3WA9D

The nucleosome containing human h2a.z.1
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
93
structure length
93
Chain Sequence
SRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords Histone H3.1
publication title Structural polymorphism in the L1 loop regions of human H2A.Z.1 and H2A.Z.2
pubmed doi rcsb
source organism Homo sapiens
total genus 37
structure length 93
sequence length 93
chains with identical sequence H
ec nomenclature
pdb deposition date 2013-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3wa9D00
5B24A 5GXQA 1P3LA 1S32D 4CAYB 5CP6A 3KWQD 1ZLAC 3MGPC 5E5AB 3AZEA 5B32D 5AV8A 3LZ0C 2F8NG 1U35C 3B6FD 3AN2A 1M18A 3NQUB 3X1TA 3X1UB 4J8UA 2PYOA 3UTBD 4DRBA 1P3MC 3W98D 2FJ7D 3O62D 3UT9C 1S32C 1KX4B 5B2JA 3KWQC 3UTAD 1N1JB 5B32C 3AZKD 3B6FC 4XUJD 3AZFA 3C1BB 3WKJD 1P3PA 3REHA 5B1MB 5G49B 5AV9A 3UTBC 5DNMA 5B24D 3V9RB 5CP6D 2BYKA 3AZED 3AZKC 5AV8D 5B31C 1TZYB 3REKA 5B40A 3RELB 3WKJC 4H9SC 5B1LB 4YM6B 3R45B 4X23C 4J8UD 2PYOD 5E5AA 3AZIB 5AY8B 4Z5TA 5B2JD 5CPJC 3REID 1F1EA 3MGRB 3C1CD 3NQUA 4H9OA 4H9PA 3X1UA 1P3KD 3AZFD 3WAAD 5C3IB 1BFMA 1KX4A 3REHD 3MGQC 1N1JA 3LJAB 5AV9D 4LD9D 1H3OB 5DNMD 1P3IA 5BNVB 5B0YC 3C1CC 3C1BA 1EQZB 1P3KC 5B1MA 5G49A 1ID3A 3REKD 3WAAC 5B40D 1KX3C 3KXBB 3AV2B 3V9RA 4LD9C 1KU5A 5E5AD 3AZGC 3W96B 3AZNB 2F8NB 1TZYA 3RELA 4NFTA 1KX5C 1P3GB 5B1LA 4YM6A 3WTPA 4E45A 4AWLC 2YFWB 4EO5B 5AY8A 2NQBA 5GSUC 1KX4D 3AZMB 1WWSA 4YS3C 4WV4B 5B33A 2NZDB 1B6WA 4DRAA 3AV1B 2RVQD 4KUDB 2HUEC 3AZLB 3B6GA 3WTPE 3C1BD 5GXQB 1P3LB 3LJAA 5B1MD 1H3OA 5BNVA 4WU8B 4J8WB 3AN2B 1M18B 1TAFA 3AZHA 3X1TB 3WAAB 1EQZA 1TZYD 3RELD 2YFVB 3VH6A 5B1LD 3LELB 4YM6D 3KXBA 3AV2A 3AZJC 1P34B 3AZID 3KUYB 4JJNC 3AZNA 4G91C 3W99C 1P3PB 1P3GA 3MGRD 2AROC 1M19C 5JRGC 3MVDB 5BT1D 5DNNA 3AZMA 4G92C 4J8XB 1P3FA 3AZIC 3LJAD 4XZQC 4ZUXC 3VH5A 4KUDA 3AZLA 3MGRC 4J8VC 1EQZD 5AVBB 4Z5TB 4WZSB 4WU8A 3MNNA 3KXBD 3AV2D 4J8WA 4H9OB 4H9PB 4HGAB 5CHLB 3W96D 3AZND 2F8ND 2YFVA 4H9QA 1P3GD 4CSRA 3LELA 1P34A 1P3IB 5AV6B 3KUYA 3W97B 3MGSB 3AZMD 3AFAA 2NZDD 1R4VA 5GT3B 2IO5C 3AV1D 3W96C 3REJB 1ID3B 3W98C 3MVDA 3O62C 2FJ7C 4KHAA 3AZLD 4KUDD 4ZBJC 5B2IB 3UTAC 5GXQD 5CPIA 1P3LD 4J8XA 3AYWA 4EO5C 4Z66B 4XUJC 3B0BA 5B0ZB 4H9NB 5B31G 4WU8D 2NZDC 4J8WD 3AN2D 1M18D 2HIOB 3AV1C 3X1TD 3WTPB 1P3OB 5AVBA 4QLCA 5B24C 2NQBB 4R8PB 1P3LC 4E44A 5CP6C 2CWEA 4WNNA 3B0DC 5B33B 3LELD 3AZEC 5AV8C 1WWIA 1P34D 5AVCB 3KUYD 1M1AB 3B6GB 3KSYA 5AV5B 1M18C 3X1TC 5KDMB 1P3PD 1F66A 4J8UC 2PYOC 3LZ1B 5FUGB 1HQ3B 5GT0B 3MVDD 5B2JC 3A6NB 3REIC 4H9RB 5AV6A 3W97A 3MGSA 4KGCB 3TU4B 4J8XD 5F99B 1TAFB 3AZHB 5GT3A 5CPKB 2CV5A 1P3AB 3AZFC 3REJA 3WA9B 3X1VB 1P3PC 3REHC 5B2IA 4NE3A 5AV9C 5AVBD 5DNMC 1ZLAB 3MGPB 4Z66A 4Z5TD 5B0ZA 1ULYA 4H9NA 1U35B 2HIOA 3X1UD 3REKC 5B40C 1P3OA 5BO0A 1AOIA 4R8PA 1P3MB 4NE6A 5DNNB 3UT9B 1P3FB 5E5AC 4Z5TC 5AVCA 1P3ID 5AV6D 3W97D 3MGSD 1M1AA 5AV5A 2BYMB 5KDMA 3X1UC 5GT3D 5BS7A 3LZ1A 5FUGA 1HQ3A 3REJD 1ID3D 3X1SA 4WU9A 5GT0A 1KX4C 5JRGA 3A6NA 5B2ID 4H9RA 3MNNB 4KGCA 3TU4A 5F99A 2L5AA 2RVQC 5CPKA 4Z66D 1P3AA 5B0ZD 5B31B 3C1BC 3WA9A 3X1VA 4H9QB 1P3BA 1BH9B 4CSRB 2HIOD 5B1MC 1ID3C 3WTPD 1P3OD 4X23B 1ZLAA 3MGPA 5AY8D 2NQBD 4NE5A 4R8PD 3AFAB 5B33D 3LZ0A 5CPJB 1U35A 3VH6T 5AVCD 1TZYC 3RELC 4KHAB 1M1AD 3B6GD 5AV5D 5B1LC 4YM6C 1P3MA 5CPIB 3WTPC 3UT9A 5JA4B 1S32A 3LZ1D 3KWQA 2JSSA 3AYWB 1HQ3D 3MGQB 5AY8C 5GT0D 5B32A 3W98A 3A6ND 5B33C 4KGCD 3B6FA 2BYMA 3TU4D 5F99D 5B0YB 3AZHD 1P3AD 1B67A 5CPKD 4QLCB 5BT1C 3B6GC 3UTBA 3X1VD 5C3IC 3WA9D 1KX3B 4WNNB 3LJAC 4Z2MH 1ZLAD 4UUZA 3MGPD 3AZKA 3AZGB 1JFIB 5B31A 3AZHC 3WKJA 1U35D 1BH9A 1KX5B 1EQZC 1F66B 4H9SA 4X23A 4AWLB 5B32G 3KXBC 3AV2C 1P3MD 5DNND 5GSUB 3UT9D 1P3FD 4YS3B 5CPJA 5BNXB 2CV5B 3NQJB 3AZNC 1P3GC 2HUEB 5JA4A 1Q9CA 3MGQA 5DNNC 3AZMC 1A7WA 1P3FC 3MNND 3REIA 5B0YA 3C1CA 4KUDC 3AZLC 5BO0B 1P3KA 5B31D 1AOIB 5GXQC 3WAAA 1KX3A 4X23D 4LD9A 3AZJB 4WU8C 3MNNC 3AZGA 4J8WC 3AN2C 3AFAD 1JFIA 4JJNB 5CPJD 4G91B 2F8NH 3W99B 1KX5A 2AROB 3X1SB 4WU9B 1M19B 5JRGB 3LELC 5CPID 5GSUA 2F8NK 4CAYA 4G92B 3AYWD 5BNXA 4YS3A 1P34C 3MGQD 3KUYC 3NQJA 4XZQB 3AFAC 4ZUXB 1P3BB 4J8VB 5B0YD 3MVDC 4QLCD 5CPIC 4J8XC 1KX3D 3AYWC 3LZ0B 4M6BA 3AZGD 1KX5D 5AVBC 1S32B 4QLCC 3KWQB 1F66D 5B32B 3AZJA 3B6FB 5GSUD 4JJNA 4YS3D 3W99A 4HGAC 2CV5D 2AROA 2IO5B 3UTBB 1M19A 3W98B 2FJ7B 3O62B 1F66C 1BH8B 4ZBJB 3UTAB 3R45A 4UUZB 1P3IC 3AZIA 5AV6C 3AZKB 3W97C 3MGSC 4XZQA 4XUJB 3WKJB 4ZUXA 5GT3C 2CV5C 3MGRA 4J8VA 3REJC 5B2IC 1AOID 5B24B 4Z2MG 5CP6B 3B0DB 3AZEB 4Z66C 5AV8B 5B0ZC 3AZJD 4JJND 2HIOC 3W99D 3VH6W 1P3OC 2AROD 4J8UB 2PYOB 2NQBC 3X1SD 4WU9D 4R8PC 1AOIC 1M19D 5JRGD 5B2JB 3REIB 3C1CB 5AVCC 1M1AC 5AV5C 4XZQD 3AZFB 3W96A 1P3KB 2F8NA 4ZUXD 1P3BD 5BS7C 3O62A 1HTAA 1BH8A 3LZ1C 3REHB 2FJ7A 4J8VD 1HQ3C 3UTAA 3X1SC 4WU9C 3VH5T 3B0CT 5GT0C 5AV9B 4LD9B 2YFWA 3A6NC 5DNMB 4KGCC 4XUJA 3TU4C 5F99C 3VH5W 3B0CW 3LZ0D 2BYKB 1P3AC 5CPKC 2NZDA 3AV1A 3WA9C 3X1VC 2LY8A 3REKB 5B40B 1P3BC
