1P3BA

Crystallographic studies of nucleosome core particles containing histone 'sin' mutants
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
99
structure length
99
Chain Sequence
KPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Structural protein/dna
molecule keywords Palindromic 146bp Human Alpha-Satellite DNA fragment
publication title Crystal structures of histone Sin mutant nucleosomes reveal altered protein-DNA interactions
pubmed doi rcsb
source organism Homo sapiens
total genus 33
structure length 99
sequence length 99
chains with identical sequence E
ec nomenclature
pdb deposition date 2003-04-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1p3bA00
4XZQD 3MGQD 5BO0B 4NFTA 1P3ID 3B0CW 1P3LC 2NQBC 3AZHC 5B2ID 5E5AA 3AZJA 4NE6A 4Z66A 3MVDB 2F8NG 4ZBJB 4XZQC 4YS3A 4J8WD 3UTBD 5B1LA 1HQ3A 3KXBB 1P3PB 5B2JB 3AZLA 4J8WC 1AOIA 3UTBC 4CSRB 5CPKD 4X23D 5B24C 3VH6W 5AY8C 3AV2D 4ZUXC 1P3LB 3AZHB 1F66A 5CPKC 4X23C 4WU9A 3AV2C 4XZQB 1P3IB 4NE3A 5B2IB 1EQZC 4H9SA 4J8WB 1P3OD 3UTBB 4G92C 3X1TA 3LZ0A 3REKC 5GSUD 1P3OC 1P34A 3AN2D 5AVCA 4Z5TA 1ZLAD 5GSUC 3B6FD 5CPKB 1KU5A 2BYKA 4X23B 3AN2C 5CHLB 3MGSA 3AV2B 5FUGA 4KGCA 3WAAA 3B6FC 2FJ7D 1ID3A 3B6GA 4EO5C 2FJ7C 1M18C 4QLCD 4G92B 3C1BD 4UUZA 3X1UD 3AZND 2AROD 1P3OB 1TAFA 3AZGC 1KX5D 3C1BC 2YFVB 5B0YD 4XUJA 3AZNC 1BH9A 5B32A 5GSUB 1KX3D 5F99A 5B33D 3AN2B 5KDMA 3WTPC 1M1AC 3X1VD 5B0ZC 1KX5C 4CAYB 5B0YC 2LY8A 1ZLAB 1KX3C 3B6FB 4J8XA 5B33C 3REHD 3LZ1A 3NQUB 3AZEA 4KHAA 2FJ7B 3W96A 4DRAA 3LELA 3MGPC 2NZDD 4QLCB 5BNXB 3C1BB 3X1UB 3AZNB 2AROB 2NZDC 5GT0A 5BT1D 5JRGA 5CPIA 1KX5B 3UTAD 2PYOD 5B0YB 3KUYA 1KX3B 5BT1C 5B33B 5DNMC 3KSYA 3X1VB 2PYOC 3RELD 3VH6T 3UTAC 4H9PB 5GXQD 5AV5C 3REHB 1TZYA 3RELC 3REIA 4LD9D 5DNNA 1P3AD 3WKJA 4H9OB 3AZIA 2NZDB 3AZKC 4LD9C 1P3AC 4H9NA 3REJC 3LJAC 1S32A 2F8NK 4J8UD 4HGAC 2PYOB 3UTAB 5GT3C 3A6NC 5AV5B 4J8VC 3RELB 3V9RA 2F8NA 4WNNB 3W98A 5GXQB 4H9RB 3AZKB 4LD9B 1P3AB 4H9QB 3LJAB 5B2JC 3MGRD 3MVDA 4HGAB 1P3GD 3AZMD 5BNVA 4YM6D 4R8PD 3MGRC 4J8UB 3KXBA 4JJND 3AZMC 1P3PA 1M19D 4KUDA 4R8PC 4CSRA 4JJNC 1M19C 1P3IC 3MNND 3MGQC 3TU4D 5JA4B 5B2IC 2NQBA 1P3LA 3VH5T 3AZHA 1P3FD 2HUEC 3AZJD 4Z66D 1HTAA 1P3FC 5B31D 5AV9D 3MGRB 3R45B 3AZMB 5B1LD 1HQ3D 4YM6B 3AZLD 4R8PB 5B31C 5AV9C 1AOID 4JJNB 1HQ3C 1M19B 3MGQB 5B24A 5AY8A 1AOIC 3O62A 4ZUXA 3MNNB 3VH6A 4X23A 3TU4B 5CPKA 2HUEB 3UT9A 5G49B 5B1MA 3AV2A 1P3FB 5CPJD 3AZJB 1EQZA 4Z66B 5B31B 5AV9B 5CPJC 3KWQA 5B1LB 1HQ3B 3REKA 3X1TD 1P3OA 3AZLB 3LZ0D 5AV6D 1ZLAC 1P34D 1AOIB 5AVCD 3AYWD 5GSUA 3W97A 5AV6C 1P34C 5AVCC 5B31G 3MGSD 3AYWC 3WAAD 1ID3D 3B6GD 4QLCC 3WAAC 3X1UC 2AROC 5CPJB 1M18A 3NQJA 1ID3C 3B6GC 1BH8A 1N1JB 3AZGA 3C1BA 3X1VC 3X1TB 2F8NH 3LZ0B 5B32D 5AV6B 5F99D 3WTPA 1P34B 1M1AA 5B0ZA 5AVCB 3B0CT 4G91C 3REHC 5B0YA 3AYWB 2HIOA 5BS7A 1P3MD 1B67A 1KX3A 3W99A 1H3OB 2BYKB 4J8XD 3LZ1D 3MGSB 3AZED 5FUGB 1P3MC 1KX4A 3WAAB 1Q9CA 1ID3B 3B6GB 3LZ1C 3C1CD 3MGPA 3AZEC 3VH5A 3C1CC 4UUZB 5CP6D 5AV8D 5GT0D 1TAFB 5JRGD 4G91B 2CV5A 1JFIA 5CPID 5C3IC 5CP6C 5AV8C 3AV1A 5GT0C 5B32B 5DNMA 5F99B 5GXQC 5KDMB 1P3MB 1P3BA 3B0DC 5AV5A 2YFWA 4J8XB 3LZ1B 3AZEB 4WNNA 1A7WA 1U35A 5DNND 4NE5A 3X1SD 3C1CB 3AZKA 3AZID 3AZFD 3WA9D 4J8UC 4WU8D 3REJA 3LJAA 3X1SC 5C3IB 2IO5C 5AV8B 5CP6B 3AZFC 3WA9C 5GT0B 1S32D 5JRGB 4WU8C 5GT3A 3A6NA 5CPIB 3B0DB 4J8VA 4AWLC 2F8ND 5BO0A 3W98D 5AVBD 1P3KD 3W98C 5DNNB 3X1SB 5AVBC 1P3GC 2IO5B 1P3KC 3AZIB 3AZFB 5B2JA 3WA9B 4YM6C 4WU8B 3AFAD 3MGRA 1S32B 3R45A 4E45A 3AZMA 3KXBD 3AFAC 4AWLB 5B40D 4R8PA 4KUDD 3MNNC 3TU4C 5E5AD 5B40C 4XZQA 3MGQA 1P3IA 2F8NB 1WWIA 3W98B 4KUDC 5B2IA 4YS3D 5AVBB 5E5AC 3AZJC 1P3GB 1P3KB 4Z66C 2NQBD 4J8WA 2L5AA 5G49A 4YS3C 3UTBA 2BYMB 5B1LC 1P3FA 3AZLC 3AFAB 5BNVB 5B31A 5AV9A 1F66D 4WV4B 5B40B 3B0BA 4WU9D 4KUDB 5B24D 5AY8D 1B6WA 5E5AB 1F66C 3O62D 4ZUXD 4WU9C 4M6BA 4YS3B 3UT9D 5B1MD 3O62C 2NQBB 4H9SC 1EQZD 3UT9C 5B1MC 2YFVA 5CPJA 3X1TC 3WTPE 1ULYA 3LZ0C 4Z5TD 3AN2A 2CWEA 3KWQD 4CAYA 3REKD 1ZLAA 3B6FA 1N1JA 4KGCD 4Z5TC 1F66B 3NQUA 3KWQC 4WU9B 5AV6A 3MGSC 5B24B 2FJ7A 3W97D 5AY8B 4KGCC 3O62B 4ZUXB 3AYWA 1H3OA 3W97C 4QLCA 3UT9B 5B1MB 5BNXA 3AZNA 3X1UA 2AROA 4XUJD 1M18D 1EQZB 1KX5A 4E44A 4XUJC 4Z2MG 4Z5TB 5B33A 5B32C 5F99C 3AZGD 3KWQB 3X1VA 3REKB 4H9PA 4KGCB 3WTPD 1M1AD 3REHA 5B0ZD 4J8XC 3W96D 2HIOD 3W99D 3LELD 3W97B 4H9OA 3W96C 1P3MA 2HIOC 3W99C 5BS7C 1KX4D 2NZDA 3LELC 2RVQD 4EO5B 3MGPD 1KX4C 4XUJB 3KUYD 1BH9B 1M18B 3NQJB 3VH5W 3C1CA 2PYOA 5JRGC 3UTAA 2JSSA 1BH8B 2RVQC 5CPIC 3KUYC 3AZGB 5CP6A 5AV8A 1TZYD 3RELA 2CV5D 3REID 5GXQA 3AV1D 5DNMD 3WTPB 4KHAB 1M1AB 5B0ZB 3WKJD 3W96B 2CV5C 1TZYC 5B32G 2HIOB 4H9RA 1P3BD 3W99B 4LD9A 3LELB 3REIC 5AV5D 3AV1C 1P3AA 5DNNC 3WKJC 4H9QA 1P3BC 3AZIC 1KX4B 1U35D 3MGPB 3AZKD 3KUYB 4J8UA 1S32C 3X1SA 1U35C 1WWSA 3LJAD 3REJD 3AZFA 3WA9A 4WU8A 1R4VA 2CV5B 5GT3D 1TZYB 3A6ND 1JFIB 3REIB 3AV1B 5DNMB 5JA4A 4J8VD 1F1EA 3WKJB 1P3BB 4DRBA 2YFWB 3MVDD 4H9NB 4Z2MH 1U35B 5AVBA 1P3KA 1P3GA 3MVDC 4YM6A 1P3PD 4ZBJC 5B2JD 4JJNA 3REJB 2BYMA 3KXBC 1M19A 1P3PC 3V9RB 3AFAA 5GT3B 3A6NB 4WZSB 1P3LD 3MNNA 3TU4A 3AZHD 1BFMA 5B40A 4J8VB
