1P3BA

Crystallographic studies of nucleosome core particles containing histone 'sin' mutants
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
99
structure length
99
Chain Sequence
KPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Palindromic 146bp Human Alpha-Satellite DNA fragment
publication title Crystal structures of histone Sin mutant nucleosomes reveal altered protein-DNA interactions
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 33
structure length 99
sequence length 99
chains with identical sequence E
ec nomenclature
pdb deposition date 2003-04-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1p3bA00
5GT3C 5AY8B 1P3FC 1ULYA 3LZ0B 1S32A 3MGSB 3REJB 3AZFC 1P3MB 3B0DB 5G49B 4Z5TC 3X1VA 3AZMA 1M1AA 3UTBB 5CPIA 3O62D 3LZ0C 3WTPA 1U35B 4WU9B 3WAAA 1BH8B 3W96B 1P3IC 4Z66D 3WTPE 4R8PA 3WA9A 5BT1C 3AZIC 4EO5B 1JFIB 1HQ3D 1ZLAB 1AOID 2PYOB 4QLCD 4ZUXD 3W96C 2HIOC 3UTAA 2FJ7A 2NZDB 5GT3D 4EO5C 1P3FD 3AZNB 3AZFD 1ZLAC 2PYOC 3KWQA 2YFVA 4NE5A 4CAYA 1TZYB 4WU8A 4G91C 2NZDC 4Z5TD 3B6FB 5FUGA 3KSYA 5B1MB 4H9PA 5KDMB 4LD9C 5CHLB 3REKC 3LZ0D 3AZNC 1WWSA 4J8UC 4KHAA 3VH5T 1P3ID 4H9OA 1P3LC 3B6FC 5AV8A 5BT1D 3AZID 4J8VC 5CPKB 1BH9B 3A6NA 1F66A 2HIOD 3MGQB 3W96D 5BS7A 4H9SA 5AVCB 3AZEA 3AZKA 4H9NB 3AZHA 1P34A 2BYMB 5E5AB 4JJNB 2CV5A 1ZLAD 2PYOD 3V9RA 3MGQC 2F8NH 2NZDD 3LJAA 1KX3B 3B6GB 3KXBA 4LD9D 1P3KA 1P3OA 3REKD 3AZJB 1P3AA 3AZND 4E44A 3AZLA 4J8UD 4KUDC 5CP6A 3REHC 1N1JB 3NQJA 5B2IC 5B0ZC 3X1UB 5B33A 3MVDA 1ID3B 4KGCC 1P3LD 5GXQC 3W99A 3B6FD 5BNVA 3VH6W 4J8VD 3RELB 3AV1A 3AFAC 1KX5A 3KUYB 3W98A 5GT0A 1M18A 3UT9B 3X1UC 4H9QA 5C3IC 5B31C 5AVBA 1ID3C 5B24C 1EQZA 3R45B 4X23C 3C1BA 1Q9CA 1P3PB 1B6WA 3LZ1A 3MGQD 4YM6A 3O62B 5DNMA 1P3PC 3VH6A 4KUDD 3B0CT 2NQBB 3REHD 2F8ND 5JRGC 5B2ID 5B0ZD 4KGCD 4YS3C 4Z66A 3W97C 5GXQD 1P3GC 5B0YC 1HQ3B 1AOIB 5BNXA 2AROA 5AV9C 2YFWA 1TAFB 3AFAD 2NQBC 1BFMA 5BO0A 4QLCA 4ZUXA 3X1UD 5B31D 1ID3D 5B24D 2LY8A 4X23D 3AZFB 4XUJC 1P3BC 5GT3A 5JA4A 1P3FA 3REIB 5B40B 5B2JB 5AV5C 4Z5TA 1P3PD 5DNNA 3WKJB 5AY8A 1P3IB 2L5AA 3LZ0A 3REIC 3MGSA 3REJA 1P3MA 5B40C 5B2JC 3B0BA 3AZIB 5JRGD 4YS3D 3W97D 3AZGC 5G49A 5B0YD 1P3GD 3MGPB 5AV9D 3UTBA 3WKJC 2HIOB 1U35A 2NQBD 4WU9A 1BH8A 3W96A 5B1LC 3MGPC 5CPJC 4XUJD 1P3BD 3MGRB 1JFIA 1S32C 4G91B 2PYOA 4LD9B 3REKB 3X1SB 2NZDA 5AV5D 4J8UB 4NE6A 4J8XB 3AZMC 1HTAA 3MGRC 1P3LB 3REID 3AZNA 3WTPC 5B40D 5B2JD 2BYKB 3WAAC 4J8VB 1TZYA 3X1SC 4R8PC 3AZGD 3B6FA 3C1CB 4J8XC 5B1MA 5KDMA 3WKJD 5F99B 5B1LD 3UTAC 3TU4B 3C1CC 3MGPD 3VH5W 5CPJD 4DRAA 5F99C 4G92B 5CPKA 1S32D 1BH9A 3KWQC 3MGQA 1H3OB 3TU4C 5AVCA 4WU8C 4KUDB 3AN2B 3REHB 4H9RB 3LELB 3AZMD 4H9NA 2F8NB 5B2IB 2BYMA 5B0ZB 3MNNB 4G92C 4KGCB 3MGRD 5GXQB 5E5AA 4JJNA 4Z2MH 3WTPD 3WAAD 5B32B 3X1SD 5GSUB 4R8PD 1KX3A 3AFAB 3B6GA 3AN2C 5AV8C 4J8XD 4XZQB 3LELC 3VH5A 5C3IB 5B31B 3MNNC 4J8WA 3AZJA 5B24B 4X23B 1N1JA 3X1UA 5B32C 3A6NC 1ID3A 1F66C 5GSUC 5BS7C 4UUZB 3UTAD 4H9SC 3C1CD 4WV4B 4XZQC 3AZEC 4WNNB 5F99D 3AZHC 3RELA 3KUYA 2CV5C 2IO5C 3KWQD 3UT9A 3TU4D 3X1TB 3R45A 4WU8D 1P3PA 5JRGB 4YS3B 1P3KC 3W97B 1P3AC 3AZLC 5B0YB 1P3GB 5CP6C 5AV9B 3MVDC 5B33C 3O62A 3X1TC 3W99C 2F8NG 3AN2D 3NQUB 5AV8D 3LELD 3MNND 4NFTA 4HGAC 3AV1C 2HUEB 4NE3A 1KX4B 1KX5C 2NQBA 1M18C 4XUJB 1P3BB 5B32D 3A6ND 1F66D 5GSUD 3B0CW 1HQ3A 3AYWB 1AOIA 5B31G 4XZQD 1EQZC 3AZED 3AZHD 2HUEC 1TAFA 4CSRB 1KX4C 5AV5B 2CV5D 3LZ1C 4YM6C 5DNMC 3AYWC 3AZFA 1WWIA 1P3KD 3REIA 3AZGB 3AZLD 1P3AD 5B40A 5B2JA 5CP6D 5AV6B 2RVQC 3MVDD 3AV2B 5B33D 1M19B 3X1TD 3W99D 3WKJA 2AROC 5B1LB 1P3IA 3AV1D 1KX5D 5CPJB 1M18D 5AV6C 3AZIA 3AV2C 1M19C 1S32B 3MGPA 1EQZD 2HIOA 1KX4D 3X1VB 3AZMB 3LZ1D 1M1AB 4YM6D 5CPIB 5DNMD 3AYWD 1ZLAA 3WTPB 5DNNC 5AY8C 3WAAB 3MGRA 4R8PB 3MGSC 3REJC 1P3MC 3X1VC 3WA9B 1M1AC 4LD9A 2RVQD 3REKA 3B0DC 3X1SA 5CPIC 4J8UA 4J8XA 3UTBC 2AROD 3UTAB 1P3LA 4DRBA 1U35C 4M6BA 2FJ7B 3WA9C 4WU9C 2BYKA 5AV6D 4J8VA 3AV2D 1M19D 3C1CA 3KWQB 5F99A 2YFVB 4CAYB 4WU8B 2FJ7C 5FUGB 4H9PB 3TU4A 4WZSB 4KHAB 5DNND 5AY8D 4H9OB 3MGSD 3REJD 1P3MD 3X1VD 5AV8B 1M1AD 1H3OA 5CPID 1TZYC 4KUDA 3AN2A 3REHA 4H9RA 3LELA 5B1MC 3UTBD 2F8NA 5B2IA 4KGCA 5B0ZA 3MNNA 3A6NB 1F66B 2F8NK 5GXQA 4AWLB 1U35D 3WA9D 4WU9D 3AZEB 3AZKB 5B32A 3AZHB 1P34B 5GSUA 2CWEA 4ZBJB 3AFAA 2CV5B 4XZQA 2IO5B 3V9RB 5B31A 5B24A 5CPKC 4AWLC 4X23A 2FJ7D 3LJAB 3KXBB 3AZKC 1P34C 4ZBJC 4UUZA 1P3KB 1P3OB 5AVCC 1P3AB 3AZLB 5CP6B 1KU5A 4WNNA 3NQJB 3VH6T 3MVDB 5B33B 4J8WB 3W99B 5E5AC 4JJNC 3LJAC 1R4VA 3KXBC 5BNVB 1P3OC 3X1TA 1TZYD 4HGAB 3AV1B 1A7WA 1KX3C 1KX5B 3B6GC 3W98B 5GT0B 1M18B 5B1MD 5JRGA 4H9QB 5AVBB 4J8WC 4YS3A 3W97A 3AZJC 1P3GA 5B0YA 1EQZB 3C1BB 4Z2MG 5AV9A 3W98C 3NQUA 5B32G 5GT0C 1B67A 3LZ1B 5AVBC 2JSSA 3RELC 4YM6B 5CPKD 1KX4A 5DNMB 3KUYC 3C1BC 4XUJA 1P3BA 3UT9C 3AZKD 1P34D 5AVCD 3AYWA 4Z66B 4CSRA 5AV5A 5E5AD 4JJND 3LJAD 3KXBD 5BNXB 2AROB 1P3OD 3O62C 4E45A 1F1EA 2YFWB 1KX3D 3B6GD 5BO0B 4ZUXB 4QLCB 4J8WD 4Z66C 3AZJD 3AZGA 5AV6A 5GT3B 5JA4B 3AV2A 1P3FB 1M19A 3W98D 1HQ3C 5GT0D 1AOIC 4QLCC 4ZUXC 5B1LA 5AVBD 3RELD 3KUYD 4Z5TB 3C1BD 5CPJA 5DNNB 3UT9D