chains in the Genus database with same CATH superfamily
5B24A 5GXQA 2BG1A 1P3LA 1S32D 4CAYB 5CP6A 3KWQD 2DF4C 1ZLAC 3MGPC 5E5AB 3AZEA 5B32D 5AV8A 3LZ0C 2F8NG 1U35C 3B6FD 3AN2A 1M18A 3NQUB 3X1TA 3X1UB 4J8UA 2PYOA 2G5HC 3UTBD 2JE5A 4DRBA 1P3MC 3W98D 2FJ7D 3O62D 3UT9C 1S32C 1KX4B 5B2JA 3KWQC 3UTAD 1N1JB 5B32C 3AZKD 3B6FC 4XUJD 3AZFA 2Y2MA 3C1BB 3WKJD 2DQNC 1P3PA 3REHA 5B1MB 5G49B 5AV9A 3UTBC 2Y2IA 5DNMA 5B24D 3V9RB 5CP6D 3H0RC 2BYKA 3AZED 3AZKC 5AV8D 5B31C 1TZYB 3REKA 5B40A 3RELB 3WKJC 4H9SC 5B1LB 2Y2OA 4YM6B 3R45B 4X23C 4J8UD 2PYOD 5E5AA 3AZIB 5AY8B 4Z5TA 2J8PA 5B2JD 5CPJC 3REID 1F1EA 3MGRB 3C1CD 3NQUA 4H9OA 4H9PA 3X1UA 1P3KD 2Y2PA 3AZFD 3WAAD 5C3IB 1BFMA 1KX4A 3REHD 3MGQC 1N1JA 3LJAB 5AV9D 4LD9D 1H3OB 5DNMD 1P3IA 5BNVB 5B0YC 3C1CC 3C1BA 1EQZB 1P3KC 5B1MA 5G49A 1ID3A 3REKD 3WAAC 5B40D 1KX3C 1W2EA 3KXBB 3AV2B 3V9RA 4LD9C 1KU5A 5E5AD 3AZGC 3W96B 3AZNB 2F8NB 1TZYA 3RELA 4NFTA 1KX5C 1P3GB 5B1LA 2G5IC 4YM6A 3WTPA 4E45A 2VQRA 4AWLC 2YFWB 4EO5B 5AY8A 3EPKA 2NQBA 5GSUC 1KX4D 3AZMB 1WWSA 4YS3C 4WV4B 5B33A 2NZDB 1B6WA 4DRAA 3AV1B 2Y2KA 2RVQD 2XD1A 2XD5A 4KUDB 2HUEC 3AZLB 3B6GA 3WTPE 3C1BD 5GXQB 1P3LB 3LJAA 5B1MD 1H3OA 5BNVA 3P5JB 4WU8B 4J8WB 3AN2B 1M18B 1TAFA 3AZHA 3X1TB 3WAAB 1EQZA 1TZYD 3RELD 2YFVB 3VH6A 3A1KA 3H0LC 5B1LD 4YM6D 3KXBA 3LELB 3AV2A 3AZJC 1P34B 3AZID 3KUYB 4JJNC 3AZNA 2Y2GA 4G91C 3W99C 1P3PB 1P3GA 3MGRD 2AROC 1M19C 5JRGC 3MVDB 5BT1D 5DNNA 3AZMA 3FDDA 4J8XB 4G92C 1P3FA 3AZIC 3LJAD 2F2AC 4XZQC 4ZUXC 3EPHA 3VH5A 4KUDA 3AZLA 3MGRC 4J8VC 1EQZD 5AVBB 2ZY5A 4Z5TB 4WZSB 4WU8A 3MNNA 3KXBD 3AV2D 4J8WA 4H9OB 4H9PB 4HGAB 5CHLB 3IP4C 3AZND 2F8ND 3W96D 2YFVA 4H9QA 1P3GD 4CSRA 3LELA 3AL0C 1P34A 1P3IB 5AV6B 3KUYA 3W97B 3MGSB 3AZMD 3AFAA 2Y2HA 2NZDD 1R4VA 5GT3B 2IO5C 3AV1D 3W96C 3REJB 1ID3B 3W98C 3MVDA 3O62C 2FJ7C 4KHAA 3AZLD 4KUDD 4ZBJC 5B2IB 3UTAC 5GXQD 5CPIA 1P3LD 4J8XA 3AYWA 4EO5C 4Z66B 4XUJC 3B0BA 5B0ZB 4H9NB 5B31G 4WU8D 2NZDC 4J8WD 3AN2D 1M18D 2HIOB 3AV1C 3X1TD 3H0MC 3WTPB 1P3OB 5AVBA 4QLCA 1Z2CB 2RIQA 5B24C 2NQBB 4R8PB 1P3LC 2Y2LA 4E44A 5CP6C 2CWEA 4WNNA 3B0DC 5B33B 3LELD 3AZEC 5AV8C 1WWIA 1P34D 5AVCB 3KUYD 1M1AB 3B6GB 3KSYA 5AV5B 1M18C 3X1TC 5KDMB 1P3PD 1F66A 4J8UC 2PYOC 3LZ1B 5FUGB 1HQ3B 5GT0B 3MVDD 2ZM5A 5B2JC 3A6NB 3REIC 4H9RB 5AV6A 3W97A 3MGSA 4KGCB 3TU4B 4J8XD 5F99B 2ZY4A 1TAFB 3AZHB 5GT3A 5CPKB 2CV5A 1P3AB 3AZFC 3REJA 3WA9B 3X1VB 1P3PC 3REHC 5B2IA 2Y2QA 4NE3A 5AV9C 5AVBD 5DNMC 1ZLAB 3MGPB 4Z66A 4Z5TD 5B0ZA 1ULYA 4H9NA 2ZY2A 1U35B 2HIOA 3X1UD 3REKC 5B40C 1P3OA 5BO0A 1AOIA 4R8PA 1P3MB 4NE6A 5DNNB 3UT9B 1P3FB 5E5AC 4Z5TC 5AVCA 1P3ID 5AV6D 3W97D 3MGSD 1M1AA 5AV5A 2BYMB 5KDMA 3X1UC 5GT3D 5BS7A 4DQYB 3LZ1A 5FUGA 1HQ3A 3REJD 1ID3D 3X1SA 4WU9A 5GT0A 1KX4C 5JRGA 3A6NA 5B2ID 4H9RA 3MNNB 4KGCA 3TU4A 5F99A 2L5AA 2RVQC 5CPKA 4Z66D 1P3AA 5B0ZD 5B31B 3KFUG 3C1BC 3WA9A 3X1VA 4H9QB 1P3BA 1BH9B 4CSRB 2HIOD 3EPLA 5B1MC 1ID3C 3WTPD 2JCHA 4X23B 1P3OD 1ZLAA 3MGPA 5AY8D 2NQBD 4NE5A 4R8PD 3AFAB 5B33D 3LZ0A 5CPJB 1U35A 3VH6T 5AVCD 1TZYC 3RELC 4KHAB 1M1AD 3B6GD 5AV5D 5B1LC 4YM6C 1P3MA 5CPIB 3WTPC 3UT9A 5JA4B 1S32A 3LZ1D 3KWQA 2JSSA 4UPKA 3AYWB 1HQ3D 3MGQB 5AY8C 5GT0D 5B32A 3W98A 3A6ND 5B33C 2W8SA 3B6FA 4KGCD 2BYMA 3TU4D 5F99D 5B0YB 3AZHD 1P3AD 1B67A 5CPKD 4QLCB 5BT1C 3B6GC 3UTBA 3X1VD 5C3IC 3WA9D 1KX3B 4WNNB 3LJAC 1T3UA 4Z2MH 3A1IA 1ZLAD 4UUZA 3MGPD 3AZKA 3AZGB 1JFIB 5B31A 3AZHC 3WKJA 1U35D 1BH9A 1KX5B 1EQZC 1F66B 4H9SA 4X23A 4AWLB 5B32G 2Y2NA 3KXBC 3AV2C 1P3MD 5DNND 5GSUB 3UT9D 1P3FD 4YS3B 5CPJA 5BNXB 1PZRA 2CV5B 3NQJB 3AZNC 1P3GC 2HUEB 5JA4A 1Q9CA 3MGQA 5DNNC 3AZMC 1A7WA 1P3FC 3MNND 3REIA 5B0YA 3C1CA 4KUDC 3AZLC 5BO0B 1P3KA 5B31D 2ZY3A 1AOIB 5GXQC 3WAAA 1KX3A 4X23D 4LD9A 3AZJB 4WU8C 3MNNC 3AZGA 4J8WC 3AN2C 3AFAD 1JFIA 4JJNB 5CPJD 4G91B 2F8NH 3W99B 1KX5A 2AROB 3X1SB 4WU9B 1M19B 5JRGB 3LELC 5CPID 4WJ3C 5GSUA 2F8NK 4CAYA 4G92B 3AYWD 5BNXA 4YS3A 1P34C 3MGQD 3KUYC 3NQJA 4XZQB 3AFAC 4ZUXB 1P3BB 4J8VB 