chains in the Genus database with same CATH superfamily
4XZQD 3MGQD 5BO0B 4NFTA 1P3ID 3B0CW 1P3LC 2NQBC 3AZHC 5B2ID 5E5AA 3AZJA 4NE6A 4Z66A 3MVDB 2F8NG 4ZBJB 4XZQC 4YS3A 4J8WD 3UTBD 5B1LA 1HQ3A 3KXBB 1P3PB 5B2JB 3AZLA 4J8WC 1AOIA 3UTBC 4CSRB 3KFUG 5CPKD 4X23D 5B24C 3VH6W 5AY8C 1W2EA 3AV2D 4ZUXC 1P3LB 3AZHB 1F66A 5CPKC 4X23C 4WU9A 3AV2C 4XZQB 1P3IB 2W8SA 4NE3A 5B2IB 1EQZC 4H9SA 4J8WB 1P3OD 3UTBB 4G92C 3X1TA 3LZ0A 3REKC 5GSUD 1P3OC 1P34A 3AN2D 5AVCA 4Z5TA 1ZLAD 5GSUC 3B6FD 5CPKB 1KU5A 2BYKA 4X23B 3AN2C 5CHLB 3MGSA 3AV2B 5FUGA 4KGCA 3WAAA 3B6FC 2FJ7D 1ID3A 3B6GA 4EO5C 2FJ7C 1M18C 4QLCD 4G92B 3C1BD 4UUZA 3X1UD 3AZND 2AROD 1P3OB 1TAFA 3AZGC 1KX5D 3C1BC 2YFVB 5B0YD 4XUJA 3AZNC 1BH9A 5B32A 5GSUB 1KX3D 5F99A 2Y2IA 5B33D 3AN2B 2JCHA 5KDMA 3WTPC 1M1AC 3X1VD 5B0ZC 1KX5C 4CAYB 5B0YC 2LY8A 1ZLAB 1KX3C 3B6FB 4J8XA 5B33C 3REHD 2Y2NA 3LZ1A 3NQUB 3AZEA 4KHAA 2FJ7B 3W96A 4DRAA 3LELA 3A1KA 3MGPC 2NZDD 3F6TA 4QLCB 2Y2PA 5BNXB 3X1UB 3C1BB 2AROB 3AZNB 5GT0A 2NZDC 5BT1D 5JRGA 5CPIA 1KX5B 3UTAD 2PYOD 5B0YB 3KUYA 1KX3B 3EPHA 5BT1C 5B33B 5DNMC 3KSYA 3X1VB 2PYOC 3RELD 3VH6T 3UTAC 4H9PB 5GXQD 5AV5C 3REHB 1TZYA 4UPKA 2ZY5A 3RELC 3REIA 4LD9D 3EG5B 5DNNA 1P3AD 3WKJA 4H9OB 3AZIA 3FDDA 2NZDB 3AZKC 4LD9C 2F2AC 1P3AC 4H9NA 3REJC 3LJAC 1S32A 3EPLA 2F8NK 2G5IC 4J8UD 4HGAC 2PYOB 3UTAB 5GT3C 3A6NC 1Z2CB 5AV5B 4J8VC 3RELB 3V9RA 2F8NA 4WNNB 3W98A 5GXQB 2BG1A 2DQNC 4H9RB 3AZKB 4LD9B 1P3AB 4H9QB 3LJAB 5B2JC 3MGRD 3MVDA 4HGAB 1P3GD 3A1IA 3AZMD 5BNVA 4YM6D 4R8PD 3MGRC 4J8UB 3KXBA 4JJND 3AZMC 1P3PA 1M19D 3EPKA 4KUDA 4R8PC 2JE5A 4CSRA 4JJNC 1M19C 1P3IC 3MNND 3MGQC 3TU4D 5JA4B 5B2IC 2NQBA 1P3LA 3VH5T 3AZHA 1P3FD 2HUEC 3AZJD 4Z66D 1HTAA 1P3FC 5B31D 5AV9D 3MGRB 3R45B 3AZMB 5B1LD 1HQ3D 4YM6B 3AZLD 4R8PB 5B31C 5AV9C 1AOID 4JJNB 1HQ3C 1M19B 3MGQB 5B24A 5AY8A 2Y2MA 1AOIC 3O62A 4ZUXA 3MNNB 3VH6A 4X23A 3TU4B 5CPKA 2HUEB 3UT9A 5G49B 5B1MA 3AV2A 2Y2JA 1P3FB 5CPJD 3P5JB 3AZJB 1EQZA 4Z66B 5B31B 5AV9B 5CPJC 2Y2OA 3KWQA 5B1LB 1HQ3B 3REKA 3X1TD 1P3OA 3AZLB 3LZ0D 5AV6D 1ZLAC 1P34D 1AOIB 5AVCD 3AYWD 5GSUA 3W97A 5AV6C 1P34C 5AVCC 5B31G 3MGSD 3AYWC 3WAAD 1ID3D 3B6GD 4QLCC 3WAAC 3X1UC 2AROC 5CPJB 1M18A 3NQJA 2ZM5A 1ID3C 3B6GC 1BH8A 1N1JB 3AZGA 3C1BA 3X1VC 3X1TB 2F8NH 3AL0C 3LZ0B 5B32D 5AV6B 5F99D 3WTPA 1P34B 1M1AA 5B0ZA 5AVCB 3B0CT 4G91C 3REHC 5B0YA 3AYWB 2HIOA 2Y2LA 5BS7A 1B67A 1P3MD 1KX3A 3W99A 2Y2GA 1H3OB 2BYKB 4J8XD 3LZ1D 3MGSB 2FFFB 3AZED 5FUGB 1P3MC 1KX4A 2Y2HA 3WAAB 1Q9CA 1ID3B 3B6GB 3LZ1C 3C1CD 3MGPA 3AZEC 3VH5A 3C1CC 4UUZB 5CP6D 5AV8D 5GT0D 1TAFB 5JRGD 4G91B 2CV5A 1JFIA 5CPID 5C3IC 5CP6C 5AV8C 3AV1A 5GT0C 5B32B 5DNMA 5F99B 5GXQC 5KDMB 1P3MB 1P3BA 3B0DC 5AV5A 2YFWA 4J8XB 2RIQA 3LZ1B 3AZEB 4WNNA 1A7WA 1U35A 5DNND 4NE5A 2ZY2A 3X1SD 3C1CB 3AZKA 3AZID 3AZFD 3WA9D 4J8UC 4WU8D 3REJA 3LJAA 3X1SC 5C3IB 2IO5C 5AV8B 5CP6B 3AZFC 3WA9C 5GT0B 1S32D 5JRGB 4WU8C 5GT3A 3A6NA 5CPIB 2G5HC 3B0DB 4J8VA 4AWLC 2F8ND 5BO0A 3W98D 5AVBD 1P3KD 3W98C 5DNNB 3X1SB 5AVBC 1P3GC 2IO5B 1P3KC 3AZIB 3AZFB 5B2JA 3WA9B 3H0MC 4YM6C 4WU8B 3AFAD 3MGRA 1S32B 3R45A 4E45A 3AZMA 3KXBD 3AFAC 4AWLB 5B40D 4R8PA 4KUDD 3MNNC 3TU4C 5E5AD 5B40C 4XZQA 3MGQA 1P3IA 2F8NB 1WWIA 3W98B 4KUDC 5B2IA 4YS3D 5AVBB 5E5AC 3AZJC 1P3GB 1P3KB 4Z66C 2NQBD 4J8WA 2L5AA 5G49A 4YS3C 3UTBA 2BYMB 5B1LC 1P3FA 3AZLC 3AFAB 5BNVB 5B31A 5AV9A 1F66D 4WV4B 5B40B 3B0BA 4WU9D 4KUDB 5B24D 5AY8D 1PZRA 1B6WA 5E5AB 1F66C 3O62D 4ZUXD 4WU9C 4M6BA 4YS3B 2UWXA 3UT9D 5B1MD 3O62C 2NQBB 4H9SC 3IP4C 1EQZD 3UT9C 5B1MC 4WJ3C 2YFVA 5CPJA 3X1TC 3WTPE 1ULYA 3LZ0C 4Z5TD 3AN2A 2CWEA 3KWQD 4CAYA 3REKD 1ZLAA 3B6FA 1N1JA 4KGCD 4Z5TC 1F66B 3NQUA 3KWQC 4WU9B 5AV6A 3MGSC 5B24B 2FJ7A 3W97D 5AY8B 4KGCC 3O62B 4ZUXB 3AYWA 1H3OA 3W97C 4QLCA 3UT9B 5B1MB 5BNXA 3AZNA 3X1UA 2AROA 4XUJD 1M18D 1EQZB 1KX5A 4E44A 3EPJA 2ZY4A 4XUJC 4Z2MG 2Y2QA 