 4J8WC 5CP6B 3REHA 3AZKA 3TU4A 1P3GB 2Y2JA 3KUYB 2FFFB 3AZMA 1JFIA 5GXQC 1WWSA 3MVDB 1P3PC 1KX5B 4YS3A 3AZIA 3MNNB 2G5HC 1F1EA 3B6FC 3LZ0B 2FJ7D 2NQBD 5E5AB 3REJB 5GT0A 2JE5A 2Y2PA 3LJAB 1P3FD 3A6NC 1P3OA 4KGCD 3RELB 5B32A 5AVCB 5B33C 1S32D 3UT9B 2PYOA 1W2EA 5AVBD 3REHC 1TAFB 5B24D 3TU4C 3AZKC 3AYWB 4H9PB 3WA9A 3AZLB 3AZMC 4NFTA 4YS3C 4J8WB 2HIOD 3AZIC 1P3MD 3AFAD 1P3LD 5KDMA 5GSUA 4UUZA 4H9OA 3NQJB 1BH8A 5JRGA 1P3PB 5DNMD 5GT0C 4R8PD 5B0ZA 1P3OC 3LELD 4QLCD 5B32C 1PZRA 1M19A 2RVQD 4E44A 4ZUXD 4LD9D 2PYOC 3UTAA 3WTPA 2BYMA 3MGSA 3C1BD 3UTBD 1BH9A 3WA9C 5B40D 1HQ3C 1M18A 3REHB 3TU4B 4CSRA 2DQNC 5DNND 5GSUC 1WWIA 3KXBD 3AZJD 5AV8D 2LY8A 5JRGC 1EQZD 2F2AC 3AZIB 2CV5B 4WV4B 5B0ZC 4AWLB 3AV1B 1P3IA 1ULYA 1M19C 4ZBJC 5BNVA 4Z5TA 2NQBA 3UTAC 4NE5A 3WTPC 3MGSC 1KX3A 4H9NB 5B32G 3WTPE 5B32B 4WU8D 2PYOB 1M18C 3X1UB 4J8VB 1S32A 3VH5T 5AVBA 2W8SA 5B24A 3WA9B 3AZMD 1HQ3B 2Y2KA 1P3IC 1P3MA 5KDMB 3LZ1B 5GSUB 4UUZB 5CPID 4H9OB 3AFAA 1BH8B 3X1TD 5CPJD 2NQBC 5G49A 3MGRA 1KX3C 5DNMA 3EPHA 4HGAC 1P34D 1P3FC 2JSSA 4R8PA 4WU9D 1M19B 1H3OB 2F8ND 4ZBJB 3WAAD 3LELA 3UTAB 1M1AD 3WKJD 1S32C 3WTPB 2BYMB 3MGPD 1F66D 4LD9A 3AZHD 5AVBC 3H0RC 5BT1D 4XUJD 5B24C 3UTBA 3C1BA 1P3KD 5JA4B 4KUDD 3KWQA 2ZY3A 4CSRB 3REKB 1P3MC 3AFAC 2RIQA 5DNNA 3KXBA 3AZJA 5AV8A 3MGQD 5B0ZD 4UPKA 1EQZA 5DNMC 3W98D 4R8PC 2VQRA 2F8NH 3KFUG 3AN2D 2NQBB 2FJ7B 3LELC 4QLCC 2RVQC 4LD9C 3MGSD 4HGAB 1P3FB 3UTBC 3C1BC 4KGCB 2ZM5A 3AZNA 3KWQC 1M18D 1BFMA 4JJNA 1S32B 4E45A 4WU8A 5AVBB 5B24B 4G92C 4WZSB 5DNNC 4Z2MG 3KXBC 3AZJC 5AV8C 1EQZC 2G5IC 2HIOB 1P3ID 3R45A 5B31D 3H0LC 3AFAB 4J8UD 1P3LB 4KHAB 5G49B 4Z5TD 5CPIA 3X1TA 5CPJA 5DNMB 1KX3D 3F6TA 3EPJA 4Z66D 3AZFD 2UWXA 1P34A 3LELB 4QLCB 4WU9A 4LD9B 4ZUXB 2F8NA 3WAAA 4WU8C 4YM6D 1M1AA 3B6GD 3WKJA 5AV6D 5B2IB 1F66A 2DF4C 2HUEC 3MGPA 3C1BB 3UTBB 3W99D 3AZHA 4XUJA 2NZDB 1P3KA 4KUDA 5B40B 2AROB 5GT3D 5AV5D 4X23D 5AY8D 3VH6T 4G92B 2Y2MA 2Y2IA 5DNNB 5CPIC 3KXBB 3MGRD 5AV8B 5GXQB 3AZJB 3X1TC 1EQZB 5CPJC 2Y2LA 3MGQA 1A7WA 1TZYD 3W98A 2XD5A 3B6FB 1P34C 4CAYA 4WU9C 3WAAC 3AN2A 4WJ3C 1M1AC 3WKJC 3A6NB 1F66C 3MGPC 3AZHC 5BT1C 4XUJC 3W97D 5BNXA 3KWQD 1P3KC 2ZY5A 5B33B 4KUDC 4WU8B 3MNND 3AZKB 1T3UA 3A1KA 2HUEB 1ZLAD 1N1JA 5FUGA 5B2JD 3AZMB 5E5AD 1JFIB 4H9QA 4YS3B 5B1MD 3MGQC 3NQUA 3W98C 3EG5B 5B31A 3RELD 5CPIB 4XZQD 4J8UA 3X1TB 3AN2C 5CPJB 5GT0B 1P3OB 1P34B 2F8NG 3REID 3AZND 4JJND 4Z66A 3WAAB 4WNNA 2CWEA 3AZFA 1M1AB 3WKJB 1F66B 3EPKA 3AZHB 4YM6A 3B6GA 4XUJB 5AV6A 1ID3D 1P3KB 1Z2CB 3FDDA 4H9RA 1P3BD 3W99A 3AV2A 5AV9D 5AV5A 4X23A 5B31C 5AY8A 4J8UC 5JRGB 4Z5TC 3VH6A 5B0ZB 4NE3A 3W98B 1TZYA 4Z66C 3AZGD 3AN2B 3AZFC 5F99D 3MGSB 5CP6A 4YM6C 1BH9B 3B6GC 5AV6C 3C1CD 3W99C 3AV2C 3W97A 2CV5D 1M18B 4M6BA 3AV1D 1N1JB 3MNNA 5AV5C 4X23C 5AY8C 1ZLAA 3W96D 1KX4D 3LZ0A 4H9QB 5B2JA 1P3AD 3MGRC 3X1VD 5E5AA 5B31G 5B1LD 1P3IB 5B31B 5B1MA 1TZYC 5BNVB 4Z5TB 3RELA 3X1UD 4XZQA 3UT9A 1KX3B 2YFVA 5CP6C 4H9PA 3O62D 4Z66B 4WNNB 3AZFB 3REIA 3W97C 3B0CW 4YM6B 3MNNC 4J8XD 3LZ1D 1ZLAC 2J8PA 3W99B 5B2JC 1AOID 