chains in the Genus database with same CATH superfamily
5GT3C 5AY8B 1P3FC 1ULYA 3LZ0B 1S32A 3MGSB 3REJB 3AZFC 1P3MB 3B0DB 5G49B 4Z5TC 3X1VA 3AZMA 1M1AA 3UTBB 5CPIA 3O62D 3LZ0C 3WTPA 1U35B 4WU9B 3WAAA 1BH8B 3W96B 1P3IC 4Z66D 3WTPE 4R8PA 3WA9A 5BT1C 3AZIC 4EO5B 1JFIB 1HQ3D 1ZLAB 1AOID 2PYOB 4QLCD 4ZUXD 3W96C 2HIOC 3EG5B 3UTAA 2FJ7A 2NZDB 5GT3D 4EO5C 1P3FD 3AZNB 3AZFD 1ZLAC 2PYOC 3KWQA 2YFVA 4NE5A 4CAYA 1TZYB 2F2AC 4WU8A 4G91C 2NZDC 4Z5TD 3B6FB 5FUGA 3KSYA 5B1MB 4H9PA 5KDMB 4LD9C 5CHLB 3REKC 2Y2OA 3LZ0D 3AZNC 1WWSA 4J8UC 4KHAA 3VH5T 1P3ID 4H9OA 1P3LC 3AL0C 3B6FC 3H0MC 5AV8A 5BT1D 3AZID 4J8VC 5CPKB 1BH9B 3A6NA 1F66A 2HIOD 3MGQB 3W96D 5BS7A 4H9SA 5AVCB 2Y2GA 3AZEA 3AZKA 4H9NB 3AZHA 1P34A 2BYMB 5E5AB 4JJNB 2CV5A 1ZLAD 2PYOD 3EPKA 3V9RA 3MGQC 2F8NH 2NZDD 3LJAA 1KX3B 3B6GB 3KXBA 4LD9D 2XD1A 1P3KA 3REKD 1P3OA 3AZJB 1P3AA 3AZND 4E44A 3AZLA 4J8UD 4KUDC 5CP6A 3REHC 1N1JB 3NQJA 5B2IC 5B0ZC 3X1UB 5B33A 3MVDA 1ID3B 4KGCC 1P3LD 5GXQC 3W99A 3B6FD 2DF4C 5BNVA 3VH6W 4J8VD 3RELB 2ZY2A 3AV1A 3AFAC 1KX5A 3KUYB 3W98A 5GT0A 1M18A 3UT9B 3X1UC 4H9QA 5C3IC 5B31C 5AVBA 1ID3C 5B24C 1EQZA 3R45B 4X23C 3C1BA 1Q9CA 1P3PB 1B6WA 3LZ1A 3MGQD 4YM6A 3O62B 5DNMA 1P3PC 3VH6A 4KUDD 3B0CT 2NQBB 3REHD 2F8ND 5JRGC 5B2ID 5B0ZD 2ZY4A 4YS3C 4KGCD 4Z66A 3W97C 5GXQD 1P3GC 5B0YC 1HQ3B 1AOIB 5BNXA 2AROA 5AV9C 2YFWA 1TAFB 3AFAD 2NQBC 1BFMA 5BO0A 4QLCA 4ZUXA 3X1UD 5B31D 1ID3D 4WJ3C 5B24D 2LY8A 4X23D 3AZFB 4XUJC 1P3BC 5GT3A 5JA4A 1P3FA 3REIB 3P5JB 5B40B 5B2JB 2DQNC 5AV5C 4Z5TA 1P3PD 5DNNA 3WKJB 5AY8A 1P3IB 2L5AA 3LZ0A 3REIC 3MGSA 3REJA 1P3MA 5B40C 5B2JC 3B0BA 3AZIB 5JRGD 4YS3D 3W97D 3AZGC 5G49A 5B0YD 1P3GD 3MGPB 5AV9D 3UTBA 3WKJC 2HIOB 1U35A 2NQBD 4WU9A 1BH8A 3W96A 5B1LC 3EPHA 3H0RC 3MGPC 5CPJC 4XUJD 1P3BD 3MGRB 1JFIA 1S32C 2Y2PA 4G91B 2PYOA 4LD9B 3REKB 3X1SB 2NZDA 5AV5D 4J8UB 4NE6A 4J8XB 3AZMC 1HTAA 3MGRC 1P3LB 3REID 3AZNA 3WTPC 5B40D 5B2JD 2BYKB 3WAAC 4J8VB 1TZYA 2Y2JA 3X1SC 4R8PC 3AZGD 3B6FA 3C1CB 4J8XC 5B1MA 5KDMA 3WKJD 5F99B 5B1LD 3UTAC 3TU4B 3C1CC 3MGPD 3VH5W 5CPJD 4DRAA 5F99C 4G92B 5CPKA 1S32D 1BH9A 3KWQC 3MGQA 1H3OB 3TU4C 5AVCA 4WU8C 4KUDB 3AN2B 3REHB 4H9RB 3LELB 3AZMD 4H9NA 2F8NB 5B2IB 2BYMA 5B0ZB 3MNNB 4G92C 4KGCB 3MGRD 2ZY5A 5GXQB 5E5AA 4JJNA 4Z2MH 3WTPD 3WAAD 5B32B 2W8SA 3A1IA 5GSUB 3X1SD 4R8PD 1KX3A 3AFAB 3B6GA 3AN2C 5AV8C 4J8XD 4XZQB 3LELC 3VH5A 2G5HC 5C3IB 5B31B 3MNNC 4J8WA 3AZJA 5B24B 4X23B 1N1JA 3X1UA 5B32C 3A6NC 1ID3A 1F66C 5GSUC 5BS7C 4UUZB 3UTAD 4H9SC 3C1CD 2J8PA 4WV4B 4XZQC 3AZEC 4WNNB 5F99D 3AZHC 3RELA 4UPKA 2UWXA 3KUYA 2CV5C 2IO5C 3KWQD 3UT9A 3A1KA 3TU4D 3X1TB 3R45A 4WU8D 1P3PA 5JRGB 4YS3B 1P3KC 3W97B 1P3AC 3AZLC 5B0YB 1P3GB 5CP6C 5AV9B 3MVDC 5B33C 3O62A 3X1TC 3W99C 2XD5A 2F8NG 3AN2D 3NQUB 5AV8D 3LELD 3MNND 4NFTA 4HGAC 3AV1C 2HUEB 2JE5A 4NE3A 1KX4B 1KX5C 2NQBA 1M18C 4XUJB 1P3BB 5B32D 3A6ND 1F66D 5GSUD 3B0CW 2Y2MA 1HQ3A 3AYWB 1AOIA 5B31G 4XZQD 1EQZC 3AZED 3AZHD 2HUEC 1TAFA 4CSRB 1KX4C 5AV5B 2Y2LA 2CV5D 3LZ1C 4YM6C 5DNMC 3AYWC 3AZFA 2JCHA 1WWIA 1P3KD 3REIA 3AZGB 3AZLD 1P3AD 5B40A 5B2JA 5CP6D 5AV6B 2RVQC 3MVDD 3AV2B 5B33D 1M19B 3X1TD 1PZRA 3W99D 3WKJA 2AROC 5B1LB 1P3IA 3AV1D 1KX5D 5CPJB 1M18D 5AV6C 3AZIA 3AV2C 3H0LC 3EPLA 1M19C 1S32B 3MGPA 1EQZD 2HIOA 1KX4D 3X1VB 3AZMB 3LZ1D 1M1AB 4YM6D 5CPIB 5DNMD 3AYWD 1ZLAA 3WTPB 2G5IC 2Y2KA 5DNNC 5AY8C 3WAAB 3MGRA 4R8PB 3MGSC 3REJC 1P3MC 3X1VC 3WA9B 1M1AC 4LD9A 2RVQD 3REKA 3B0DC 3X1SA 5CPIC 4J8UA 2Y2NA 4J8XA 3UTBC 2AROD 3UTAB 1P3LA 4DRBA 1U35C 4M6BA 2FJ7B 3WA9C 4WU9C 2BYKA 5AV6D 2ZY3A 4J8VA 3AV2D 1M19D 3C1CA 3KWQB 5F99A 2YFVB 4CAYB 4WU8B 2FJ7C 5FUGB 4H9PB 2ZM5A 3TU4A 4WZSB 4KHAB 5DNND 3FDDA 5AY8D 4H9OB 3MGSD 3REJD 1P3MD 3X1VD 5AV8B 1M1AD 1H3OA 5CPID 1TZYC 4KUDA 3AN2A 3REHA 4H9RA 3LELA 5B1MC 3UTBD 2F8NA 2RIQA 5B2IA 5B0ZA 3MNNA 3A6NB 1F66B 2F8NK 4KGCA 5GXQA 4AWLB 1U35D 3WA9D 4WU9D 3AZEB 3AZKB 