4Z5TB 5B33A 5B32C 5F99C 3AZGD 3KWQB 3X1VA 3REKB 4H9PA 4KGCB 3WTPD 1M1AD 3REHA 5B0ZD 4J8XC 3W96D 2DF4C 2HIOD 3W99D 3LELD 3W97B 4H9OA 3W96C 1P3MA 2HIOC 3W99C 5BS7C 1KX4D 2NZDA 3LELC 2RVQD 4EO5B 3MGPD 3H0LC 1KX4C 4XUJB 3KUYD 1BH9B 1M18B 3NQJB 3VH5W 3C1CA 2Y2KA 2PYOA 5JRGC 3UTAA 2JSSA 1BH8B 2RVQC 5CPIC 3KUYC 3AZGB 1T3UA 5CP6A 1TZYD 5AV8A 2XD5A 3RELA 2CV5D 3REID 5GXQA 3AV1D 5DNMD 3WTPB 4KHAB 1M1AB 5B0ZB 3WKJD 3W96B 2CV5C 1TZYC 5B32G 2HIOB 4H9RA 1P3BD 3W99B 4LD9A 3LELB 3REIC 5AV5D 3AV1C 1P3AA 5DNNC 3WKJC 4H9QA 1P3BC 4DQYB 3AZIC 1KX4B 1U35D 3MGPB 3AZKD 3KUYB 4J8UA 1S32C 3X1SA 1U35C 1WWSA 3LJAD 3REJD 3AZFA 3WA9A 4WU8A 1R4VA 2CV5B 5GT3D 1TZYB 3A6ND 1JFIB 3REIB 3AV1B 5DNMB 5JA4A 4J8VD 1F1EA 3WKJB 1P3BB 4DRBA 2YFWB 2J8PA 3H0RC 3MVDD 4H9NB 4Z2MH 1U35B 5AVBA 1P3KA 1P3GA 3MVDC 2XD1A 4YM6A 1P3PD 4ZBJC 5B2JD 4JJNA 3REJB 2BYMA 3KXBC 1M19A 1P3PC 3V9RB 3AFAA 5GT3B 3A6NB 4WZSB 1P3LD 3MNNA 2ZY3A 3TU4A 3AZHD 2VQRA 1BFMA 5B40A 4J8VB
chains in the Genus database with same CATH topology
4XZQD 3MGQD 5BO0B 4NFTA 1P3ID 3B0CW 1P3LC 2NQBC 3AZHC 5B2ID 5E5AA 3AZJA 4NE6A 4Z66A 3MVDB 2F8NG 4ZBJB 4XZQC 4YS3A 4J8WD 3UTBD 5B1LA 1HQ3A 3KXBB 1P3PB 5B2JB 3AZLA 4J8WC 1AOIA 3UTBC 4CSRB 3KFUG 5CPKD 4X23D 5B24C 3VH6W 5AY8C 1W2EA 3AV2D 4ZUXC 1P3LB 3AZHB 1F66A 5CPKC 4X23C 4WU9A 3AV2C 4XZQB 1P3IB 2W8SA 4NE3A 5B2IB 1EQZC 4H9SA 4J8WB 1P3OD 3UTBB 4G92C 3X1TA 3LZ0A 3REKC 5GSUD 1P3OC 1P34A 3AN2D 5AVCA 4Z5TA 1ZLAD 5GSUC 3B6FD 5CPKB 1KU5A 2BYKA 4X23B 3AN2C 5CHLB 3MGSA 3AV2B 5FUGA 4KGCA 3WAAA 3B6FC 2FJ7D 1ID3A 3B6GA 4EO5C 2FJ7C 1M18C 4QLCD 4G92B 3C1BD 4UUZA 3X1UD 3AZND 2AROD 1P3OB 1TAFA 3AZGC 1KX5D 3C1BC 2YFVB 5B0YD 4XUJA 3AZNC 1BH9A 5B32A 5GSUB 1KX3D 5F99A 2Y2IA 5B33D 3AN2B 2JCHA 5KDMA 3WTPC 1M1AC 3X1VD 5B0ZC 1KX5C 4CAYB 5B0YC 2LY8A 1ZLAB 1KX3C 3B6FB 4J8XA 5B33C 3REHD 2Y2NA 3LZ1A 3NQUB 3AZEA 4KHAA 2FJ7B 3W96A 4DRAA 3LELA 3A1KA 3MGPC 2NZDD 3F6TA 4QLCB 2Y2PA 5BNXB 3X1UB 3C1BB 2AROB 3AZNB 5GT0A 2NZDC 5BT1D 5JRGA 5CPIA 1KX5B 3UTAD 2PYOD 5B0YB 3KUYA 1KX3B 3EPHA 5BT1C 5B33B 5DNMC 3KSYA 3X1VB 2PYOC 3RELD 3VH6T 3UTAC 4H9PB 5GXQD 5AV5C 3REHB 1TZYA 4UPKA 2ZY5A 3RELC 3REIA 4LD9D 3EG5B 5DNNA 1P3AD 3WKJA 4H9OB 3AZIA 3FDDA 2NZDB 3AZKC 4LD9C 2F2AC 1P3AC 4H9NA 3REJC 3LJAC 1S32A 3EPLA 2F8NK 2G5IC 4J8UD 4HGAC 2PYOB 3UTAB 5GT3C 3A6NC 1Z2CB 5AV5B 4J8VC 3RELB 3V9RA 2F8NA 4WNNB 3W98A 5GXQB 2BG1A 2DQNC 4H9RB 3AZKB 4LD9B 1P3AB 4H9QB 3LJAB 5B2JC 3MGRD 3MVDA 4HGAB 1P3GD 3A1IA 3AZMD 5BNVA 4YM6D 4R8PD 3MGRC 4J8UB 3KXBA 4JJND 3AZMC 1P3PA 1M19D 3EPKA 4KUDA 4R8PC 2JE5A 4CSRA 4JJNC 1M19C 1P3IC 3MNND 3MGQC 3TU4D 5JA4B 5B2IC 2NQBA 1P3LA 3VH5T 3AZHA 1P3FD 2HUEC 3AZJD 4Z66D 1HTAA 1P3FC 5B31D 5AV9D 3MGRB 3R45B 3AZMB 5B1LD 1HQ3D 4YM6B 3AZLD 4R8PB 5B31C 5AV9C 1AOID 4JJNB 1HQ3C 1M19B 3MGQB 5B24A 5AY8A 2Y2MA 1AOIC 3O62A 4ZUXA 3MNNB 3VH6A 4X23A 3TU4B 5CPKA 2HUEB 3UT9A 5G49B 5B1MA 3AV2A 2Y2JA 1P3FB 5CPJD 3P5JB 3AZJB 1EQZA 4Z66B 5B31B 5AV9B 5CPJC 2Y2OA 3KWQA 5B1LB 1HQ3B 3REKA 3X1TD 1P3OA 3AZLB 3LZ0D 5AV6D 1ZLAC 1P34D 1AOIB 5AVCD 3AYWD 5GSUA 3W97A 5AV6C 1P34C 5AVCC 5B31G 3MGSD 3AYWC 3WAAD 1ID3D 3B6GD 4QLCC 3WAAC 3X1UC 2AROC 5CPJB 1M18A 3NQJA 2ZM5A 1ID3C 3B6GC 1BH8A 1N1JB 3AZGA 3C1BA 3X1VC 3X1TB 2F8NH 3AL0C 3LZ0B 5B32D 5AV6B 5F99D 3WTPA 1P34B 1M1AA 5B0ZA 5AVCB 3B0CT 4G91C 3REHC 5B0YA 3AYWB 2HIOA 2Y2LA 5BS7A 1B67A 1P3MD 1KX3A 3W99A 2Y2GA 1H3OB 2BYKB 4J8XD 3LZ1D 3MGSB 2FFFB 3AZED 5FUGB 1P3MC 1KX4A 2Y2HA 3WAAB 1Q9CA 1ID3B 3B6GB 3LZ1C 3C1CD 3MGPA 3AZEC 3VH5A 3C1CC 4UUZB 5CP6D 5AV8D 5GT0D 1TAFB 5JRGD 4G91B 2CV5A 1JFIA 5CPID 5C3IC 5CP6C 5AV8C 3AV1A 5GT0C 5B32B 5DNMA 5F99B 5GXQC 5KDMB 1P3MB 1P3BA 3B0DC 5AV5A 2YFWA 4J8XB 2RIQA 3LZ1B 3AZEB 4WNNA 1A7WA 1U35A 5DNND 4NE5A 2ZY2A 3X1SD 3C1CB 3AZKA 3AZID 3AZFD 3WA9D 4J8UC 4WU8D 3REJA 3LJAA 3X1SC 5C3IB 2IO5C 5AV8B 5CP6B 3AZFC 3WA9C 5GT0B 1S32D 5JRGB 4WU8C 5GT3A 3A6NA 5CPIB 2G5HC 3B0DB 4J8VA 4AWLC 2F8ND 5BO0A 3W98D 5AVBD 1P3KD 3W98C 5DNNB 3X1SB 5AVBC 1P3GC 2IO5B 1P3KC 3AZIB 3AZFB 5B2JA 3WA9B 3H0MC 4YM6C 4WU8B 3AFAD 3MGRA 1S32B 3R45A 4E45A 3AZMA 3KXBD 3AFAC 4AWLB 5B40D 4R8PA 4KUDD 3MNNC 3TU4C 5E5AD 5B40C 4XZQA 3MGQA 1P3IA 2F8NB 1WWIA 3W98B 4KUDC 5B2IA 4YS3D 5AVBB 5E5AC 3AZJC 1P3GB 1P3KB 4Z66C 2NQBD 4J8WA 2L5AA 5G49A 4YS3C 3UTBA 2BYMB 5B1LC 1P3FA 3AZLC 3AFAB 5BNVB 5B31A 5AV9A 1F66D 4WV4B 5B40B 3B0BA 4WU9D 4KUDB 5B24D 5AY8D 1PZRA 1B6WA 5E5AB 1F66C 3O62D 4ZUXD 4WU9C 4M6BA 4YS3B 2UWXA 3UT9D 5B1MD 3O62C 2NQBB 4H9SC 3IP4C 1EQZD 3UT9C 