4E44A

Crystal structure of the hmhf1/hmhf2 histone-fold tetramer
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
104
structure length
104
Chain Sequence
GSMEEEAETEEQQRFSYQQRLKAAVHYTVGCLCEEVALDKEMQFSKQTIAAISELTFRQCENFAKDLEMFARHAKRTTINTEDVKLLARRSNSLLKYITDKSEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Centromere protein S
publication title Crystal Structures Reveal that FANCM remodels the MHF Tetramer in favor of binding Branched DNA
rcsb
source organism Homo sapiens
molecule tags Dna binding protein
total genus 41
structure length 104
sequence length 104
chains with identical sequence C
ec nomenclature
pdb deposition date 2012-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF15630 CENP-S CENP-S protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4e44A00
5GT3A 3MNND 3KXBA 3UT9D 4R8PD 1EQZA 5B0ZA 4H9NA 2IO5C 4ZBJB 3AZJD 4LD9D 3AYWC 1P3PB 5BO0A 1P34B 5C3IC 5AV9D 5AV5A 3WAAB 3AZLD 1KX3C 3AYWA 5BT1D 4WNNB 3X1TD 2HUEB 3AZNB 1ZLAB 4G91C 1Q9CA 4Z5TC 3B0DB 3AZMB 3KUYD 1AOID 3WA9D 3AZKA 5B1MD 5CP6A 1P3FC 3MGPC 4H9PA 5GT0B 3AZGC 3AZHD 3MGRA 5B31G 5AV6D 5B31D 3UTAC 1P3FA 1KX4D 3MGPA 4WU9D 5B0YD 3LJAB 3AZGA 5B2IB 4KUDD 3AN2B 5KDMA 3UTAA 4XUJC 3REJC 1EQZD 5FUGB 5AVCC 1M1AC 3B6FD 5GXQB 4NE6A 1ID3C 3AZEC 4WV4B 4XUJA 2HIOA 5F99B 3AYWD 5CPKB 4AWLB 4YS3C 4Z66C 1ID3A 3AZEA 1KX3D 1M18B 3WKJC 3VH6A 4J8VA 3AV1B 1P3AC 2NZDB 4Z5TD 3REHC 3MGQA 3UTBB 5BNVA 1F66B 3WKJA 5JRGB 4X23A 2RVQD 5CHLB 1P3AA 5DNMC 3AZGD 1P3MB 4WZSB 5B40B 5AVBD 3KWQB 2BYKB 3X1UA 1P3BB 3W98D 5DNMA 3A6ND 4KHAA 4NE3A 3VH5A 4XUJD 3REJD 5BNXA 5AVCD 1M1AD 3W99B 4NE5A 1U35C 3AV2C 5G49A 4J8WA 4YS3D 4Z66D 5B2JD 1KU5A 3REID 1U35A 4ZUXB 1P3PC 1P34C 4KGCD 1M19B 4H9RB 2BYMB 1P3PA 3REHD 2HUEC 1P34A 4CAYB 4EO5B 2JSSA 3AZID 3AZNA 3X1VB 1P3OB 1P3GB 3AZFB 4J8UC 1BFMA 2CWEA 3C1BC 5GT0A 4J8UA 2NQBD 5B2IC 1P3LB 4G92B 3AFAB 3LJAA 3B6GB 5B2IA 3REKB 3NQJB 3AV2D 4QLCB 1P3IC 3WTPB 5AY8C 5FUGA 4AWLC 3W96C 3WTPE 5B24D 5GXQA 4JJNC 4J8XB 3W96A 1KX5D 5DNNC 1HQ3D 5B32G 1H3OA 3AV1C 4JJNA 3MGSB 1S32B 4H9SC 3UTBC 5B1LB 5DNNA 1A7WA 4H9OB 4WU8B 3VH5W 3KXBC 3LZ0B 2F8NB 3AV1A 1TZYB 3X1SB 5B0ZC 2PYOD 2NZDA 4J8UD 4H9SA 3UTBA 1F66A 5JRGA 5B40C 4XZQB 3KWQC 5AV5C 3V9RA 1P3BC 3C1BD 3TU4C 5AV8D 4YM6C 5B33D 5B40A 3KWQA 2BYKA 2FJ7C 1P3BA 3TU4A 4YM6A 3B0CW 1P3ID 5GSUD 3AZKC 2FJ7A 5AY8D 5CP6C 3W96D 5CPIB 3MGRC 4JJND 1JFIB 1N1JB 1BH8B 5DNND 3RELB 1M19C 3LELC 4EO5C 2CV5B 5GT3D 1M19A 3KXBD 4H9RA 3LELA 2BYMA 5B0ZD 2HIOC 3C1CC 4CAYA 5B32B 5AV5D 3LZ1B 5E5AB 3TU4D 3C1CA 1HTAA 4YM6D 3AZFA 2FJ7D 4J8VC 3MNNB 3MGQC 1P3LC 3UT9B 4R8PB 4X23C 4G92C 3AZKD 4LD9B 3AZJB 4H9QB 3REKC 5CP6D 1P3LA 3W97C 5AV9B 3MGRD 3AZLB 3X1UC 2YFVB 3B6GA 3REKA 5CPJC 1P3FD 3MGPD 4QLCA 3X1TB 3W97A 3WTPA 1P3KC 4HGAC 3O62C 3LELD 3UTAD 5CPJA 3WA9B 3KUYB 1AOIB 5B1MB 1P3KA 3O62A 2HIOD 3AZHB 3MVDC 3C1CD 4WU8C 4J8WC 1TZYC 5AV6B 5B31B 1ID3D 1KX4B 1S32A 3AZED 2AROC 5B0YB 4WU9B 1M18C 5B1LA 3MVDA 4KUDB 2F8NA 4WU8A 1TZYA 1EQZB 4ZBJC 4J8VD 1M18A 2AROA 3B6FB 3MGQD 3WKJD 3WAAC 4X23D 2IO5B 1P3AD 3AYWB 3AZNC 1ZLAC 5C3IB 3W97D 3WAAA 3X1UD 1KX3B 4WNNA 5CPJD 5CPIC 3B0DC 3AZMC 1ZLAA 5DNMD 1P3KD 3O62D 4Z5TB 5GT0C 4H9PB 5CPIA 3AZMA 1JFIA 1N1JA 3LJAC 2CV5C 1BH8A 3AZGB 3MVDD 5AVBB 4J8WD 3AN2C 1R4VA 3W98B 1M18D 3VH6W 1U35D 2CV5A 4NFTA 5GXQC 3A6NB 3AN2A 5F99C 4XUJB 3REJB 5AVCB 5CPKC 1P3PD 1P34D 1M1AB 3LZ1A 3WAAD 5F99A 3KSYA 3MNNC 5CPKA 3AZND 3UT9C 4YS3B 1ZLAD 4Z66B 5B2JB 4LD9C 3REIB 2NZDC 3MNNA 1F66C 3UT9A 3AZMD 5JRGC 4KGCB 4LD9A 3AZJA 3REHB 5GT0D 1P3MC 2YFVA 3AZIB 3LJAD 3KUYC 1P3MA 5B2ID 5B1MC 3AN2D 3WA9A 3KUYA 1AOIA 3W99C 5GXQD 5B1MA 5AV6C 5F99D 2NQBB 3AZHA 5CPKD 3R45B 3W99A 1BH9B 5AV6A 5B31A 4DRAA 4WU9A 4ZUXC 3AV2B 3B6FC 4KUDA 5JA4B 3AV1D 2NZDD 4ZUXA 3B6FA 5B24B 1B67A 3UTBD 1F66D 5JRGD 4E44A 1KX5B 1HQ3B 1P3MD 2YFWB 5B40D 1F1EA 3X1VC 1P3GC 3KWQD 3AZFC 1P3OC 1KX3A 1P3BD 3X1VA 2RVQC 1P3OA 1P3GA 3NQUB 2PYOB 4Z5TA 4J8UB 5AVBC 3W99D 3C1BB 3AFAC 3W98C 4CSRB 5AV8B 3B6GC 4QLCC 3A6NC 5B33B 5AVBA 3WTPC 3AFAA 3W98A 4ZUXD 3NQJA 1P3IB 3A6NA 5GSUB 1M19D 5AY8B 3REJA 5AVCA 1TAFB 4J8XC 3W96B 1M1AA 1H3OB 5B2JC 4E45A 4JJNB 3REIC 3MGSC 1S32C 4J8XA 5B1LC 5DNNB 4YS3A 3LZ0C 4KGCC 4Z66A 5B2JA 1WWSA 3X1VD 3X1SC 1P3GD 3REIA 3AZFD 1P3OD 4UUZB 3MGSA 5GT3B 4KGCA 4H9OA 3LZ0A 4XZQC 3KXBB 3X1SA 3V9RB 5B0ZB 4H9NB 3AZIC 3REHA 5BO0B 1P3LD 4XZQA 5AV5B 3AZIA 3AFAD 3B0BA 3TU4B 3B6GD 3REKD 4YM6B 4QLCD 3WTPD 2FJ7B 2F8NH 2NQBC 3VH6T 4G91B 1ULYA 3AZKB 2LY8A 2NQBA 