5B0YD 3EPJA 3MVDC 4QLCD 5CPIC 4J8XC 1KX3D 2FFFB 3AYWC 3LZ0B 4M6BA 3AZGD 1KX5D 5AVBC 1S32B 4QLCC 3KWQB 1F66D 5B32B 3AZJA 3B6FB 5GSUD 4JJNA 4YS3D 3W99A 3F6TA 4HGAC 2CV5D 2AROA 2UWXA 2IO5B 3UTBB 1M19A 3W98B 2FJ7B 3O62B 1F66C 1BH8B 4ZBJB 3UTAB 3R45A 4UUZB 1P3IC 3AZIA 5AV6C 3AZKB 3W97C 3MGSC 4XZQA 4XUJB 3WKJB 4ZUXA 5GT3C 2CV5C 3MGRA 4J8VA 3REJC 2Y2JA 5B2IC 1AOID 5B24B 4Z2MG 5CP6B 3B0DB 3AZEB 4Z66C 5AV8B 5B0ZC 3AZJD 4JJND 2HIOC 3W99D 3VH6W 1P3OC 2AROD 4J8UB 2PYOB 2NQBC 3X1SD 4WU9D 4R8PC 1AOIC 3EG5B 5JRGD 1M19D 5B2JB 3REIB 3C1CB 5AVCC 1M1AC 5AV5C 4XZQD 3AZFB 3W96A 1P3KB 2F8NA 4ZUXD 1P3BD 5BS7C 3O62A 1HTAA 1BH8A 3LZ1C 3REHB 2FJ7A 4J8VD 1HQ3C 3UTAA 3X1SC 4WU9C 3VH5T 3B0CT 5GT0C 5AV9B 4LD9B 2YFWA 3A6NC 5DNMB 4KGCC 4XUJA 3TU4C 5F99C 3VH5W 3B0CW 3LZ0D 2BYKB 1P3AC 5CPKC 2NZDA 3AV1A 3WA9C 3X1VC 2LY8A 3REKB 5B40B 1P3BC
chains in the Genus database with same CATH topology
5B24A 5GXQA 2BG1A 1P3LA 1S32D 4CAYB 5CP6A 3KWQD 2DF4C 1ZLAC 3MGPC 5E5AB 3AZEA 5B32D 5AV8A 3LZ0C 2F8NG 1U35C 3B6FD 3AN2A 1M18A 3NQUB 3X1TA 3X1UB 4J8UA 2PYOA 2G5HC 3UTBD 2JE5A 4DRBA 1P3MC 3W98D 2FJ7D 3O62D 3UT9C 1S32C 1KX4B 5B2JA 3KWQC 3UTAD 1N1JB 5B32C 3AZKD 3B6FC 4XUJD 3AZFA 2Y2MA 3C1BB 3WKJD 2DQNC 1P3PA 3REHA 5B1MB 5G49B 5AV9A 3UTBC 2Y2IA 5DNMA 5B24D 3V9RB 5CP6D 3H0RC 2BYKA 3AZED 3AZKC 5AV8D 5B31C 1TZYB 3REKA 5B40A 3RELB 3WKJC 4H9SC 5B1LB 2Y2OA 4YM6B 3R45B 4X23C 4J8UD 2PYOD 5E5AA 3AZIB 5AY8B 4Z5TA 2J8PA 5B2JD 5CPJC 3REID 1F1EA 3MGRB 3C1CD 3NQUA 4H9OA 4H9PA 3X1UA 1P3KD 2Y2PA 3AZFD 3WAAD 5C3IB 1BFMA 1KX4A 3REHD 3MGQC 1N1JA 3LJAB 5AV9D 4LD9D 1H3OB 5DNMD 1P3IA 5BNVB 5B0YC 3C1CC 3C1BA 1EQZB 1P3KC 5B1MA 5G49A 1ID3A 3REKD 3WAAC 5B40D 1KX3C 1W2EA 3KXBB 3AV2B 3V9RA 4LD9C 1KU5A 5E5AD 3AZGC 3W96B 3AZNB 2F8NB 1TZYA 3RELA 4NFTA 1KX5C 1P3GB 5B1LA 2G5IC 4YM6A 3WTPA 4E45A 2VQRA 4AWLC 2YFWB 4EO5B 5AY8A 3EPKA 2NQBA 5GSUC 1KX4D 3AZMB 1WWSA 4YS3C 4WV4B 5B33A 2NZDB 1B6WA 4DRAA 3AV1B 2Y2KA 2RVQD 2XD1A 2XD5A 4KUDB 2HUEC 3AZLB 3B6GA 3WTPE 3C1BD 5GXQB 1P3LB 3LJAA 5B1MD 1H3OA 5BNVA 3P5JB 4WU8B 4J8WB 3AN2B 1M18B 1TAFA 3AZHA 3X1TB 3WAAB 1EQZA 1TZYD 3RELD 2YFVB 3VH6A 3A1KA 3H0LC 5B1LD 4YM6D 3KXBA 3LELB 3AV2A 3AZJC 1P34B 3AZID 3KUYB 4JJNC 3AZNA 2Y2GA 4G91C 3W99C 1P3PB 1P3GA 3MGRD 2AROC 1M19C 5JRGC 3MVDB 5BT1D 5DNNA 3AZMA 3FDDA 4J8XB 4G92C 1P3FA 3AZIC 3LJAD 2F2AC 4XZQC 4ZUXC 3EPHA 3VH5A 4KUDA 3AZLA 3MGRC 4J8VC 1EQZD 5AVBB 2ZY5A 4Z5TB 4WZSB 4WU8A 3MNNA 3KXBD 3AV2D 4J8WA 4H9OB 4H9PB 4HGAB 5CHLB 3IP4C 3AZND 2F8ND 3W96D 2YFVA 4H9QA 1P3GD 4CSRA 3LELA 3AL0C 1P34A 1P3IB 5AV6B 3KUYA 3W97B 3MGSB 3AZMD 3AFAA 2Y2HA 2NZDD 1R4VA 5GT3B 2IO5C 3AV1D 3W96C 3REJB 1ID3B 3W98C 3MVDA 3O62C 2FJ7C 4KHAA 3AZLD 4KUDD 4ZBJC 5B2IB 3UTAC 5GXQD 5CPIA 1P3LD 4J8XA 3AYWA 4EO5C 4Z66B 4XUJC 3B0BA 5B0ZB 4H9NB 5B31G 4WU8D 2NZDC 4J8WD 3AN2D 1M18D 2HIOB 3AV1C 3X1TD 3H0MC 3WTPB 1P3OB 5AVBA 4QLCA 1Z2CB 2RIQA 5B24C 2NQBB 4R8PB 1P3LC 2Y2LA 4E44A 5CP6C 2CWEA 4WNNA 3B0DC 5B33B 3LELD 3AZEC 5AV8C 1WWIA 1P34D 5AVCB 3KUYD 1M1AB 3B6GB 3KSYA 5AV5B 1M18C 3X1TC 5KDMB 1P3PD 1F66A 4J8UC 2PYOC 3LZ1B 5FUGB 1HQ3B 5GT0B 3MVDD 2ZM5A 5B2JC 3A6NB 3REIC 4H9RB 5AV6A 3W97A 3MGSA 4KGCB 3TU4B 4J8XD 5F99B 2ZY4A 1TAFB 3AZHB 5GT3A 5CPKB 2CV5A 1P3AB 3AZFC 3REJA 3WA9B 3X1VB 1P3PC 3REHC 5B2IA 2Y2QA 4NE3A 5AV9C 5AVBD 5DNMC 1ZLAB 3MGPB 4Z66A 4Z5TD 5B0ZA 1ULYA 4H9NA 2ZY2A 1U35B 2HIOA 3X1UD 3REKC 5B40C 1P3OA 5BO0A 1AOIA 4R8PA 1P3MB 4NE6A 5DNNB 3UT9B 1P3FB 5E5AC 4Z5TC 5AVCA 1P3ID 5AV6D 3W97D 3MGSD 1M1AA 5AV5A 2BYMB 5KDMA 3X1UC 5GT3D 5BS7A 4DQYB 3LZ1A 5FUGA 1HQ3A 3REJD 1ID3D 3X1SA 4WU9A 5GT0A 1KX4C 5JRGA 3A6NA 5B2ID 4H9RA 3MNNB 4KGCA 3TU4A 5F99A 2L5AA 2RVQC 5CPKA 4Z66D 1P3AA 5B0ZD 5B31B 3KFUG 3C1BC 3WA9A 3X1VA 4H9QB 1P3BA 1BH9B 4CSRB 2HIOD 3EPLA 5B1MC 1ID3C 3WTPD 2JCHA 4X23B 1P3OD 1ZLAA 3MGPA 5AY8D 2NQBD 4NE5A 4R8PD 3AFAB 5B33D 3LZ0A 5CPJB 1U35A 3VH6T 5AVCD 1TZYC 3RELC 4KHAB 1M1AD 3B6GD 5AV5D 5B1LC 4YM6C 1P3MA 5CPIB 3WTPC 3UT9A 5JA4B 1S32A 3LZ1D 3KWQA 2JSSA 4UPKA 3AYWB 1HQ3D 3MGQB 5AY8C 5GT0D 5B32A 3W98A 3A6ND 5B33C 2W8SA 3B6FA 4KGCD 2BYMA 3TU4D 5F99D 5B0YB 3AZHD 1P3AD 1B67A 5CPKD 4QLCB 5BT1C 3B6GC 3UTBA 3X1VD 5C3IC 3WA9D 1KX3B 4WNNB 3LJAC 1T3UA 4Z2MH 3A1IA 1ZLAD 4UUZA 3MGPD 3AZKA 3AZGB 1JFIB 5B31A 3AZHC 3WKJA 1U35D 1BH9A 1KX5B 1EQZC 1F66B 4H9SA 4X23A 4AWLB 5B32G 2Y2NA 3KXBC 3AV2C 1P3MD 5DNND 5GSUB 3UT9D 1P3FD 4YS3B 5CPJA 5BNXB 1PZRA 2CV5B 3NQJB 3AZNC 1P3GC 2HUEB 5JA4A 1Q9CA 3MGQA 5DNNC 3AZMC 1A7WA 