1ID3A 5E5AC 3VH5A 1P3BA 3H0MC 5AV5B 4X23B 1P3MB 1R4VA 5AY8B 5B1MC 5AV9A 5CPKD 3X1SD 3RELC 3MGRB 4XZQC 5C3IC 5B0YD 4R8PB 1TZYB 3REIC 3AZNC 4G91C 3IP4C 4JJNC 3AZGA 3REKD 2L5AA 5F99A 2Y2NA 3C1CA 3KWQB 3AV2D 1ID3C 3W97B 1U35D 1P3BC 4NE6A 2CV5A 3AV1A 5AV9C 1ZLAB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5B2J B;  3W96 A;  1KX4 A;  1P3A A;  3X1V A;  5B1M B;  5B1L A;  2IO5 C;  4H9N A;  3AZE D;  2F8N K;  2BYK A;  4XZQ B;  3AZG C;  5C3I B;  2YFV B;  3B0D C;  5CP6 D;  3X1U A;  5F99 C;  4J8V A;  1P3G D;  2YFW A;  3KUY D;  3C1C C;  3REI B;  3AZN B;  4G91 B;  3O62 A;  4JJN B;  3MVD D;  1KX5 D;  1HQ3 A;  2CV5 C;  4AWL C;  3AV1 C;  4J8X A;  3LZ0 D;  3LZ1 A;  1ID3 B;  3W96 C;  1P3B B;  1KX4 C;  3REJ D;  1P3A C;  1AOI A;  5BO0 A;  3R45 B;  3X1V C;  3LJA D;  5AV9 B;  5B1L C;  5CHL B;  1H3O A;  5AVC D;  5CPK A;  3UT9 D;  3X1S A;  3X1U C;  4J8V C;  3AYW D;  5B2I D;  2IO5 B;  5B0Y A;  2NZD D;  3AZL D;  4Z2M H;  3O62 C;  4WU9 B;  5JA4 A;  3AZG B;  2F8N B;  2ARO D;  4J8W D;  3B0D B;  4H9S A;  5F99 B;  3MGP B;  3REK A;  4J8X C;  3LZ1 C;  3C1C B;  5GXQ D;  1P3P D;  4KUD B;  1AOI C;  3B0C T;  1U35 A;  3V9R A;  3B6F D;  5GT3 A;  3W96 B;  1KX4 B;  5CPK C;  2FJ7 A;  1P3A B;  3X1S C;  3X1V B;  3A6N D;  3MGQ B;  3KSY A;  5B1L B;  5B0Y C;  1P3F A;  2BYK B;  4DRA A;  4CAY B;  1B6W A;  4KGC A;  5B33 D;  3AZE A;  1Q9C A;  4H9S C;  3REH D;  3AZK D;  3TU4 D;  2YFW B;  3REK C;  3VH6 W;  5BS7 A;  1B67 A;  5BNX B;  1KU5 A;  3O62 B;  1P3G A;  3KUY A;  4YS3 D;  3AZI D;  1U35 C;  3MVD A;  1KX5 A;  2HIO A;  5FUG B;  4J8X B;  5GT3 C;  1P3L A;  4KHA A;  2FJ7 C;  1AOI B;  5GT0 D;  5BO0 B;  3REJ A;  3NQU B;  1P3O D;  3LJA A;  5B32 D;  4J8U B;  4KGC C;  5CPK B;  3AZE C;  2PYO D;  3X1S B;  4QLC A;  4J8V D;  5AVC A;  4ZUX A;  4EO5 C;  5BS7 C;  5B0Y B;  1TAF A;  3AYW A;  3WA9 D;  5B2I A;  1P3G C;  3KUY C;  1HQ3 D;  2NZD A;  3AZL A;  3MVD C;  5B40 A;  1KX5 C;  2ARO A;  2HIO C;  4J8W A;  3B6G B;  5GSU D;  5AV6 B;  3B0B A;  1P3L C;  4H9R B;  5JRG D;  3LZ0 C;  3AV2 B;  5GXQ A;  3NQJ A;  1U35 B;  1P3P A;  3REJ C;  3V9R B;  3LJA C;  4DRB A;  5GT3 B;  1M19 D;  3B6F A;  3UTA D;  5AVC C;  4ZUX C;  3WTP D;  3UT9 C;  3VH5 W;  3AYW C;  5B2I C;  3A6N A;  1HTA A;  3AZE B;  2NZD C;  3AZL C;  5B33 A;  4EO5 B;  5B40 C;  2ARO C;  4J8W C;  5CP6 B;  3REH A;  3AZK A;  3TU4 A;  1P3G B;  3KUY B;  3AZM A;  1JFI A;  5GXQ C;  1WWS A;  3MVD B;  1P3P C;  1KX5 B;  4YS3 A;  3AZI A;  3MNN B;  1F1E A;  3B6F C;  3LZ0 B;  2FJ7 D;  2NQB D;  5E5A B;  3REJ B;  5GT0 A;  3LJA B;  1P3F D;  3A6N C;  1P3O A;  4KGC D;  3REL B;  5B32 A;  5AVC B;  5B33 C;  1S32 D;  3UT9 B;  2PYO A;  5AVB D;  3REH C;  1TAF B;  5B24 D;  3TU4 C;  3AZK C;  3AYW B;  4H9P B;  3WA9 A;  3AZL B;  3AZM C;  4NFT A;  4YS3 C;  4J8W B;  2HIO D;  3AZI C;  1P3M D;  3AFA D;  1P3L D;  5KDM A;  5GSU A;  4UUZ A;  4H9O A;  3NQJ B;  1BH8 A;  5JRG A;  1P3P B;  5DNM D;  5GT0 C;  4R8P D;  5B0Z A;  1P3O C;  3LEL D;  4QLC D;  5B32 C;  1M19 A;  2RVQ D;  4E44 A;  4ZUX