4E44A

Crystal structure of the hmhf1/hmhf2 histone-fold tetramer
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
104
structure length
104
Chain Sequence
GSMEEEAETEEQQRFSYQQRLKAAVHYTVGCLCEEVALDKEMQFSKQTIAAISELTFRQCENFAKDLEMFARHAKRTTINTEDVKLLARRSNSLLKYITDKSEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords Centromere protein S
publication title Crystal Structures Reveal that FANCM remodels the MHF Tetramer in favor of binding Branched DNA
rcsb
source organism Homo sapiens
total genus 41
structure length 104
sequence length 104
chains with identical sequence C
ec nomenclature
pdb deposition date 2012-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF15630 CENP-S CENP-S protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4e44A00
1M19A 3AZKA 1M1AB 3X1TD 2HIOD 4CAYB 5AV5B 5DNND 1BH9B 5JRGC 5B32A 5AVBA 3WTPC 4J8WC 3B6GC 3MNNB 4YS3A 1P3IA 3AZFD 1U35B 3RELB 5AVBD 5GSUB 2FJ7C 1S32B 3AV2B 4R8PA 3LZ0B 3W98C 3AZGB 3MGQB 4Z66D 3KXBB 3MGSA 5B24D 3AZHB 4R8PD 5AV5C 1M18D 5AV8D 1H3OA 3X1SC 5B40C 1AOID 2AROA 4WU9D 3MGSD 3AZIB 1P34A 3REJA 3WKJB 5GT0B 5B0ZD 1F66B 5AY8B 2AROD 1B67A 3AN2C 3AV2C 3LZ0C 5B1LB 5CPJB 2NZDB 1BH8A 3REJD 3AV1C 2F8NA 1P3FC 4WNNB 4ZUXC 3AZHC 3UTAD 2YFVA 1KX5B 2F8ND 5AVCA 5B0YC 3AZIC 1P3PD 4H9QB 2RVQC 1EQZA 1N1JB 3WAAB 3LZ1D 3WKJC 5GT0C 3UT9A 3NQJA 5AVCD 5AY8C 4YM6D 4AWLC 1P3OA 1EQZD 3X1TB 2HIOB 3WA9C 5B33A 5DNNB 2YFWB 3AZFB 4CSRA 5AV6A 3B0CW 4KGCA 5AVBB 5GT3C 5JRGA 3B6GA 4J8XA 3MGPA 4Z66B 5CPKA 2HIOC 5B24B 5JRGD 3WTPD 4J8WD 1M18B 3B6GD 5AV8B 3KWQA 2FJ7A 1F1EA 4H9RA 3UTBB 1AOIB 3AZFC 4WU9B 3MGSB 3W98A 2FJ7D 4NFTA 4Z2MH 4CAYA 5B0ZB 5AV9C 5AV5A 1BH9A 3MNNA 4G91C 3REJB 4ZBJB 4Z66C 4EO5B 4XUJC 3KUYC 1U35A 3RELA 3UTAB 1M18C 3AZEC 5GSUA 3X1SD 1BH8B 4NE6A 5B40D 3B6FC 3UTBC 2F8NB 1AOIC 3AV2A 3AN2A 1A7WA 3LZ0A 5GXQD 1P3PB 3AZGA 4KHAB 3A6NB 3AV1A 3LZ1B 4NE3A 5B0ZC 1P3FA 3KXBA 4YM6B 4ZUXA 3AN2D 3AZHA 3AV2D 1HTAA 3LZ0D 4WZSB 3AZLC 1EQZB 