1P3FC 3MNND 3REIA 5B0YA 3C1CA 4KUDC 3AZLC 5BO0B 1P3KA 5B31D 2ZY3A 1AOIB 5GXQC 3WAAA 1KX3A 4X23D 4LD9A 3AZJB 4WU8C 3MNNC 3AZGA 4J8WC 3AN2C 3AFAD 1JFIA 4JJNB 5CPJD 4G91B 2F8NH 3W99B 1KX5A 2AROB 3X1SB 4WU9B 1M19B 5JRGB 3LELC 5CPID 4WJ3C 5GSUA 2F8NK 4CAYA 4G92B 3AYWD 5BNXA 4YS3A 1P34C 3MGQD 3KUYC 3NQJA 4XZQB 3AFAC 4ZUXB 1P3BB 4J8VB 5B0YD 3EPJA 3MVDC 4QLCD 5CPIC 4J8XC 1KX3D 2FFFB 3AYWC 3LZ0B 4M6BA 3AZGD 1KX5D 5AVBC 1S32B 4QLCC 3KWQB 1F66D 5B32B 3AZJA 3B6FB 5GSUD 4JJNA 4YS3D 3W99A 3F6TA 4HGAC 2CV5D 2AROA 2UWXA 2IO5B 3UTBB 1M19A 3W98B 2FJ7B 3O62B 1F66C 1BH8B 4ZBJB 3UTAB 3R45A 4UUZB 1P3IC 3AZIA 5AV6C 3AZKB 3W97C 3MGSC 4XZQA 4XUJB 3WKJB 4ZUXA 5GT3C 2CV5C 3MGRA 4J8VA 3REJC 2Y2JA 5B2IC 1AOID 5B24B 4Z2MG 5CP6B 3B0DB 3AZEB 4Z66C 5AV8B 5B0ZC 3AZJD 4JJND 2HIOC 3W99D 3VH6W 1P3OC 2AROD 4J8UB 2PYOB 2NQBC 3X1SD 4WU9D 4R8PC 1AOIC 3EG5B 5JRGD 1M19D 5B2JB 3REIB 3C1CB 5AVCC 1M1AC 5AV5C 4XZQD 3AZFB 3W96A 1P3KB 2F8NA 4ZUXD 1P3BD 5BS7C 3O62A 1HTAA 1BH8A 3LZ1C 3REHB 2FJ7A 4J8VD 1HQ3C 3UTAA 3X1SC 4WU9C 3VH5T 3B0CT 5GT0C 5AV9B 4LD9B 2YFWA 3A6NC 5DNMB 4KGCC 4XUJA 3TU4C 5F99C 3VH5W 3B0CW 3LZ0D 2BYKB 1P3AC 5CPKC 2NZDA 3AV1A 3WA9C 3X1VC 2LY8A 3REKB 5B40B 1P3BC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5B24 A;  5GXQ A;  1P3L A;  1S32 D;  4CAY B;  5CP6 A;  3KWQ D;  1ZLA C;  3MGP C;  5E5A B;  3AZE A;  5B32 D;  5AV8 A;  3LZ0 C;  2F8N G;  1U35 C;  3B6F D;  3AN2 A;  1M18 A;  3NQU B;  3X1T A;  3X1U B;  4J8U A;  2PYO A;  3UTB D;  4DRB A;  1P3M C;  3W98 D;  2FJ7 D;  3O62 D;  3UT9 C;  1S32 C;  1KX4 B;  5B2J A;  3KWQ C;  3UTA D;  1N1J B;  5B32 C;  3AZK D;  3B6F C;  4XUJ D;  3AZF A;  3C1B B;  3WKJ D;  1P3P A;  3REH A;  5B1M B;  5G49 B;  5AV9 A;  3UTB C;  5DNM A;  5B24 D;  3V9R B;  5CP6 D;  2BYK A;  3AZE D;  3AZK C;  5AV8 D;  5B31 C;  1TZY B;  3REK A;  5B40 A;  3REL B;  3WKJ C;  4H9S C;  5B1L B;  4YM6 B;  3R45 B;  4X23 C;  4J8U D;  2PYO D;  5E5A A;  3AZI B;  5AY8 B;  4Z5T A;  5B2J D;  5CPJ C;  3REI D;  1F1E A;  3MGR B;  3C1C D;  3NQU A;  4H9O A;  4H9P A;  3X1U A;  1P3K D;  3AZF D;  3WAA D;  5C3I B;  1BFM A;  1KX4 A;  3REH D;  3MGQ C;  1N1J A;  3LJA B;  5AV9 D;  4LD9 D;  1H3O B;  5DNM D;  1P3I A;  5BNV B;  5B0Y C;  3C1C C;  3C1B A;  1EQZ B;  1P3K C;  5B1M A;  5G49 A;  1ID3 A;  3REK D;  3WAA C;  5B40 D;  1KX3 C;  3KXB B;  3AV2 B;  3V9R A;  4LD9 C;  1KU5 A;  5E5A D;  3AZG C;  3W96 B;  3AZN B;  2F8N B;  1TZY A;  3REL A;  4NFT A;  1KX5 C;  1P3G B;  5B1L A;  4YM6 A;  3WTP A;  4E45 A;  4AWL C;  2YFW B;  4EO5 B;  5AY8 A;  2NQB A;  5GSU C;  1KX4 D;  3AZM B;  1WWS A;  4YS3 C;  4WV4 B;  5B33 A;  2NZD B;  1B6W A;  4DRA A;  3AV1 B;  2RVQ D;  4KUD B;  2HUE C;  3AZL B;  3B6G A;  3WTP E;  3C1B D;  5GXQ B;  1P3L B;  3LJA A;  5B1M D;  1H3O A;  5BNV A;  4WU8 B;  4J8W B;  3AN2 B;  1M18 B;  1TAF A;  3AZH A;  3X1T B;  3WAA B;  1EQZ A;  1TZY D;  3REL D;  2YFV B;  3VH6 A;  5B1L D;  3LEL B;  4YM6 D;  3KXB A;  3AV2 A;  3AZJ C;  1P34 B;  3AZI D;  3KUY B;  4JJN C;  3AZN A;  4G91 C;  3W99 C;  1P3P B;  1P3G A;  3MGR D;  2ARO C;  1M19 C;  5JRG C;  3MVD B;  5BT1 D;  5DNN A;  3AZM A;  4G92 C;  4J8X B;  1P3F A;  3AZI C;  3LJA D;  4XZQ C;  4ZUX C;  3VH5 A;  4KUD A;  3AZL A;  3MGR C;  4J8V C;  1EQZ D;  5AVB B;  4Z5T B;  4WZS B;  4WU8 A;  3MNN A;  3KXB D;  3AV2 D;  4J8W A;  4H9O B;  4H9P B;  4HGA B;  5CHL B;  3W96 D;  3AZN D;  2F8N D;  2YFV A;  4H9Q A;  1P3G D;  4CSR A;  3LEL A;  1P34 A;  1P3I B;  5AV6 B;  3KUY A;  3W97 B;  3MGS B;  3AZM D;  3AFA A;  2NZD D;  1R4V A;  5GT3 B;  2IO5 C;  3AV1 D;  3W96 C;  3REJ B;  1ID3 B;  3W98 C;  3MVD A;  3O62 C;  2FJ7 C;  4KHA A;  3AZL D;  4KUD D;  4ZBJ C;  5B2I B;  3UTA C;  5GXQ D;  5CPI A;  1P3L D;  4J8X A;  3AYW A;  4EO5 C;  4Z66 B;  4XUJ C;  3B0B A;  5B0Z B;  4H9N B;  5B31 G;  4WU8 D;  2NZD C;  4J8W D;  3AN2 D;  1M18 D;  2HIO B;  3AV1 C;  3X1T D;  3WTP B;  1P3O B;  5AVB A;  4QLC A;  5B24 C;  2NQB B;  4R8P B;  1P3L C;  4E44 A;  5CP6 C;  2CWE A;  4WNN A;  3B0D C;  5B33 B;  3LEL D;  3AZE C;  5AV8 C;  1WWI A;  1P34 D;  5AVC B;  3KUY D;  1M1A B;  3B6G B;  3KSY A;  5AV5 B;  1M18 C;  3X1T C;  5KDM B;  1P3P D;  1F66 A;  4J8U C;  2PYO C;  3LZ1 B;  5FUG B;  1HQ3 B;  5GT0 B;  3MVD D;  5B2J C;  3A6N B;  3REI C;  4H9R B;  5AV6 A;  3W97 A;  3MGS A;  4KGC B;  3TU4 B;  4J8X D;  5F99 B;  1TAF B;  3AZH B;  5GT3 A;  5CPK B;  2CV5 A;  1P3A B;  3AZF C;  3REJ A;  3WA9 B;  3X1V B;  1P3P C;  3REH C;  