D;  4LD9 D;  2PYO C;  3UTA A;  3WTP A;  2BYM A;  3MGS A;  3C1B D;  3UTB D;  1BH9 A;  3WA9 C;  5B40 D;  1HQ3 C;  1M18 A;  3REH B;  3TU4 B;  4CSR A;  5DNN D;  5GSU C;  1WWI A;  3KXB D;  3AZJ D;  5AV8 D;  2LY8 A;  5JRG C;  1EQZ D;  3AZI B;  2CV5 B;  4WV4 B;  5B0Z C;  4AWL B;  3AV1 B;  1P3I A;  1ULY A;  1M19 C;  4ZBJ C;  5BNV A;  4Z5T A;  2NQB A;  3UTA C;  4NE5 A;  3WTP C;  3MGS C;  1KX3 A;  4H9N B;  5B32 G;  3WTP E;  5B32 B;  4WU8 D;  2PYO B;  1M18 C;  3X1U B;  4J8V B;  1S32 A;  3VH5 T;  5AVB A;  5B24 A;  3WA9 B;  3AZM D;  1HQ3 B;  1P3I C;  1P3M A;  5KDM B;  3LZ1 B;  5GSU B;  4UUZ B;  5CPI D;  4H9O B;  3AFA A;  1BH8 B;  3X1T D;  5CPJ D;  2NQB C;  5G49 A;  3MGR A;  1KX3 C;  5DNM A;  4HGA C;  1P34 D;  1P3F C;  2JSS A;  4R8P A;  4WU9 D;  1M19 B;  1H3O B;  2F8N D;  4ZBJ B;  3WAA D;  3LEL A;  3UTA B;  1M1A D;  3WKJ D;  1S32 C;  3WTP B;  2BYM B;  3MGP D;  1F66 D;  4LD9 A;  3AZH D;  5AVB C;  5BT1 D;  4XUJ D;  5B24 C;  3UTB A;  3C1B A;  1P3K D;  5JA4 B;  4KUD D;  3KWQ A;  4CSR B;  3REK B;  1P3M C;  3AFA C;  5DNN A;  3KXB A;  3AZJ A;  5AV8 A;  3MGQ D;  5B0Z D;  1EQZ A;  5DNM C;  3W98 D;  4R8P C;  2F8N H;  3AN2 D;  2NQB B;  2FJ7 B;  3LEL C;  4QLC C;  2RVQ C;  4LD9 C;  3MGS D;  4HGA B;  1P3F B;  3UTB C;  3C1B C;  4KGC B;  3AZN A;  3KWQ C;  1M18 D;  1BFM A;  4JJN A;  1S32 B;  4E45 A;  4WU8 A;  5AVB B;  5B24 B;  4G92 C;  4WZS B;  5DNN C;  4Z2M G;  3KXB C;  3AZJ C;  5AV8 C;  1EQZ C;  2HIO B;  1P3I D;  3R45 A;  5B31 D;  3AFA B;  4J8U D;  1P3L B;  4KHA B;  5G49 B;  4Z5T D;  5CPI A;  3X1T A;  5CPJ A;  5DNM B;  1KX3 D;  4Z66 D;  3AZF D;  1P34 A;  3LEL B;  4QLC B;  4WU9 A;  4LD9 B;  4ZUX B;  2F8N A;  3WAA A;  4WU8 C;  4YM6 D;  1M1A A;  3B6G D;  3WKJ A;  5AV6 D;  5B2I B;  1F66 A;  3UTB B;  2HUE C;  3MGP A;  3C1B B;  3AZH A;  3W99 D;  4XUJ A;  2NZD B;  1P3K A;  4KUD A;  5B40 B;  2ARO B;  5GT3 D;  5AV5 D;  4X23 D;  5AY8 D;  3VH6 T;  4G92 B;  5DNN B;  5CPI C;  3KXB B;  3MGR D;  5AV8 B;  5GXQ B;  3AZJ B;  3X1T C;  1EQZ B;  5CPJ C;  3MGQ A;  1A7W A;  1TZY D;  3W98 A;  3B6F B;  1P34 C;  4CAY A;  4WU9 C;  3WAA C;  3AN2 A;  1M1A C;  3WKJ C;  3A6N B;  1F66 C;  3MGP C;  3AZH C;  5BT1 C;  4XUJ C;  3W97 D;  5BNX A;  3KWQ D;  1P3K C;  5B33 B;  4KUD C;  4WU8 B;  3MNN D;  3AZK B;  2HUE B;  1ZLA D;  1N1J A;  5FUG A;  5B2J D;  3AZM B;  5E5A D;  1JFI B;  4H9Q A;  4YS3 B;  5B1M D;  3MGQ C;  3NQU A;  3W98 C;  5B31 A;  3REL D;  5CPI B;  4XZQ D;  4J8U A;  3X1T B;  3AN2 C;  5CPJ B;  5GT0 B;  1P3O B;  1P34 B;  2F8N G;  3REI D;  3AZN D;  4JJN D;  4Z66 A;  3WAA B;  4WNN A;  2CWE A;  3AZF A;  1M1A B;  3WKJ B;  1F66 B;  3AZH B;  4YM6 A;  3B6G A;  4XUJ B;  5AV6 A;  1ID3 D;  1P3K B;  4H9R A;  1P3B D;  3W99 A;  3AV2 A;  5AV9 D;  5AV5 A;  4X23 A;  5B31 C;  5AY8 A;  4J8U C;  5JRG B;  4Z5T C;  3VH6 A;  5B0Z B;  4NE3 A;  3W98 B;  1TZY A;  4Z66 C;  3AZG D;  3AN2 B;  3AZF C;  5F99 D;  3MGS B;  5CP6 A;  4YM6 C;  1BH9 B;  3B6G C;  5AV6 C;  3C1C D;  3W99 C;  3AV2 C;  3W97 A;  2CV5 D;  1M18 B;  4M6B