5B32A 3AZHB 1P34B 5GSUA 2CWEA 4ZBJB 3AFAA 2CV5B 4XZQA 2IO5B 3V9RB 5B31A 5B24A 5CPKC 4AWLC 4X23A 2FJ7D 1Z2CB 3LJAB 3KXBB 3AZKC 1T3UA 2FFFB 1P34C 4ZBJC 4UUZA 1P3KB 1P3OB 5AVCC 1P3AB 3AZLB 3IP4C 5CP6B 1KU5A 1W2EA 4WNNA 3NQJB 3VH6T 3MVDB 5B33B 4J8WB 3W99B 5E5AC 4JJNC 3LJAC 1R4VA 3KXBC 5BNVB 1P3OC 3X1TA 1TZYD 4HGAB 3AV1B 1A7WA 1KX3C 1KX5B 3B6GC 3W98B 2VQRA 5GT0B 4DQYB 3F6TA 5B1MD 2Y2HA 1M18B 5JRGA 4H9QB 5AVBB 4J8WC 4YS3A 3W97A 3AZJC 1P3GA 5B0YA 1EQZB 3C1BB 4Z2MG 5AV9A 3KFUG 3W98C 3NQUA 5B32G 5GT0C 3EPJA 1B67A 3LZ1B 5AVBC 2JSSA 3RELC 4YM6B 5CPKD 1KX4A 5DNMB 3KUYC 3C1BC 2Y2QA 4XUJA 1P3BA 3UT9C 3AZKD 1P34D 5AVCD 3AYWA 4Z66B 4CSRA 5AV5A 5E5AD 4JJND 3LJAD 3KXBD 5BNXB 2AROB 1P3OD 3O62C 4E45A 1F1EA 2YFWB 1KX3D 3B6GD 5BO0B 4ZUXB 4QLCB 4J8WD 4Z66C 3AZJD 3AZGA 5AV6A 2BG1A 2Y2IA 5GT3B 5JA4B 3AV2A 1P3FB 1M19A 3W98D 1HQ3C 5GT0D 1AOIC 4QLCC 4ZUXC 5B1LA 5AVBD 3RELD 3KUYD 4Z5TB 3C1BD 5CPJA 5DNNB 3UT9D
chains in the Genus database with same CATH topology
5GT3C 5AY8B 1P3FC 1ULYA 3LZ0B 1S32A 3MGSB 3REJB 3AZFC 1P3MB 3B0DB 5G49B 4Z5TC 3X1VA 3AZMA 1M1AA 3UTBB 5CPIA 3O62D 3LZ0C 3WTPA 1U35B 4WU9B 3WAAA 1BH8B 3W96B 1P3IC 4Z66D 3WTPE 4R8PA 3WA9A 5BT1C 3AZIC 4EO5B 1JFIB 1HQ3D 1ZLAB 1AOID 2PYOB 4QLCD 4ZUXD 3W96C 2HIOC 3EG5B 3UTAA 2FJ7A 2NZDB 5GT3D 4EO5C 1P3FD 3AZNB 3AZFD 1ZLAC 2PYOC 3KWQA 2YFVA 4NE5A 4CAYA 1TZYB 2F2AC 4WU8A 4G91C 2NZDC 4Z5TD 3B6FB 5FUGA 3KSYA 5B1MB 4H9PA 5KDMB 4LD9C 5CHLB 3REKC 2Y2OA 3LZ0D 3AZNC 1WWSA 4J8UC 4KHAA 3VH5T 1P3ID 4H9OA 1P3LC 3AL0C 3B6FC 3H0MC 5AV8A 5BT1D 3AZID 4J8VC 5CPKB 1BH9B 3A6NA 1F66A 2HIOD 3MGQB 3W96D 5BS7A 4H9SA 5AVCB 2Y2GA 3AZEA 3AZKA 4H9NB 3AZHA 1P34A 2BYMB 5E5AB 4JJNB 2CV5A 1ZLAD 2PYOD 3EPKA 3V9RA 3MGQC 2F8NH 2NZDD 3LJAA 1KX3B 3B6GB 3KXBA 4LD9D 2XD1A 1P3KA 3REKD 1P3OA 3AZJB 1P3AA 3AZND 4E44A 3AZLA 4J8UD 4KUDC 5CP6A 3REHC 1N1JB 3NQJA 5B2IC 5B0ZC 3X1UB 5B33A 3MVDA 1ID3B 4KGCC 1P3LD 5GXQC 3W99A 3B6FD 2DF4C 5BNVA 3VH6W 4J8VD 3RELB 2ZY2A 3AV1A 3AFAC 1KX5A 3KUYB 3W98A 5GT0A 1M18A 3UT9B 3X1UC 4H9QA 5C3IC 5B31C 5AVBA 1ID3C 5B24C 1EQZA 3R45B 4X23C 3C1BA 1Q9CA 1P3PB 1B6WA 3LZ1A 3MGQD 4YM6A 3O62B 5DNMA 1P3PC 3VH6A 4KUDD 3B0CT 2NQBB 3REHD 2F8ND 5JRGC 5B2ID 5B0ZD 2ZY4A 4YS3C 4KGCD 4Z66A 3W97C 5GXQD 1P3GC 5B0YC 1HQ3B 1AOIB 5BNXA 2AROA 5AV9C 2YFWA 1TAFB 3AFAD 2NQBC 1BFMA 5BO0A 4QLCA 4ZUXA 3X1UD 5B31D 1ID3D 4WJ3C 5B24D 2LY8A 4X23D 3AZFB 4XUJC 1P3BC 5GT3A 5JA4A 1P3FA 3REIB 3P5JB 5B40B 5B2JB 2DQNC 5AV5C 4Z5TA 1P3PD 5DNNA 3WKJB 5AY8A 1P3IB 2L5AA 3LZ0A 3REIC 3MGSA 3REJA 1P3MA 5B40C 5B2JC 3B0BA 3AZIB 5JRGD 4YS3D 3W97D 3AZGC 5G49A 5B0YD 1P3GD 3MGPB 5AV9D 3UTBA 3WKJC 2HIOB 1U35A 2NQBD 4WU9A 1BH8A 3W96A 5B1LC 3EPHA 3H0RC 3MGPC 5CPJC 4XUJD 1P3BD 3MGRB 1JFIA 1S32C 2Y2PA 4G91B 2PYOA 4LD9B 3REKB 3X1SB 2NZDA 5AV5D 4J8UB 4NE6A 4J8XB 3AZMC 1HTAA 3MGRC 1P3LB 3REID 3AZNA 3WTPC 5B40D 5B2JD 2BYKB 3WAAC 4J8VB 1TZYA 2Y2JA 3X1SC 4R8PC 3AZGD 3B6FA 3C1CB 4J8XC 5B1MA 5KDMA 3WKJD 5F99B 5B1LD 3UTAC 3TU4B 3C1CC 3MGPD 3VH5W 5CPJD 4DRAA 5F99C 4G92B 5CPKA 1S32D 1BH9A 3KWQC 3MGQA 1H3OB 3TU4C 5AVCA 4WU8C 4KUDB 3AN2B 3REHB 4H9RB 3LELB 3AZMD 4H9NA 2F8NB 5B2IB 2BYMA 5B0ZB 3MNNB 4G92C 4KGCB 3MGRD 2ZY5A 5GXQB 5E5AA 4JJNA 4Z2MH 3WTPD 3WAAD 5B32B 2W8SA 3A1IA 5GSUB 3X1SD 4R8PD 1KX3A 3AFAB 3B6GA 3AN2C 5AV8C 4J8XD 4XZQB 3LELC 3VH5A 2G5HC 5C3IB 5B31B 3MNNC 4J8WA 3AZJA 5B24B 4X23B 1N1JA 3X1UA 5B32C 3A6NC 1ID3A 1F66C 5GSUC 5BS7C 4UUZB 3UTAD 4H9SC 3C1CD 2J8PA 4WV4B 4XZQC 3AZEC 4WNNB 5F99D 3AZHC 3RELA 4UPKA 2UWXA 3KUYA 2CV5C 2IO5C 3KWQD 3UT9A 3A1KA 3TU4D 3X1TB 3R45A 4WU8D 1P3PA 5JRGB 4YS3B 1P3KC 3W97B 1P3AC 3AZLC 5B0YB 1P3GB 5CP6C 5AV9B 3MVDC 5B33C 3O62A 3X1TC 3W99C 2XD5A 2F8NG 3AN2D 3NQUB 5AV8D 3LELD 3MNND 4NFTA 4HGAC 3AV1C 2HUEB 2JE5A 4NE3A 1KX4B 1KX5C 2NQBA 1M18C 4XUJB 1P3BB 5B32D 3A6ND 1F66D 5GSUD 3B0CW 2Y2MA 1HQ3A 3AYWB 1AOIA 5B31G 4XZQD 1EQZC 3AZED 3AZHD 2HUEC 1TAFA 4CSRB 1KX4C 5AV5B 2Y2LA 2CV5D 3LZ1C 4YM6C 5DNMC 3AYWC 3AZFA 2JCHA 1WWIA 1P3KD 3REIA 3AZGB 3AZLD 1P3AD 5B40A 5B2JA 5CP6D 5AV6B 2RVQC 3MVDD 3AV2B 5B33D 1M19B 3X1TD 1PZRA 3W99D 3WKJA 2AROC 5B1LB 1P3IA 3AV1D 1KX5D 5CPJB 1M18D 5AV6C 3AZIA 3AV2C 3H0LC 3EPLA 1M19C 1S32B 3MGPA 1EQZD 2HIOA 1KX4D 3X1VB 3AZMB 3LZ1D 1M1AB 4YM6D 5CPIB 5DNMD 3AYWD 1ZLAA 3WTPB 2G5IC 2Y2KA 5DNNC 5AY8C 3WAAB 3MGRA 4R8PB 3MGSC 3REJC 1P3MC 3X1VC 3WA9B 1M1AC 4LD9A 2RVQD 3REKA 3B0DC 3X1SA 5CPIC 4J8UA 2Y2NA 4J8XA 3UTBC 2AROD 3UTAB 1P3LA 4DRBA 1U35C 4M6BA 2FJ7B 3WA9C 4WU9C 2BYKA 5AV6D 