5B2I A;  4NE3 A;  5AV9 C;  5AVB D;  5DNM C;  1ZLA B;  3MGP B;  4Z66 A;  4Z5T D;  5B0Z A;  1ULY A;  4H9N A;  1U35 B;  2HIO A;  3X1U D;  3REK C;  5B40 C;  1P3O A;  5BO0 A;  1AOI A;  4R8P A;  1P3M B;  4NE6 A;  5DNN B;  3UT9 B;  1P3F B;  5E5A C;  4Z5T C;  5AVC A;  1P3I D;  5AV6 D;  3W97 D;  3MGS D;  1M1A A;  5AV5 A;  2BYM B;  5KDM A;  3X1U C;  5GT3 D;  5BS7 A;  3LZ1 A;  5FUG A;  1HQ3 A;  3REJ D;  1ID3 D;  3X1S A;  4WU9 A;  5GT0 A;  1KX4 C;  5JRG A;  3A6N A;  5B2I D;  4H9R A;  3MNN B;  4KGC A;  3TU4 A;  5F99 A;  2L5A A;  2RVQ C;  5CPK A;  4Z66 D;  1P3A A;  5B0Z D;  5B31 B;  3C1B C;  3WA9 A;  3X1V A;  4H9Q B;  1P3B A;  1BH9 B;  4CSR B;  2HIO D;  5B1M C;  1ID3 C;  3WTP D;  1P3O D;  4X23 B;  1ZLA A;  3MGP A;  5AY8 D;  2NQB D;  4NE5 A;  4R8P D;  3AFA B;  5B33 D;  3LZ0 A;  5CPJ B;  1U35 A;  3VH6 T;  5AVC D;  1TZY C;  3REL C;  4KHA B;  1M1A D;  3B6G D;  5AV5 D;  5B1L C;  4YM6 C;  1P3M A;  5CPI B;  3WTP C;  3UT9 A;  5JA4 B;  1S32 A;  3LZ1 D;  3KWQ A;  2JSS A;  3AYW B;  1HQ3 D;  3MGQ B;  5AY8 C;  5GT0 D;  5B32 A;  3W98 A;  3A6N D;  5B33 C;  4KGC D;  3B6F A;  2BYM A;  3TU4 D;  5F99 D;  5B0Y B;  3AZH D;  1P3A D;  1B67 A;  5CPK D;  4QLC B;  5BT1 C;  3B6G C;  3UTB A;  3X1V D;  5C3I C;  3WA9 D;  1KX3 B;  4WNN B;  3LJA C;  4Z2M H;  1ZLA D;  4UUZ A;  3MGP D;  3AZK A;  3AZG B;  1JFI B;  5B31 A;  3AZH C;  3WKJ A;  1U35 D;  1BH9 A;  1KX5 B;  1EQZ C;  1F66 B;  4H9S A;  4X23 A;  4AWL B;  5B32 G;  3KXB C;  3AV2 C;  1P3M D;  5DNN D;  5GSU B;  3UT9 D;  1P3F D;  4YS3 B;  5CPJ A;  5BNX B;  2CV5 B;  3NQJ B;  3AZN C;  1P3G C;  2HUE B;  5JA4 A;  1Q9C A;  3MGQ A;  5DNN C;  3AZM C;  1A7W A;  1P3F C;  3MNN D;  3REI A;  5B0Y A;  3C1C A;  4KUD C;  3AZL C;  5BO0 B;  1P3K A;  5B31 D;  1AOI B;  5GXQ C;  3WAA A;  1KX3 A;  4X23 D;  4LD9 A;  3AZJ B;  4WU8 C;  3MNN C;  3AZG A;  4J8W C;  3AN2 C;  3AFA D;  1JFI A;  4JJN B;  5CPJ D;  4G91 B;  2F8N H;  3W99 B;  1KX5 A;  2ARO B;  3X1S B;  4WU9 B;  1M19 B;  5JRG B;  3LEL C;  5CPI D;  5GSU A;  2F8N K;  4CAY A;  4G92 B;  3AYW D;  5BNX A;  4YS3 A;  1P34 C;  3MGQ D;  3KUY C;  3NQJ A;  4XZQ B;  3AFA C;  4ZUX B;  1P3B B;  4J8V B;  5B0Y D;  3MVD C;  4QLC D;  5CPI C;  4J8X C;  1KX3 D;  3AYW C;  3LZ0 B;  4M6B A;  3AZG D;  1KX5 D;  5AVB C;  1S32 B;  4QLC C;  3KWQ B;  1F66 D;  5B32 B;  3AZJ A;  3B6F B;  5GSU D;  4JJN A;  4YS3 D;  3W99 A;  4HGA C;  2CV5 D;  2ARO A;  2IO5 B;  3UTB B;  1M19 A;  3W98 B;  2FJ7 B;  3O62 B;  1F66 C;  1BH8 B;  4ZBJ B;  3UTA B;  3R45 A;  4UUZ B;  1P3I C;  3AZI A;  5AV6 C;  3AZK B;  3W97 C;  3MGS C;  4XZQ A;  4XUJ B;  3WKJ B;  4ZUX A;  5GT3 C;  2CV5 C;  3MGR A;  4J8V A;  3REJ C;  5B2I C;  1AOI D;  5B24 B;  4Z2M G;  5CP6 B;  3B0D B;  3AZE B;  4Z66 C;  5AV8 B;  5B0Z C;  3AZJ D;  4JJN D;  2HIO C;  3W99 D;  3VH6 W;  1P3O C;  2ARO D;  4J8U B;  2PYO B;  2NQB C;  3X1S D;  4WU9 D;  4R8P C;  1AOI C;  1M19 D;  5JRG D;  5B2J B;  3REI B;  3C1C B;  5AVC C;  1M1A C;  5AV5 C;  4XZQ D;  3AZF B;  3W96 A;  1P3K B;  2F8N A;  4ZUX D;  1P3B D;  5BS7 C;  3O62 A;  1HTA A;  1BH8 A;  3LZ1 C;  3REH B;  2FJ7 A;  4J8V D;  1HQ3 C;  3UTA A;  3X1S C;  4WU9 C;  3VH5 T;  3B0C T;  5GT0 C;  5AV9 B;  4LD9 B;  2YFW A;  3A6N C;  5DNM B;  4KGC C;  4XUJ A;  3TU4 C;  5F99 C;  3VH5 W;  3B0C W;  3LZ0 D;  2BYK B;  1P3A C;  5CPK C;  2NZD A;  3AV1 A;  3WA9 C;  3X1V C;  2LY8 A;  3REK B;  5B40 B;  1P3B C; 
#chains in the Genus database with same CATH topology
 5B24 A;  5GXQ A;  2BG1 A;  1P3L A;  1S32 D;  4CAY B;  5CP6 A;  3KWQ D;  2DF4 C;  1ZLA C;  3MGP C;  5E5A B;  3AZE A;  5B32 D;  5AV8 A;  3LZ0 C;  2F8N G;  1U35 C;  3B6F D;  3AN2 A;  1M18 A;  3NQU B;  3X1T A;  3X1U B;  4J8U A;  2PYO A;  2G5H C;  3UTB D;  2JE5 A;  4DRB A;  1P3M C;  3W98 D;  2FJ7 D;  3O62 D;  3UT9 C;  1S32 C;  1KX4 B;  5B2J A;  3KWQ C;  3UTA D;  1N1J B;  5B32 C;  3AZK D;  3B6F C;  4XUJ D;  3AZF A;  2Y2M A;  3C1B B;  3WKJ D;  2DQN C;  1P3P A;  3REH A;  5B1M B;  5G49 B;  5AV9 A;  3UTB C;  2Y2I A;  5DNM A;  5B24 D;  3V9R B;  5CP6 D;  3H0R C;  2BYK A;  3AZE D;  3AZK C;  5AV8 D;  5B31 C;  1TZY B;  3REK A;  5B40 A;  3REL B;  3WKJ C;  4H9S C;  5B1L B;  2Y2O A;  4YM6 B;  3R45 B;  4X23 C;  4J8U D;  2PYO D;  5E5A A;  3AZI B;  5AY8 B;  4Z5T A;  2J8P A;  5B2J D;  5CPJ C;  3REI D;  1F1E A;  3MGR B;  3C1C D;  3NQU A;  4H9O A;  4H9P A;  3X1U A;  1P3K D;  2Y2P A;  3AZF D;  3WAA D;  5C3I B;  1BFM A;  1KX4 A;  3REH D;  3MGQ C;  