5CP6B 4J8XD 3R45A 3RELC 1BH9A 3MGRB 3MGSD 1P3FB 3AV2A 3MGPB 5B24C 1S32D 5B1LD 3RELA 2F8NG 3LZ0D 2F8ND 4WU8D 5JA4A 3LELB 1TZYD 3X1SD 5KDMB 3UTAB 1KX5C 5B24A 2AROD 1HQ3C 4Z2MH 5B32C 3VH5T 4XZQD 3LZ1C 1WWIA 5E5AC 2HIOB 1KX5A 3C1CB 1HQ3A 4M6BA 5B32A 2YFWA 2PYOC 1ID3B 5E5AA 3AZEB 2L5AA 4R8PC 3NQUA 2PYOA 4Z2MG 3AZJC 4J8VB 5AV8C 2F8NK 4DRBA 3B0CT 5B33C 3MGQB 5BNVB 5CPID 5BS7C 5AV9C 3WKJB 4R8PA 4X23B 3C1BA 3AZLC 1B6WA 4CSRA 5AV8A 1P3AB 4H9QA 5BT1C 3X1TC 5B33A 5GSUC 3RELD 5BS7A 5AV9A 3W97B 3AZLA 3X1UB 5CPJB 1P3IA 3X1TA 3WA9C 2CV5D 1AOIC 5GSUA 5DNMB 5AY8A 4KHAB 1P3KB 4HGAB 3O62B 1TAFA 3AZHC 5BNXB 5B32D 5B31C 3LZ1D 1KX4C 4WU9C 5E5AD 5B0YC 5GT3C 4KUDC 3MVDB 5G49B 4J8WB 1EQZC 4UUZA 1KX4A 5B0YA 2AROB 1U35B
chains in the Genus database with same CATH superfamily
5GT3A 3A1IA 3MNND 3KXBA 2G5IC 2Y2MA 3UT9D 4R8PD 1EQZA 5B0ZA 4H9NA 2IO5C 4ZBJB 3AZJD 4LD9D 3AYWC 1P3PB 5BO0A 1P34B 5C3IC 5AV9D 5AV5A 3WAAB 3AZLD 1KX3C 3AYWA 5BT1D 4WNNB 3X1TD 2HUEB 3AZNB 1ZLAB 4G91C 1Q9CA 4Z5TC 3B0DB 3AZMB 3KUYD 1AOID 3WA9D 3AZKA 5B1MD 5CP6A 1P3FC 3MGPC 4H9PA 5GT0B 3AZGC 3AZHD 3MGRA 5B31G 5AV6D 5B31D 3UTAC 1P3FA 1KX4D 3MGPA 4WU9D 5B0YD 3LJAB 3AZGA 5B2IB 4KUDD 3AN2B 5KDMA 3UTAA 4XUJC 3REJC 1EQZD 5FUGB 5AVCC 1M1AC 3B6FD 5GXQB 4NE6A 1ID3C 3AZEC 2Y2IA 4WV4B 2HIOA 4XUJA 5F99B 3AYWD 5CPKB 4AWLB 4YS3C 4Z66C 1ID3A 3EPJA 3AZEA 1KX3D 2G5HC 2ZY5A 1M18B 3WKJC 3VH6A 2Y2PA 4J8VA 3AV1B 1P3AC 2NZDB 4Z5TD 3REHC 3KFUG 3MGQA 3UTBB 5BNVA 1F66B 3WKJA 5JRGB 3A1KA 4X23A 2RVQD 5CHLB 1P3AA 1W2EA 5DNMC 3AZGD 1P3MB 4WZSB 5B40B 5AVBD 2W8SA 3KWQB 2BYKB 2JCHA 3X1UA 1P3BB 3W98D 5DNMA 3AL0C 3A6ND 4KHAA 4NE3A 3VH5A 4XUJD 4UPKA 3REJD 5BNXA 5AVCD 3IP4C 1M1AD 3W99B 4NE5A 1U35C 3AV2C 5G49A 3EPHA 4J8WA 4YS3D 4Z66D 5B2JD 1KU5A 3REID 1U35A 4ZUXB 1P3PC 1P34C 2XD5A 4KGCD 1M19B 4H9RB 2BYMB 1P3PA 3REHD 2HUEC 1P34A 4CAYB 4EO5B 2JSSA 3AZID 3AZNA 2ZY4A 2Y2KA 2FFFB 3X1VB 1P3OB 1P3GB 3AZFB 4J8UC 1BFMA 2CWEA 2J8PA 3C1BC 5GT0A 4J8UA 2NQBD 5B2IC 1P3LB 4G92B 3AFAB 3EG5B 3LJAA 3B6GB 5B2IA 3REKB 3NQJB 3AV2D 4QLCB 1P3IC 3WTPB 5AY8C 5FUGA 2DQNC 4AWLC 3W96C 3WTPE 5B24D 5GXQA 4JJNC 3H0LC 4J8XB 3W96A 2Y2OA 1KX5D 5DNNC 1HQ3D 5B32G 1H3OA 3AV1C 4JJNA 3MGSB 1S32B 4H9SC 3UTBC 5B1LB 5DNNA 1A7WA 4H9OB 4WU8B 3VH5W 3KXBC 3LZ0B 2F8NB 3AV1A 1TZYB 3X1SB 5B0ZC 2PYOD 2NZDA 4J8UD 4H9SA 3UTBA 1F66A 5JRGA 5B40C 4XZQB 3KWQC 5AV5C 3V9RA 1P3BC 3C1BD 3TU4C 5AV8D 4YM6C 5B33D 5B40A 4DQYB 3KWQA 2BYKA 2FJ7C 1P3BA 3TU4A 4YM6A 3B0CW 1P3ID 5GSUD 3AZKC 2FJ7A 5AY8D 5CP6C 2ZM5A 3W96D 5CPIB 3MGRC 4JJND 2XD1A 1JFIB 1N1JB 1BH8B 5DNND 3RELB 1M19C 3LELC 4EO5C 2CV5B 5GT3D 1M19A 3KXBD 4H9RA 3LELA 2BYMA 5B0ZD 2HIOC 3C1CC 4CAYA 3F6TA 5B32B 5AV5D 3LZ1B 5E5AB 3TU4D 3C1CA 1HTAA 4YM6D 2Y2JA 3AZFA 2FJ7D 4J8VC 2Y2LA 3MNNB 3MGQC 1P3LC 3P5JB 3UT9B 4R8PB 4X23C 4G92C 3AZKD 2JE5A 4LD9B 3AZJB 4H9QB 3REKC 5CP6D 1P3LA 3W97C 5AV9B 3MGRD 2Y2GA 3X1UC 3AZLB 2YFVB 3B6GA 3REKA 5CPJC 1P3FD 3MGPD 4QLCA 3X1TB 3W97A 3WTPA 1P3KC 4HGAC 3O62C 3LELD 3UTAD 3EPLA 2F2AC 5CPJA 3WA9B 3KUYB 1AOIB 2ZY2A 5B1MB 1P3KA 3O62A 2HIOD 3AZHB 3MVDC 3C1CD 4WU8C 4J8WC 1TZYC 5AV6B 5B31B 1ID3D 1KX4B 1S32A 3AZED 2AROC 5B0YB 4WU9B 1M18C 5B1LA 3MVDA 4KUDB 2F8NA 4WU8A 1TZYA 1EQZB 4ZBJC 4J8VD 1M18A 2AROA 3B6FB 3MGQD 3WKJD 3WAAC 4X23D 2IO5B 1P3AD 3AYWB 3AZNC 1ZLAC 5C3IB 3W97D 3WAAA 3X1UD 1KX3B 4WNNA 2Y2NA 5CPJD 5CPIC 3B0DC 3AZMC 1ZLAA 5DNMD 1P3KD 3O62D 4Z5TB 5GT0C 4H9PB 5CPIA 3AZMA 1JFIA 1N1JA 3LJAC 2CV5C 1BH8A 3AZGB 3MVDD 5AVBB 4J8WD 3AN2C 1R4VA 3W98B 1M18D 3VH6W 1U35D 2CV5A 4NFTA 5GXQC 3A6NB 3AN2A 5F99C 4XUJB 3REJB 5AVCB 5CPKC 1P3PD 1P34D 1M1AB 3LZ1A 3WAAD 3H0MC 5F99A 3KSYA 3MNNC 5CPKA 3AZND 3UT9C 2UWXA 4YS3B 1ZLAD 4Z66B 2VQRA 5B2JB 4LD9C 3REIB 2NZDC 3MNNA 1F66C 3UT9A 3AZMD 5JRGC 4KGCB 4LD9A 3AZJA 2BG1A 3REHB 5GT0D 1P3MC 2YFVA 3AZIB 3LJAD 3KUYC 1P3MA 5B2ID 5B1MC 3AN2D 3WA9A 3KUYA 1AOIA 3W99C 5GXQD 5B1MA 5AV6C 5F99D 2NQBB 3AZHA 5CPKD 1Z2CB 3R45B 3W99A 1BH9B 5AV6A 5B31A 4DRAA 4WU9A 4ZUXC 3AV2B 3B6FC 4KUDA 5JA4B 3AV1D 2Y2HA 2NZDD 4ZUXA 2Y2QA 1PZRA 1B67A 5B24B 3UTBD 1F66D 3B6FA 5JRGD 4E44A 1KX5B 1HQ3B 1P3MD 2YFWB 5B40D 1F1EA 3X1VC 1P3GC 3KWQD 3AZFC 3EPKA 1P3OC 1KX3A 1P3BD 3X1VA 2RVQC 3FDDA 1P3GA 1P3OA 3NQUB 2PYOB 4Z5TA 4J8UB 5AVBC 3W99D 3C1BB 3AFAC 3W98C 4CSRB 5AV8B 3B6GC 4QLCC 3A6NC 5B33B 5AVBA 3WTPC 3AFAA 3W98A 2RIQA 4ZUXD 3NQJA 1P3IB 3A6NA 5GSUB 1M19D 1T3UA 5AY8B 3REJA 5AVCA 1TAFB 4J8XC 3W96B 1M1AA 1H3OB 5B2JC 4E45A 4JJNB 3REIC 3MGSC 1S32C 4J8XA 5B1LC 5DNNB 4YS3A 