3AV1D 1P3FD 4ZUXD 3AZIA 3AZHD 2NQBB 5BS7C 4X23D 3WKJA 5GT0A 5AY8A 4DRBA 4KUDB 5B0YD 3AZID 4XZQC 2RVQD 5CPJA 1P3PC 3C1BB 2NZDA 3VH6A 5B2IC 3A6NC 3WKJD 5B31G 4CSRB 4J8UB 5KDMA 3WA9D 1KX5A 3WTPB 5JRGB 4J8WB 1TAFB 1ULYA 4H9QA 2NQBC 3WAAA 3AZNC 5GT3A 3VH5A 4KUDC 3X1TA 3C1BC 2FJ7B 2HIOA 4UUZB 5GT3D 3X1VB 5CPIB 5DNNA 4J8UC 2YFWA 2BYKB 3AZFA 3AZMB 5DNMC 3X1SB 5B40B 3B0CT 3AYWC 5AV9A 5GXQB 1P3BD 4Z66A 5AV9D 5JA4B 2CV5C 3AN2B 5B24A 3X1VC 5CPIC 1M18A 5AV8A 3AZJC 1P3MD 3AV1B 4XUJD 3KUYD 3UTBA 1AOIA 5F99C 4WU9A 1P3FB 3AZMC 4ZUXB 3REKD 4X23B 3AZED 3B6FD 3B0DC 5B0ZA 3UTBD 5B0YB 1TZYC 5GXQC 3LJAD 4DRAA 4JJNB 3UTAA 3AZLD 4AWLB 5B1MC 1JFIB 1KX3D 3AFAD 3WA9B 5B31C 5B2JD 1P3PA 4KHAA 5KDMB 4X23C 3A6NA 3LZ1A 4QLCB 4YM6A 4J8VB 4XZQD 5B2ID 3A6ND 5B32G 4H9NB 5GT3B 3W97B 4JJNC 2NQBA 3REIC 4Z2MG 4KUDA 2NQBD 3C1BA 3AZND 4QLCC 4KUDD 4J8VC 4J8UA 1P3GC 1P3BB 3C1BD 3MGRC 5G49B 5AV9B 3WTPA 4J8WA 3W97C 1TAFA 5DNMA 4J8UD 4G91B 2HUEC 1P3MB 4XUJB 3KUYB 3W99C 3WTPE 3REKB 5DNMD 1P3AB 3AZEB 3B6FB 3W96C 3AYWD 4UUZA 2CV5A 1Q9CA 3X1VA 5CPIA 2BYMB 1P3BC 3LJAB 5BNXB 2BYKA 5F99A 2CV5D 3AZMA 3X1VD 5CPID 2IO5B 3C1CB 3AZLB 3AZJD 3R45B 3X1SA 5B40A 3AFAB 1P3MC 1KX3B 5F99D 4WU8B 3AZMD 5CP6C 5B2JB 5GXQA 3REKC 1P3AC 1ZLAB 3TU4C 2CWEA 5JA4A 4XZQB 1TZYD 3NQUB 5E5AC 5B2IB 3AZKC 5B31A 3LJAC 1M19C 2IO5C 5B1MD 3C1CC 5B32C 4X23A 3REHD 5B31D 1KX3C 3AFAC 1P3IC 4WU8C 5B0YA 5B2JC 1WWSA 3KSYA 3AZNB 1ZLAC 4JJNA 4H9PB 1JFIA 5FUGB 3WA9A 3LELB 1KX4B 3VH6T 1B6WA 4JJND 1P3KC 3REID 4QLCA 4J8VA 5DNMB 3MGRA 3AYWB 4QLCD 4H9NA 3W97A 4J8VD 4LD9B 3VH5T 1P3GD 3X1UC 3LELC 3O62C 3MGRD 1KX4C 2CV5B 3W97D 3V9RA 3W96A 3AZJB 1HQ3C 3W99D 5F99B 1ID3B 5BO0B 2L5AA 1P3BA 3B0DB 3W96D 5G49A 3UT9C 4LD9C 3MVDB 1TZYB 1KU5A 1P3OC 1P3MA 4XUJA 3KUYA 5BNVB 3REKA 1P3AA 5B1MB 3REHB 3AZEA 3B6FA 3TU4A 5B31B 1ID3C 2BYMA 5CP6D 1P3AD 5AV6C 5E5AA 4KGCC 3LJAA 5BNXA 3TU4D 2PYOC 3MVDC 5BT1C 3C1CA 4J8XC 3AZLA 5E5AD 1M19D 3R45A 3MGPC 4G92B 3AZKD 3AFAA 1KX3A 