2ZY3A 4J8VA 3AV2D 1M19D 3C1CA 3KWQB 5F99A 2YFVB 4CAYB 4WU8B 2FJ7C 5FUGB 4H9PB 2ZM5A 3TU4A 4WZSB 4KHAB 5DNND 3FDDA 5AY8D 4H9OB 3MGSD 3REJD 1P3MD 3X1VD 5AV8B 1M1AD 1H3OA 5CPID 1TZYC 4KUDA 3AN2A 3REHA 4H9RA 3LELA 5B1MC 3UTBD 2F8NA 2RIQA 5B2IA 5B0ZA 3MNNA 3A6NB 1F66B 2F8NK 4KGCA 5GXQA 4AWLB 1U35D 3WA9D 4WU9D 3AZEB 3AZKB 5B32A 3AZHB 1P34B 5GSUA 2CWEA 4ZBJB 3AFAA 2CV5B 4XZQA 2IO5B 3V9RB 5B31A 5B24A 5CPKC 4AWLC 4X23A 2FJ7D 1Z2CB 3LJAB 3KXBB 3AZKC 1T3UA 2FFFB 1P34C 4ZBJC 4UUZA 1P3KB 1P3OB 5AVCC 1P3AB 3AZLB 3IP4C 5CP6B 1KU5A 1W2EA 4WNNA 3NQJB 3VH6T 3MVDB 5B33B 4J8WB 3W99B 5E5AC 4JJNC 3LJAC 1R4VA 3KXBC 5BNVB 1P3OC 3X1TA 1TZYD 4HGAB 3AV1B 1A7WA 1KX3C 1KX5B 3B6GC 3W98B 2VQRA 5GT0B 4DQYB 3F6TA 5B1MD 2Y2HA 1M18B 5JRGA 4H9QB 5AVBB 4J8WC 4YS3A 3W97A 3AZJC 1P3GA 5B0YA 1EQZB 3C1BB 4Z2MG 5AV9A 3KFUG 3W98C 3NQUA 5B32G 5GT0C 3EPJA 1B67A 3LZ1B 5AVBC 2JSSA 3RELC 4YM6B 5CPKD 1KX4A 5DNMB 3KUYC 3C1BC 2Y2QA 4XUJA 1P3BA 3UT9C 3AZKD 1P34D 5AVCD 3AYWA 4Z66B 4CSRA 5AV5A 5E5AD 4JJND 3LJAD 3KXBD 5BNXB 2AROB 1P3OD 3O62C 4E45A 1F1EA 2YFWB 1KX3D 3B6GD 5BO0B 4ZUXB 4QLCB 4J8WD 4Z66C 3AZJD 3AZGA 5AV6A 2BG1A 2Y2IA 5GT3B 5JA4B 3AV2A 1P3FB 1M19A 3W98D 1HQ3C 5GT0D 1AOIC 4QLCC 4ZUXC 5B1LA 5AVBD 3RELD 3KUYD 4Z5TB 3C1BD 5CPJA 5DNNB 3UT9D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GT3 C;  5AY8 B;  1P3F C;  1ULY A;  3LZ0 B;  1S32 A;  3MGS B;  3REJ B;  3AZF C;  1P3M B;  3B0D B;  5G49 B;  4Z5T C;  3X1V A;  3AZM A;  1M1A A;  3UTB B;  5CPI A;  3O62 D;  3LZ0 C;  3WTP A;  1U35 B;  4WU9 B;  3WAA A;  1BH8 B;  3W96 B;  1P3I C;  4Z66 D;  3WTP E;  4R8P A;  3WA9 A;  5BT1 C;  3AZI C;  4EO5 B;  1JFI B;  1HQ3 D;  1ZLA B;  1AOI D;  2PYO B;  4QLC D;  4ZUX D;  3W96 C;  2HIO C;  3UTA A;  2FJ7 A;  2NZD B;  5GT3 D;  4EO5 C;  1P3F D;  3AZN B;  3AZF D;  1ZLA C;  2PYO C;  3KWQ A;  2YFV A;  4NE5 A;  4CAY A;  1TZY B;  4WU8 A;  4G91 C;  2NZD C;  4Z5T D;  3B6F B;  5FUG A;  3KSY A;  5B1M B;  4H9P A;  5KDM B;  4LD9 C;  5CHL B;  3REK C;  3LZ0 D;  3AZN C;  1WWS A;  4J8U C;  4KHA A;  3VH5 T;  1P3I D;  4H9O A;  1P3L C;  3B6F C;  5AV8 A;  5BT1 D;  3AZI D;  4J8V C;  5CPK B;  1BH9 B;  3A6N A;  1F66 A;  2HIO D;  3MGQ B;  3W96 D;  5BS7 A;  4H9S A;  5AVC B;  3AZE A;  3AZK A;  4H9N B;  3AZH A;  1P34 A;  2BYM B;  5E5A B;  4JJN B;  2CV5 A;  1ZLA D;  2PYO D;  3V9R A;  3MGQ C;  2F8N H;  2NZD D;  3LJA A;  1KX3 B;  3B6G B;  3KXB A;  4LD9 D;  1P3K A;  1P3O A;  3REK D;  3AZJ B;  1P3A A;  3AZN D;  4E44 A;  3AZL A;  4J8U D;  4KUD C;  5CP6 A;  3REH C;  1N1J B;  3NQJ A;  5B2I C;  5B0Z C;  3X1U B;  5B33 A;  3MVD A;  1ID3 B;  4KGC C;  1P3L D;  5GXQ C;  3W99 A;  3B6F D;  5BNV A;  3VH6 W;  4J8V D;  3REL B;  3AV1 A;  3AFA C;  1KX5 A;  3KUY B;  3W98 A;  5GT0 A;  1M18 A;  3UT9 B;  3X1U C;  4H9Q A;  5C3I C;  5B31 C;  5AVB A;  1ID3 C;  5B24 C;  1EQZ A;  3R45 B;  4X23 C;  3C1B A;  1Q9C A;  1P3P B;  1B6W A;  3LZ1 A;  3MGQ D;  4YM6 A;  3O62 B;  5DNM A;  1P3P C;  3VH6 A;  4KUD D;  3B0C T;  2NQB B;  3REH D;  2F8N D;  5JRG C;  5B2I D;  5B0Z D;  4KGC D;  4YS3 C;  4Z66 A;  3W97 C;  5GXQ D;  1P3G C;  5B0Y C;  1HQ3 B;  1AOI B;  5BNX A;  2ARO A;  5AV9 C;  2YFW A;  1TAF B;  3AFA D;  2NQB C;  1BFM A;  5BO0 A;  4QLC A;  4ZUX A;  3X1U D;  5B31 D;  1ID3 D;  5B24 D;  2LY8 A;  4X23 D;  3AZF B;  4XUJ C;  1P3B C;  5GT3 A;  5JA4 A;  1P3F A;  3REI B;  5B40 B;  5B2J B;  5AV5 C;  4Z5T A;  1P3P D;  5DNN A;  3WKJ B;  5AY8 A;  1P3I B;  2L5A A;  3LZ0 A;  3REI C;  3MGS A;  3REJ A;  1P3M A;  5B40 C;  5B2J C;  3B0B A;  3AZI B;  5JRG D;  4YS3 D;  3W97 D;  3AZG C;  5G49 A;  5B0Y D;  1P3G D;  3MGP B;  5AV9 D;  3UTB A;  3WKJ C;  2HIO B;  1U35 A;  2NQB D;  4WU9 A;  1BH8 A;  3W96 A;  5B1L C;  3MGP C;  5CPJ C;  4XUJ D;  1P3B D;  3MGR B;  1JFI A;  1S32 C;  4G91 B;  2PYO A;  4LD9 B;  3REK B;  3X1S B;  2NZD A;  5AV5 D;  4J8U B;  4NE6 A;  4J8X B;  3AZM C;  1HTA A;  3MGR C;  1P3L B;  3REI D;  3AZN A;  3WTP C;  5B40 D;  5B2J D;  2BYK B;  3WAA C;  4J8V B;  1TZY A;  3X1S C;  4R8P C;  3AZG D;  3B6F A;  3C1C B;  4J8X C;  5B1M A;  5KDM A;  3WKJ D;  5F99 B;  5B1L D;  3UTA C;  3TU4 B;  3C1C C;  3MGP D;  3VH5 W;  5CPJ D;  4DRA A;  5F99 C;  4G92 B;  5CPK A;  1S32 D;  1BH9 A;  3KWQ C;  3MGQ A;  1H3O B;  3TU4 C;  5AVC A;  4WU8 C;  4KUD B;  3AN2 B;  3REH B;  4H9R B;  3LEL B;  3AZM D;  4H9N A;  2F8N B;  5B2I B;  2BYM A;  5B0Z B;  3MNN B;  4G92 C;  4KGC B;  3MGR D;  5GXQ B;  5E5A A;  4JJN A;  4Z2M H;  3WTP D;  3WAA