3LZ0C 4KGCC 4Z66A 5B2JA 1WWSA 3X1VD 3X1SC 1P3GD 3REIA 3AZFD 1P3OD 4UUZB 3MGSA 5GT3B 4KGCA 4H9OA 3LZ0A 4XZQC 3KXBB 3X1SA 3V9RB 5B0ZB 4H9NB 3AZIC 3REHA 2ZY3A 5BO0B 1P3LD 4XZQA 5AV5B 3AZIA 3AFAD 3B0BA 3TU4B 3B6GD 3REKD 4YM6B 4QLCD 3WTPD 2FJ7B 2F8NH 2NQBC 3VH6T 4G91B 1ULYA 3AZKB 2LY8A 2NQBA 5CP6B 4J8XD 3R45A 3RELC 1BH9A 3MGRB 2DF4C 3MGSD 1P3FB 3AV2A 3MGPB 5B24C 1S32D 5B1LD 3RELA 2F8NG 3LZ0D 2F8ND 4WU8D 5JA4A 3LELB 1TZYD 3X1SD 5KDMB 3UTAB 1KX5C 3H0RC 2AROD 5B24A 1HQ3C 4Z2MH 5B32C 3VH5T 4XZQD 3LZ1C 1WWIA 5E5AC 2HIOB 1KX5A 3C1CB 1HQ3A 4M6BA 5B32A 2YFWA 2PYOC 1ID3B 5E5AA 3AZEB 2L5AA 4R8PC 3NQUA 2PYOA 4Z2MG 3AZJC 4J8VB 5AV8C 2F8NK 4DRBA 3B0CT 5B33C 3MGQB 5BNVB 5CPID 5BS7C 5AV9C 3WKJB 4R8PA 4X23B 3C1BA 3AZLC 1B6WA 4CSRA 5AV8A 1P3AB 4H9QA 5BT1C 3X1TC 5B33A 5GSUC 3RELD 5BS7A 5AV9A 3W97B 3AZLA 3X1UB 5CPJB 1P3IA 3X1TA 3WA9C 2CV5D 1AOIC 5GSUA 5DNMB 5AY8A 4KHAB 1P3KB 4HGAB 3O62B 1TAFA 3AZHC 5BNXB 4WJ3C 5B32D 5B31C 3LZ1D 1KX4C 4WU9C 5E5AD 5B0YC 5GT3C 4KUDC 3MVDB 5G49B 4J8WB 1EQZC 4UUZA 1KX4A 5B0YA 2AROB 1U35B
chains in the Genus database with same CATH topology
5GT3A 3A1IA 3MNND 3KXBA 2G5IC 2Y2MA 3UT9D 4R8PD 1EQZA 5B0ZA 4H9NA 2IO5C 4ZBJB 3AZJD 4LD9D 3AYWC 1P3PB 5BO0A 1P34B 5C3IC 5AV9D 5AV5A 3WAAB 3AZLD 1KX3C 3AYWA 5BT1D 4WNNB 3X1TD 2HUEB 3AZNB 1ZLAB 4G91C 1Q9CA 4Z5TC 3B0DB 3AZMB 3KUYD 1AOID 3WA9D 3AZKA 5B1MD 5CP6A 1P3FC 3MGPC 4H9PA 5GT0B 3AZGC 3AZHD 3MGRA 5B31G 5AV6D 5B31D 3UTAC 1P3FA 1KX4D 3MGPA 4WU9D 5B0YD 3LJAB 3AZGA 5B2IB 4KUDD 3AN2B 5KDMA 3UTAA 4XUJC 3REJC 1EQZD 5FUGB 5AVCC 1M1AC 3B6FD 5GXQB 4NE6A 1ID3C 3AZEC 2Y2IA 4WV4B 2HIOA 4XUJA 5F99B 3AYWD 5CPKB 4AWLB 4YS3C 4Z66C 1ID3A 3EPJA 3AZEA 1KX3D 2G5HC 2ZY5A 1M18B 3WKJC 3VH6A 2Y2PA 4J8VA 3AV1B 1P3AC 2NZDB 4Z5TD 3REHC 3KFUG 3MGQA 3UTBB 5BNVA 1F66B 3WKJA 5JRGB 3A1KA 4X23A 2RVQD 5CHLB 1P3AA 1W2EA 5DNMC 3AZGD 1P3MB 4WZSB 5B40B 5AVBD 2W8SA 3KWQB 2BYKB 2JCHA 3X1UA 1P3BB 3W98D 5DNMA 3AL0C 3A6ND 4KHAA 4NE3A 3VH5A 4XUJD 4UPKA 3REJD 5BNXA 5AVCD 3IP4C 1M1AD 3W99B 4NE5A 1U35C 3AV2C 5G49A 3EPHA 4J8WA 4YS3D 4Z66D 5B2JD 1KU5A 3REID 1U35A 4ZUXB 1P3PC 1P34C 2XD5A 4KGCD 1M19B 4H9RB 2BYMB 1P3PA 3REHD 2HUEC 1P34A 4CAYB 4EO5B 2JSSA 3AZID 3AZNA 2ZY4A 2Y2KA 2FFFB 3X1VB 1P3OB 1P3GB 3AZFB 4J8UC 1BFMA 2CWEA 2J8PA 3C1BC 5GT0A 4J8UA 2NQBD 5B2IC 1P3LB 4G92B 3AFAB 3EG5B 3LJAA 3B6GB 5B2IA 3REKB 3NQJB 3AV2D 4QLCB 1P3IC 3WTPB 5AY8C 5FUGA 2DQNC 4AWLC 3W96C 3WTPE 5B24D 5GXQA 4JJNC 3H0LC 4J8XB 3W96A 2Y2OA 1KX5D 5DNNC 1HQ3D 5B32G 1H3OA 3AV1C 4JJNA 3MGSB 1S32B 4H9SC 3UTBC 5B1LB 5DNNA 1A7WA 4H9OB 4WU8B 3VH5W 3KXBC 3LZ0B 2F8NB 3AV1A 1TZYB 3X1SB 5B0ZC 2PYOD 2NZDA 4J8UD 4H9SA 3UTBA 1F66A 5JRGA 5B40C 4XZQB 3KWQC 5AV5C 3V9RA 1P3BC 3C1BD 3TU4C 5AV8D 4YM6C 5B33D 5B40A 4DQYB 3KWQA 2BYKA 2FJ7C 1P3BA 3TU4A 4YM6A 3B0CW 1P3ID 5GSUD 3AZKC 2FJ7A 5AY8D 5CP6C 2ZM5A 3W96D 5CPIB 3MGRC 4JJND 2XD1A 1JFIB 1N1JB 1BH8B 5DNND 3RELB 1M19C 3LELC 4EO5C 2CV5B 5GT3D 1M19A 3KXBD 4H9RA 3LELA 2BYMA 5B0ZD 2HIOC 3C1CC 4CAYA 3F6TA 5B32B 5AV5D 3LZ1B 5E5AB 3TU4D 3C1CA 1HTAA 4YM6D 2Y2JA 3AZFA 2FJ7D 4J8VC 2Y2LA 3MNNB 3MGQC 1P3LC 3P5JB 3UT9B 4R8PB 4X23C 4G92C 3AZKD 2JE5A 4LD9B 3AZJB 4H9QB 3REKC 5CP6D 1P3LA 3W97C 5AV9B 3MGRD 2Y2GA 3X1UC 3AZLB 2YFVB 3B6GA 3REKA 5CPJC 1P3FD 3MGPD 4QLCA 3X1TB 3W97A 3WTPA 1P3KC 4HGAC 3O62C 3LELD 3UTAD 3EPLA 2F2AC 5CPJA 3WA9B 3KUYB 1AOIB 2ZY2A 5B1MB 1P3KA 3O62A 2HIOD 3AZHB 3MVDC 3C1CD 4WU8C 4J8WC 1TZYC 5AV6B 5B31B 1ID3D 1KX4B 1S32A 3AZED 2AROC 5B0YB 4WU9B 1M18C 5B1LA 3MVDA 4KUDB 2F8NA 4WU8A 1TZYA 1EQZB 4ZBJC 4J8VD 1M18A 2AROA 3B6FB 3MGQD 3WKJD 3WAAC 4X23D 2IO5B 1P3AD 3AYWB 3AZNC 1ZLAC 5C3IB 3W97D 3WAAA 3X1UD 1KX3B 4WNNA 2Y2NA 5CPJD 5CPIC 3B0DC 3AZMC 1ZLAA 5DNMD 1P3KD 3O62D 4Z5TB 5GT0C 4H9PB 5CPIA 3AZMA 1JFIA 1N1JA 3LJAC 2CV5C 1BH8A 3AZGB 3MVDD 5AVBB 4J8WD 3AN2C 1R4VA 3W98B 1M18D 3VH6W 1U35D 2CV5A 4NFTA 5GXQC 3A6NB 3AN2A 5F99C 4XUJB 3REJB 5AVCB 5CPKC 1P3PD 1P34D 1M1AB 3LZ1A 3WAAD 3H0MC 5F99A 3KSYA 3MNNC 5CPKA 3AZND 3UT9C 2UWXA 4YS3B 1ZLAD 4Z66B 2VQRA 5B2JB 4LD9C 3REIB 2NZDC 3MNNA 1F66C 3UT9A 3AZMD 5JRGC 4KGCB 4LD9A 3AZJA 2BG1A 3REHB 5GT0D 1P3MC 2YFVA 3AZIB 3LJAD 3KUYC 1P3MA 5B2ID 5B1MC 3AN2D 3WA9A 3KUYA 1AOIA 3W99C 5GXQD 5B1MA 5AV6C 5F99D 2NQBB 3AZHA 5CPKD 1Z2CB 3R45B 3W99A 1BH9B 5AV6A 5B31A 4DRAA 4WU9A 4ZUXC 3AV2B 3B6FC 4KUDA 5JA4B 3AV1D 2Y2HA 2NZDD 4ZUXA 2Y2QA 1PZRA 1B67A 5B24B 3UTBD 1F66D 3B6FA 5JRGD 4E44A 1KX5B 1HQ3B 1P3MD 2YFWB 5B40D 1F1EA 3X1VC 1P3GC 3KWQD 3AZFC 3EPKA 1P3OC 1KX3A 1P3BD 3X1VA 