A;  3AV1 D;  1N1J B;  3MNN A;  5AV5 C;  4X23 C;  5AY8 C;  1ZLA A;  3W96 D;  1KX4 D;  3LZ0 A;  4H9Q B;  5B2J A;  1P3A D;  3MGR C;  3X1V D;  5E5A A;  5B31 G;  5B1L D;  1P3I B;  5B31 B;  5B1M A;  1TZY C;  5BNV B;  4Z5T B;  3REL A;  3X1U D;  4XZQ A;  3UT9 A;  1KX3 B;  2YFV A;  5CP6 C;  4H9P A;  3O62 D;  4Z66 B;  4WNN B;  3AZF B;  3REI A;  3W97 C;  3B0C W;  4YM6 B;  3MNN C;  4J8X D;  3LZ1 D;  1ZLA C;  3W99 B;  5B2J C;  1AOI D;  1ID3 A;  5E5A C;  3VH5 A;  1P3B A;  5AV5 B;  4X23 B;  1P3M B;  1R4V A;  5AY8 B;  5B1M C;  5AV9 A;  5CPK D;  3X1S D;  3REL C;  3MGR B;  4XZQ C;  5C3I C;  5B0Y D;  4R8P B;  1TZY B;  3REI C;  3AZN C;  4G91 C;  4JJN C;  3AZG A;  3REK D;  2L5A A;  5F99 A;  3C1C A;  3KWQ B;  3AV2 D;  1ID3 C;  3W97 B;  1U35 D;  1P3B C;  4NE6 A;  2CV5 A;  3AV1 A;  5AV9 C;  1ZLA B; 
#chains in the Genus database with same CATH topology
 5B2J B;  3EPL A;  3W96 A;  1KX4 A;  1P3A A;  3X1V A;  5B1M B;  5B1L A;  2IO5 C;  4H9N A;  3AZE D;  2F8N K;  2BYK A;  4XZQ B;  3AZG C;  5C3I B;  2YFV B;  3B0D C;  5CP6 D;  2Y2O A;  3X1U A;  5F99 C;  4J8V A;  1P3G D;  2YFW A;  3AL0 C;  3KUY D;  3C1C C;  3REI B;  3AZN B;  4G91 B;  3O62 A;  4JJN B;  3MVD D;  1KX5 D;  1HQ3 A;  2CV5 C;  4AWL C;  3AV1 C;  4J8X A;  3LZ0 D;  3LZ1 A;  1ID3 B;  3W96 C;  1P3B B;  1KX4 C;  3REJ D;  1P3A C;  1AOI A;  5BO0 A;  3R45 B;  3X1V C;  3LJA D;  5AV9 B;  5B1L C;  5CHL B;  2ZY2 A;  1H3O A;  5AVC D;  5CPK A;  3UT9 D;  3X1S A;  3X1U C;  4J8V C;  3AYW D;  5B2I D;  2IO5 B;  5B0Y A;  2NZD D;  3AZL D;  4Z2M H;  3O62 C;  4WU9 B;  5JA4 A;  3AZG B;  2F8N B;  2ARO D;  4J8W D;  3B0D B;  2Y2G A;  4H9S A;  5F99 B;  3MGP B;  3REK A;  4J8X C;  3LZ1 C;  2XD1 A;  3C1C B;  5GXQ D;  1P3P D;  4KUD B;  1AOI C;  3B0C T;  2Y2Q A;  1U35 A;  3V9R A;  3B6F D;  2JCH A;  5GT3 A;  3W96 B;  1KX4 B;  5CPK C;  2FJ7 A;  1P3A B;  3X1S C;  3X1V B;  3A6N D;  3MGQ B;  3KSY A;  5B1L B;  5B0Y C;  1P3F A;  2BYK B;  4DRA A;  4CAY B;  2Y2H A;  1B6W A;  4KGC A;  5B33 D;  3AZE A;  1Q9C A;  4H9S C;  3REH D;  3AZK D;  3TU4 D;  2YFW B;  3REK C;  3VH6 W;  5BS7 A;  1B67 A;  5BNX B;  1KU5 A;  3O62 B;  1P3G A;  3KUY A;  4YS3 D;  3AZI D;  1U35 C;  3MVD A;  1KX5 A;  2HIO A;  5FUG B;  4J8X B;  5GT3 C;  1P3L A;  2ZY4 A;  4KHA A;  2FJ7 C;  1AOI B;  5GT0 D;  5BO0 B;  3REJ A;  3NQU B;  1P3O D;  3LJA A;  5B32 D;  4J8U B;  4KGC C;  5CPK B;  3AZE C;  2PYO D;  3X1S B;  4QLC A;  2BG1 A;  4J8V D;  5AVC A;  4ZUX A;  4EO5 C;  5BS7 C;  5B0Y B;  1TAF A;  3AYW A;  3WA9 D;  5B2I A;  4DQY B;  1P3G C;  3KUY C;  1HQ3 D;  2NZD A;  3AZL A;  3MVD C;  5B40 A;  1KX5 C;  2ARO A;  2HIO C;  4J8W A;  3P5J B;  3B6G B;  3A1I A;  5GSU D;  5AV6 B;  3B0B A;  1P3L C;  4H9R B;  5JRG D;  3LZ0 C;  3AV2 B;  3NQJ A;  5GXQ A;  1U35 B;  1P3P A;  3REJ C;  3V9R B;  3LJA C;  4DRB A;  5GT3 B;  1M19 D;  3B6F A;  3UTA D;  5AVC C;  4ZUX C;  3WTP D;  3UT9 C;  3VH5 W;  3AYW C;  5B2I C;  3A6N A;  1HTA A;  3AZE B;  2NZD C;  3AZL C;  5B33 A;  4EO5 B;  5B40 C;  2ARO C;  4J8W C;  5CP6 B;  3REH