D;  5B32 B;  3X1S D;  5GSU B;  4R8P D;  1KX3 A;  3AFA B;  3B6G A;  3AN2 C;  5AV8 C;  4J8X D;  4XZQ B;  3LEL C;  3VH5 A;  5C3I B;  5B31 B;  3MNN C;  4J8W A;  3AZJ A;  5B24 B;  4X23 B;  1N1J A;  3X1U A;  5B32 C;  3A6N C;  1ID3 A;  1F66 C;  5GSU C;  5BS7 C;  4UUZ B;  3UTA D;  4H9S C;  3C1C D;  4WV4 B;  4XZQ C;  3AZE C;  4WNN B;  5F99 D;  3AZH C;  3REL A;  3KUY A;  2CV5 C;  2IO5 C;  3KWQ D;  3UT9 A;  3TU4 D;  3X1T B;  3R45 A;  4WU8 D;  1P3P A;  5JRG B;  4YS3 B;  1P3K C;  3W97 B;  1P3A C;  3AZL C;  5B0Y B;  1P3G B;  5CP6 C;  5AV9 B;  3MVD C;  5B33 C;  3O62 A;  3X1T C;  3W99 C;  2F8N G;  3AN2 D;  3NQU B;  5AV8 D;  3LEL D;  3MNN D;  4NFT A;  4HGA C;  3AV1 C;  2HUE B;  4NE3 A;  1KX4 B;  1KX5 C;  2NQB A;  1M18 C;  4XUJ B;  1P3B B;  5B32 D;  3A6N D;  1F66 D;  5GSU D;  3B0C W;  1HQ3 A;  3AYW B;  1AOI A;  5B31 G;  4XZQ D;  1EQZ C;  3AZE D;  3AZH D;  2HUE C;  1TAF A;  4CSR B;  1KX4 C;  5AV5 B;  2CV5 D;  3LZ1 C;  4YM6 C;  5DNM C;  3AYW C;  3AZF A;  1WWI A;  1P3K D;  3REI A;  3AZG B;  3AZL D;  1P3A D;  5B40 A;  5B2J A;  5CP6 D;  5AV6 B;  2RVQ C;  3MVD D;  3AV2 B;  5B33 D;  1M19 B;  3X1T D;  3W99 D;  3WKJ A;  2ARO C;  5B1L B;  1P3I A;  3AV1 D;  1KX5 D;  5CPJ B;  1M18 D;  5AV6 C;  3AZI A;  3AV2 C;  1M19 C;  1S32 B;  3MGP A;  1EQZ D;  2HIO A;  1KX4 D;  3X1V B;  3AZM B;  3LZ1 D;  1M1A B;  4YM6 D;  5CPI B;  5DNM D;  3AYW D;  1ZLA A;  3WTP B;  5DNN C;  5AY8 C;  3WAA B;  3MGR A;  4R8P B;  3MGS C;  3REJ C;  1P3M C;  3X1V C;  3WA9 B;  1M1A C;  4LD9 A;  2RVQ D;  3REK A;  3B0D C;  3X1S A;  5CPI C;  4J8U A;  4J8X A;  3UTB C;  2ARO D;  3UTA B;  1P3L A;  4DRB A;  1U35 C;  4M6B A;  2FJ7 B;  3WA9 C;  4WU9 C;  2BYK A;  5AV6 D;  4J8V A;  3AV2 D;  1M19 D;  3C1C A;  3KWQ B;  5F99 A;  2YFV B;  4CAY B;  4WU8 B;  2FJ7 C;  5FUG B;  4H9P B;  3TU4 A;  4WZS B;  4KHA B;  5DNN D;  5AY8 D;  4H9O B;  3MGS D;  3REJ D;  1P3M D;  3X1V D;  5AV8 B;  1M1A D;  1H3O A;  5CPI D;  1TZY C;  4KUD A;  3AN2 A;  3REH A;  4H9R A;  3LEL A;  5B1M C;  3UTB D;  2F8N A;  5B2I A;  4KGC A;  5B0Z A;  3MNN A;  3A6N B;  1F66 B;  2F8N K;  5GXQ A;  4AWL B;  1U35 D;  3WA9 D;  4WU9 D;  3AZE B;  3AZK B;  5B32 A;  3AZH B;  1P34 B;  5GSU A;  2CWE A;  4ZBJ B;  3AFA A;  2CV5 B;  4XZQ A;  2IO5 B;  3V9R B;  5B31 A;  5B24 A;  5CPK C;  4AWL C;  4X23 A;  2FJ7 D;  3LJA B;  3KXB B;  3AZK C;  1P34 C;  4ZBJ C;  4UUZ A;  1P3K B;  1P3O B;  5AVC C;  1P3A B;  3AZL B;  5CP6 B;  1KU5 A;  4WNN A;  3NQJ B;  3VH6 T;  3MVD B;  5B33 B;  4J8W B;  3W99 B;  5E5A C;  4JJN C;  3LJA C;  1R4V A;  3KXB C;  5BNV B;  1P3O C;  3X1T A;  1TZY D;  4HGA B;  3AV1 B;  1A7W A;  1KX3 C;  1KX5 B;  3B6G C;  3W98 B;  5GT0 B;  1M18 B;  5B1M D;  5JRG A;  4H9Q B;  5AVB B;  4J8W C;  4YS3 A;  3W97 A;  3AZJ C;  1P3G A;  5B0Y A;  1EQZ B;  3C1B B;  4Z2M G;  5AV9 A;  3W98 C;  3NQU A;  5B32 G;  5GT0 C;  1B67 A;  3LZ1 B;  5AVB C;  2JSS A;  3REL C;  4YM6 B;  5CPK D;  1KX4 A;  5DNM B;  3KUY C;  3C1B C;  4XUJ A;  1P3B A;  3UT9 C;  3AZK D;  1P34 D;  5AVC D;  3AYW A;  4Z66 B;  4CSR A;  5AV5 A;  5E5A D;  4JJN D;  3LJA D;  3KXB D;  5BNX B;  2ARO B;  1P3O D;  3O62 C;  4E45 A;  1F1E A;  2YFW B;  1KX3 D;  3B6G D;  5BO0 B;  4ZUX B;  4QLC B;  4J8W D;  4Z66 C;  3AZJ D;  3AZG A;  5AV6 A;  5GT3 B;  5JA4 B;  3AV2 A;  1P3F B;  1M19 A;  3W98 D;  1HQ3 C;  5GT0 D;  1AOI C;  4QLC C;  4ZUX C;  5B1L A;  5AVB D;  3REL D;  3KUY D;  4Z5T B;  3C1B D;  5CPJ A;  5DNN B;  3UT9 D; 
#chains in the Genus database with same CATH topology
 5GT3 C;  5AY8 B;  1P3F C;  1ULY A;  3LZ0 B;  1S32 A;  3MGS B;  3REJ B;  3AZF C;  1P3M B;  3B0D B;  5G49 B;  4Z5T C;  3X1V A;  3AZM A;  1M1A A;  3UTB B;  5CPI A;  3O62 D;  3LZ0 C;  3WTP A;  1U35 B;  4WU9 B;  3WAA A;  1BH8 B;  3W96 B;  1P3I C;  4Z66 D;  3WTP E;  4R8P A;  3WA9 A;  5BT1 C;  3AZI C;  4EO5 B;  1JFI B;  1HQ3 D;  1ZLA B;  1AOI D;  2PYO B;  4QLC D;  4ZUX D;  3W96 C;  2HIO C;  3EG5 B;  3UTA A;  2FJ7 A;  2NZD B;  5GT3 D;  4EO5 C;  1P3F D;  3AZN B;  3AZF D;  1ZLA C;  2PYO C;  3KWQ A;  2YFV A;  4NE5 A;  4CAY A;  1TZY B;  2F2A C;  4WU8 A;  4G91 C;  2NZD C;  4Z5T D;  3B6F B;  5FUG A;  3KSY A;  5B1M B;  4H9P A;  5KDM B;  4LD9 C;  5CHL B;  3REK C;  2Y2O A;  3LZ0 D;  3AZN C;  1WWS A;  4J8U C;  4KHA A;  3VH5 T;  1P3I D;  4H9O A;  1P3L C;  3AL0 C;  3B6F C;  3H0M C;  5AV8 A;  5BT1 D;  3AZI D;  4J8V C;  5CPK B;  1BH9 B;  3A6N A;  1F66 A;  2HIO D;  3MGQ B;  3W96 D;  5BS7 A;  4H9S A;  5AVC B;  