2RVQC 3FDDA 1P3GA 1P3OA 3NQUB 2PYOB 4Z5TA 4J8UB 5AVBC 3W99D 3C1BB 3AFAC 3W98C 4CSRB 5AV8B 3B6GC 4QLCC 3A6NC 5B33B 5AVBA 3WTPC 3AFAA 3W98A 2RIQA 4ZUXD 3NQJA 1P3IB 3A6NA 5GSUB 1M19D 1T3UA 5AY8B 3REJA 5AVCA 1TAFB 4J8XC 3W96B 1M1AA 1H3OB 5B2JC 4E45A 4JJNB 3REIC 3MGSC 1S32C 4J8XA 5B1LC 5DNNB 4YS3A 3LZ0C 4KGCC 4Z66A 5B2JA 1WWSA 3X1VD 3X1SC 1P3GD 3REIA 3AZFD 1P3OD 4UUZB 3MGSA 5GT3B 4KGCA 4H9OA 3LZ0A 4XZQC 3KXBB 3X1SA 3V9RB 5B0ZB 4H9NB 3AZIC 3REHA 2ZY3A 5BO0B 1P3LD 4XZQA 5AV5B 3AZIA 3AFAD 3B0BA 3TU4B 3B6GD 3REKD 4YM6B 4QLCD 3WTPD 2FJ7B 2F8NH 2NQBC 3VH6T 4G91B 1ULYA 3AZKB 2LY8A 2NQBA 5CP6B 4J8XD 3R45A 3RELC 1BH9A 3MGRB 2DF4C 3MGSD 1P3FB 3AV2A 3MGPB 5B24C 1S32D 5B1LD 3RELA 2F8NG 3LZ0D 2F8ND 4WU8D 5JA4A 3LELB 1TZYD 3X1SD 5KDMB 3UTAB 1KX5C 3H0RC 2AROD 5B24A 1HQ3C 4Z2MH 5B32C 3VH5T 4XZQD 3LZ1C 1WWIA 5E5AC 2HIOB 1KX5A 3C1CB 1HQ3A 4M6BA 5B32A 2YFWA 2PYOC 1ID3B 5E5AA 3AZEB 2L5AA 4R8PC 3NQUA 2PYOA 4Z2MG 3AZJC 4J8VB 5AV8C 2F8NK 4DRBA 3B0CT 5B33C 3MGQB 5BNVB 5CPID 5BS7C 5AV9C 3WKJB 4R8PA 4X23B 3C1BA 3AZLC 1B6WA 4CSRA 5AV8A 1P3AB 4H9QA 5BT1C 3X1TC 5B33A 5GSUC 3RELD 5BS7A 5AV9A 3W97B 3AZLA 3X1UB 5CPJB 1P3IA 3X1TA 3WA9C 2CV5D 1AOIC 5GSUA 5DNMB 5AY8A 4KHAB 1P3KB 4HGAB 3O62B 1TAFA 3AZHC 5BNXB 4WJ3C 5B32D 5B31C 3LZ1D 1KX4C 4WU9C 5E5AD 5B0YC 5GT3C 4KUDC 3MVDB 5G49B 4J8WB 1EQZC 4UUZA 1KX4A 5B0YA 2AROB 1U35B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GT3 A;  3MNN D;  3KXB A;  3UT9 D;  4R8P D;  1EQZ A;  5B0Z A;  4H9N A;  2IO5 C;  4ZBJ B;  3AZJ D;  4LD9 D;  3AYW C;  1P3P B;  5BO0 A;  1P34 B;  5C3I C;  5AV9 D;  5AV5 A;  3WAA B;  3AZL D;  1KX3 C;  3AYW A;  5BT1 D;  4WNN B;  3X1T D;  2HUE B;  3AZN B;  1ZLA B;  4G91 C;  1Q9C A;  4Z5T C;  3B0D B;  3AZM B;  3KUY D;  1AOI D;  3WA9 D;  3AZK A;  5B1M D;  5CP6 A;  1P3F C;  3MGP C;  4H9P A;  5GT0 B;  3AZG C;  3AZH D;  3MGR A;  5B31 G;  5AV6 D;  5B31 D;  3UTA C;  1P3F A;  1KX4 D;  3MGP A;  4WU9 D;  5B0Y D;  3LJA B;  3AZG A;  5B2I B;  4KUD D;  3AN2 B;  5KDM A;  3UTA A;  4XUJ C;  3REJ C;  1EQZ D;  5FUG B;  5AVC C;  1M1A C;  3B6F D;  5GXQ B;  4NE6 A;  1ID3 C;  3AZE C;  4WV4 B;  4XUJ A;  2HIO A;  5F99 B;  3AYW D;  5CPK B;  4AWL B;  4YS3 C;  4Z66 C;  1ID3 A;  3AZE A;  1KX3 D;  1M18 B;  3WKJ C;  3VH6 A;  4J8V A;  3AV1 B;  1P3A C;  2NZD B;  4Z5T D;  3REH C;  3MGQ A;  3UTB B;  5BNV A;  1F66 B;  3WKJ A;  5JRG B;  4X23 A;  2RVQ D;  5CHL B;  1P3A A;  5DNM C;  3AZG D;  1P3M B;  4WZS B;  5B40 B;  5AVB D;  3KWQ B;  2BYK B;  3X1U A;  1P3B B;  3W98 D;  5DNM A;  3A6N D;  4KHA A;  4NE3 A;  3VH5 A;  4XUJ D;  3REJ D;  5BNX A;  5AVC D;  1M1A D;  3W99 B;  4NE5 A;  1U35 C;  3AV2 C;  5G49 A;  4J8W A;  4YS3 D;  4Z66 D;  5B2J D;  1KU5 A;  3REI D;  1U35 A;  4ZUX B;  1P3P C;  1P34 C;  4KGC D;  1M19 B;  4H9R B;  2BYM B;  1P3P A;  3REH D;  2HUE C;  1P34 A;  4CAY B;  4EO5 B;  2JSS A;  3AZI D;  3AZN A;  3X1V B;  1P3O B;  1P3G B;  3AZF B;  4J8U C;  1BFM A;  2CWE A;  3C1B C;  5GT0 A;  4J8U A;  2NQB D;  5B2I C;  1P3L B;  4G92 B;  3AFA B;  3LJA A;  3B6G B;  5B2I A;  3REK B;  3NQJ B;  3AV2 D;  4QLC B;  1P3I C;  3WTP B;  5AY8 C;  5FUG A;  4AWL C;  3W96 C;  3WTP E;  5B24 D;  5GXQ A;  4JJN C;  4J8X B;  3W96 A;  1KX5 D;  5DNN C;  1HQ3 D;  5B32 G;  1H3O A;  3AV1 C;  4JJN A;  3MGS B;  1S32 B;  4H9S C;  3UTB C;  5B1L B;  5DNN A;  1A7W A;  4H9O B;  4WU8 B;  3VH5 W;  3KXB C;  3LZ0 B;  2F8N B;  3AV1 A;  1TZY B;  3X1S B;  5B0Z C;  2PYO D;  2NZD A;  4J8U D;  4H9S A;  3UTB A;  1F66 A;  5JRG A;  5B40 C;  4XZQ B;  3KWQ C;  5AV5 C;  3V9R A;  1P3B C;  3C1B D;  3TU4 C;  5AV8 D;  4YM6 C;  5B33 D;  5B40 A;  3KWQ A;  2BYK A;  2FJ7 C;  1P3B A;  3TU4 A;  4YM6 A;  3B0C W;  1P3I D;  5GSU D;  3AZK C;  2FJ7 A;  5AY8 D;  5CP6 C;  3W96 D;  5CPI B;  3MGR C;  4JJN D;  1JFI B;  1N1J B;  1BH8 B;  5DNN D;  3REL B;  1M19 C;  3LEL C;  4EO5 C;  2CV5 B;  5GT3 D;  1M19 A;  3KXB D;  4H9R A;  3LEL A;  2BYM A;  5B0Z D;  2HIO C;  3C1C C;  4CAY A;  5B32 B;  5AV5 D;  3LZ1 B;  5E5A B;  3TU4 D;  3C1C A;  1HTA A;  4YM6 D;  3AZF A;  2FJ7 D;  4J8V C;  3MNN B;  3MGQ C;  1P3L C;  3UT9 B;  4R8P B;  4X23 C;  4G92 C;  3AZK D;  4LD9 B;  3AZJ B;  4H9Q B;  3REK C;  5CP6 D;  1P3L A;  3W97 C;  5AV9 B;  3MGR D;  3AZL B;  3X1U C;  2YFV B;  3B6G A;  3REK A;  5CPJ C;  1P3F D;  3MGP D;  4QLC A;  3X1T B;  3W97 A;  3WTP A;  1P3K C;  4HGA C;  3O62 C;  3LEL D;  3UTA D;  5CPJ A;  3WA9 B;  3KUY B;  1AOI B;  5B1M B;  1P3K A;  3O62 A;  2HIO D;  3AZH B;  3MVD C;  