A;  3AZK A;  3TU4 A;  1P3G B;  2Y2J A;  3KUY B;  2FFF B;  3AZM A;  1JFI A;  5GXQ C;  1WWS A;  3MVD B;  1P3P C;  1KX5 B;  4YS3 A;  3AZI A;  3MNN B;  2G5H C;  1F1E A;  3B6F C;  3LZ0 B;  2FJ7 D;  2NQB D;  5E5A B;  3REJ B;  5GT0 A;  2JE5 A;  2Y2P A;  3LJA B;  1P3F D;  3A6N C;  1P3O A;  4KGC D;  3REL B;  5B32 A;  5AVC B;  5B33 C;  1S32 D;  3UT9 B;  2PYO A;  1W2E A;  5AVB D;  3REH C;  1TAF B;  5B24 D;  3TU4 C;  3AZK C;  3AYW B;  4H9P B;  3WA9 A;  3AZL B;  3AZM C;  4NFT A;  4YS3 C;  4J8W B;  2HIO D;  3AZI C;  1P3M D;  3AFA D;  1P3L D;  5KDM A;  5GSU A;  4UUZ A;  4H9O A;  3NQJ B;  1BH8 A;  5JRG A;  1P3P B;  5DNM D;  5GT0 C;  4R8P D;  5B0Z A;  1P3O C;  3LEL D;  4QLC D;  5B32 C;  1PZR A;  1M19 A;  2RVQ D;  4E44 A;  4ZUX D;  4LD9 D;  2PYO C;  3UTA A;  3WTP A;  2BYM A;  3MGS A;  3C1B D;  3UTB D;  1BH9 A;  3WA9 C;  5B40 D;  1HQ3 C;  1M18 A;  3REH B;  3TU4 B;  4CSR A;  2DQN C;  5DNN D;  5GSU C;  1WWI A;  3KXB D;  3AZJ D;  5AV8 D;  2LY8 A;  5JRG C;  1EQZ D;  2F2A C;  3AZI B;  2CV5 B;  4WV4 B;  5B0Z C;  4AWL B;  3AV1 B;  1P3I A;  1ULY A;  1M19 C;  4ZBJ C;  5BNV A;  4Z5T A;  2NQB A;  3UTA C;  4NE5 A;  3WTP C;  3MGS C;  1KX3 A;  4H9N B;  5B32 G;  3WTP E;  5B32 B;  4WU8 D;  2PYO B;  1M18 C;  3X1U B;  4J8V B;  1S32 A;  3VH5 T;  5AVB A;  2W8S A;  5B24 A;  3WA9 B;  3AZM D;  1HQ3 B;  2Y2K A;  1P3I C;  1P3M A;  5KDM B;  3LZ1 B;  5GSU B;  4UUZ B;  5CPI D;  4H9O B;  3AFA A;  1BH8 B;  3X1T D;  5CPJ D;  2NQB C;  5G49 A;  3MGR A;  1KX3 C;  5DNM A;  3EPH A;  4HGA C;  1P34 D;  1P3F C;  2JSS A;  4R8P A;  4WU9 D;  1M19 B;  1H3O B;  2F8N D;  4ZBJ B;  3WAA D;  3LEL A;  3UTA B;  1M1A D;  3WKJ D;  1S32 C;  3WTP B;  2BYM B;  3MGP D;  1F66 D;  4LD9 A;  3AZH D;  5AVB C;  3H0R C;  5BT1 D;  4XUJ D;  5B24 C;  3UTB A;  3C1B A;  1P3K D;  5JA4 B;  4KUD D;  3KWQ A;  2ZY3 A;  4CSR B;  3REK B;  1P3M C;  3AFA C;  2RIQ A;  5DNN A;  3KXB A;  3AZJ A;  5AV8 A;  3MGQ D;  5B0Z D;  4UPK A;  1EQZ A;  5DNM C;  3W98 D;  4R8P C;  2VQR A;  2F8N H;  3KFU G;  3AN2 D;  2NQB B;  2FJ7 B;  3LEL C;  4QLC C;  2RVQ C;  4LD9 C;  3MGS D;  4HGA B;  1P3F B;  3UTB C;  3C1B C;  4KGC B;  2ZM5 A;  3AZN A;  3KWQ C;  1M18 D;  1BFM A;  4JJN A;  1S32 B;  4E45 A;  4WU8 A;  5AVB B;  5B24 B;  4G92 C;  4WZS B;  5DNN C;  4Z2M G;  3KXB C;  3AZJ C;  5AV8 C;  1EQZ C;  2G5I C;  2HIO B;  1P3I D;  3R45 A;  5B31 D;  3H0L C;  3AFA B;  4J8U D;  1P3L B;  4KHA B;  5G49 B;  4Z5T D;  5CPI A;  3X1T A;  5CPJ A;  5DNM B;  1KX3 D;  3F6T A;  3EPJ A;  4Z66 D;  3AZF D;  2UWX A;  1P34 A;  3LEL B;  4QLC B;  4WU9 A;  4LD9 B;  4ZUX B;  2F8N A;  3WAA A;  4WU8 C;  4YM6 D;  1M1A A;  3B6G D;  3WKJ A;  5AV6 D;  5B2I B;  1F66 A;  2DF4 C;  2HUE C;  3MGP A;  3C1B B;  3UTB B;  3W99 D;  3AZH A;  4XUJ A;  2NZD B;  1P3K A;  4KUD A;  5B40 B;  2ARO B;  5GT3 D;  5AV5 D;  4X23 D;  5AY8 D;  3VH6 T;  4G92 B;  2Y2M A;  2Y2I A;  5DNN B;  5CPI C;  3KXB B;  3MGR D;  5AV8 B;  5GXQ B;  3AZJ B;  3X1T C;  1EQZ B;  5CPJ C;  2Y2L A;  3MGQ A;  1A7W A;  1TZY D;  3W98 A;  2XD5 