2Y2G A;  3AZE A;  3AZK A;  4H9N B;  3AZH A;  1P34 A;  2BYM B;  5E5A B;  4JJN B;  2CV5 A;  1ZLA D;  2PYO D;  3EPK A;  3V9R A;  3MGQ C;  2F8N H;  2NZD D;  3LJA A;  1KX3 B;  3B6G B;  3KXB A;  4LD9 D;  2XD1 A;  1P3K A;  3REK D;  1P3O A;  3AZJ B;  1P3A A;  3AZN D;  4E44 A;  3AZL A;  4J8U D;  4KUD C;  5CP6 A;  3REH C;  1N1J B;  3NQJ A;  5B2I C;  5B0Z C;  3X1U B;  5B33 A;  3MVD A;  1ID3 B;  4KGC C;  1P3L D;  5GXQ C;  3W99 A;  3B6F D;  2DF4 C;  5BNV A;  3VH6 W;  4J8V D;  3REL B;  2ZY2 A;  3AV1 A;  3AFA C;  1KX5 A;  3KUY B;  3W98 A;  5GT0 A;  1M18 A;  3UT9 B;  3X1U C;  4H9Q A;  5C3I C;  5B31 C;  5AVB A;  1ID3 C;  5B24 C;  1EQZ A;  3R45 B;  4X23 C;  3C1B A;  1Q9C A;  1P3P B;  1B6W A;  3LZ1 A;  3MGQ D;  4YM6 A;  3O62 B;  5DNM A;  1P3P C;  3VH6 A;  4KUD D;  3B0C T;  2NQB B;  3REH D;  2F8N D;  5JRG C;  5B2I D;  5B0Z D;  2ZY4 A;  4YS3 C;  4KGC D;  4Z66 A;  3W97 C;  5GXQ D;  1P3G C;  5B0Y C;  1HQ3 B;  1AOI B;  5BNX A;  2ARO A;  5AV9 C;  2YFW A;  1TAF B;  3AFA D;  2NQB C;  1BFM A;  5BO0 A;  4QLC A;  4ZUX A;  3X1U D;  5B31 D;  1ID3 D;  4WJ3 C;  5B24 D;  2LY8 A;  4X23 D;  3AZF B;  4XUJ C;  1P3B C;  5GT3 A;  5JA4 A;  1P3F A;  3REI B;  3P5J B;  5B40 B;  5B2J B;  2DQN C;  5AV5 C;  4Z5T A;  1P3P D;  5DNN A;  3WKJ B;  5AY8 A;  1P3I B;  2L5A A;  3LZ0 A;  3REI C;  3MGS A;  3REJ A;  1P3M A;  5B40 C;  5B2J C;  3B0B A;  3AZI B;  5JRG D;  4YS3 D;  3W97 D;  3AZG C;  5G49 A;  5B0Y D;  1P3G D;  3MGP B;  5AV9 D;  3UTB A;  3WKJ C;  2HIO B;  1U35 A;  2NQB D;  4WU9 A;  1BH8 A;  3W96 A;  5B1L C;  3EPH A;  3H0R C;  3MGP C;  5CPJ C;  4XUJ D;  1P3B D;  3MGR B;  1JFI A;  1S32 C;  2Y2P A;  4G91 B;  2PYO A;  4LD9 B;  3REK B;  3X1S B;  2NZD A;  5AV5 D;  4J8U B;  4NE6 A;  4J8X B;  3AZM C;  1HTA A;  3MGR C;  1P3L B;  3REI D;  3AZN A;  3WTP C;  5B40 D;  5B2J D;  2BYK B;  3WAA C;  4J8V B;  1TZY A;  2Y2J A;  3X1S C;  4R8P C;  3AZG D;  3B6F A;  3C1C B;  4J8X C;  5B1M A;  5KDM A;  3WKJ D;  5F99 B;  5B1L D;  3UTA C;  3TU4 B;  3C1C C;  3MGP D;  3VH5 W;  5CPJ D;  4DRA A;  5F99 C;  4G92 B;  5CPK A;  1S32 D;  1BH9 A;  3KWQ C;  3MGQ A;  1H3O B;  3TU4 C;  5AVC A;  4WU8 C;  4KUD B;  3AN2 B;  3REH B;  4H9R B;  3LEL B;  3AZM D;  4H9N A;  2F8N B;  5B2I B;  2BYM A;  5B0Z B;  3MNN B;  4G92 C;  4KGC B;  3MGR D;  2ZY5 A;  5GXQ B;  5E5A A;  4JJN A;  4Z2M H;  3WTP D;  3WAA D;  5B32 B;  2W8S A;  3A1I A;  5GSU B;  3X1S D;  4R8P D;  1KX3 A;  3AFA B;  3B6G A;  3AN2 C;  5AV8 C;  4J8X D;  4XZQ B;  3LEL C;  3VH5 A;  2G5H C;  5C3I B;  5B31 B;  3MNN C;  4J8W A;  3AZJ A;  5B24 B;  4X23 B;  1N1J A;  3X1U A;  5B32 C;  3A6N C;  1ID3 A;  1F66 C;  5GSU C;  5BS7 C;  4UUZ B;  3UTA D;  4H9S C;  3C1C D;  2J8P A;  4WV4 B;  4XZQ C;  3AZE C;  4WNN B;  5F99 D;  3AZH C;  3REL A;  4UPK A;  2UWX A;  3KUY A;  2CV5 C;  2IO5 C;  3KWQ D;  3UT9 A;  3A1K A;  3TU4 D;  3X1T B;  3R45 A;  4WU8 D;  1P3P A;  5JRG B;  4YS3 B;  1P3K C;  3W97 B;  1P3A C;  3AZL C;  5B0Y B;  1P3G B;  5CP6 C;  5AV9 B;  3MVD C;  5B33 C;  3O62 A;  3X1T C;  3W99 C;  2XD5 A;  2F8N G;  3AN2 D;  3NQU B;  5AV8 D;  3LEL D;  3MNN D;  4NFT A;  4HGA C;  3AV1 C;  2HUE B;  2JE5 A;  4NE3 A;  1KX4 B;  1KX5 C;  2NQB A;  1M18 C;  4XUJ B;  1P3B B;  5B32 D;  3A6N D;  1F66 D;  5GSU D;  3B0C W;  2Y2M A;  1HQ3 A;  3AYW B;  1AOI A;  5B31 G;  4XZQ D;  1EQZ C;  3AZE D;  3AZH D;  2HUE C;  1TAF A;  4CSR B;  1KX4 C;  5AV5 B;  2Y2L A;  2CV5 D;  3LZ1 C;  4YM6 C;  5DNM C;  3AYW C;  3AZF A;  2JCH A;  1WWI A;  1P3K D;  3REI A;  3AZG B;  3AZL D;  1P3A D;  5B40 A;  5B2J A;  5CP6 D;  5AV6 B;  2RVQ C;  3MVD D;  3AV2 B;  5B33 D;  1M19 B;  3X1T D;  1PZR A;  3W99 D;  3WKJ A;  2ARO C;  5B1L B;  1P3I A;  3AV1 D;  1KX5 D;  5CPJ B;  1M18 D;  5AV6 C;  3AZI A;  3AV2 C;  3H0L C;  3EPL A;  1M19 C;  1S32 B;  3MGP A;  1EQZ D;  2HIO A;  1KX4 D;  3X1V B;  3AZM B;  3LZ1 D;  1M1A B;  4YM6 D;  5CPI B;  5DNM D;  3AYW D;  1ZLA A;  3WTP B;  2G5I C;  2Y2K A;  5DNN C;  5AY8 C;  3WAA B;  3MGR A;  4R8P B;  3MGS C;  3REJ C;  1P3M C;  3X1V C;  3WA9 B;  1M1A C;  4LD9 A;  2RVQ D;  3REK A;  3B0D C;  3X1S A;  5CPI C;  4J8U A;  2Y2N A;  4J8X A;  3UTB C;  2ARO D;  3UTA B;  1P3L A;  4DRB A;  1U35 C;  4M6B A;  2FJ7 B;  3WA9 C;  4WU9 C;  2BYK A;  5AV6 D;  2ZY3 A;  4J8V A;  3AV2 D;  1M19 D;  3C1C A;  3KWQ B;  5F99 A;  2YFV B;  4CAY B;  4WU8 B;  2FJ7 C;  5FUG B;  4H9P B;  2ZM5 A;  3TU4 A;  4WZS B;  4KHA B;  5DNN D;  3FDD A;  5AY8 D;  4H9O B;  3MGS D;  3REJ D;  1P3M D;  3X1V D;  5AV8 B;  1M1A D;  1H3O A;  5CPI D;  1TZY C;  4KUD A;  3AN2 A;  3REH A;  4H9R A;  3LEL A;  5B1M C;  3UTB D;  2F8N A;  2RIQ A;  5B2I A;  5B0Z A;  3MNN A;  3A6N B;  1F66 B;  2F8N K;  4KGC A;  5GXQ A;  4AWL B;  1U35 D;  3WA9 D;  4WU9 D;  3AZE B;  3AZK B;  5B32 A;  3AZH B;  1P34 B;  5GSU A;  2CWE A;  4ZBJ B;  3AFA A;  2CV5 B;  4XZQ A;  2IO5 B;  3V9R B;  5B31 A;  5B24 A;  5CPK C;  4AWL C;  4X23 A;  2FJ7 D;  1Z2C B;  3LJA B;  3KXB B;  3AZK C;  1T3U A;  2FFF B;  1P34 C;  4ZBJ C;  4UUZ A;  1P3K B;  1P3O B;  5AVC C;  1P3A B;  3AZL B;  3IP4 C;  5CP6 B;  1KU5 A;  1W2E A;  4WNN A;  3NQJ B;  3VH6 T;  3MVD B;  5B33 B;  4J8W B;  3W99 B;  5E5A C;  4JJN C;  3LJA C;  1R4V A;  3KXB C;  5BNV B;  1P3O C;  3X1T A;  1TZY D;  4HGA B;  3AV1 B;  1A7W A;  1KX3 C;  1KX5 B;  3B6G C;  3W98 B;  2VQR A;  5GT0 B;  4DQY B;  3F6T A;  5B1M D;  2Y2H A;  1M18 B;  5JRG A;  4H9Q B;  5AVB B;  4J8W C;  4YS3 A;  3W97 A;  3AZJ C;  1P3G A;  5B0Y A;  1EQZ B;  3C1B B;  4Z2M G;  5AV9 A;  3KFU G;  3W98 C;  3NQU A;  5B32 G;  5GT0 C;  3EPJ A;  1B67 A;  3LZ1 B;  5AVB C;  2JSS A;  3REL C;  4YM6 B;  5CPK D;  1KX4 A;  5DNM B;  3KUY C;  3C1B C;  2Y2Q A;  4XUJ A;  1P3B A;  3UT9 C;  3AZK D;  1P34 D;  5AVC D;  3AYW A;  4Z66 B;  4CSR A;  5AV5 A;  5E5A D;  4JJN D;  3LJA D;  3KXB D;  5BNX B;  2ARO B;  1P3O D;  3O62 C;  4E45 A;  1F1E A;  2YFW B;  1KX3 D;  3B6G D;  5BO0 B;  4ZUX B;  4QLC B;  4J8W D;  4Z66 C;  3AZJ D;  3AZG A;  5AV6 A;  2BG1 A;  2Y2I A;  5GT3 B;  5JA4 B;  3AV2 A;  1P3F B;  1M19 A;  3W98 D;  1HQ3 C;  5GT0 D;  1AOI C;  4QLC C;  4ZUX C;  5B1L A;  5AVB D;  3REL D;  3KUY D;  4Z5T B;  3C1B D;  5CPJ A;  5DNN B;  3UT9 D; 
#chains in the Genus database with same CATH homology
 5GT3 C;  5AY8 B;  1P3F C;  1ULY A;  3LZ0 B;  1S32 A;  3MGS B;  3REJ B;  3AZF C;  1P3M B;  3B0D B;  5G49 B;  4Z5T C;  3X1V A;  3AZM A;  1M1A A;  3UTB B;  5CPI A;  3O62 D;  3LZ0 C;  3WTP A;  1U35 B;  4WU9 B;  3WAA A;  1BH8 B;  3W96 B;  1P3I C;  4Z66 D;  3WTP E;  4R8P A;  3WA9 A;  5BT1 C;  3AZI C;  4EO5 B;  1JFI B;  1HQ3 D;  1ZLA B;  1AOI D;  2PYO B;  4QLC D;  4ZUX D;  3W96 C;  2HIO C;  3EG5 B;  3UTA A;  2FJ7 A;  2NZD B;  5GT3 D;  4EO5 C;  1P3F D;  3AZN B;  3AZF D;  1ZLA C;  2PYO C;  3KWQ A;  2YFV A;  4NE5 A;  4CAY A;  1TZY B;  2F2A C;  4WU8 A;  4G91 C;  2NZD C;  4Z5T D;  3B6F B;  5FUG A;  3KSY A;  5B1M B;  4H9P A;  5KDM B;  4LD9 C;  5CHL B;  3REK C;  2Y2O A;  3LZ0 D;  3AZN C;  1WWS A;  4J8U C;  4KHA A;  3VH5 T;  1P3I D;  4H9O A;  1P3L C;  3AL0 C;  3B6F C;  3H0M C;  5AV8 A;  5BT1 D;  3AZI D;  4J8V C;  5CPK B;  1BH9 B;  3A6N A;  1F66 A;  2HIO D;  3MGQ B;  3W96 D;  5BS7 A;  4H9S A;  5AVC B;  2Y2G A;  3AZE A;  3AZK A;  4H9N B;  3AZH A;  1P34 A;  2BYM B;  5E5A B;  4JJN B;  2CV5 A;  1ZLA D;  2PYO D;  3EPK A;  3V9R A;  3MGQ C;  2F8N H;  2NZD D;  3LJA A;  1KX3 B;  3B6G B;  3KXB A;  4LD9 D;  2XD1 A;  1P3K A;  3REK D;  1P3O A;  3AZJ B;  1P3A A;  3AZN D;  4E44 A;  3AZL A;  4J8U D;  4KUD C;  5CP6 A;  3REH C;  1N1J B;  3NQJ A;  5B2I C;  5B0Z C;  3X1U B;  5B33 A;  3MVD A;  1ID3 B;  4KGC C;  1P3L D;  5GXQ C;  3W99 A;  3B6F D;  2DF4 C;  5BNV A;  3VH6 W;  4J8V D;  3REL B;  2ZY2 A;  3AV1 A;  3AFA C;  1KX5 A;  3KUY B;  3W98 A;  5GT0 A;  1M18 A;  3UT9 B;  3X1U C;  4H9Q A;  5C3I C;  5B31 C;  5AVB A;  1ID3 C;  5B24 C;  1EQZ A;  3R45 B;  4X23 C;  3C1B A;  1Q9C A;  1P3P B;  1B6W A;  3LZ1 A;  3MGQ D;  4YM6 A;  3O62 B;  5DNM A;  1P3P C;  3VH6 A;  4KUD D;  3B0C T;  2NQB B;  3REH D;  2F8N D;  5JRG C;  5B2I D;  5B0Z D;  2ZY4 A;  4YS3 C;  4KGC D;  4Z66 A;  3W97 C;  5GXQ D;  1P3G C;  5B0Y C;  1HQ3 B;  1AOI B;  5BNX A;  2ARO A;  5AV9 C;  2YFW A;  1TAF B;  3AFA D;  2NQB C;  1BFM A;  5BO0 A;  4QLC A;  4ZUX A;  3X1U D;  5B31 D;  1ID3 D;  4WJ3 C;  5B24 D;  2LY8 A;  4X23 D;  3AZF B;  4XUJ C;  1P3B C;  5GT3 A;  5JA4 A;  1P3F A;  3REI B;  3P5J B;  5B40 B;  5B2J B;  2DQN C;  5AV5 C;  4Z5T A;  1P3P D;  5DNN A;  3WKJ B;  5AY8 A;  1P3I B;  2L5A A;  3LZ0 A;  3REI C;  3MGS A;  3REJ A;  1P3M A;  5B40 C;  5B2J C;  3B0B A;  3AZI B;  5JRG D;  4YS3 D;  3W97 D;  3AZG C;  5G49 A;  5B0Y D;  1P3G D;  3MGP B;  5AV9 D;  3UTB A;  3WKJ C;  2HIO B;  1U35 A;  2NQB D;  4WU9 A;  1BH8 A;  3W96 A;  5B1L C;  3EPH A;  3H0R C;  3MGP C;  5CPJ C;  4XUJ D;  1P3B D;  3MGR B;  1JFI A;  1S32 C;  2Y2P A;  4G91 B;  2PYO A;  4LD9 B;  3REK B;  3X1S B;  2NZD A;  5AV5 D;  4J8U B;  4NE6 A;  4J8X B;  