3C1C D;  4WU8 C;  4J8W C;  1TZY C;  5AV6 B;  5B31 B;  1ID3 D;  1KX4 B;  1S32 A;  3AZE D;  2ARO C;  5B0Y B;  4WU9 B;  1M18 C;  5B1L A;  3MVD A;  4KUD B;  2F8N A;  4WU8 A;  1TZY A;  1EQZ B;  4ZBJ C;  4J8V D;  1M18 A;  2ARO A;  3B6F B;  3MGQ D;  3WKJ D;  3WAA C;  4X23 D;  2IO5 B;  1P3A D;  3AYW B;  3AZN C;  1ZLA C;  5C3I B;  3W97 D;  3WAA A;  3X1U D;  1KX3 B;  4WNN A;  5CPJ D;  5CPI C;  3B0D C;  3AZM C;  1ZLA A;  5DNM D;  1P3K D;  3O62 D;  4Z5T B;  5GT0 C;  4H9P B;  5CPI A;  3AZM A;  1JFI A;  1N1J A;  3LJA C;  2CV5 C;  1BH8 A;  3AZG B;  3MVD D;  5AVB B;  4J8W D;  3AN2 C;  1R4V A;  3W98 B;  1M18 D;  3VH6 W;  1U35 D;  2CV5 A;  4NFT A;  5GXQ C;  3A6N B;  3AN2 A;  5F99 C;  4XUJ B;  3REJ B;  5AVC B;  5CPK C;  1P3P D;  1P34 D;  1M1A B;  3LZ1 A;  3WAA D;  5F99 A;  3KSY A;  3MNN C;  5CPK A;  3AZN D;  3UT9 C;  4YS3 B;  1ZLA D;  4Z66 B;  5B2J B;  4LD9 C;  3REI B;  2NZD C;  3MNN A;  1F66 C;  3UT9 A;  3AZM D;  5JRG C;  4KGC B;  4LD9 A;  3AZJ A;  3REH B;  5GT0 D;  1P3M C;  2YFV A;  3AZI B;  3LJA D;  3KUY C;  1P3M A;  5B2I D;  5B1M C;  3AN2 D;  3WA9 A;  3KUY A;  1AOI A;  3W99 C;  5GXQ D;  5B1M A;  5AV6 C;  5F99 D;  2NQB B;  3AZH A;  5CPK D;  3R45 B;  3W99 A;  1BH9 B;  5AV6 A;  5B31 A;  4DRA A;  4WU9 A;  4ZUX C;  3AV2 B;  3B6F C;  4KUD A;  5JA4 B;  3AV1 D;  2NZD D;  4ZUX A;  3B6F A;  5B24 B;  1B67 A;  3UTB D;  1F66 D;  5JRG D;  4E44 A;  1KX5 B;  1HQ3 B;  1P3M D;  2YFW B;  5B40 D;  1F1E A;  3X1V C;  1P3G C;  3KWQ D;  3AZF C;  1P3O C;  1KX3 A;  1P3B D;  3X1V A;  2RVQ C;  1P3O A;  1P3G A;  3NQU B;  2PYO B;  4Z5T A;  4J8U B;  5AVB C;  3W99 D;  3C1B B;  3AFA C;  3W98 C;  4CSR B;  5AV8 B;  3B6G C;  4QLC C;  3A6N C;  5B33 B;  5AVB A;  3WTP C;  3AFA A;  3W98 A;  4ZUX D;  3NQJ A;  1P3I B;  3A6N A;  5GSU B;  1M19 D;  5AY8 B;  3REJ A;  5AVC A;  1TAF B;  4J8X C;  3W96 B;  1M1A A;  1H3O B;  5B2J C;  4E45 A;  4JJN B;  3REI C;  3MGS C;  1S32 C;  4J8X A;  5B1L C;  5DNN B;  4YS3 A;  3LZ0 C;  4KGC C;  4Z66 A;  5B2J A;  1WWS A;  3X1V D;  3X1S C;  1P3G D;  3REI A;  3AZF D;  1P3O D;  4UUZ B;  3MGS A;  5GT3 B;  4KGC A;  4H9O A;  3LZ0 A;  4XZQ C;  3KXB B;  3X1S A;  3V9R B;  5B0Z B;  4H9N B;  3AZI C;  3REH A;  5BO0 B;  1P3L D;  4XZQ A;  5AV5 B;  3AZI A;  3AFA D;  3B0B A;  3TU4 B;  3B6G D;  3REK D;  4YM6 B;  4QLC D;  3WTP D;  2FJ7 B;  2F8N H;  2NQB C;  3VH6 T;  4G91 B;  1ULY A;  3AZK B;  2LY8 A;  2NQB A;  5CP6 B;  4J8X D;  3R45 A;  3REL C;  1BH9 A;  3MGR B;  3MGS D;  1P3F B;  3AV2 A;  3MGP B;  5B24 C;  1S32 D;  5B1L D;  3REL A;  2F8N G;  3LZ0 D;  2F8N D;  4WU8 D;  5JA4 A;  3LEL B;  1TZY D;  3X1S D;  5KDM B;  3UTA B;  1KX5 C;  5B24 A;  2ARO D;  1HQ3 C;  4Z2M H;  5B32 C;  3VH5 T;  4XZQ D;  3LZ1 C;  1WWI A;  5E5A C;  2HIO B;  1KX5 A;  3C1C B;  1HQ3 A;  4M6B A;  5B32 A;  2YFW A;  2PYO C;  1ID3 B;  5E5A A;  3AZE B;  2L5A A;  4R8P C;  3NQU A;  2PYO A;  4Z2M G;  3AZJ C;  4J8V B;  5AV8 C;  2F8N K;  4DRB A;  3B0C T;  5B33 C;  3MGQ B;  5BNV B;  5CPI D;  5BS7 C;  5AV9 C;  3WKJ B;  4R8P A;  4X23 B;  3C1B A;  3AZL C;  1B6W A;  4CSR A;  5AV8 A;  1P3A B;  4H9Q A;  5BT1 C;  3X1T C;  5B33 A;  5GSU C;  3REL D;  5BS7 A;  5AV9 A;  3W97 B;  3AZL A;  3X1U B;  5CPJ B;  1P3I A;  3X1T A;  3WA9 C;  2CV5 D;  1AOI C;  5GSU A;  5DNM B;  5AY8 A;  4KHA B;  1P3K B;  4HGA B;  3O62 B;  1TAF A;  3AZH C;  5BNX B;  5B32 D;  5B31 C;  3LZ1 D;  1KX4 C;  4WU9 C;  5E5A D;  5B0Y C;  5GT3 C;  4KUD C;  3MVD B;  5G49 B;  4J8W B;  1EQZ C;  4UUZ A;  1KX4 A;  5B0Y A;  2ARO B;  1U35 B; 
#chains in the Genus database with same CATH topology
 5GT3 A;  3A1I A;  3MNN D;  3KXB A;  2G5I C;  2Y2M A;  3UT9 D;  4R8P D;  1EQZ A;  5B0Z A;  4H9N A;  2IO5 C;  4ZBJ B;  3AZJ D;  4LD9 D;  3AYW C;  1P3P B;  5BO0 A;  1P34 B;  5C3I C;  5AV9 D;  5AV5 A;  3WAA B;  3AZL D;  1KX3 C;  3AYW A;  5BT1 D;  4WNN B;  3X1T D;  2HUE B;  3AZN B;  1ZLA B;  4G91 C;  1Q9C A;  4Z5T C;  3B0D B;  3AZM B;  3KUY D;  1AOI D;  3WA9 D;  3AZK A;  5B1M D;  5CP6 A;  1P3F C;  3MGP C;  4H9P A;  5GT0 B;  3AZG C;  3AZH D;  3MGR A;  5B31 G;  5AV6 D;  5B31 D;  3UTA C;  1P3F A;  1KX4 D;  3MGP A;  4WU9 D;  5B0Y D;  3LJA B;  3AZG A;  5B2I B;  4KUD D;  3AN2 B;  5KDM A;  3UTA A;  4XUJ C;  3REJ C;  1EQZ D;  5FUG B;  5AVC C;  1M1A C;  3B6F D;  5GXQ B;  4NE6 A;  1ID3 C;  3AZE C;  2Y2I A;  4WV4 B;  2HIO A;  4XUJ A;  5F99 B;  3AYW D;  5CPK B;  4AWL B;  4YS3 C;  4Z66 C;  1ID3 A;  3EPJ A;  3AZE A;  1KX3 D;  2G5H C;  2ZY5 A;  1M18 