A;  3B6F B;  1P34 C;  4CAY A;  4WU9 C;  3WAA C;  3AN2 A;  4WJ3 C;  1M1A C;  3WKJ C;  3A6N B;  1F66 C;  3MGP C;  3AZH C;  5BT1 C;  4XUJ C;  3W97 D;  5BNX A;  3KWQ D;  1P3K C;  2ZY5 A;  5B33 B;  4KUD C;  4WU8 B;  3MNN D;  3AZK B;  1T3U A;  3A1K A;  2HUE B;  1ZLA D;  1N1J A;  5FUG A;  5B2J D;  3AZM B;  5E5A D;  1JFI B;  4H9Q A;  4YS3 B;  5B1M D;  3MGQ C;  3NQU A;  3W98 C;  3EG5 B;  5B31 A;  3REL D;  5CPI B;  4XZQ D;  4J8U A;  3X1T B;  3AN2 C;  5CPJ B;  5GT0 B;  1P3O B;  1P34 B;  2F8N G;  3REI D;  3AZN D;  4JJN D;  4Z66 A;  3WAA B;  4WNN A;  2CWE A;  3AZF A;  1M1A B;  3WKJ B;  1F66 B;  3EPK A;  3AZH B;  4YM6 A;  3B6G A;  4XUJ B;  5AV6 A;  1ID3 D;  1P3K B;  1Z2C B;  3FDD A;  4H9R A;  1P3B D;  3W99 A;  3AV2 A;  5AV9 D;  5AV5 A;  4X23 A;  5B31 C;  5AY8 A;  4J8U C;  5JRG B;  4Z5T C;  3VH6 A;  5B0Z B;  4NE3 A;  3W98 B;  1TZY A;  4Z66 C;  3AZG D;  3AN2 B;  3AZF C;  5F99 D;  3MGS B;  5CP6 A;  4YM6 C;  1BH9 B;  3B6G C;  5AV6 C;  3C1C D;  3W99 C;  3AV2 C;  3W97 A;  2CV5 D;  1M18 B;  4M6B A;  3AV1 D;  1N1J B;  3MNN A;  5AV5 C;  4X23 C;  5AY8 C;  1ZLA A;  3W96 D;  1KX4 D;  3LZ0 A;  4H9Q B;  5B2J A;  1P3A D;  3MGR C;  3X1V D;  5E5A A;  5B31 G;  5B1L D;  1P3I B;  5B31 B;  5B1M A;  1TZY C;  5BNV B;  4Z5T B;  3REL A;  3X1U D;  4XZQ A;  3UT9 A;  1KX3 B;  2YFV A;  5CP6 C;  4H9P A;  3O62 D;  4Z66 B;  4WNN B;  3AZF B;  3REI A;  3W97 C;  3B0C W;  4YM6 B;  3MNN C;  4J8X D;  3LZ1 D;  1ZLA C;  2J8P A;  3W99 B;  5B2J C;  1AOI D;  1ID3 A;  5E5A C;  3VH5 A;  1P3B A;  3H0M C;  5AV5 B;  4X23 B;  1P3M B;  1R4V A;  5AY8 B;  5B1M C;  5AV9 A;  5CPK D;  3X1S D;  3REL C;  3MGR B;  4XZQ C;  5C3I C;  5B0Y D;  4R8P B;  1TZY B;  3REI C;  3AZN C;  4G91 C;  3IP4 C;  4JJN C;  3AZG A;  3REK D;  2L5A A;  5F99 A;  2Y2N A;  3C1C A;  3KWQ B;  3AV2 D;  1ID3 C;  3W97 B;  1U35 D;  1P3B C;  4NE6 A;  2CV5 A;  3AV1 A;  5AV9 C;  1ZLA B; 
#chains in the Genus database with same CATH homology
 5B2J B;  3EPL A;  3W96 A;  1KX4 A;  1P3A A;  3X1V A;  5B1M B;  5B1L A;  2IO5 C;  4H9N A;  3AZE D;  2F8N K;  2BYK A;  4XZQ B;  3AZG C;  5C3I B;  2YFV B;  3B0D C;  5CP6 D;  2Y2O A;  3X1U A;  5F99 C;  4J8V A;  1P3G D;  2YFW A;  3AL0 C;  3KUY D;  3C1C C;  3REI B;  3AZN B;  4G91 B;  3O62 A;  4JJN B;  3MVD D;  1KX5 D;  1HQ3 A;  2CV5 C;  4AWL C;  3AV1 C;  4J8X A;  3LZ0 D;  3LZ1 A;  1ID3 B;  3W96 C;  1P3B B;  1KX4 C;  3REJ D;  1P3A C;  1AOI A;  5BO0 A;  3R45 B;  3X1V C;  3LJA D;  5AV9 B;  5B1L C;  5CHL B;  2ZY2 A;  1H3O A;  5AVC D;  5CPK A;  3UT9 D;  3X1S A;  3X1U C;  4J8V C;  3AYW D;  5B2I D;  2IO5 B;  5B0Y A;  2NZD D;  3AZL D;  4Z2M H;  3O62 C;  4WU9 B;  5JA4 A;  3AZG B;  2F8N B;  2ARO D;  4J8W D;  3B0D B;  2Y2G A;  4H9S A;  5F99 B;  3MGP B;  3REK A;  4J8X C;  3LZ1 C;  2XD1 A;  3C1C B;  5GXQ D;  1P3P D;  4KUD B;  1AOI C;  3B0C T;  2Y2Q A;  1U35 A;  3V9R A;  3B6F D;  2JCH A;  5GT3 A;  3W96 B;  1KX4 B;  5CPK C;  2FJ7 A;  1P3A B;  3X1S C;  3X1V B;  3A6N D;  3MGQ B;  3KSY A;  5B1L B;  5B0Y C;  1P3F A;  2BYK B;  4DRA