1N1J A;  3LJA B;  5AV9 D;  4LD9 D;  1H3O B;  5DNM D;  1P3I A;  5BNV B;  5B0Y C;  3C1C C;  3C1B A;  1EQZ B;  1P3K C;  5B1M A;  5G49 A;  1ID3 A;  3REK D;  3WAA C;  5B40 D;  1KX3 C;  1W2E A;  3KXB B;  3AV2 B;  3V9R A;  4LD9 C;  1KU5 A;  5E5A D;  3AZG C;  3W96 B;  3AZN B;  2F8N B;  1TZY A;  3REL A;  4NFT A;  1KX5 C;  1P3G B;  5B1L A;  2G5I C;  4YM6 A;  3WTP A;  4E45 A;  2VQR A;  4AWL C;  2YFW B;  4EO5 B;  5AY8 A;  3EPK A;  2NQB A;  5GSU C;  1KX4 D;  3AZM B;  1WWS A;  4YS3 C;  4WV4 B;  5B33 A;  2NZD B;  1B6W A;  4DRA A;  3AV1 B;  2Y2K A;  2RVQ D;  2XD1 A;  2XD5 A;  4KUD B;  2HUE C;  3AZL B;  3B6G A;  3WTP E;  3C1B D;  5GXQ B;  1P3L B;  3LJA A;  5B1M D;  1H3O A;  5BNV A;  3P5J B;  4WU8 B;  4J8W B;  3AN2 B;  1M18 B;  1TAF A;  3AZH A;  3X1T B;  3WAA B;  1EQZ A;  1TZY D;  3REL D;  2YFV B;  3VH6 A;  3A1K A;  3H0L C;  5B1L D;  4YM6 D;  3KXB A;  3LEL B;  3AV2 A;  3AZJ C;  1P34 B;  3AZI D;  3KUY B;  4JJN C;  3AZN A;  2Y2G A;  4G91 C;  3W99 C;  1P3P B;  1P3G A;  3MGR D;  2ARO C;  1M19 C;  5JRG C;  3MVD B;  5BT1 D;  5DNN A;  3AZM A;  3FDD A;  4J8X B;  4G92 C;  1P3F A;  3AZI C;  3LJA D;  2F2A C;  4XZQ C;  4ZUX C;  3EPH A;  3VH5 A;  4KUD A;  3AZL A;  3MGR C;  4J8V C;  1EQZ D;  5AVB B;  2ZY5 A;  4Z5T B;  4WZS B;  4WU8 A;  3MNN A;  3KXB D;  3AV2 D;  4J8W A;  4H9O B;  4H9P B;  4HGA B;  5CHL B;  3IP4 C;  3AZN D;  2F8N D;  3W96 D;  2YFV A;  4H9Q A;  1P3G D;  4CSR A;  3LEL A;  3AL0 C;  1P34 A;  1P3I B;  5AV6 B;  3KUY A;  3W97 B;  3MGS B;  3AZM D;  3AFA A;  2Y2H A;  2NZD D;  1R4V A;  5GT3 B;  2IO5 C;  3AV1 D;  3W96 C;  3REJ B;  1ID3 B;  3W98 C;  3MVD A;  3O62 C;  2FJ7 C;  4KHA A;  3AZL D;  4KUD D;  4ZBJ C;  5B2I B;  3UTA C;  5GXQ D;  5CPI A;  1P3L D;  4J8X A;  3AYW A;  4EO5 C;  4Z66 B;  4XUJ C;  3B0B A;  5B0Z B;  4H9N B;  5B31 G;  4WU8 D;  2NZD C;  4J8W D;  3AN2 D;  1M18 D;  2HIO B;  3AV1 C;  3X1T D;  3H0M C;  3WTP B;  1P3O B;  5AVB A;  4QLC A;  1Z2C B;  2RIQ A;  5B24 C;  2NQB B;  4R8P B;  1P3L C;  2Y2L A;  4E44 A;  5CP6 C;  2CWE A;  4WNN A;  3B0D C;  5B33 B;  3LEL D;  3AZE C;  5AV8 C;  1WWI A;  1P34 D;  5AVC B;  3KUY D;  1M1A B;  3B6G B;  3KSY A;  5AV5 B;  1M18 C;  3X1T C;  5KDM B;  1P3P D;  1F66 A;  4J8U C;  2PYO C;  3LZ1 B;  5FUG B;  1HQ3 B;  5GT0 B;  3MVD D;  2ZM5 A;  5B2J C;  3A6N B;  3REI C;  4H9R B;  5AV6 A;  3W97 A;  3MGS A;  4KGC B;  3TU4 B;  4J8X D;  5F99 B;  2ZY4 A;  1TAF B;  3AZH B;  5GT3 A;  5CPK B;  2CV5 A;  1P3A B;  3AZF C;  3REJ A;  3WA9 B;  3X1V B;  1P3P C;  3REH C;  5B2I A;  2Y2Q A;  4NE3 A;  5AV9 C;  5AVB D;  5DNM C;  1ZLA B;  3MGP B;  4Z66 A;  4Z5T D;  5B0Z A;  1ULY A;  4H9N A;  2ZY2 A;  1U35 B;  2HIO A;  3X1U D;  3REK C;  5B40 C;  1P3O A;  5BO0 A;  1AOI A;  4R8P A;  1P3M B;  4NE6 A;  5DNN B;  3UT9 B;  1P3F B;  5E5A C;  4Z5T C;  5AVC A;  1P3I D;  5AV6 D;  3W97 D;  3MGS D;  1M1A A;  5AV5 A;  2BYM B;  5KDM A;  3X1U C;  5GT3 D;  5BS7 A;  4DQY B;  3LZ1 A;  5FUG A;  1HQ3 A;  3REJ D;  1ID3 D;  3X1S A;  4WU9 A;  5GT0 A;  1KX4 C;  5JRG A;  3A6N A;  5B2I D;  4H9R A;  3MNN B;  4KGC A;  3TU4 A;  5F99 A;  2L5A A;  2RVQ C;  5CPK A;  4Z66 D;  1P3A A;  5B0Z D;  5B31 B;  3KFU G;  3C1B C;  3WA9 A;  3X1V A;  4H9Q B;  1P3B A;  1BH9 B;  4CSR B;  2HIO D;  3EPL A;  5B1M C;  1ID3 C;  3WTP D;  2JCH A;  4X23 B;  1P3O D;  1ZLA A;  3MGP A;  5AY8 D;  2NQB D;  4NE5 A;  4R8P D;  3AFA B;  5B33 D;  3LZ0 A;  5CPJ B;  1U35 A;  3VH6 T;  5AVC D;  1TZY C;  3REL C;  4KHA B;  1M1A D;  3B6G D;  5AV5 D;  5B1L C;  4YM6 C;  1P3M A;  5CPI B;  3WTP C;  3UT9 A;  5JA4 B;  1S32 A;  3LZ1 D;  3KWQ A;  2JSS A;  4UPK A;  3AYW B;  1HQ3 D;  3MGQ B;  5AY8 C;  5GT0 D;  5B32 A;  3W98 A;  3A6N D;  5B33 C;  2W8S A;  3B6F A;  4KGC D;  2BYM A;  3TU4 D;  5F99 D;  5B0Y B;  3AZH D;  1P3A D;  1B67 A;  5CPK D;  4QLC B;  5BT1 C;  3B6G C;  3UTB A;  3X1V D;  5C3I C;  3WA9 D;  1KX3 B;  4WNN B;  3LJA C;  1T3U A;  4Z2M H;  3A1I A;  1ZLA D;  4UUZ A;  3MGP D;  3AZK A;  3AZG B;  1JFI B;  5B31 A;  3AZH C;  3WKJ A;  1U35 D;  1BH9 A;  1KX5 B;  1EQZ C;  1F66 B;  4H9S A;  4X23 A;  4AWL B;  5B32 G;  2Y2N A;  3KXB C;  3AV2 C;  1P3M D;  5DNN D;  5GSU B;  3UT9 D;  1P3F D;  4YS3 B;  5CPJ A;  5BNX B;  1PZR A;  2CV5 B;  3NQJ B;  3AZN C;  1P3G C;  2HUE B;  5JA4 A;  1Q9C A;  3MGQ A;  5DNN C;  3AZM C;  1A7W A;  1P3F C;  3MNN D;  3REI A;  5B0Y A;  3C1C A;  4KUD C;  3AZL C;  5BO0 B;  1P3K A;  5B31 D;  2ZY3 A;  1AOI B;  5GXQ C;  3WAA A;  1KX3 