4WU8A 5CPKC 5B2JA 3VH6W 5BS7A 5B32D 3C1CD 4HGAB 3REIB 3REHC 3KWQC 4YS3D 1ZLAA 1P3ID 4H9SC 4WU8D 4XZQA 4Z5TC 1ZLAD 3NQUA 5B2IA 1M1AC 1P3KA 1P3GB 3MNNC 4G92C 3VH5W 3MGRB 1U35C 1P3KD 3RELC 3AZNA 2HUEB 4HGAC 5GSUC 3W99B 1S32C 3V9RB 4H9PA 3X1UA 5FUGA 1P34D 3AZGC 3W96B 3LELA 3O62A 3MGQC 1KX4A 3KXBC 4M6BA 3X1UD 1R4VA 1HQ3A 3LELD 3O62D 1KX4D 5C3IB 1HQ3D 3AYWA 1P3LB 1F66C 4LD9A 5CP6B 5B1LC 5CPJC 2NZDC 3TU4B 3UT9D 4LD9D 4NE5A 4H9OA 2F8NG 5E5AB 3AZJA 3AZKB 1P3OD 1M19B 1ID3A 5BO0A 1KX5C 5B33D 5B32B 2PYOA 3WAAC 5C3IC 4YS3B 1P3IB 1ID3D 3B0BA 1P3LC 3MVDA 1TZYA 5AV6D 4KGCD 2PYOD 3X1TC 5BNVA 3MVDD 4R8PB 5BT1D 5DNNC 2LY8A 5B1MA 4J8XD 3MGPD 3REHA 4H9SA 5CPKD 4Z5TA 1P3KB 5AVBC 3KWQD 1M1AA 4YS3C 1H3OB 2AROB 2F8NH 4Z5TD 3W98D 1P34B 1M1AD 1BFMA 5AV5D 5B24C 4R8PC 3X1UB 3REIA 5AV8C 3MNND 3O62B 1S32A 1U35D 4WU9C 3MGSC 3RELD 3MGQA 5GSUD 1HQ3B 2YFVB 1S32D 5AVCB 2AROC 1P3GA 3AZGD 1P34C 3MGQD 3REJC 2F8NK 4ZBJC 4EO5C 3KXBD 3NQJB 3UT9B 4E45A 3UTAC 1P3OB 3W99A 1F66A 5B33B 4H9OB 5B1LA 5GT0D 3LZ1C 1F66D 5AY8D 4WNNA 4YM6C 5AVCC 5AV6B 4KGCB 5B1LD 5CPJD 2NZDD 4E44A 1EQZC 2PYOB 1WWIA 3B6GB 4J8XB 3MGPB 1N1JA 5CPKB 1P3LA 1KX5D 5B33C 5CP6A 4WV4B 3KWQB 2JSSA 3WAAD 4H9RB 5CHLB 1P3LD 4Z5TB 3W98B
chains in the Genus database with same CATH superfamily
1M19A 3AZKA 1M1AB 3X1TD 2HIOD 4CAYB 3A1IA 5DNND 1BH9B 5JRGC 5B32A 5AVBA 5AV5B 3WTPC 4J8WC 3B6GC 3MNNB 4YS3A 2Y2NA 1P3IA 3AZFD 1U35B 3RELB 5AVBD 2F2AC 5GSUB 2FJ7C 1S32B 3AV2B 4R8PA 3LZ0B 3W98C 3AZGB 3MGQB 4Z66D 3KXBB 3MGSA 2FFFB 5B24D 3AZHB 4R8PD 5AV5C 1M18D 5AV8D 1H3OA 3X1SC 5B40C 1AOID 2AROA 4WU9D 3MGSD 3AZIB 1P34A 3REJA 3WKJB 5GT0B 5B0ZD 1F66B 5AY8B 2AROD 1B67A 3AN2C 3AV2C 3LZ0C 2Y2LA 5B1LB 5CPJB 2NZDB 1BH8A 3REJD 3AV1C 2F8NA 1P3FC 4WNNB 4ZUXC 3AZHC 3UTAD 2DQNC 2YFVA 1KX5B 2F8ND 5AVCA 5B0YC 3AZIC 1P3PD 4H9QB 2RVQC 1EQZA 1N1JB 3WAAB 3KFUG 3LZ1D 3WKJC 5GT0C 3UT9A 3NQJA 5AVCD 5AY8C 4YM6D 3EPHA 2J8PA 4AWLC 1P3OA 1EQZD 3X1TB 2HIOB 3WA9C 5B33A 5DNNB 2YFWB 3AZFB 4CSRA 5AV6A 3B0CW 4KGCA 5AVBB 5GT3C 5JRGA 3B6GA 4J8XA 3MGPA 4Z66B 5CPKA 2HIOC 5B24B 5JRGD 3WTPD 4J8WD 1M18B 3B6GD 5AV8B 3KWQA 2FJ7A 1F1EA 3H0LC 4H9RA 3UTBB 3AZFC 4WU9B 3MGSB 1AOIB 3W98A 2JCHA 2FJ7D 4NFTA 4Z2MH 4CAYA 5B0ZB 5AV9C 5AV5A 1BH9A 3MNNA 4G91C 3IP4C 3REJB 4ZBJB 4Z66C 2G5HC 4EO5B 4XUJC 3KUYC 1U35A 4DQYB 3RELA 3UTAB 1M18C 3AZEC 5GSUA 3X1SD 1BH8B 4NE6A 5B40D 3B6FC 3UTBC 2F8NB 1PZRA 3AV2A 3AN2A 1AOIC 1A7WA 3LZ0A 5GXQD 1P3PB 3AZGA 4KHAB 3A6NB 3AV1A 3LZ1B 4NE3A 5B0ZC 1P3FA 3KXBA 4YM6B 4ZUXA 3AN2D 3AZHA 3AV2D 1HTAA 3LZ0D 4WZSB 3AZLC 1EQZB 3AV1D 1P3FD 4ZUXD 3AZIA 3AZHD 2NQBB 5BS7C 4X23D 3WKJA 5GT0A 5AY8A 4DRBA 4KUDB 5B0YD 3AZID 4XZQC 2RVQD 5CPJA 1P3PC 3C1BB 2NZDA 3VH6A 5B2IC 3A6NC 3WKJD 5B31G 4CSRB 4J8UB 5KDMA 3WA9D 1KX5A 3WTPB 5JRGB 4J8WB 1TAFB 1ULYA 4H9QA 2NQBC 3WAAA 3AZNC 5GT3A 3VH5A 4KUDC 3H0RC 3X1TA 3C1BC 2FJ7B 2HIOA 4UUZB 5GT3D 3X1VB 2UWXA 5CPIB 5DNNA 4J8UC 2YFWA 2BYKB 3AZFA 3AZMB 5DNMC 3X1SB 5B40B 3B0CT 3AYWC 5AV9A 5GXQB 1P3BD 4Z66A 5AV9D 5JA4B 2CV5C 3AN2B 5B24A 3X1VC 5CPIC 1M18A 5AV8A 3AZJC 1P3MD 3EPKA 3AV1B 4XUJD 3KUYD 3UTBA 1AOIA 5F99C 4WU9A 1P3FB 3AZMC 4ZUXB 3REKD 4X23B 3AZED 3B6FD 3B0DC 3H0MC 5B0ZA 3UTBD 5B0YB 1TZYC 5GXQC 2Y2PA 3LJAD 4DRAA 4JJNB 3UTAA 3AZLD 4AWLB 2RIQA 5B1MC 1JFIB 2JE5A 1Z2CB 1KX3D 3AFAD 3WA9B 5B31C 5B2JD 1P3PA 4KHAA 5KDMB 4X23C 3A6NA 3LZ1A 4QLCB 4YM6A 4J8VB 4XZQD 5B2ID 3A6ND 2Y2OA 5B32G 4H9NB 5GT3B 3W97B 2G5IC 4JJNC 2NQBA 3REIC 4Z2MG 4KUDA 2NQBD 3C1BA 3AZND 3F6TA 4QLCC 4KUDD 4J8VC 4J8UA 1P3GC 1P3BB 3C1BD 3MGRC 5G49B 5AV9B 2Y2KA 3WTPA 4J8WA 3W97C 1TAFA 5DNMA 4J8UD 4G91B 2HUEC 1P3MB 4XUJB 3KUYB 3W99C 3WTPE 3REKB 5DNMD 1P3AB 3AZEB 3B6FB 3W96C 3AYWD 4UUZA 2CV5A 1Q9CA 3X1VA 5CPIA 2BYMB 2Y2MA 1P3BC 3LJAB 5BNXB 2BYKA 5F99A 2CV5D 3AZMA 3X1VD 5CPID 2IO5B 3C1CB 3AZLB 3AZJD 3R45B 3X1SA 5B40A 3AFAB 1P3MC 1KX3B 5F99D 4WU8B 3AZMD 5CP6C 5B2JB 5GXQA 3REKC 1P3AC 1ZLAB 3TU4C 2CWEA 5JA4A 4XZQB 1TZYD 3NQUB 5E5AC 5B2IB 3AZKC 5B31A 