B;  3WKJ C;  3VH6 A;  2Y2P A;  4J8V A;  3AV1 B;  1P3A C;  2NZD B;  4Z5T D;  3REH C;  3KFU G;  3MGQ A;  3UTB B;  5BNV A;  1F66 B;  3WKJ A;  5JRG B;  3A1K A;  4X23 A;  2RVQ D;  5CHL B;  1P3A A;  1W2E A;  5DNM C;  3AZG D;  1P3M B;  4WZS B;  5B40 B;  5AVB D;  2W8S A;  3KWQ B;  2BYK B;  2JCH A;  3X1U A;  1P3B B;  3W98 D;  5DNM A;  3AL0 C;  3A6N D;  4KHA A;  4NE3 A;  3VH5 A;  4XUJ D;  4UPK A;  3REJ D;  5BNX A;  5AVC D;  3IP4 C;  1M1A D;  3W99 B;  4NE5 A;  1U35 C;  3AV2 C;  5G49 A;  3EPH A;  4J8W A;  4YS3 D;  4Z66 D;  5B2J D;  1KU5 A;  3REI D;  1U35 A;  4ZUX B;  1P3P C;  1P34 C;  2XD5 A;  4KGC D;  1M19 B;  4H9R B;  2BYM B;  1P3P A;  3REH D;  2HUE C;  1P34 A;  4CAY B;  4EO5 B;  2JSS A;  3AZI D;  3AZN A;  2ZY4 A;  2Y2K A;  2FFF B;  3X1V B;  1P3O B;  1P3G B;  3AZF B;  4J8U C;  1BFM A;  2CWE A;  2J8P A;  3C1B C;  5GT0 A;  4J8U A;  2NQB D;  5B2I C;  1P3L B;  4G92 B;  3AFA B;  3EG5 B;  3LJA A;  3B6G B;  5B2I A;  3REK B;  3NQJ B;  3AV2 D;  4QLC B;  1P3I C;  3WTP B;  5AY8 C;  5FUG A;  2DQN C;  4AWL C;  3W96 C;  3WTP E;  5B24 D;  5GXQ A;  4JJN C;  3H0L C;  4J8X B;  3W96 A;  2Y2O A;  1KX5 D;  5DNN C;  1HQ3 D;  5B32 G;  1H3O A;  3AV1 C;  4JJN A;  3MGS B;  1S32 B;  4H9S C;  3UTB C;  5B1L B;  5DNN A;  1A7W A;  4H9O B;  4WU8 B;  3VH5 W;  3KXB C;  3LZ0 B;  2F8N B;  3AV1 A;  1TZY B;  3X1S B;  5B0Z C;  2PYO D;  2NZD A;  4J8U D;  4H9S A;  3UTB A;  1F66 A;  5JRG A;  5B40 C;  4XZQ B;  3KWQ C;  5AV5 C;  3V9R A;  1P3B C;  3C1B D;  3TU4 C;  5AV8 D;  4YM6 C;  5B33 D;  5B40 A;  4DQY B;  3KWQ A;  2BYK A;  2FJ7 C;  1P3B A;  3TU4 A;  4YM6 A;  3B0C W;  1P3I D;  5GSU D;  3AZK C;  2FJ7 A;  5AY8 D;  5CP6 C;  2ZM5 A;  3W96 D;  5CPI B;  3MGR C;  4JJN D;  2XD1 A;  1JFI B;  1N1J B;  1BH8 B;  5DNN D;  3REL B;  1M19 C;  3LEL C;  4EO5 C;  2CV5 B;  5GT3 D;  1M19 A;  3KXB D;  4H9R A;  3LEL A;  2BYM A;  5B0Z D;  2HIO C;  3C1C C;  4CAY A;  3F6T A;  5B32 B;  5AV5 D;  3LZ1 B;  5E5A B;  3TU4 D;  3C1C A;  1HTA A;  4YM6 D;  2Y2J A;  3AZF A;  2FJ7 D;  4J8V C;  2Y2L A;  3MNN B;  3MGQ C;  1P3L C;  3P5J B;  3UT9 B;  4R8P B;  4X23 C;  4G92 C;  3AZK D;  2JE5 A;  4LD9 B;  3AZJ B;  4H9Q B;  3REK C;  5CP6 D;  1P3L A;  3W97 C;  5AV9 B;  3MGR D;  2Y2G A;  3X1U C;  3AZL B;  2YFV B;  3B6G A;  3REK A;  5CPJ C;  1P3F D;  3MGP D;  4QLC A;  3X1T B;  3W97 A;  3WTP A;  1P3K C;  4HGA C;  3O62 C;  3LEL D;  3UTA D;  3EPL A;  2F2A C;  5CPJ A;  3WA9 B;  3KUY B;  1AOI B;  2ZY2 A;  5B1M B;  1P3K A;  3O62 A;  2HIO D;  3AZH B;  3MVD C;  3C1C D;  4WU8 C;  4J8W C;  1TZY C;  5AV6 B;  5B31 B;  1ID3 D;  1KX4 B;  1S32 A;  3AZE D;  2ARO C;  5B0Y B;  4WU9 B;  1M18 C;  5B1L A;  3MVD A;  4KUD B;  2F8N A;  4WU8 A;  1TZY A;  1EQZ B;  4ZBJ C;  4J8V D;  1M18 A;  2ARO A;  3B6F B;  3MGQ D;  3WKJ D;  3WAA C;  4X23 D;  2IO5 B;  1P3A D;  3AYW B;  3AZN C;  1ZLA C;  5C3I B;  3W97 D;  3WAA A;  3X1U D;  1KX3 B;  4WNN A;  2Y2N A;  5CPJ D;  5CPI C;  3B0D C;  3AZM C;  1ZLA A;  5DNM D;  1P3K D;  3O62 D;  4Z5T B;  5GT0 C;  4H9P B;  5CPI A;  3AZM A;  1JFI A;  1N1J A;  3LJA C;  2CV5 C;  1BH8 A;  3AZG B;  3MVD D;  5AVB B;  4J8W D;  3AN2 C;  1R4V A;  3W98 B;  1M18 D;  3VH6 W;  1U35 D;  2CV5 A;  4NFT A;  5GXQ C;  3A6N B;  3AN2 A;  5F99 C;  4XUJ B;  3REJ B;  5AVC B;  5CPK C;  1P3P D;  1P34 D;  1M1A B;  3LZ1 A;  3WAA D;  3H0M C;  5F99 A;  3KSY A;  3MNN C;  5CPK A;  3AZN D;  3UT9 C;  2UWX A;  4YS3 B;  1ZLA D;  4Z66 B;  2VQR A;  5B2J B;  4LD9 C;  3REI B;  2NZD C;  3MNN A;  1F66 C;  3UT9 A;  3AZM D;  5JRG C;  4KGC B;  4LD9 A;  3AZJ A;  2BG1 A;  3REH B;  5GT0 D;  1P3M C;  2YFV A;  3AZI B;  3LJA D;  3KUY C;  1P3M A;  5B2I D;  5B1M C;  3AN2 D;  3WA9 A;  3KUY A;  1AOI A;  3W99 C;  5GXQ D;  5B1M A;  5AV6 C;  5F99 D;  2NQB B;  3AZH A;  5CPK D;  1Z2C B;  3R45 B;  3W99 A;  1BH9 B;  5AV6 A;  5B31 A;  4DRA A;  4WU9 A;  4ZUX C;  3AV2 B;  3B6F C;  4KUD A;  5JA4 B;  3AV1 D;  2Y2H A;  2NZD D;  4ZUX A;  2Y2Q A;  1PZR A;  1B67 A;  5B24 B;  3UTB D;  1F66 D;  3B6F A;  5JRG D;  4E44 A;  1KX5 B;  1HQ3 B;  1P3M D;  2YFW B;  5B40 D;  1F1E A;  3X1V C;  1P3G C;  3KWQ D;  3AZF C;  3EPK A;  1P3O C;  1KX3 A;  1P3B D;  3X1V A;  2RVQ C;  3FDD A;  1P3G A;  1P3O A;  3NQU B;  2PYO B;  4Z5T A;  4J8U B;  5AVB C;  3W99 D;  3C1B B;  3AFA C;  3W98 C;  4CSR B;  5AV8 B;  3B6G C;  4QLC C;  3A6N C;  5B33 B;  5AVB A;  3WTP C;  3AFA A;  3W98 A;  2RIQ A;  4ZUX D;  3NQJ A;  1P3I B;  3A6N A;  5GSU B;  1M19 D;  1T3U A;  5AY8 B;  3REJ A;  5AVC