5B1MC 4WJ3C 2YFVA 5CPJA 3X1TC 3WTPE 1ULYA 3LZ0C 4Z5TD 3AN2A 2CWEA 3KWQD 4CAYA 3REKD 1ZLAA 3B6FA 1N1JA 4KGCD 4Z5TC 1F66B 3NQUA 3KWQC 4WU9B 5AV6A 3MGSC 5B24B 2FJ7A 3W97D 5AY8B 4KGCC 3O62B 4ZUXB 3AYWA 1H3OA 3W97C 4QLCA 3UT9B 5B1MB 5BNXA 3AZNA 3X1UA 2AROA 4XUJD 1M18D 1EQZB 1KX5A 4E44A 3EPJA 2ZY4A 4XUJC 4Z2MG 2Y2QA 4Z5TB 5B33A 5B32C 5F99C 3AZGD 3KWQB 3X1VA 3REKB 4H9PA 4KGCB 3WTPD 1M1AD 3REHA 5B0ZD 4J8XC 3W96D 2DF4C 2HIOD 3W99D 3LELD 3W97B 4H9OA 3W96C 1P3MA 2HIOC 3W99C 5BS7C 1KX4D 2NZDA 3LELC 2RVQD 4EO5B 3MGPD 3H0LC 1KX4C 4XUJB 3KUYD 1BH9B 1M18B 3NQJB 3VH5W 3C1CA 2Y2KA 2PYOA 5JRGC 3UTAA 2JSSA 1BH8B 2RVQC 5CPIC 3KUYC 3AZGB 1T3UA 5CP6A 1TZYD 5AV8A 2XD5A 3RELA 2CV5D 3REID 5GXQA 3AV1D 5DNMD 3WTPB 4KHAB 1M1AB 5B0ZB 3WKJD 3W96B 2CV5C 1TZYC 5B32G 2HIOB 4H9RA 1P3BD 3W99B 4LD9A 3LELB 3REIC 5AV5D 3AV1C 1P3AA 5DNNC 3WKJC 4H9QA 1P3BC 4DQYB 3AZIC 1KX4B 1U35D 3MGPB 3AZKD 3KUYB 4J8UA 1S32C 3X1SA 1U35C 1WWSA 3LJAD 3REJD 3AZFA 3WA9A 4WU8A 1R4VA 2CV5B 5GT3D 1TZYB 3A6ND 1JFIB 3REIB 3AV1B 5DNMB 5JA4A 4J8VD 1F1EA 3WKJB 1P3BB 4DRBA 2YFWB 2J8PA 3H0RC 3MVDD 4H9NB 4Z2MH 1U35B 5AVBA 1P3KA 1P3GA 3MVDC 2XD1A 4YM6A 1P3PD 4ZBJC 5B2JD 4JJNA 3REJB 2BYMA 3KXBC 1M19A 1P3PC 3V9RB 3AFAA 5GT3B 3A6NB 4WZSB 1P3LD 3MNNA 2ZY3A 3TU4A 3AZHD 2VQRA 1BFMA 5B40A 4J8VB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XZQ D;  3MGQ D;  5BO0 B;  4NFT A;  1P3I D;  3B0C W;  1P3L C;  2NQB C;  3AZH C;  5B2I D;  5E5A A;  3AZJ A;  4NE6 A;  4Z66 A;  3MVD B;  2F8N G;  4ZBJ B;  4XZQ C;  4YS3 A;  4J8W D;  3UTB D;  5B1L A;  1HQ3 A;  3KXB B;  1P3P B;  5B2J B;  3AZL A;  4J8W C;  1AOI A;  3UTB C;  4CSR B;  5CPK D;  4X23 D;  5B24 C;  3VH6 W;  5AY8 C;  3AV2 D;  4ZUX C;  1P3L B;  3AZH B;  1F66 A;  5CPK C;  4X23 C;  4WU9 A;  3AV2 C;  4XZQ B;  1P3I B;  4NE3 A;  5B2I B;  1EQZ C;  4H9S A;  4J8W B;  1P3O D;  3UTB B;  4G92 C;  3X1T A;  3LZ0 A;  3REK C;  5GSU D;  1P3O C;  1P34 A;  3AN2 D;  5AVC A;  4Z5T A;  1ZLA D;  5GSU C;  3B6F D;  5CPK B;  1KU5 A;  2BYK A;  4X23 B;  3AN2 C;  5CHL B;  3MGS A;  3AV2 B;  5FUG A;  4KGC A;  3WAA A;  3B6F C;  2FJ7 D;  1ID3 A;  3B6G A;  4EO5 C;  2FJ7 C;  1M18 C;  4QLC D;  4G92 B;  3C1B D;  4UUZ A;  3X1U D;  3AZN D;  2ARO D;  1P3O B;  1TAF A;  3AZG C;  1KX5 D;  3C1B C;  2YFV B;  5B0Y D;  4XUJ A;  3AZN C;  1BH9 A;  5B32 A;  5GSU B;  1KX3 D;  5F99 A;  5B33 D;  3AN2 B;  5KDM A;  3WTP C;  1M1A C;  3X1V D;  5B0Z C;  1KX5 C;  4CAY B;  5B0Y C;  2LY8 A;  1ZLA B;  1KX3 C;  3B6F B;  4J8X A;  5B33 C;  3REH D;  3LZ1 A;  3NQU B;  3AZE A;  4KHA A;  2FJ7 B;  3W96 A;  4DRA A;  3LEL A;  3MGP C;  2NZD D;  4QLC B;  5BNX B;  3C1B B;  3X1U B;  3AZN B;  2ARO B;  2NZD C;  5GT0 A;  5BT1 D;  5JRG A;  5CPI A;  1KX5 B;  3UTA D;  2PYO D;  5B0Y B;  3KUY A;  1KX3 B;  5BT1 C;  5B33 B;  5DNM C;  3KSY A;  3X1V B;  2PYO C;  3REL D;  3VH6 T;  3UTA C;  4H9P B;  5GXQ D;  5AV5 C;  3REH B;  1TZY A;  3REL C;  3REI A;  4LD9 D;  5DNN A;  1P3A D;  3WKJ A;  4H9O B;  3AZI A;  2NZD B;  3AZK C;  4LD9 C;  1P3A C;  4H9N A;  3REJ C;  3LJA C;  1S32 A;  2F8N K;  4J8U D;  4HGA C;  2PYO B;  3UTA B;  5GT3 C;  3A6N C;  5AV5 B;  4J8V C;  3REL B;  3V9R A;  2F8N A;  4WNN B;  3W98 A;  5GXQ B;  4H9R B;  3AZK B;  4LD9 B;  1P3A B;  4H9Q B;  3LJA B;  5B2J C;  3MGR D;  3MVD A;  4HGA B;  1P3G D;  3AZM D;  5BNV A;  4YM6 D;  4R8P D;  3MGR C;  4J8U B;  3KXB A;  4JJN D;  3AZM C;  1P3P A;  1M19 D;  4KUD A;  4R8P C;  4CSR A;  4JJN C;  1M19 C;  1P3I C;  3MNN D;  3MGQ C;  3TU4 D;  5JA4 B;  5B2I C;  2NQB A;  1P3L A;  3VH5 T;  3AZH A;  1P3F D;  2HUE C;  3AZJ D;  4Z66 D;  1HTA A;  1P3F C;  5B31 D;  5AV9 D;  3MGR B;  3R45 B;  3AZM B;  5B1L D;  1HQ3 D;  4YM6 B;  3AZL D;  4R8P B;  5B31 C;  5AV9 C;  1AOI D;  4JJN B;  1HQ3 C;  1M19 B;  3MGQ B;  5B24 A;  5AY8 A;  1AOI C;  3O62 A;  4ZUX A;  3MNN B;  3VH6 A;  4X23 A;  3TU4 B;  5CPK A;  2HUE B;  3UT9 A;  5G49 B;  5B1M A;  3AV2 A;  1P3F B;  5CPJ D;  3AZJ B;  1EQZ A;  4Z66 B;  5B31 B;  5AV9 B;  5CPJ C;  3KWQ A;  5B1L B;  1HQ3 B;  3REK A;  3X1T D;  1P3O A;  3AZL B;  3LZ0 D;  5AV6 D;  1ZLA C;  1P34 D;  1AOI B;  5AVC D;  3AYW D;  5GSU A;  3W97 A;  5AV6 C;  1P34 C;  5AVC C;  5B31 G;  3MGS D;  3AYW C;  3WAA D;  1ID3 D;  3B6G D;  4QLC C;  3WAA C;  3X1U C;  2ARO C;  5CPJ B;  1M18 A;  3NQJ A;  1ID3 C;  3B6G C;  1BH8 A;  1N1J B;  3AZG A;  3C1B A;  3X1V C;  3X1T B;  2F8N H;  3LZ0 B;  5B32 D;  5AV6 B;  5F99 D;  3WTP A;  1P34 B;  1M1A A;  5B0Z A;  5AVC B;  