3LJAC 1M19C 2IO5C 5B1MD 3C1CC 5B32C 4X23A 3REHD 5B31D 1KX3C 3AFAC 1P3IC 4WU8C 5B0YA 5B2JC 1WWSA 3KSYA 3AZNB 1ZLAC 2Y2JA 4JJNA 4H9PB 1JFIA 5FUGB 3WA9A 3LELB 1KX4B 3VH6T 1B6WA 4JJND 1P3KC 3REID 4QLCA 4J8VA 2DF4C 5DNMB 3MGRA 3AYWB 4QLCD 4H9NA 3W97A 4J8VD 4LD9B 3VH5T 1P3GD 3X1UC 3LELC 3O62C 3MGRD 1KX4C 2CV5B 3W97D 3V9RA 3W96A 3AZJB 2W8SA 1HQ3C 3W99D 5F99B 1ID3B 5BO0B 2L5AA 1P3BA 3B0DB 3W96D 5G49A 3UT9C 3FDDA 3MVDB 4LD9C 1TZYB 1KU5A 1P3OC 1P3MA 4XUJA 3KUYA 5BNVB 2ZM5A 3REKA 2VQRA 1P3AA 5B1MB 3REHB 3AZEA 3B6FA 2XD5A 3TU4A 5B31B 1ID3C 2BYMA 5CP6D 1P3AD 5AV6C 5E5AA 4KGCC 3LJAA 5BNXA 3TU4D 2PYOC 3MVDC 5BT1C 3C1CA 4J8XC 3AZLA 5E5AD 1M19D 3R45A 3MGPC 4G92B 3AZKD 3AFAA 1KX3A 4WU8A 5CPKC 5B2JA 3VH6W 5BS7A 3EG5B 5B32D 4HGAB 3C1CD 3REHC 3KWQC 4YS3D 3REIB 1ZLAA 1P3ID 4H9SC 4WU8D 4XZQA 4Z5TC 2ZY3A 1ZLAD 3NQUA 5B2IA 1M1AC 3EPJA 1P3KA 1P3GB 3MNNC 4G92C 3VH5W 3MGRB 4UPKA 1U35C 1W2EA 1P3KD 3RELC 3AZNA 2HUEB 4HGAC 5GSUC 3W99B 1S32C 3V9RB 4H9PA 3X1UA 5FUGA 1P34D 3AZGC 3W96B 3LELA 3O62A 3MGQC 1KX4A 3KXBC 4M6BA 3X1UD 1R4VA 1HQ3A 3LELD 3O62D 1KX4D 3AL0C 2ZY2A 5C3IB 1HQ3D 3AYWA 1P3LB 1F66C 4LD9A 5CP6B 5B1LC 5CPJC 2NZDC 3TU4B 3UT9D 4LD9D 4NE5A 4H9OA 2F8NG 5E5AB 3AZJA 3AZKB 1P3OD 1M19B 1ID3A 2Y2GA 2XD1A 5BO0A 5B33D 1KX5C 1T3UA 5B32B 2PYOA 3WAAC 5C3IC 4YS3B 1P3IB 1ID3D 3B0BA 1P3LC 3EPLA 3MVDA 1TZYA 5AV6D 4KGCD 2PYOD 3X1TC 5BNVA 3P5JB 3MVDD 5BT1D 4R8PB 5DNNC 2LY8A 5B1MA 4J8XD 3MGPD 3REHA 4H9SA 5CPKD 4Z5TA 1P3KB 4WJ3C 5AVBC 3KWQD 1M1AA 4YS3C 1H3OB 2AROB 2Y2QA 2F8NH 4Z5TD 3W98D 1P34B 1M1AD 1BFMA 5AV5D 5B24C 4R8PC 3X1UB 3REIA 5AV8C 3MNND 3O62B 1S32A 1U35D 4WU9C 3MGSC 3RELD 3MGQA 5GSUD 1HQ3B 2YFVB 1S32D 5AVCB 2AROC 1P3GA 3AZGD 1P34C 3MGQD 3REJC 2F8NK 4ZBJC 4EO5C 3KXBD 3NQJB 3UT9B 4E45A 3UTAC 1P3OB 3A1KA 2BG1A 3W99A 1F66A 5B33B 4H9OB 5B1LA 5GT0D 3LZ1C 1F66D 5AY8D 2ZY4A 2Y2IA 4WNNA 5AVCC 4YM6C 5AV6B 4KGCB 5B1LD 5CPJD 2NZDD 4E44A 1EQZC 2PYOB 1WWIA 3B6GB 4J8XB 2ZY5A 1N1JA 3MGPB 5CPKB 1P3LA 1KX5D 5B33C 5CP6A 4WV4B 3KWQB 2JSSA 3WAAD 2Y2HA 4H9RB 5CHLB 1P3LD 4Z5TB 3W98B