A;  4CAY B;  2Y2H A;  1B6W A;  4KGC A;  5B33 D;  3AZE A;  1Q9C A;  4H9S C;  3REH D;  3AZK D;  3TU4 D;  2YFW B;  3REK C;  3VH6 W;  5BS7 A;  1B67 A;  5BNX B;  1KU5 A;  3O62 B;  1P3G A;  3KUY A;  4YS3 D;  3AZI D;  1U35 C;  3MVD A;  1KX5 A;  2HIO A;  5FUG B;  4J8X B;  5GT3 C;  1P3L A;  2ZY4 A;  4KHA A;  2FJ7 C;  1AOI B;  5GT0 D;  5BO0 B;  3REJ A;  3NQU B;  1P3O D;  3LJA A;  5B32 D;  4J8U B;  4KGC C;  5CPK B;  3AZE C;  2PYO D;  3X1S B;  4QLC A;  2BG1 A;  4J8V D;  5AVC A;  4ZUX A;  4EO5 C;  5BS7 C;  5B0Y B;  1TAF A;  3AYW A;  3WA9 D;  5B2I A;  4DQY B;  1P3G C;  3KUY C;  1HQ3 D;  2NZD A;  3AZL A;  3MVD C;  5B40 A;  1KX5 C;  2ARO A;  2HIO C;  4J8W A;  3P5J B;  3B6G B;  3A1I A;  5GSU D;  5AV6 B;  3B0B A;  1P3L C;  4H9R B;  5JRG D;  3LZ0 C;  3AV2 B;  3NQJ A;  5GXQ A;  1U35 B;  1P3P A;  3REJ C;  3V9R B;  3LJA C;  4DRB A;  5GT3 B;  1M19 D;  3B6F A;  3UTA D;  5AVC C;  4ZUX C;  3WTP D;  3UT9 C;  3VH5 W;  3AYW C;  5B2I C;  3A6N A;  1HTA A;  3AZE B;  2NZD C;  3AZL C;  5B33 A;  4EO5 B;  5B40 C;  2ARO C;  4J8W C;  5CP6 B;  3REH A;  3AZK A;  3TU4 A;  1P3G B;  2Y2J A;  3KUY B;  2FFF B;  3AZM A;  1JFI A;  5GXQ C;  1WWS A;  3MVD B;  1P3P C;  1KX5 B;  4YS3 A;  3AZI A;  3MNN B;  2G5H C;  1F1E A;  3B6F C;  3LZ0 B;  2FJ7 D;  2NQB D;  5E5A B;  3REJ B;  5GT0 A;  2JE5 A;  2Y2P A;  3LJA B;  1P3F D;  3A6N C;  1P3O A;  4KGC D;  3REL B;  5B32 A;  5AVC B;  5B33 C;  1S32 D;  3UT9 B;  2PYO A;  1W2E A;  5AVB D;  3REH C;  1TAF B;  5B24 D;  3TU4 C;  3AZK C;  3AYW B;  4H9P B;  3WA9 A;  3AZL B;  3AZM C;  4NFT A;  4YS3 C;  4J8W B;  2HIO D;  3AZI C;  1P3M D;  3AFA D;  1P3L D;  5KDM A;  5GSU A;  4UUZ A;  4H9O A;  3NQJ B;  1BH8 A;  5JRG A;  1P3P B;  5DNM D;  5GT0 C;  4R8P D;  5B0Z A;  1P3O C;  3LEL D;  4QLC D;  5B32 C;  1PZR A;  1M19 A;  2RVQ D;  4E44 A;  4ZUX D;  4LD9 D;  2PYO C;  3UTA A;  3WTP A;  2BYM A;  3MGS A;  3C1B D;  3UTB D;  1BH9 A;  3WA9 C;  5B40 D;  1HQ3 C;  1M18 A;  3REH B;  3TU4 B;  4CSR A;  2DQN C;  5DNN D;  5GSU C;  1WWI A;  3KXB D;  3AZJ D;  5AV8 D;  2LY8 A;  5JRG C;  1EQZ D;  2F2A C;  3AZI B;  2CV5 B;  4WV4 B;  5B0Z C;  4AWL B;  3AV1 B;  1P3I A;  1ULY A;  1M19 C;  4ZBJ C;  5BNV A;  4Z5T A;  2NQB A;  3UTA C;  4NE5 A;  3WTP C;  3MGS C;  1KX3 A;  4H9N B;  5B32 G;  3WTP E;  5B32 B;  4WU8 D;  2PYO B;  1M18 C;  3X1U B;  4J8V B;  1S32 A;  3VH5 T;  5AVB A;  2W8S A;  5B24 A;  3WA9 B;  3AZM D;  1HQ3 B;  2Y2K A;  1P3I C;  1P3M A;  5KDM B;  3LZ1 B;  5GSU B;  4UUZ B;  5CPI D;  4H9O B;  3AFA A;  1BH8 B;  3X1T D;  5CPJ D;  2NQB C;  5G49 A;  3MGR A;  1KX3 C;  5DNM A;  3EPH A;  4HGA C;  1P34 D;  1P3F C;  2JSS A;  4R8P A;  4WU9 D;  1M19 B;  1H3O B;  2F8N D;  4ZBJ B;  3WAA D;  3LEL A;  3UTA B;  1M1A D;  3WKJ D;  1S32 C;  3WTP B;  2BYM B;  3MGP D;  1F66 D;  4LD9 A;  3AZH D;  5AVB C;  3H0R C;  5BT1 D;  4XUJ D;  5B24 C;  3UTB A;  3C1B A;  1P3K D;  5JA4 B;  4KUD D;  3KWQ A;  2ZY3 A;  4CSR B;  3REK B;  1P3M C;  3AFA C;  2RIQ A;  5DNN A;  3KXB A;  3AZJ A;  5AV8 A;  3MGQ D;  5B0Z D;  4UPK