3B0C T;  4G91 C;  3REH C;  5B0Y A;  3AYW B;  2HIO A;  5BS7 A;  1P3M D;  1B67 A;  1KX3 A;  3W99 A;  1H3O B;  2BYK B;  4J8X D;  3LZ1 D;  3MGS B;  3AZE D;  5FUG B;  1P3M C;  1KX4 A;  3WAA B;  1Q9C A;  1ID3 B;  3B6G B;  3LZ1 C;  3C1C D;  3MGP A;  3AZE C;  3VH5 A;  3C1C C;  4UUZ B;  5CP6 D;  5AV8 D;  5GT0 D;  1TAF B;  5JRG D;  4G91 B;  2CV5 A;  1JFI A;  5CPI D;  5C3I C;  5CP6 C;  5AV8 C;  3AV1 A;  5GT0 C;  5B32 B;  5DNM A;  5F99 B;  5GXQ C;  5KDM B;  1P3M B;  1P3B A;  3B0D C;  5AV5 A;  2YFW A;  4J8X B;  3LZ1 B;  3AZE B;  4WNN A;  1A7W A;  1U35 A;  5DNN D;  4NE5 A;  3X1S D;  3C1C B;  3AZK A;  3AZI D;  3AZF D;  3WA9 D;  4J8U C;  4WU8 D;  3REJ A;  3LJA A;  3X1S C;  5C3I B;  2IO5 C;  5AV8 B;  5CP6 B;  3AZF C;  3WA9 C;  5GT0 B;  1S32 D;  5JRG B;  4WU8 C;  5GT3 A;  3A6N A;  5CPI B;  3B0D B;  4J8V A;  4AWL C;  2F8N D;  5BO0 A;  3W98 D;  5AVB D;  1P3K D;  3W98 C;  5DNN B;  3X1S B;  5AVB C;  1P3G C;  2IO5 B;  1P3K C;  3AZI B;  3AZF B;  5B2J A;  3WA9 B;  4YM6 C;  4WU8 B;  3AFA D;  3MGR A;  1S32 B;  3R45 A;  4E45 A;  3AZM A;  3KXB D;  3AFA C;  4AWL B;  5B40 D;  4R8P A;  4KUD D;  3MNN C;  3TU4 C;  5E5A D;  5B40 C;  4XZQ A;  3MGQ A;  1P3I A;  2F8N B;  1WWI A;  3W98 B;  4KUD C;  5B2I A;  4YS3 D;  5AVB B;  5E5A C;  3AZJ C;  1P3G B;  1P3K B;  4Z66 C;  2NQB D;  4J8W A;  2L5A A;  5G49 A;  4YS3 C;  3UTB A;  2BYM B;  5B1L C;  1P3F A;  3AZL C;  3AFA B;  5BNV B;  5B31 A;  5AV9 A;  1F66 D;  4WV4 B;  5B40 B;  3B0B A;  4WU9 D;  4KUD B;  5B24 D;  5AY8 D;  1B6W A;  5E5A B;  1F66 C;  3O62 D;  4ZUX D;  4WU9 C;  4M6B A;  4YS3 B;  3UT9 D;  5B1M D;  3O62 C;  2NQB B;  4H9S C;  1EQZ D;  3UT9 C;  5B1M C;  2YFV A;  5CPJ A;  3X1T C;  3WTP E;  1ULY A;  3LZ0 C;  4Z5T D;  3AN2 A;  2CWE A;  3KWQ D;  4CAY A;  3REK D;  1ZLA A;  3B6F A;  1N1J A;  4KGC D;  4Z5T C;  1F66 B;  3NQU A;  3KWQ C;  4WU9 B;  5AV6 A;  3MGS C;  5B24 B;  2FJ7 A;  3W97 D;  5AY8 B;  4KGC C;  3O62 B;  4ZUX B;  3AYW A;  1H3O A;  3W97 C;  4QLC A;  3UT9 B;  5B1M B;  5BNX A;  3AZN A;  3X1U A;  2ARO A;  4XUJ D;  1M18 D;  1EQZ B;  1KX5 A;  4E44 A;  4XUJ C;  4Z2M G;  4Z5T B;  5B33 A;  5B32 C;  5F99 C;  3AZG D;  3KWQ B;  3X1V A;  3REK B;  4H9P A;  4KGC B;  3WTP D;  1M1A D;  3REH A;  5B0Z D;  4J8X C;  3W96 D;  2HIO D;  3W99 D;  3LEL D;  3W97 B;  4H9O A;  3W96 C;  1P3M A;  2HIO C;  3W99 C;  5BS7 C;  1KX4 D;  2NZD A;  3LEL C;  2RVQ D;  4EO5 B;  3MGP D;  1KX4 C;  4XUJ B;  3KUY D;  1BH9 B;  1M18 B;  3NQJ B;  3VH5 W;  3C1C A;  2PYO A;  5JRG C;  3UTA A;  2JSS A;  1BH8 B;  2RVQ C;  5CPI C;  3KUY C;  3AZG B;  5CP6 A;  5AV8 A;  1TZY D;  3REL A;  2CV5 D;  3REI D;  5GXQ A;  3AV1 D;  5DNM D;  3WTP B;  4KHA B;  1M1A B;  5B0Z B;  3WKJ D;  3W96 B;  2CV5 C;  1TZY C;  5B32 G;  2HIO B;  4H9R A;  1P3B D;  3W99 B;  4LD9 A;  3LEL B;  3REI C;  5AV5 D;  3AV1 C;  1P3A A;  5DNN C;  3WKJ C;  4H9Q A;  1P3B C;  3AZI C;  1KX4 B;  1U35 D;  3MGP B;  3AZK D;  3KUY B;  4J8U A;  1S32 C;  3X1S A;  1U35 C;  1WWS A;  3LJA D;  3REJ D;  3AZF A;  3WA9 A;  4WU8 A;  1R4V A;  2CV5 B;  5GT3 D;  1TZY B;  3A6N D;  1JFI B;  3REI B;  3AV1 B;  5DNM B;  5JA4 A;  4J8V D;  1F1E A;  3WKJ B;  1P3B B;  4DRB A;  2YFW B;  3MVD D;  4H9N B;  4Z2M H;  1U35 B;  5AVB A;  1P3K A;  1P3G A;  3MVD C;  4YM6 A;  1P3P D;  4ZBJ C;  5B2J D;  4JJN A;  3REJ B;  2BYM A;  3KXB C;  1M19 A;  1P3P C;  3V9R B;  3AFA A;  5GT3 B;  3A6N B;  4WZS B;  1P3L D;  3MNN A;  3TU4 A;  3AZH D;  1BFM A;  5B40 A;  4J8V B; 
#chains in the Genus database with same CATH topology
 4XZQ D;  3MGQ D;  5BO0 B;  4NFT A;  1P3I D;  3B0C W;  1P3L C;  2NQB C;  3AZH C;  5B2I D;  5E5A A;  3AZJ A;  4NE6 A;  4Z66 A;  3MVD B;  2F8N G;  4ZBJ B;  4XZQ C;  4YS3 A;  4J8W D;  3UTB D;  5B1L A;  1HQ3 A;  3KXB B;  1P3P B;  5B2J B;  3AZL A;  4J8W C;  1AOI A;  3UTB C;  4CSR B;  3KFU G;  5CPK D;  4X23 D;  5B24 C;  3VH6 W;  5AY8 C;  1W2E A;  3AV2 D;  4ZUX C;  1P3L B;  3AZH B;  1F66 A;  5CPK C;  4X23 C;  4WU9 A;  3AV2 C;  4XZQ B;  1P3I B;  2W8S A;  4NE3 A;  5B2I B;  1EQZ C;  4H9S A;  4J8W B;  1P3O D;  3UTB B;  4G92 C;  3X1T A;  3LZ0 A;  3REK C;  5GSU D;  1P3O C;  1P34 A;  3AN2 D;  5AVC A;  4Z5T A;  1ZLA D;  5GSU C;  3B6F D;  5CPK B;  1KU5 A;  2BYK A;  4X23 B;  3AN2 C;  5CHL B;  3MGS A;  3AV2 B;  5FUG A;  4KGC A;  3WAA A;  3B6F C;  2FJ7 D;  1ID3 A;  3B6G A;  4EO5 C;  2FJ7 C;  1M18 C;  4QLC D;  4G92 B;  3C1B D;  4UUZ A;  3X1U D;  3AZN D;  2ARO D;  1P3O B;  1TAF A;  3AZG C;  