A;  4X23 D;  4LD9 A;  3AZJ B;  4WU8 C;  3MNN C;  3AZG A;  4J8W C;  3AN2 C;  3AFA D;  1JFI A;  4JJN B;  5CPJ D;  4G91 B;  2F8N H;  3W99 B;  1KX5 A;  2ARO B;  3X1S B;  4WU9 B;  1M19 B;  5JRG B;  3LEL C;  5CPI D;  4WJ3 C;  5GSU A;  2F8N K;  4CAY A;  4G92 B;  3AYW D;  5BNX A;  4YS3 A;  1P34 C;  3MGQ D;  3KUY C;  3NQJ A;  4XZQ B;  3AFA C;  4ZUX B;  1P3B B;  4J8V B;  5B0Y D;  3EPJ A;  3MVD C;  4QLC D;  5CPI C;  4J8X C;  1KX3 D;  2FFF B;  3AYW C;  3LZ0 B;  4M6B A;  3AZG D;  1KX5 D;  5AVB C;  1S32 B;  4QLC C;  3KWQ B;  1F66 D;  5B32 B;  3AZJ A;  3B6F B;  5GSU D;  4JJN A;  4YS3 D;  3W99 A;  3F6T A;  4HGA C;  2CV5 D;  2ARO A;  2UWX A;  2IO5 B;  3UTB B;  1M19 A;  3W98 B;  2FJ7 B;  3O62 B;  1F66 C;  1BH8 B;  4ZBJ B;  3UTA B;  3R45 A;  4UUZ B;  1P3I C;  3AZI A;  5AV6 C;  3AZK B;  3W97 C;  3MGS C;  4XZQ A;  4XUJ B;  3WKJ B;  4ZUX A;  5GT3 C;  2CV5 C;  3MGR A;  4J8V A;  3REJ C;  2Y2J A;  5B2I C;  1AOI D;  5B24 B;  4Z2M G;  5CP6 B;  3B0D B;  3AZE B;  4Z66 C;  5AV8 B;  5B0Z C;  3AZJ D;  4JJN D;  2HIO C;  3W99 D;  3VH6 W;  1P3O C;  2ARO D;  4J8U B;  2PYO B;  2NQB C;  3X1S D;  4WU9 D;  4R8P C;  1AOI C;  3EG5 B;  5JRG D;  1M19 D;  5B2J B;  3REI B;  3C1C B;  5AVC C;  1M1A C;  5AV5 C;  4XZQ D;  3AZF B;  3W96 A;  1P3K B;  2F8N A;  4ZUX D;  1P3B D;  5BS7 C;  3O62 A;  1HTA A;  1BH8 A;  3LZ1 C;  3REH B;  2FJ7 A;  4J8V D;  1HQ3 C;  3UTA A;  3X1S C;  4WU9 C;  3VH5 T;  3B0C T;  5GT0 C;  5AV9 B;  4LD9 B;  2YFW A;  3A6N C;  5DNM B;  4KGC C;  4XUJ A;  3TU4 C;  5F99 C;  3VH5 W;  3B0C W;  3LZ0 D;  2BYK B;  1P3A C;  5CPK C;  2NZD A;  3AV1 A;  3WA9 C;  3X1V C;  2LY8 A;  3REK B;  5B40 B;  1P3B C; 
#chains in the Genus database with same CATH homology
 5B24 A;  5GXQ A;  2BG1 A;  1P3L A;  1S32 D;  4CAY B;  5CP6 A;  3KWQ D;  2DF4 C;  1ZLA C;  3MGP C;  5E5A B;  3AZE A;  5B32 D;  5AV8 A;  3LZ0 C;  2F8N G;  1U35 C;  3B6F D;  3AN2 A;  1M18 A;  3NQU B;  3X1T A;  3X1U B;  4J8U A;  2PYO A;  2G5H C;  3UTB D;  2JE5 A;  4DRB A;  1P3M C;  3W98 D;  2FJ7 D;  3O62 D;  3UT9 C;  1S32 C;  1KX4 B;  5B2J A;  3KWQ C;  3UTA D;  1N1J B;  5B32 C;  3AZK D;  3B6F C;  4XUJ D;  3AZF A;  2Y2M A;  3C1B B;  3WKJ D;  2DQN C;  1P3P A;  3REH A;  5B1M B;  5G49 B;  5AV9 A;  3UTB C;  2Y2I A;  5DNM A;  5B24 D;  3V9R B;  5CP6 D;  3H0R C;  2BYK A;  3AZE D;  3AZK C;  5AV8 D;  5B31 C;  1TZY B;  3REK A;  5B40 A;  3REL B;  3WKJ C;  4H9S C;  5B1L B;  2Y2O A;  4YM6 B;  3R45 B;  4X23 C;  4J8U D;  2PYO D;  5E5A A;  3AZI B;  5AY8 B;  4Z5T A;  2J8P A;  5B2J D;  5CPJ C;  3REI D;  1F1E A;  3MGR B;  3C1C D;  3NQU A;  4H9O A;  4H9P A;  3X1U A;  1P3K D;  2Y2P A;  3AZF D;  3WAA D;  5C3I B;  1BFM A;  1KX4 A;  3REH D;  3MGQ C;  1N1J A;  3LJA B;  5AV9 D;  4LD9 D;  1H3O B;  5DNM D;  1P3I A;  5BNV B;  5B0Y C;  3C1C C;  3C1B A;  1EQZ B;  1P3K C;  5B1M A;  5G49 A;  1ID3 A;  3REK D;  3WAA C;  5B40 D;  1KX3 C;  1W2E A;  3KXB B;  3AV2 B;  3V9R A;  4LD9 C;  1KU5 A;  5E5A D;  3AZG C;  3W96 B;  3AZN B;  2F8N B;  1TZY A;  3REL A;  4NFT A;  1KX5 C;  1P3G B;  5B1L A;  2G5I C;  4YM6 A;  3WTP A;  4E45 A;  2VQR A;  4AWL C;  2YFW B;  4EO5 B;  5AY8 A;  3EPK A;  2NQB A;  5GSU C;  1KX4 D;  3AZM B;  1WWS A;  4YS3 C;  4WV4 B;  5B33 A;  2NZD B;  1B6W A;  4DRA A;  3AV1 B;  2Y2K A;  2RVQ D;  2XD1 A;  2XD5 A;  4KUD B;  2HUE C;  3AZL B;  3B6G A;  3WTP E;  3C1B D;  5GXQ B;  1P3L B;  3LJA A;  5B1M D;  1H3O A;  5BNV A;  3P5J B;  4WU8 B;  4J8W B;  3AN2 B;  1M18 B;  1TAF A;  3AZH A;  3X1T B;  3WAA B;  1EQZ A;  1TZY D;  3REL D;  2YFV B;  3VH6 A;  3A1K A;  3H0L C;  5B1L D;  4YM6 D;  3KXB A;  3LEL B;  3AV2 A;  3AZJ C;  1P34 B;  3AZI D;  3KUY B;  4JJN C;  3AZN A;  2Y2G A;  4G91 C;  3W99 C;  1P3P B;  1P3G A;  3MGR D;  2ARO C;  1M19 C;  5JRG C;  3MVD B;  5BT1 D;  5DNN A;  3AZM A;  3FDD A;  4J8X B;  4G92 C;  1P3F A;  3AZI C;  3LJA D;  2F2A C;  4XZQ C;  4ZUX C;  3EPH A;  3VH5 A;  4KUD A;  3AZL A;  3MGR C;  4J8V C;  1EQZ D;  5AVB B;  2ZY5 A;  4Z5T B;  4WZS B;  4WU8 A;  3MNN A;  3KXB D;  3AV2 D;  4J8W A;  4H9O B;  4H9P B;  4HGA B;  5CHL B;  3IP4 C;  3AZN D;  2F8N D;  3W96 D;  2YFV A;  4H9Q A;  1P3G D;  4CSR A;  3LEL A;  3AL0 C;  1P34 A;  1P3I B;  5AV6 B;  3KUY A;  3W97 B;  3MGS B;  3AZM D;  3AFA A;  2Y2H A;  2NZD D;  1R4V A;  5GT3 B;  2IO5 C;  3AV1 D;  3W96 C;  3REJ B;  1ID3 B;  3W98 C;  3MVD A;  3O62 C;  2FJ7 C;  4KHA A;  3AZL D;  4KUD D;  4ZBJ C;  5B2I B;  3UTA C;  5GXQ D;  5CPI