A;  1EQZ A;  5DNM C;  3W98 D;  4R8P C;  2VQR A;  2F8N H;  3KFU G;  3AN2 D;  2NQB B;  2FJ7 B;  3LEL C;  4QLC C;  2RVQ C;  4LD9 C;  3MGS D;  4HGA B;  1P3F B;  3UTB C;  3C1B C;  4KGC B;  2ZM5 A;  3AZN A;  3KWQ C;  1M18 D;  1BFM A;  4JJN A;  1S32 B;  4E45 A;  4WU8 A;  5AVB B;  5B24 B;  4G92 C;  4WZS B;  5DNN C;  4Z2M G;  3KXB C;  3AZJ C;  5AV8 C;  1EQZ C;  2G5I C;  2HIO B;  1P3I D;  3R45 A;  5B31 D;  3H0L C;  3AFA B;  4J8U D;  1P3L B;  4KHA B;  5G49 B;  4Z5T D;  5CPI A;  3X1T A;  5CPJ A;  5DNM B;  1KX3 D;  3F6T A;  3EPJ A;  4Z66 D;  3AZF D;  2UWX A;  1P34 A;  3LEL B;  4QLC B;  4WU9 A;  4LD9 B;  4ZUX B;  2F8N A;  3WAA A;  4WU8 C;  4YM6 D;  1M1A A;  3B6G D;  3WKJ A;  5AV6 D;  5B2I B;  1F66 A;  2DF4 C;  2HUE C;  3MGP A;  3C1B B;  3UTB B;  3W99 D;  3AZH A;  4XUJ A;  2NZD B;  1P3K A;  4KUD A;  5B40 B;  2ARO B;  5GT3 D;  5AV5 D;  4X23 D;  5AY8 D;  3VH6 T;  4G92 B;  2Y2M A;  2Y2I A;  5DNN B;  5CPI C;  3KXB B;  3MGR D;  5AV8 B;  5GXQ B;  3AZJ B;  3X1T C;  1EQZ B;  5CPJ C;  2Y2L A;  3MGQ A;  1A7W A;  1TZY D;  3W98 A;  2XD5 A;  3B6F B;  1P34 C;  4CAY A;  4WU9 C;  3WAA C;  3AN2 A;  4WJ3 C;  1M1A C;  3WKJ C;  3A6N B;  1F66 C;  3MGP C;  3AZH C;  5BT1 C;  4XUJ C;  3W97 D;  5BNX A;  3KWQ D;  1P3K C;  2ZY5 A;  5B33 B;  4KUD C;  4WU8 B;  3MNN D;  3AZK B;  1T3U A;  3A1K A;  2HUE B;  1ZLA D;  1N1J A;  5FUG A;  5B2J D;  3AZM B;  5E5A D;  1JFI B;  4H9Q A;  4YS3 B;  5B1M D;  3MGQ C;  3NQU A;  3W98 C;  3EG5 B;  5B31 A;  3REL D;  5CPI B;  4XZQ D;  4J8U A;  3X1T B;  3AN2 C;  5CPJ B;  5GT0 B;  1P3O B;  1P34 B;  2F8N G;  3REI D;  3AZN D;  4JJN D;  4Z66 A;  3WAA B;  4WNN A;  2CWE A;  3AZF A;  1M1A B;  3WKJ B;  1F66 B;  3EPK A;  3AZH B;  4YM6 A;  3B6G A;  4XUJ B;  5AV6 A;  1ID3 D;  1P3K B;  1Z2C B;  3FDD A;  4H9R A;  1P3B D;  3W99 A;  3AV2 A;  5AV9 D;  5AV5 A;  4X23 A;  5B31 C;  5AY8 A;  4J8U C;  5JRG B;  4Z5T C;  3VH6 A;  5B0Z B;  4NE3 A;  3W98 B;  1TZY A;  4Z66 C;  3AZG D;  3AN2 B;  3AZF C;  5F99 D;  3MGS B;  5CP6 A;  4YM6 C;  1BH9 B;  3B6G C;  5AV6 C;  3C1C D;  3W99 C;  3AV2 C;  3W97 A;  2CV5 D;  1M18 B;  4M6B A;  3AV1 D;  1N1J B;  3MNN A;  5AV5 C;  4X23 C;  5AY8 C;  1ZLA A;  3W96 D;  1KX4 D;  3LZ0 A;  4H9Q B;  5B2J A;  1P3A D;  3MGR C;  3X1V D;  5E5A A;  5B31 G;  5B1L D;  1P3I B;  5B31 B;  5B1M A;  1TZY C;  5BNV B;  4Z5T B;  3REL A;  3X1U D;  4XZQ A;  3UT9 A;  1KX3 B;  2YFV A;  5CP6 C;  4H9P A;  3O62 D;  4Z66 B;  4WNN B;  3AZF B;  3REI A;  3W97 C;  3B0C W;  4YM6 B;  3MNN C;  4J8X D;  3LZ1 D;  1ZLA C;  2J8P A;  3W99 B;  5B2J C;  1AOI D;  1ID3 A;  5E5A C;  3VH5 A;  1P3B A;  3H0M C;  5AV5 B;  4X23 B;  1P3M B;  1R4V A;  5AY8 B;  5B1M C;  5AV9 A;  5CPK D;  3X1S D;  3REL C;  3MGR B;  4XZQ C;  5C3I C;  5B0Y D;  4R8P B;  1TZY B;  3REI C;  3AZN C;  4G91 C;  3IP4 C;  4JJN C;  3AZG A;  3REK D;  2L5A A;  5F99 A;  2Y2N A;  3C1C A;  3KWQ B;  3AV2 D;  1ID3 C;  3W97 B;  1U35 D;  1P3B C;  4NE6 A;  2CV5 A;  3AV1 A;  5AV9 C;  1ZLA B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...