3AZM C;  1HTA A;  3MGR C;  1P3L B;  3REI D;  3AZN A;  3WTP C;  5B40 D;  5B2J D;  2BYK B;  3WAA C;  4J8V B;  1TZY A;  2Y2J A;  3X1S C;  4R8P C;  3AZG D;  3B6F A;  3C1C B;  4J8X C;  5B1M A;  5KDM A;  3WKJ D;  5F99 B;  5B1L D;  3UTA C;  3TU4 B;  3C1C C;  3MGP D;  3VH5 W;  5CPJ D;  4DRA A;  5F99 C;  4G92 B;  5CPK A;  1S32 D;  1BH9 A;  3KWQ C;  3MGQ A;  1H3O B;  3TU4 C;  5AVC A;  4WU8 C;  4KUD B;  3AN2 B;  3REH B;  4H9R B;  3LEL B;  3AZM D;  4H9N A;  2F8N B;  5B2I B;  2BYM A;  5B0Z B;  3MNN B;  4G92 C;  4KGC B;  3MGR D;  2ZY5 A;  5GXQ B;  5E5A A;  4JJN A;  4Z2M H;  3WTP D;  3WAA D;  5B32 B;  2W8S A;  3A1I A;  5GSU B;  3X1S D;  4R8P D;  1KX3 A;  3AFA B;  3B6G A;  3AN2 C;  5AV8 C;  4J8X D;  4XZQ B;  3LEL C;  3VH5 A;  2G5H C;  5C3I B;  5B31 B;  3MNN C;  4J8W A;  3AZJ A;  5B24 B;  4X23 B;  1N1J A;  3X1U A;  5B32 C;  3A6N C;  1ID3 A;  1F66 C;  5GSU C;  5BS7 C;  4UUZ B;  3UTA D;  4H9S C;  3C1C D;  2J8P A;  4WV4 B;  4XZQ C;  3AZE C;  4WNN B;  5F99 D;  3AZH C;  3REL A;  4UPK A;  2UWX A;  3KUY A;  2CV5 C;  2IO5 C;  3KWQ D;  3UT9 A;  3A1K A;  3TU4 D;  3X1T B;  3R45 A;  4WU8 D;  1P3P A;  5JRG B;  4YS3 B;  1P3K C;  3W97 B;  1P3A C;  3AZL C;  5B0Y B;  1P3G B;  5CP6 C;  5AV9 B;  3MVD C;  5B33 C;  3O62 A;  3X1T C;  3W99 C;  2XD5 A;  2F8N G;  3AN2 D;  3NQU B;  5AV8 D;  3LEL D;  3MNN D;  4NFT A;  4HGA C;  3AV1 C;  2HUE B;  2JE5 A;  4NE3 A;  1KX4 B;  1KX5 C;  2NQB A;  1M18 C;  4XUJ B;  1P3B B;  5B32 D;  3A6N D;  1F66 D;  5GSU D;  3B0C W;  2Y2M A;  1HQ3 A;  3AYW B;  1AOI A;  5B31 G;  4XZQ D;  1EQZ C;  3AZE D;  3AZH D;  2HUE C;  1TAF A;  4CSR B;  1KX4 C;  5AV5 B;  2Y2L A;  2CV5 D;  3LZ1 C;  4YM6 C;  5DNM C;  3AYW C;  3AZF A;  2JCH A;  1WWI A;  1P3K D;  3REI A;  3AZG B;  3AZL D;  1P3A D;  5B40 A;  5B2J A;  5CP6 D;  5AV6 B;  2RVQ C;  3MVD D;  3AV2 B;  5B33 D;  1M19 B;  3X1T D;  1PZR A;  3W99 D;  3WKJ A;  2ARO C;  5B1L B;  1P3I A;  3AV1 D;  1KX5 D;  5CPJ B;  1M18 D;  5AV6 C;  3AZI A;  3AV2 C;  3H0L C;  3EPL A;  1M19 C;  1S32 B;  3MGP A;  1EQZ D;  2HIO A;  1KX4 D;  3X1V B;  3AZM B;  3LZ1 D;  1M1A B;  4YM6 D;  5CPI B;  5DNM D;  3AYW D;  1ZLA A;  3WTP B;  2G5I C;  2Y2K A;  5DNN C;  5AY8 C;  3WAA B;  3MGR A;  4R8P B;  3MGS C;  3REJ C;  1P3M C;  3X1V C;  3WA9 B;  1M1A C;  4LD9 A;  2RVQ D;  3REK A;  3B0D C;  3X1S A;  5CPI C;  4J8U A;  2Y2N A;  4J8X A;  3UTB C;  2ARO D;  3UTA B;  1P3L A;  4DRB A;  1U35 C;  4M6B A;  2FJ7 B;  3WA9 C;  4WU9 C;  2BYK A;  5AV6 D;  2ZY3 A;  4J8V A;  3AV2 D;  1M19 D;  3C1C A;  3KWQ B;  5F99 A;  2YFV B;  4CAY B;  4WU8 B;  2FJ7 C;  5FUG B;  4H9P B;  2ZM5 A;  3TU4 A;  4WZS B;  4KHA B;  5DNN D;  3FDD A;  5AY8 D;  4H9O B;  3MGS D;  3REJ D;  1P3M D;  3X1V D;  5AV8 B;  1M1A D;  1H3O A;  5CPI D;  1TZY C;  4KUD A;  3AN2 A;  3REH A;  4H9R A;  3LEL A;  5B1M C;  3UTB D;  2F8N A;  2RIQ A;  5B2I A;  5B0Z A;  3MNN A;  3A6N B;  1F66 B;  2F8N K;  4KGC A;  5GXQ A;  4AWL B;  1U35 D;  3WA9 D;  4WU9 D;  3AZE B;  3AZK B;  5B32 A;  3AZH B;  1P34 B;  5GSU A;  2CWE A;  4ZBJ B;  3AFA A;  2CV5 B;  4XZQ A;  2IO5 B;  3V9R B;  5B31 A;  5B24 A;  5CPK C;  4AWL C;  4X23 A;  2FJ7 D;  1Z2C B;  3LJA B;  3KXB B;  3AZK C;  1T3U A;  2FFF B;  1P34 C;  4ZBJ C;  4UUZ A;  1P3K B;  1P3O B;  5AVC C;  1P3A B;  3AZL B;  3IP4 C;  5CP6 B;  1KU5 A;  1W2E A;  4WNN A;  3NQJ B;  3VH6 T;  3MVD B;  5B33 B;  4J8W B;  3W99 B;  5E5A C;  4JJN C;  3LJA C;  1R4V A;  3KXB C;  5BNV B;  1P3O C;  3X1T A;  1TZY D;  4HGA B;  3AV1 B;  1A7W A;  1KX3 C;  1KX5 B;  3B6G C;  3W98 B;  2VQR A;  5GT0 B;  4DQY B;  3F6T A;  5B1M D;  2Y2H A;  1M18 B;  5JRG A;  4H9Q B;  5AVB B;  4J8W C;  4YS3 A;  3W97 A;  3AZJ C;  1P3G A;  5B0Y A;  1EQZ B;  3C1B B;  4Z2M G;  5AV9 A;  3KFU G;  3W98 C;  3NQU A;  5B32 G;  5GT0 C;  3EPJ A;  1B67 A;  3LZ1 B;  5AVB C;  2JSS A;  3REL C;  4YM6 B;  5CPK D;  1KX4 A;  5DNM B;  3KUY C;  3C1B C;  2Y2Q A;  4XUJ A;  1P3B A;  3UT9 C;  3AZK D;  1P34 D;  5AVC D;  3AYW A;  4Z66 B;  4CSR A;  5AV5 A;  5E5A D;  4JJN D;  3LJA D;  3KXB D;  5BNX B;  2ARO B;  1P3O D;  3O62 C;  4E45 A;  1F1E A;  2YFW B;  1KX3 D;  3B6G D;  5BO0 B;  4ZUX B;  4QLC B;  4J8W D;  4Z66 C;  3AZJ D;  3AZG A;  5AV6 A;  2BG1 A;  2Y2I A;  5GT3 B;  5JA4 B;  3AV2 A;  1P3F B;  1M19 A;  3W98 D;  1HQ3 C;  5GT0 D;  1AOI C;  4QLC C;  4ZUX C;  5B1L A;  5AVB D;  3REL D;  3KUY D;  4Z5T B;  3C1B D;  5CPJ A;  5DNN B;  3UT9 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...