1KX5 D;  3C1B C;  2YFV B;  5B0Y D;  4XUJ A;  3AZN C;  1BH9 A;  5B32 A;  5GSU B;  1KX3 D;  5F99 A;  2Y2I A;  5B33 D;  3AN2 B;  2JCH A;  5KDM A;  3WTP C;  1M1A C;  3X1V D;  5B0Z C;  1KX5 C;  4CAY B;  5B0Y C;  2LY8 A;  1ZLA B;  1KX3 C;  3B6F B;  4J8X A;  5B33 C;  3REH D;  2Y2N A;  3LZ1 A;  3NQU B;  3AZE A;  4KHA A;  2FJ7 B;  3W96 A;  4DRA A;  3LEL A;  3A1K A;  3MGP C;  2NZD D;  3F6T A;  4QLC B;  2Y2P A;  5BNX B;  3X1U B;  3C1B B;  2ARO B;  3AZN B;  5GT0 A;  2NZD C;  5BT1 D;  5JRG A;  5CPI A;  1KX5 B;  3UTA D;  2PYO D;  5B0Y B;  3KUY A;  1KX3 B;  3EPH A;  5BT1 C;  5B33 B;  5DNM C;  3KSY A;  3X1V B;  2PYO C;  3REL D;  3VH6 T;  3UTA C;  4H9P B;  5GXQ D;  5AV5 C;  3REH B;  1TZY A;  4UPK A;  2ZY5 A;  3REL C;  3REI A;  4LD9 D;  3EG5 B;  5DNN A;  1P3A D;  3WKJ A;  4H9O B;  3AZI A;  3FDD A;  2NZD B;  3AZK C;  4LD9 C;  2F2A C;  1P3A C;  4H9N A;  3REJ C;  3LJA C;  1S32 A;  3EPL A;  2F8N K;  2G5I C;  4J8U D;  4HGA C;  2PYO B;  3UTA B;  5GT3 C;  3A6N C;  1Z2C B;  5AV5 B;  4J8V C;  3REL B;  3V9R A;  2F8N A;  4WNN B;  3W98 A;  5GXQ B;  2BG1 A;  2DQN C;  4H9R B;  3AZK B;  4LD9 B;  1P3A B;  4H9Q B;  3LJA B;  5B2J C;  3MGR D;  3MVD A;  4HGA B;  1P3G D;  3A1I A;  3AZM D;  5BNV A;  4YM6 D;  4R8P D;  3MGR C;  4J8U B;  3KXB A;  4JJN D;  3AZM C;  1P3P A;  1M19 D;  3EPK A;  4KUD A;  4R8P C;  2JE5 A;  4CSR A;  4JJN C;  1M19 C;  1P3I C;  3MNN D;  3MGQ C;  3TU4 D;  5JA4 B;  5B2I C;  2NQB A;  1P3L A;  3VH5 T;  3AZH A;  1P3F D;  2HUE C;  3AZJ D;  4Z66 D;  1HTA A;  1P3F C;  5B31 D;  5AV9 D;  3MGR B;  3R45 B;  3AZM B;  5B1L D;  1HQ3 D;  4YM6 B;  3AZL D;  4R8P B;  5B31 C;  5AV9 C;  1AOI D;  4JJN B;  1HQ3 C;  1M19 B;  3MGQ B;  5B24 A;  5AY8 A;  2Y2M A;  1AOI C;  3O62 A;  4ZUX A;  3MNN B;  3VH6 A;  4X23 A;  3TU4 B;  5CPK A;  2HUE B;  3UT9 A;  5G49 B;  5B1M A;  3AV2 A;  2Y2J A;  1P3F B;  5CPJ D;  3P5J B;  3AZJ B;  1EQZ A;  4Z66 B;  5B31 B;  5AV9 B;  5CPJ C;  2Y2O A;  3KWQ A;  5B1L B;  1HQ3 B;  3REK A;  3X1T D;  1P3O A;  3AZL B;  3LZ0 D;  5AV6 D;  1ZLA C;  1P34 D;  1AOI B;  5AVC D;  3AYW D;  5GSU A;  3W97 A;  5AV6 C;  1P34 C;  5AVC C;  5B31 G;  3MGS D;  3AYW C;  3WAA D;  1ID3 D;  3B6G D;  4QLC C;  3WAA C;  3X1U C;  2ARO C;  5CPJ B;  1M18 A;  3NQJ A;  2ZM5 A;  1ID3 C;  3B6G C;  1BH8 A;  1N1J B;  3AZG A;  3C1B A;  3X1V C;  3X1T B;  2F8N H;  3AL0 C;  3LZ0 B;  5B32 D;  5AV6 B;  5F99 D;  3WTP A;  1P34 B;  1M1A A;  5B0Z A;  5AVC B;  3B0C T;  4G91 C;  3REH C;  5B0Y A;  3AYW B;  2HIO A;  2Y2L A;  5BS7 A;  1B67 A;  1P3M D;  1KX3 A;  3W99 A;  2Y2G A;  1H3O B;  2BYK B;  4J8X D;  3LZ1 D;  3MGS B;  2FFF B;  3AZE D;  5FUG B;  1P3M C;  1KX4 A;  2Y2H A;  3WAA B;  1Q9C A;  1ID3 B;  3B6G B;  3LZ1 C;  3C1C D;  3MGP A;  3AZE C;  3VH5 A;  3C1C C;  4UUZ B;  5CP6 D;  5AV8 D;  5GT0 D;  1TAF B;  5JRG D;  4G91 B;  2CV5 A;  1JFI A;  5CPI D;  5C3I C;  5CP6 C;  5AV8 C;  3AV1 A;  5GT0 C;  5B32 B;  5DNM A;  5F99 B;  5GXQ C;  5KDM B;  1P3M B;  1P3B A;  3B0D C;  5AV5 A;  2YFW A;  4J8X B;  2RIQ A;  3LZ1 B;  3AZE B;  4WNN A;  1A7W A;  1U35 A;  5DNN D;  4NE5 A;  2ZY2 A;  3X1S D;  3C1C B;  3AZK A;  3AZI D;  3AZF D;  3WA9 D;  4J8U C;  4WU8 D;  3REJ A;  3LJA A;  3X1S C;  5C3I B;  2IO5 C;  5AV8 B;  5CP6 B;  3AZF C;  3WA9 C;  5GT0 B;  1S32 D;  5JRG B;  4WU8 C;  5GT3 A;  3A6N A;  5CPI B;  2G5H C;  3B0D B;  4J8V A;  4AWL C;  2F8N D;  5BO0 A;  3W98 D;  5AVB D;  1P3K D;  3W98 C;  5DNN B;  3X1S B;  5AVB C;  1P3G C;  2IO5 B;  1P3K C;  3AZI B;  3AZF B;  5B2J A;  3WA9 B;  3H0M C;  4YM6 C;  4WU8 B;  3AFA D;  3MGR A;  1S32 B;  3R45 A;  4E45 A;  3AZM A;  3KXB D;  3AFA C;  4AWL B;  5B40 D;  4R8P A;  4KUD D;  3MNN C;  3TU4 C;  5E5A D;  5B40 C;  4XZQ A;  3MGQ A;  1P3I A;  2F8N B;  1WWI A;  3W98 B;  4KUD C;  5B2I A;  4YS3 D;  5AVB B;  5E5A C;  3AZJ C;  1P3G B;  1P3K B;  4Z66 C;  2NQB D;  4J8W A;  2L5A A;  5G49 A;  4YS3 C;  3UTB A;  2BYM B;  5B1L C;  1P3F A;  3AZL C;  3AFA B;  5BNV B;  5B31 A;  5AV9 A;  1F66 D;  4WV4 B;  5B40 B;  3B0B A;  4WU9 D;  4KUD B;  5B24 D;  5AY8 D;  1PZR A;  1B6W A;  5E5A B;  1F66 C;  3O62 D;  4ZUX D;  4WU9 C;  4M6B A;  4YS3 B;  2UWX A;  3UT9 D;  5B1M D;  3O62 C;  2NQB B;  4H9S C;  3IP4 C;  1EQZ D;  3UT9 C;  5B1M C;  4WJ3 C;  2YFV A;  5CPJ A;  3X1T C;  3WTP E;  1ULY A;  3LZ0 C;  4Z5T D;  3AN2 A;  2CWE A;  3KWQ D;  4CAY A;  3REK D;  1ZLA A;  3B6F A;  1N1J A;  4KGC D;  4Z5T C;  1F66 B;  3NQU A;  3KWQ C;  4WU9 B;  5AV6 A;  3MGS C;  5B24 