A;  1P3L D;  4J8X A;  3AYW A;  4EO5 C;  4Z66 B;  4XUJ C;  3B0B A;  5B0Z B;  4H9N B;  5B31 G;  4WU8 D;  2NZD C;  4J8W D;  3AN2 D;  1M18 D;  2HIO B;  3AV1 C;  3X1T D;  3H0M C;  3WTP B;  1P3O B;  5AVB A;  4QLC A;  1Z2C B;  2RIQ A;  5B24 C;  2NQB B;  4R8P B;  1P3L C;  2Y2L A;  4E44 A;  5CP6 C;  2CWE A;  4WNN A;  3B0D C;  5B33 B;  3LEL D;  3AZE C;  5AV8 C;  1WWI A;  1P34 D;  5AVC B;  3KUY D;  1M1A B;  3B6G B;  3KSY A;  5AV5 B;  1M18 C;  3X1T C;  5KDM B;  1P3P D;  1F66 A;  4J8U C;  2PYO C;  3LZ1 B;  5FUG B;  1HQ3 B;  5GT0 B;  3MVD D;  2ZM5 A;  5B2J C;  3A6N B;  3REI C;  4H9R B;  5AV6 A;  3W97 A;  3MGS A;  4KGC B;  3TU4 B;  4J8X D;  5F99 B;  2ZY4 A;  1TAF B;  3AZH B;  5GT3 A;  5CPK B;  2CV5 A;  1P3A B;  3AZF C;  3REJ A;  3WA9 B;  3X1V B;  1P3P C;  3REH C;  5B2I A;  2Y2Q A;  4NE3 A;  5AV9 C;  5AVB D;  5DNM C;  1ZLA B;  3MGP B;  4Z66 A;  4Z5T D;  5B0Z A;  1ULY A;  4H9N A;  2ZY2 A;  1U35 B;  2HIO A;  3X1U D;  3REK C;  5B40 C;  1P3O A;  5BO0 A;  1AOI A;  4R8P A;  1P3M B;  4NE6 A;  5DNN B;  3UT9 B;  1P3F B;  5E5A C;  4Z5T C;  5AVC A;  1P3I D;  5AV6 D;  3W97 D;  3MGS D;  1M1A A;  5AV5 A;  2BYM B;  5KDM A;  3X1U C;  5GT3 D;  5BS7 A;  4DQY B;  3LZ1 A;  5FUG A;  1HQ3 A;  3REJ D;  1ID3 D;  3X1S A;  4WU9 A;  5GT0 A;  1KX4 C;  5JRG A;  3A6N A;  5B2I D;  4H9R A;  3MNN B;  4KGC A;  3TU4 A;  5F99 A;  2L5A A;  2RVQ C;  5CPK A;  4Z66 D;  1P3A A;  5B0Z D;  5B31 B;  3KFU G;  3C1B C;  3WA9 A;  3X1V A;  4H9Q B;  1P3B A;  1BH9 B;  4CSR B;  2HIO D;  3EPL A;  5B1M C;  1ID3 C;  3WTP D;  2JCH A;  4X23 B;  1P3O D;  1ZLA A;  3MGP A;  5AY8 D;  2NQB D;  4NE5 A;  4R8P D;  3AFA B;  5B33 D;  3LZ0 A;  5CPJ B;  1U35 A;  3VH6 T;  5AVC D;  1TZY C;  3REL C;  4KHA B;  1M1A D;  3B6G D;  5AV5 D;  5B1L C;  4YM6 C;  1P3M A;  5CPI B;  3WTP C;  3UT9 A;  5JA4 B;  1S32 A;  3LZ1 D;  3KWQ A;  2JSS A;  4UPK A;  3AYW B;  1HQ3 D;  3MGQ B;  5AY8 C;  5GT0 D;  5B32 A;  3W98 A;  3A6N D;  5B33 C;  2W8S A;  3B6F A;  4KGC D;  2BYM A;  3TU4 D;  5F99 D;  5B0Y B;  3AZH D;  1P3A D;  1B67 A;  5CPK D;  4QLC B;  5BT1 C;  3B6G C;  3UTB A;  3X1V D;  5C3I C;  3WA9 D;  1KX3 B;  4WNN B;  3LJA C;  1T3U A;  4Z2M H;  3A1I A;  1ZLA D;  4UUZ A;  3MGP D;  3AZK A;  3AZG B;  1JFI B;  5B31 A;  3AZH C;  3WKJ A;  1U35 D;  1BH9 A;  1KX5 B;  1EQZ C;  1F66 B;  4H9S A;  4X23 A;  4AWL B;  5B32 G;  2Y2N A;  3KXB C;  3AV2 C;  1P3M D;  5DNN D;  5GSU B;  3UT9 D;  1P3F D;  4YS3 B;  5CPJ A;  5BNX B;  1PZR A;  2CV5 B;  3NQJ B;  3AZN C;  1P3G C;  2HUE B;  5JA4 A;  1Q9C A;  3MGQ A;  5DNN C;  3AZM C;  1A7W A;  1P3F C;  3MNN D;  3REI A;  5B0Y A;  3C1C A;  4KUD C;  3AZL C;  5BO0 B;  1P3K A;  5B31 D;  2ZY3 A;  1AOI B;  5GXQ C;  3WAA A;  1KX3 A;  4X23 D;  4LD9 A;  3AZJ B;  4WU8 C;  3MNN C;  3AZG A;  4J8W C;  3AN2 C;  3AFA D;  1JFI A;  4JJN B;  5CPJ D;  4G91 B;  2F8N H;  3W99 B;  1KX5 A;  2ARO B;  3X1S B;  4WU9 B;  1M19 B;  5JRG B;  3LEL C;  5CPI D;  4WJ3 C;  5GSU A;  2F8N K;  4CAY A;  4G92 B;  3AYW D;  5BNX A;  4YS3 A;  1P34 C;  3MGQ D;  3KUY C;  3NQJ A;  4XZQ B;  3AFA C;  4ZUX B;  1P3B B;  4J8V B;  5B0Y D;  3EPJ A;  3MVD C;  4QLC D;  5CPI C;  4J8X C;  1KX3 D;  2FFF B;  3AYW C;  3LZ0 B;  4M6B A;  3AZG D;  1KX5 D;  5AVB C;  1S32 B;  4QLC C;  3KWQ B;  1F66 D;  5B32 B;  3AZJ A;  3B6F B;  5GSU D;  4JJN A;  4YS3 D;  3W99 A;  3F6T A;  4HGA C;  2CV5 D;  2ARO A;  2UWX A;  2IO5 B;  3UTB B;  1M19 A;  3W98 B;  2FJ7 B;  3O62 B;  1F66 C;  1BH8 B;  4ZBJ B;  3UTA B;  3R45 A;  4UUZ B;  1P3I C;  3AZI A;  5AV6 C;  3AZK B;  3W97 C;  3MGS C;  4XZQ A;  4XUJ B;  3WKJ B;  4ZUX A;  5GT3 C;  2CV5 C;  3MGR A;  4J8V A;  3REJ C;  2Y2J A;  5B2I C;  1AOI D;  5B24 B;  4Z2M G;  5CP6 B;  3B0D B;  3AZE B;  4Z66 C;  5AV8 B;  5B0Z C;  3AZJ D;  4JJN D;  2HIO C;  3W99 D;  3VH6 W;  1P3O C;  2ARO D;  4J8U B;  2PYO B;  2NQB C;  3X1S D;  4WU9 D;  4R8P C;  1AOI C;  3EG5 B;  5JRG D;  1M19 D;  5B2J B;  3REI B;  3C1C B;  5AVC C;  1M1A C;  5AV5 C;  4XZQ D;  3AZF B;  3W96 A;  1P3K B;  2F8N A;  4ZUX D;  1P3B D;  5BS7 C;  3O62 A;  1HTA A;  1BH8 A;  3LZ1 C;  3REH B;  2FJ7 A;  4J8V D;  1HQ3 C;  3UTA A;  3X1S C;  4WU9 C;  3VH5 T;  3B0C T;  5GT0 C;  5AV9 B;  4LD9 B;  2YFW A;  3A6N C;  5DNM B;  4KGC C;  4XUJ A;  3TU4 C;  5F99 C;  3VH5 W;  3B0C W;  3LZ0 D;  2BYK B;  1P3A C;  5CPK C;  2NZD A;  3AV1 A;  3WA9 C;  3X1V C;  2LY8 A;  3REK B;  5B40 B;  1P3B C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...