chains in the Genus database with same CATH topology
1M19A 3AZKA 1M1AB 3X1TD 2HIOD 4CAYB 3A1IA 5DNND 1BH9B 5JRGC 5B32A 5AVBA 5AV5B 3WTPC 4J8WC 3B6GC 3MNNB 4YS3A 2Y2NA 1P3IA 3AZFD 1U35B 3RELB 5AVBD 2F2AC 5GSUB 2FJ7C 1S32B 3AV2B 4R8PA 3LZ0B 3W98C 3AZGB 3MGQB 4Z66D 3KXBB 3MGSA 2FFFB 5B24D 3AZHB 4R8PD 5AV5C 1M18D 5AV8D 1H3OA 3X1SC 5B40C 1AOID 2AROA 4WU9D 3MGSD 3AZIB 1P34A 3REJA 3WKJB 5GT0B 5B0ZD 1F66B 5AY8B 2AROD 1B67A 3AN2C 3AV2C 3LZ0C 2Y2LA 5B1LB 5CPJB 2NZDB 1BH8A 3REJD 3AV1C 2F8NA 1P3FC 4WNNB 4ZUXC 3AZHC 3UTAD 2DQNC 2YFVA 1KX5B 2F8ND 5AVCA 5B0YC 3AZIC 1P3PD 4H9QB 2RVQC 1EQZA 1N1JB 3WAAB 3KFUG 3LZ1D 3WKJC 5GT0C 3UT9A 3NQJA 5AVCD 5AY8C 4YM6D 3EPHA 2J8PA 4AWLC 1P3OA 1EQZD 3X1TB 2HIOB 3WA9C 5B33A 5DNNB 2YFWB 3AZFB 4CSRA 5AV6A 3B0CW 4KGCA 5AVBB 5GT3C 5JRGA 3B6GA 4J8XA 3MGPA 4Z66B 5CPKA 2HIOC 5B24B 5JRGD 3WTPD 4J8WD 1M18B 3B6GD 5AV8B 3KWQA 2FJ7A 1F1EA 3H0LC 4H9RA 3UTBB 3AZFC 4WU9B 3MGSB 1AOIB 3W98A 2JCHA 2FJ7D 4NFTA 4Z2MH 4CAYA 5B0ZB 5AV9C 5AV5A 1BH9A 3MNNA 4G91C 3IP4C 3REJB 4ZBJB 4Z66C 2G5HC 4EO5B 4XUJC 3KUYC 1U35A 4DQYB 3RELA 3UTAB 1M18C 3AZEC 5GSUA 3X1SD 1BH8B 4NE6A 5B40D 3B6FC 3UTBC 2F8NB 1PZRA 3AV2A 3AN2A 1AOIC 1A7WA 3LZ0A 5GXQD 1P3PB 3AZGA 4KHAB 3A6NB 3AV1A 3LZ1B 4NE3A 5B0ZC 1P3FA 3KXBA 4YM6B 4ZUXA 3AN2D 3AZHA 3AV2D 1HTAA 3LZ0D 4WZSB 3AZLC 1EQZB 3AV1D 1P3FD 4ZUXD 3AZIA 3AZHD 2NQBB 5BS7C 4X23D 3WKJA 5GT0A 5AY8A 4DRBA 4KUDB 5B0YD 3AZID 4XZQC 2RVQD 5CPJA 1P3PC 3C1BB 2NZDA 3VH6A 5B2IC 3A6NC 3WKJD 5B31G 4CSRB 4J8UB 5KDMA 3WA9D 1KX5A 3WTPB 5JRGB 4J8WB 1TAFB 1ULYA 4H9QA 2NQBC 3WAAA 3AZNC 5GT3A 3VH5A 4KUDC 3H0RC 3X1TA 3C1BC 2FJ7B 2HIOA 4UUZB 5GT3D 3X1VB 2UWXA 5CPIB 5DNNA 4J8UC 2YFWA 2BYKB 3AZFA 3AZMB 5DNMC 3X1SB 5B40B 3B0CT 3AYWC 5AV9A 5GXQB 1P3BD 4Z66A 5AV9D 5JA4B 2CV5C 3AN2B 5B24A 3X1VC 5CPIC 1M18A 5AV8A 3AZJC 1P3MD 3EPKA 3AV1B 4XUJD 3KUYD 3UTBA 1AOIA 5F99C 4WU9A 1P3FB 