B;  2FJ7 A;  3W97 D;  5AY8 B;  4KGC C;  3O62 B;  4ZUX B;  3AYW A;  1H3O A;  3W97 C;  4QLC A;  3UT9 B;  5B1M B;  5BNX A;  3AZN A;  3X1U A;  2ARO A;  4XUJ D;  1M18 D;  1EQZ B;  1KX5 A;  4E44 A;  3EPJ A;  2ZY4 A;  4XUJ C;  4Z2M G;  2Y2Q A;  4Z5T B;  5B33 A;  5B32 C;  5F99 C;  3AZG D;  3KWQ B;  3X1V A;  3REK B;  4H9P A;  4KGC B;  3WTP D;  1M1A D;  3REH A;  5B0Z D;  4J8X C;  3W96 D;  2DF4 C;  2HIO D;  3W99 D;  3LEL D;  3W97 B;  4H9O A;  3W96 C;  1P3M A;  2HIO C;  3W99 C;  5BS7 C;  1KX4 D;  2NZD A;  3LEL C;  2RVQ D;  4EO5 B;  3MGP D;  3H0L C;  1KX4 C;  4XUJ B;  3KUY D;  1BH9 B;  1M18 B;  3NQJ B;  3VH5 W;  3C1C A;  2Y2K A;  2PYO A;  5JRG C;  3UTA A;  2JSS A;  1BH8 B;  2RVQ C;  5CPI C;  3KUY C;  3AZG B;  1T3U A;  5CP6 A;  1TZY D;  5AV8 A;  2XD5 A;  3REL A;  2CV5 D;  3REI D;  5GXQ A;  3AV1 D;  5DNM D;  3WTP B;  4KHA B;  1M1A B;  5B0Z B;  3WKJ D;  3W96 B;  2CV5 C;  1TZY C;  5B32 G;  2HIO B;  4H9R A;  1P3B D;  3W99 B;  4LD9 A;  3LEL B;  3REI C;  5AV5 D;  3AV1 C;  1P3A A;  5DNN C;  3WKJ C;  4H9Q A;  1P3B C;  4DQY B;  3AZI C;  1KX4 B;  1U35 D;  3MGP B;  3AZK D;  3KUY B;  4J8U A;  1S32 C;  3X1S A;  1U35 C;  1WWS A;  3LJA D;  3REJ D;  3AZF A;  3WA9 A;  4WU8 A;  1R4V A;  2CV5 B;  5GT3 D;  1TZY B;  3A6N D;  1JFI B;  3REI B;  3AV1 B;  5DNM B;  5JA4 A;  4J8V D;  1F1E A;  3WKJ B;  1P3B B;  4DRB A;  2YFW B;  2J8P A;  3H0R C;  3MVD D;  4H9N B;  4Z2M H;  1U35 B;  5AVB A;  1P3K A;  1P3G A;  3MVD C;  2XD1 A;  4YM6 A;  1P3P D;  4ZBJ C;  5B2J D;  4JJN A;  3REJ B;  2BYM A;  3KXB C;  1M19 A;  1P3P C;  3V9R B;  3AFA A;  5GT3 B;  3A6N B;  4WZS B;  1P3L D;  3MNN A;  2ZY3 A;  3TU4 A;  3AZH D;  2VQR A;  1BFM A;  5B40 A;  4J8V B; 
#chains in the Genus database with same CATH homology
 4XZQ D;  3MGQ D;  5BO0 B;  4NFT A;  1P3I D;  3B0C W;  1P3L C;  2NQB C;  3AZH C;  5B2I D;  5E5A A;  3AZJ A;  4NE6 A;  4Z66 A;  3MVD B;  2F8N G;  4ZBJ B;  4XZQ C;  4YS3 A;  4J8W D;  3UTB D;  5B1L A;  1HQ3 A;  3KXB B;  1P3P B;  5B2J B;  3AZL A;  4J8W C;  1AOI A;  3UTB C;  4CSR B;  3KFU G;  5CPK D;  4X23 D;  5B24 C;  3VH6 W;  5AY8 C;  1W2E A;  3AV2 D;  4ZUX C;  1P3L B;  3AZH B;  1F66 A;  5CPK C;  4X23 C;  4WU9 A;  3AV2 C;  4XZQ B;  1P3I B;  2W8S A;  4NE3 A;  5B2I B;  1EQZ C;  4H9S A;  4J8W B;  1P3O D;  3UTB B;  4G92 C;  3X1T A;  3LZ0 A;  3REK C;  5GSU D;  1P3O C;  1P34 A;  3AN2 D;  5AVC A;  4Z5T A;  1ZLA D;  5GSU C;  3B6F D;  5CPK B;  1KU5 A;  2BYK A;  4X23 B;  3AN2 C;  5CHL B;  3MGS A;  3AV2 B;  5FUG A;  4KGC A;  3WAA A;  3B6F C;  2FJ7 D;  1ID3 A;  3B6G A;  4EO5 C;  2FJ7 C;  1M18 C;  4QLC D;  4G92 B;  3C1B D;  4UUZ A;  3X1U D;  3AZN D;  2ARO D;  1P3O B;  1TAF A;  3AZG C;  1KX5 D;  3C1B C;  2YFV B;  5B0Y D;  4XUJ A;  3AZN C;  1BH9 A;  5B32 A;  5GSU B;  1KX3 D;  5F99 A;  2Y2I A;  5B33 D;  3AN2 B;  2JCH A;  5KDM A;  3WTP C;  1M1A C;  3X1V D;  5B0Z C;  1KX5 C;  4CAY B;  5B0Y C;  2LY8 A;  1ZLA B;  1KX3 C;  3B6F B;  4J8X A;  5B33 C;  3REH D;  2Y2N A;  3LZ1 A;  3NQU B;  3AZE A;  4KHA A;  2FJ7 B;  3W96 A;  4DRA A;  3LEL A;  3A1K A;  3MGP C;  2NZD D;  3F6T A;  4QLC B;  2Y2P A;  5BNX B;  3X1U B;  3C1B B;  2ARO B;  3AZN B;  5GT0 A;  2NZD C;  5BT1 D;  5JRG A;  5CPI A;  1KX5 B;  3UTA D;  2PYO D;  5B0Y B;  3KUY A;  1KX3 B;  3EPH A;  5BT1 C;  5B33 B;  5DNM C;  3KSY A;  3X1V B;  2PYO C;  3REL D;  3VH6 T;  3UTA C;  4H9P B;  5GXQ D;  5AV5 C;  3REH B;  1TZY A;  4UPK A;  2ZY5 A;  3REL C;  3REI A;  4LD9 D;  3EG5 B;  5DNN A;  1P3A D;  3WKJ A;  4H9O B;  3AZI A;  3FDD A;  2NZD B;  3AZK C;  4LD9 C;  2F2A C;  1P3A C;  4H9N A;  3REJ C;  3LJA C;  1S32 A;  3EPL A;  2F8N K;  2G5I C;  4J8U D;  4HGA C;  2PYO B;  3UTA B;  5GT3 C;  3A6N C;  1Z2C B;  5AV5 B;  4J8V C;  3REL B;  3V9R A;  2F8N A;  4WNN B;  3W98 A;  5GXQ B;  2BG1 A;  2DQN C;  4H9R B;  3AZK B;  4LD9 B;  1P3A B;  4H9Q B;  3LJA B;  5B2J C;  3MGR D;  3MVD A;  4HGA B;  1P3G D;  3A1I A;  3AZM D;  5BNV A;  4YM6 D;  4R8P D;  3MGR C;  4J8U B;  3KXB A;  4JJN D;  3AZM C;  1P3P A;  1M19 D;  3EPK A;  4KUD A;  4R8P C;  2JE5 A;  4CSR A;  4JJN C;  1M19 C;  1P3I C;  3MNN D;  3MGQ C;  3TU4 D;  5JA4 B;  5B2I C;  2NQB A;  1P3L A;  3VH5 T;  3AZH A;  1P3F D;  2HUE C;  3AZJ D;  4Z66 D;  1HTA A;  1P3F C;  5B31 D;  5AV9 D;  3MGR B;  3R45 B;  3AZM B;  5B1L D;  1HQ3 D;  4YM6 B;  3AZL D;  4R8P B;  5B31 C;  5AV9 C;  1AOI D;  4JJN B;  1HQ3 C;  1M19 B;  3MGQ B;  5B24 A;  5AY8 A;  2Y2M A;  1AOI C;  3O62 A;  4ZUX A;  3MNN