A;  1TAF B;  4J8X C;  3W96 B;  1M1A A;  1H3O B;  5B2J C;  4E45 A;  4JJN B;  3REI C;  3MGS C;  1S32 C;  4J8X A;  5B1L C;  5DNN B;  4YS3 A;  3LZ0 C;  4KGC C;  4Z66 A;  5B2J A;  1WWS A;  3X1V D;  3X1S C;  1P3G D;  3REI A;  3AZF D;  1P3O D;  4UUZ B;  3MGS A;  5GT3 B;  4KGC A;  4H9O A;  3LZ0 A;  4XZQ C;  3KXB B;  3X1S A;  3V9R B;  5B0Z B;  4H9N B;  3AZI C;  3REH A;  2ZY3 A;  5BO0 B;  1P3L D;  4XZQ A;  5AV5 B;  3AZI A;  3AFA D;  3B0B A;  3TU4 B;  3B6G D;  3REK D;  4YM6 B;  4QLC D;  3WTP D;  2FJ7 B;  2F8N H;  2NQB C;  3VH6 T;  4G91 B;  1ULY A;  3AZK B;  2LY8 A;  2NQB A;  5CP6 B;  4J8X D;  3R45 A;  3REL C;  1BH9 A;  3MGR B;  2DF4 C;  3MGS D;  1P3F B;  3AV2 A;  3MGP B;  5B24 C;  1S32 D;  5B1L D;  3REL A;  2F8N G;  3LZ0 D;  2F8N D;  4WU8 D;  5JA4 A;  3LEL B;  1TZY D;  3X1S D;  5KDM B;  3UTA B;  1KX5 C;  3H0R C;  2ARO D;  5B24 A;  1HQ3 C;  4Z2M H;  5B32 C;  3VH5 T;  4XZQ D;  3LZ1 C;  1WWI A;  5E5A C;  2HIO B;  1KX5 A;  3C1C B;  1HQ3 A;  4M6B A;  5B32 A;  2YFW A;  2PYO C;  1ID3 B;  5E5A A;  3AZE B;  2L5A A;  4R8P C;  3NQU A;  2PYO A;  4Z2M G;  3AZJ C;  4J8V B;  5AV8 C;  2F8N K;  4DRB A;  3B0C T;  5B33 C;  3MGQ B;  5BNV B;  5CPI D;  5BS7 C;  5AV9 C;  3WKJ B;  4R8P A;  4X23 B;  3C1B A;  3AZL C;  1B6W A;  4CSR A;  5AV8 A;  1P3A B;  4H9Q A;  5BT1 C;  3X1T C;  5B33 A;  5GSU C;  3REL D;  5BS7 A;  5AV9 A;  3W97 B;  3AZL A;  3X1U B;  5CPJ B;  1P3I A;  3X1T A;  3WA9 C;  2CV5 D;  1AOI C;  5GSU A;  5DNM B;  5AY8 A;  4KHA B;  1P3K B;  4HGA B;  3O62 B;  1TAF A;  3AZH C;  5BNX B;  4WJ3 C;  5B32 D;  5B31 C;  3LZ1 D;  1KX4 C;  4WU9 C;  5E5A D;  5B0Y C;  5GT3 C;  4KUD C;  3MVD B;  5G49 B;  4J8W B;  1EQZ C;  4UUZ A;  1KX4 A;  5B0Y A;  2ARO B;  1U35 B; 
#chains in the Genus database with same CATH homology
 5GT3 A;  3A1I A;  3MNN D;  3KXB A;  2G5I C;  2Y2M A;  3UT9 D;  4R8P D;  1EQZ A;  5B0Z A;  4H9N A;  2IO5 C;  4ZBJ B;  3AZJ D;  4LD9 D;  3AYW C;  1P3P B;  5BO0 A;  1P34 B;  5C3I C;  5AV9 D;  5AV5 A;  3WAA B;  3AZL D;  1KX3 C;  3AYW A;  5BT1 D;  4WNN B;  3X1T D;  2HUE B;  3AZN B;  1ZLA B;  4G91 C;  1Q9C A;  4Z5T C;  3B0D B;  3AZM B;  3KUY D;  1AOI D;  3WA9 D;  3AZK A;  5B1M D;  5CP6 A;  1P3F C;  3MGP C;  4H9P A;  5GT0 B;  3AZG C;  3AZH D;  3MGR A;  5B31 G;  5AV6 D;  5B31 D;  3UTA C;  1P3F A;  1KX4 D;  3MGP A;  4WU9 D;  5B0Y D;  3LJA B;  3AZG A;  5B2I B;  4KUD D;  3AN2 B;  5KDM A;  3UTA A;  4XUJ C;  3REJ C;  1EQZ D;  5FUG B;  5AVC C;  1M1A C;  3B6F D;  5GXQ B;  4NE6 A;  1ID3 C;  3AZE C;  2Y2I A;  4WV4 B;  2HIO A;  4XUJ A;  5F99 B;  3AYW D;  5CPK B;  4AWL B;  4YS3 C;  4Z66 C;  1ID3 A;  3EPJ A;  3AZE A;  1KX3 D;  2G5H C;  2ZY5 A;  1M18 B;  3WKJ C;  3VH6 A;  2Y2P A;  4J8V A;  3AV1 B;  1P3A C;  2NZD B;  4Z5T D;  3REH C;  3KFU G;  3MGQ A;  3UTB B;  5BNV A;  1F66 B;  3WKJ A;  5JRG B;  3A1K A;  4X23 A;  2RVQ D;  5CHL B;  1P3A A;  1W2E A;  5DNM C;  3AZG D;  1P3M B;  4WZS B;  5B40 B;  5AVB D;  2W8S A;  3KWQ B;  2BYK B;  2JCH A;  3X1U A;  1P3B B;  3W98 D;  5DNM A;  3AL0 C;  3A6N D;  4KHA A;  4NE3 A;  3VH5 A;  4XUJ D;  4UPK A;  3REJ D;  5BNX A;  5AVC D;  3IP4 C;  1M1A D;  3W99 B;  4NE5 A;  1U35 C;  3AV2 C;  5G49 A;  3EPH A;  4J8W A;  4YS3 D;  4Z66 D;  5B2J D;  1KU5 A;  3REI D;  1U35 A;  4ZUX B;  1P3P C;  1P34 C;  2XD5 A;  4KGC D;  1M19 B;  4H9R B;  2BYM B;  1P3P A;  3REH D;  2HUE C;  1P34 A;  4CAY B;  4EO5 B;  2JSS A;  3AZI D;  3AZN A;  2ZY4 A;  2Y2K A;  2FFF B;  3X1V B;  1P3O B;  1P3G B;  3AZF B;  4J8U C;  1BFM A;  2CWE A;  2J8P A;  3C1B C;  5GT0 A;  4J8U A;  2NQB D;  5B2I C;  1P3L B;  4G92 B;  3AFA B;  3EG5 B;  3LJA A;  3B6G B;  5B2I A;  3REK B;  3NQJ B;  3AV2 D;  4QLC B;  1P3I C;  3WTP B;  5AY8 C;  5FUG A;  2DQN C;  4AWL C;  3W96 C;  3WTP E;  5B24 D;  5GXQ A;  4JJN C;  3H0L C;  4J8X B;  3W96 A;  2Y2O A;  1KX5 D;  5DNN C;  1HQ3 D;  5B32 G;  1H3O A;  3AV1 C;  4JJN A;  3MGS B;  1S32 B;  4H9S C;  3UTB C;  5B1L B;  5DNN A;  1A7W A;  4H9O B;  4WU8 B;  3VH5 W;  3KXB C;  3LZ0 B;  2F8N B;  3AV1 A;  1TZY B;  3X1S B;  5B0Z C;  2PYO D;  2NZD A;  4J8U D;  4H9S A;  3UTB A;  1F66 A;  5JRG A;  5B40 C;  4XZQ B;  3KWQ C;  5AV5 C;  3V9R A;  1P3B C;  3C1B D;  3TU4 C;  5AV8 D;  4YM6 C;  5B33 D;  5B40 A;  4DQY B;  3KWQ A;  2BYK A;  2FJ7 C;  1P3B A;  3TU4 A;  4YM6 A;  3B0C W;  1P3I D;  5GSU D;  3AZK C;  2FJ7 A;  5AY8 D;  5CP6 C;  2ZM5 A;  3W96 D;  5CPI B;  3MGR C;  4JJN D;  2XD1 A;  1JFI B;  1N1J B;  1BH8 B;  5DNN D;  3REL B;  1M19 C;  