3AZMC 4ZUXB 3REKD 4X23B 3AZED 3B6FD 3B0DC 3H0MC 5B0ZA 3UTBD 5B0YB 1TZYC 5GXQC 2Y2PA 3LJAD 4DRAA 4JJNB 3UTAA 3AZLD 4AWLB 2RIQA 5B1MC 1JFIB 2JE5A 1Z2CB 1KX3D 3AFAD 3WA9B 5B31C 5B2JD 1P3PA 4KHAA 5KDMB 4X23C 3A6NA 3LZ1A 4QLCB 4YM6A 4J8VB 4XZQD 5B2ID 3A6ND 2Y2OA 5B32G 4H9NB 5GT3B 3W97B 2G5IC 4JJNC 2NQBA 3REIC 4Z2MG 4KUDA 2NQBD 3C1BA 3AZND 3F6TA 4QLCC 4KUDD 4J8VC 4J8UA 1P3GC 1P3BB 3C1BD 3MGRC 5G49B 5AV9B 2Y2KA 3WTPA 4J8WA 3W97C 1TAFA 5DNMA 4J8UD 4G91B 2HUEC 1P3MB 4XUJB 3KUYB 3W99C 3WTPE 3REKB 5DNMD 1P3AB 3AZEB 3B6FB 3W96C 3AYWD 4UUZA 2CV5A 1Q9CA 3X1VA 5CPIA 2BYMB 2Y2MA 1P3BC 3LJAB 5BNXB 2BYKA 5F99A 2CV5D 3AZMA 3X1VD 5CPID 2IO5B 3C1CB 3AZLB 3AZJD 3R45B 3X1SA 5B40A 3AFAB 1P3MC 1KX3B 5F99D 4WU8B 3AZMD 5CP6C 5B2JB 5GXQA 3REKC 1P3AC 1ZLAB 3TU4C 2CWEA 5JA4A 4XZQB 1TZYD 3NQUB 5E5AC 5B2IB 3AZKC 5B31A 3LJAC 1M19C 2IO5C 5B1MD 3C1CC 5B32C 4X23A 3REHD 5B31D 1KX3C 3AFAC 1P3IC 4WU8C 5B0YA 5B2JC 1WWSA 3KSYA 3AZNB 1ZLAC 2Y2JA 4JJNA 4H9PB 1JFIA 5FUGB 3WA9A 3LELB 1KX4B 3VH6T 1B6WA 4JJND 1P3KC 3REID 4QLCA 4J8VA 2DF4C 5DNMB 3MGRA 3AYWB 4QLCD 4H9NA 3W97A 4J8VD 4LD9B 3VH5T 1P3GD 3X1UC 3LELC 3O62C 3MGRD 1KX4C 2CV5B 3W97D 3V9RA 3W96A 3AZJB 2W8SA 1HQ3C 3W99D 5F99B 1ID3B 5BO0B 2L5AA 1P3BA 3B0DB 3W96D 5G49A 3UT9C 3FDDA 3MVDB 4LD9C 1TZYB 1KU5A 1P3OC 1P3MA 4XUJA 3KUYA 5BNVB 2ZM5A 3REKA 2VQRA 1P3AA 5B1MB 3REHB 3AZEA 3B6FA 2XD5A 3TU4A 5B31B 1ID3C 2BYMA 5CP6D 1P3AD 5AV6C 5E5AA 4KGCC 3LJAA 5BNXA 3TU4D 2PYOC 3MVDC 5BT1C 3C1CA 4J8XC 3AZLA 5E5AD 1M19D 3R45A 3MGPC 4G92B 3AZKD 3AFAA 1KX3A 4WU8A 5CPKC 5B2JA 3VH6W 5BS7A 3EG5B 5B32D 4HGAB 3C1CD 3REHC 3KWQC 4YS3D 3REIB 1ZLAA 1P3ID 4H9SC 4WU8D 4XZQA 4Z5TC 2ZY3A 1ZLAD 3NQUA 5B2IA 1M1AC 3EPJA 1P3KA 1P3GB 3MNNC 4G92C 3VH5W 3MGRB 4UPKA 1U35C 1W2EA 1P3KD 3RELC 3AZNA 2HUEB 4HGAC 5GSUC 3W99B 1S32C 3V9RB 4H9PA 3X1UA 5FUGA 1P34D 3AZGC 3W96B 3LELA 3O62A 3MGQC 1KX4A 3KXBC 4M6BA 3X1UD 1R4VA 1HQ3A 3LELD 3O62D 1KX4D 3AL0C 2ZY2A 5C3IB 1HQ3D 3AYWA 1P3LB 1F66C 4LD9A 