B;  3VH6 A;  4X23 A;  3TU4 B;  5CPK A;  2HUE B;  3UT9 A;  5G49 B;  5B1M A;  3AV2 A;  2Y2J A;  1P3F B;  5CPJ D;  3P5J B;  3AZJ B;  1EQZ A;  4Z66 B;  5B31 B;  5AV9 B;  5CPJ C;  2Y2O A;  3KWQ A;  5B1L B;  1HQ3 B;  3REK A;  3X1T D;  1P3O A;  3AZL B;  3LZ0 D;  5AV6 D;  1ZLA C;  1P34 D;  1AOI B;  5AVC D;  3AYW D;  5GSU A;  3W97 A;  5AV6 C;  1P34 C;  5AVC C;  5B31 G;  3MGS D;  3AYW C;  3WAA D;  1ID3 D;  3B6G D;  4QLC C;  3WAA C;  3X1U C;  2ARO C;  5CPJ B;  1M18 A;  3NQJ A;  2ZM5 A;  1ID3 C;  3B6G C;  1BH8 A;  1N1J B;  3AZG A;  3C1B A;  3X1V C;  3X1T B;  2F8N H;  3AL0 C;  3LZ0 B;  5B32 D;  5AV6 B;  5F99 D;  3WTP A;  1P34 B;  1M1A A;  5B0Z A;  5AVC B;  3B0C T;  4G91 C;  3REH C;  5B0Y A;  3AYW B;  2HIO A;  2Y2L A;  5BS7 A;  1B67 A;  1P3M D;  1KX3 A;  3W99 A;  2Y2G A;  1H3O B;  2BYK B;  4J8X D;  3LZ1 D;  3MGS B;  2FFF B;  3AZE D;  5FUG B;  1P3M C;  1KX4 A;  2Y2H A;  3WAA B;  1Q9C A;  1ID3 B;  3B6G B;  3LZ1 C;  3C1C D;  3MGP A;  3AZE C;  3VH5 A;  3C1C C;  4UUZ B;  5CP6 D;  5AV8 D;  5GT0 D;  1TAF B;  5JRG D;  4G91 B;  2CV5 A;  1JFI A;  5CPI D;  5C3I C;  5CP6 C;  5AV8 C;  3AV1 A;  5GT0 C;  5B32 B;  5DNM A;  5F99 B;  5GXQ C;  5KDM B;  1P3M B;  1P3B A;  3B0D C;  5AV5 A;  2YFW A;  4J8X B;  2RIQ A;  3LZ1 B;  3AZE B;  4WNN A;  1A7W A;  1U35 A;  5DNN D;  4NE5 A;  2ZY2 A;  3X1S D;  3C1C B;  3AZK A;  3AZI D;  3AZF D;  3WA9 D;  4J8U C;  4WU8 D;  3REJ A;  3LJA A;  3X1S C;  5C3I B;  2IO5 C;  5AV8 B;  5CP6 B;  3AZF C;  3WA9 C;  5GT0 B;  1S32 D;  5JRG B;  4WU8 C;  5GT3 A;  3A6N A;  5CPI B;  2G5H C;  3B0D B;  4J8V A;  4AWL C;  2F8N D;  5BO0 A;  3W98 D;  5AVB D;  1P3K D;  3W98 C;  5DNN B;  3X1S B;  5AVB C;  1P3G C;  2IO5 B;  1P3K C;  3AZI B;  3AZF B;  5B2J A;  3WA9 B;  3H0M C;  4YM6 C;  4WU8 B;  3AFA D;  3MGR A;  1S32 B;  3R45 A;  4E45 A;  3AZM A;  3KXB D;  3AFA C;  4AWL B;  5B40 D;  4R8P A;  4KUD D;  3MNN C;  3TU4 C;  5E5A D;  5B40 C;  4XZQ A;  3MGQ A;  1P3I A;  2F8N B;  1WWI A;  3W98 B;  4KUD C;  5B2I A;  4YS3 D;  5AVB B;  5E5A C;  3AZJ C;  1P3G B;  1P3K B;  4Z66 C;  2NQB D;  4J8W A;  2L5A A;  5G49 A;  4YS3 C;  3UTB A;  2BYM B;  5B1L C;  1P3F A;  3AZL C;  3AFA B;  5BNV B;  5B31 A;  5AV9 A;  1F66 D;  4WV4 B;  5B40 B;  3B0B A;  4WU9 D;  4KUD B;  5B24 D;  5AY8 D;  1PZR A;  1B6W A;  5E5A B;  1F66 C;  3O62 D;  4ZUX D;  4WU9 C;  4M6B A;  4YS3 B;  2UWX A;  3UT9 D;  5B1M D;  3O62 C;  2NQB B;  4H9S C;  3IP4 C;  1EQZ D;  3UT9 C;  5B1M C;  4WJ3 C;  2YFV A;  5CPJ A;  3X1T C;  3WTP E;  1ULY A;  3LZ0 C;  4Z5T D;  3AN2 A;  2CWE A;  3KWQ D;  4CAY A;  3REK D;  1ZLA A;  3B6F A;  1N1J A;  4KGC D;  4Z5T C;  1F66 B;  3NQU A;  3KWQ C;  4WU9 B;  5AV6 A;  3MGS C;  5B24 B;  2FJ7 A;  3W97 D;  5AY8 B;  4KGC C;  3O62 B;  4ZUX B;  3AYW A;  1H3O A;  3W97 C;  4QLC A;  3UT9 B;  5B1M B;  5BNX A;  3AZN A;  3X1U A;  2ARO A;  4XUJ D;  1M18 D;  1EQZ B;  1KX5 A;  4E44 A;  3EPJ A;  2ZY4 A;  4XUJ C;  4Z2M G;  2Y2Q A;  4Z5T B;  5B33 A;  5B32 C;  5F99 C;  3AZG D;  3KWQ B;  3X1V A;  3REK B;  4H9P A;  4KGC B;  3WTP D;  1M1A D;  3REH A;  5B0Z D;  4J8X C;  3W96 D;  2DF4 C;  2HIO D;  3W99 D;  3LEL D;  3W97 B;  4H9O A;  3W96 C;  1P3M A;  2HIO C;  3W99 C;  5BS7 C;  1KX4 D;  2NZD A;  3LEL C;  2RVQ D;  4EO5 B;  3MGP D;  3H0L C;  1KX4 C;  4XUJ B;  3KUY D;  1BH9 B;  1M18 B;  3NQJ B;  3VH5 W;  3C1C A;  2Y2K A;  2PYO A;  5JRG C;  3UTA A;  2JSS A;  1BH8 B;  2RVQ C;  5CPI C;  3KUY C;  3AZG B;  1T3U A;  5CP6 A;  1TZY D;  5AV8 A;  2XD5 A;  3REL A;  2CV5 D;  3REI D;  5GXQ A;  3AV1 D;  5DNM D;  3WTP B;  4KHA B;  1M1A B;  5B0Z B;  3WKJ D;  3W96 B;  2CV5 C;  1TZY C;  5B32 G;  2HIO B;  4H9R A;  1P3B D;  3W99 B;  4LD9 A;  3LEL B;  3REI C;  5AV5 D;  3AV1 C;  1P3A A;  5DNN C;  3WKJ C;  4H9Q A;  1P3B C;  4DQY B;  3AZI C;  1KX4 B;  1U35 D;  3MGP B;  3AZK D;  3KUY B;  4J8U A;  1S32 C;  3X1S A;  1U35 C;  1WWS A;  3LJA D;  3REJ D;  3AZF A;  3WA9 A;  4WU8 A;  1R4V A;  2CV5 B;  5GT3 D;  1TZY B;  3A6N D;  1JFI B;  3REI B;  3AV1 B;  5DNM B;  5JA4 A;  4J8V D;  1F1E A;  3WKJ B;  1P3B B;  4DRB A;  2YFW B;  2J8P A;  3H0R C;  3MVD D;  4H9N B;  4Z2M H;  1U35 B;  5AVB A;  1P3K A;  1P3G A;  3MVD C;  2XD1 A;  4YM6 A;  1P3P D;  4ZBJ C;  5B2J D;  4JJN A;  3REJ B;  2BYM A;  3KXB C;  1M19 A;  1P3P C;  3V9R B;  3AFA A;  5GT3 B;  3A6N B;  4WZS B;  1P3L D;  3MNN A;  2ZY3 A;  3TU4 A;  3AZH D;  2VQR A;  1BFM A;  5B40 A;  4J8V B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...