3LEL C;  4EO5 C;  2CV5 B;  5GT3 D;  1M19 A;  3KXB D;  4H9R A;  3LEL A;  2BYM A;  5B0Z D;  2HIO C;  3C1C C;  4CAY A;  3F6T A;  5B32 B;  5AV5 D;  3LZ1 B;  5E5A B;  3TU4 D;  3C1C A;  1HTA A;  4YM6 D;  2Y2J A;  3AZF A;  2FJ7 D;  4J8V C;  2Y2L A;  3MNN B;  3MGQ C;  1P3L C;  3P5J B;  3UT9 B;  4R8P B;  4X23 C;  4G92 C;  3AZK D;  2JE5 A;  4LD9 B;  3AZJ B;  4H9Q B;  3REK C;  5CP6 D;  1P3L A;  3W97 C;  5AV9 B;  3MGR D;  2Y2G A;  3X1U C;  3AZL B;  2YFV B;  3B6G A;  3REK A;  5CPJ C;  1P3F D;  3MGP D;  4QLC A;  3X1T B;  3W97 A;  3WTP A;  1P3K C;  4HGA C;  3O62 C;  3LEL D;  3UTA D;  3EPL A;  2F2A C;  5CPJ A;  3WA9 B;  3KUY B;  1AOI B;  2ZY2 A;  5B1M B;  1P3K A;  3O62 A;  2HIO D;  3AZH B;  3MVD C;  3C1C D;  4WU8 C;  4J8W C;  1TZY C;  5AV6 B;  5B31 B;  1ID3 D;  1KX4 B;  1S32 A;  3AZE D;  2ARO C;  5B0Y B;  4WU9 B;  1M18 C;  5B1L A;  3MVD A;  4KUD B;  2F8N A;  4WU8 A;  1TZY A;  1EQZ B;  4ZBJ C;  4J8V D;  1M18 A;  2ARO A;  3B6F B;  3MGQ D;  3WKJ D;  3WAA C;  4X23 D;  2IO5 B;  1P3A D;  3AYW B;  3AZN C;  1ZLA C;  5C3I B;  3W97 D;  3WAA A;  3X1U D;  1KX3 B;  4WNN A;  2Y2N A;  5CPJ D;  5CPI C;  3B0D C;  3AZM C;  1ZLA A;  5DNM D;  1P3K D;  3O62 D;  4Z5T B;  5GT0 C;  4H9P B;  5CPI A;  3AZM A;  1JFI A;  1N1J A;  3LJA C;  2CV5 C;  1BH8 A;  3AZG B;  3MVD D;  5AVB B;  4J8W D;  3AN2 C;  1R4V A;  3W98 B;  1M18 D;  3VH6 W;  1U35 D;  2CV5 A;  4NFT A;  5GXQ C;  3A6N B;  3AN2 A;  5F99 C;  4XUJ B;  3REJ B;  5AVC B;  5CPK C;  1P3P D;  1P34 D;  1M1A B;  3LZ1 A;  3WAA D;  3H0M C;  5F99 A;  3KSY A;  3MNN C;  5CPK A;  3AZN D;  3UT9 C;  2UWX A;  4YS3 B;  1ZLA D;  4Z66 B;  2VQR A;  5B2J B;  4LD9 C;  3REI B;  2NZD C;  3MNN A;  1F66 C;  3UT9 A;  3AZM D;  5JRG C;  4KGC B;  4LD9 A;  3AZJ A;  2BG1 A;  3REH B;  5GT0 D;  1P3M C;  2YFV A;  3AZI B;  3LJA D;  3KUY C;  1P3M A;  5B2I D;  5B1M C;  3AN2 D;  3WA9 A;  3KUY A;  1AOI A;  3W99 C;  5GXQ D;  5B1M A;  5AV6 C;  5F99 D;  2NQB B;  3AZH A;  5CPK D;  1Z2C B;  3R45 B;  3W99 A;  1BH9 B;  5AV6 A;  5B31 A;  4DRA A;  4WU9 A;  4ZUX C;  3AV2 B;  3B6F C;  4KUD A;  5JA4 B;  3AV1 D;  2Y2H A;  2NZD D;  4ZUX A;  2Y2Q A;  1PZR A;  1B67 A;  5B24 B;  3UTB D;  1F66 D;  3B6F A;  5JRG D;  4E44 A;  1KX5 B;  1HQ3 B;  1P3M D;  2YFW B;  5B40 D;  1F1E A;  3X1V C;  1P3G C;  3KWQ D;  3AZF C;  3EPK A;  1P3O C;  1KX3 A;  1P3B D;  3X1V A;  2RVQ C;  3FDD A;  1P3G A;  1P3O A;  3NQU B;  2PYO B;  4Z5T A;  4J8U B;  5AVB C;  3W99 D;  3C1B B;  3AFA C;  3W98 C;  4CSR B;  5AV8 B;  3B6G C;  4QLC C;  3A6N C;  5B33 B;  5AVB A;  3WTP C;  3AFA A;  3W98 A;  2RIQ A;  4ZUX D;  3NQJ A;  1P3I B;  3A6N A;  5GSU B;  1M19 D;  1T3U A;  5AY8 B;  3REJ A;  5AVC A;  1TAF B;  4J8X C;  3W96 B;  1M1A A;  1H3O B;  5B2J C;  4E45 A;  4JJN B;  3REI C;  3MGS C;  1S32 C;  4J8X A;  5B1L C;  5DNN B;  4YS3 A;  3LZ0 C;  4KGC C;  4Z66 A;  5B2J A;  1WWS A;  3X1V D;  3X1S C;  1P3G D;  3REI A;  3AZF D;  1P3O D;  4UUZ B;  3MGS A;  5GT3 B;  4KGC A;  4H9O A;  3LZ0 A;  4XZQ C;  3KXB B;  3X1S A;  3V9R B;  5B0Z B;  4H9N B;  3AZI C;  3REH A;  2ZY3 A;  5BO0 B;  1P3L D;  4XZQ A;  5AV5 B;  3AZI A;  3AFA D;  3B0B A;  3TU4 B;  3B6G D;  3REK D;  4YM6 B;  4QLC D;  3WTP D;  2FJ7 B;  2F8N H;  2NQB C;  3VH6 T;  4G91 B;  1ULY A;  3AZK B;  2LY8 A;  2NQB A;  5CP6 B;  4J8X D;  3R45 A;  3REL C;  1BH9 A;  3MGR B;  2DF4 C;  3MGS D;  1P3F B;  3AV2 A;  3MGP B;  5B24 C;  1S32 D;  5B1L D;  3REL A;  2F8N G;  3LZ0 D;  2F8N D;  4WU8 D;  5JA4 A;  3LEL B;  1TZY D;  3X1S D;  5KDM B;  3UTA B;  1KX5 C;  3H0R C;  2ARO D;  5B24 A;  1HQ3 C;  4Z2M H;  5B32 C;  3VH5 T;  4XZQ D;  3LZ1 C;  1WWI A;  5E5A C;  2HIO B;  1KX5 A;  3C1C B;  1HQ3 A;  4M6B A;  5B32 A;  2YFW A;  2PYO C;  1ID3 B;  5E5A A;  3AZE B;  2L5A A;  4R8P C;  3NQU A;  2PYO A;  4Z2M G;  3AZJ C;  4J8V B;  5AV8 C;  2F8N K;  4DRB A;  3B0C T;  5B33 C;  3MGQ B;  5BNV B;  5CPI D;  5BS7 C;  5AV9 C;  3WKJ B;  4R8P A;  4X23 B;  3C1B A;  3AZL C;  1B6W A;  4CSR A;  5AV8 A;  1P3A B;  4H9Q A;  5BT1 C;  3X1T C;  5B33 A;  5GSU C;  3REL D;  5BS7 A;  5AV9 A;  3W97 B;  3AZL A;  3X1U B;  5CPJ B;  1P3I A;  3X1T A;  3WA9 C;  2CV5 D;  1AOI C;  5GSU A;  5DNM B;  5AY8 A;  4KHA B;  1P3K B;  4HGA B;  3O62 B;  1TAF A;  3AZH C;  5BNX B;  4WJ3 C;  5B32 D;  5B31 C;  3LZ1 D;  1KX4 C;  4WU9 C;  5E5A D;  5B0Y C;  5GT3 C;  4KUD C;  3MVD B;  5G49 B;  4J8W B;  1EQZ C;  4UUZ A;  1KX4 A;  5B0Y A;  2ARO B;  1U35 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...