5CP6B 5B1LC 5CPJC 2NZDC 3TU4B 3UT9D 4LD9D 4NE5A 4H9OA 2F8NG 5E5AB 3AZJA 3AZKB 1P3OD 1M19B 1ID3A 2Y2GA 2XD1A 5BO0A 5B33D 1KX5C 1T3UA 5B32B 2PYOA 3WAAC 5C3IC 4YS3B 1P3IB 1ID3D 3B0BA 1P3LC 3EPLA 3MVDA 1TZYA 5AV6D 4KGCD 2PYOD 3X1TC 5BNVA 3P5JB 3MVDD 5BT1D 4R8PB 5DNNC 2LY8A 5B1MA 4J8XD 3MGPD 3REHA 4H9SA 5CPKD 4Z5TA 1P3KB 4WJ3C 5AVBC 3KWQD 1M1AA 4YS3C 1H3OB 2AROB 2Y2QA 2F8NH 4Z5TD 3W98D 1P34B 1M1AD 1BFMA 5AV5D 5B24C 4R8PC 3X1UB 3REIA 5AV8C 3MNND 3O62B 1S32A 1U35D 4WU9C 3MGSC 3RELD 3MGQA 5GSUD 1HQ3B 2YFVB 1S32D 5AVCB 2AROC 1P3GA 3AZGD 1P34C 3MGQD 3REJC 2F8NK 4ZBJC 4EO5C 3KXBD 3NQJB 3UT9B 4E45A 3UTAC 1P3OB 3A1KA 2BG1A 3W99A 1F66A 5B33B 4H9OB 5B1LA 5GT0D 3LZ1C 1F66D 5AY8D 2ZY4A 2Y2IA 4WNNA 5AVCC 4YM6C 5AV6B 4KGCB 5B1LD 5CPJD 2NZDD 4E44A 1EQZC 2PYOB 1WWIA 3B6GB 4J8XB 2ZY5A 1N1JA 3MGPB 5CPKB 1P3LA 1KX5D 5B33C 5CP6A 4WV4B 3KWQB 2JSSA 3WAAD 2Y2HA 4H9RB 5CHLB 1P3LD 4Z5TB 3W98B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1M19 A;  3AZK A;  1M1A B;  3X1T D;  2HIO D;  4CAY B;  5AV5 B;  5DNN D;  1BH9 B;  5JRG C;  5B32 A;  5AVB A;  3WTP C;  4J8W C;  3B6G C;  3MNN B;  4YS3 A;  1P3I A;  3AZF D;  1U35 B;  3REL B;  5AVB D;  5GSU B;  2FJ7 C;  1S32 B;  3AV2 B;  4R8P A;  3LZ0 B;  3W98 C;  3AZG B;  3MGQ B;  4Z66 D;  3KXB B;  3MGS A;  5B24 D;  3AZH B;  4R8P D;  5AV5 C;  1M18 D;  5AV8 D;  1H3O A;  3X1S C;  5B40 C;  1AOI D;  2ARO A;  4WU9 D;  3MGS D;  3AZI B;  1P34 A;  3REJ A;  3WKJ B;  5GT0 B;  5B0Z D;  1F66 B;  5AY8 B;  2ARO D;  1B67 A;  3AN2 C;  3AV2 C;  3LZ0 C;  5B1L B;  5CPJ B;  2NZD B;  1BH8 A;  3REJ D;  3AV1 C;  2F8N A;  1P3F C;  4WNN B;  4ZUX C;  3AZH C;  3UTA D;  2YFV A;  1KX5 B;  2F8N D;  5AVC A;  5B0Y C;  3AZI C;  1P3P D;  4H9Q B;  2RVQ C;  1EQZ A;  1N1J B;  3WAA B;  3LZ1 D;  3WKJ C;  5GT0 C;  3UT9 A;  3NQJ A;  5AVC D;  5AY8 C;  4YM6 D;  4AWL C;  1P3O A;  1EQZ D;  3X1T B;  2HIO B;  3WA9 C;  5B33 A;  5DNN B;  2YFW B;  3AZF B;  4CSR A;  5AV6 A;  3B0C W;  4KGC A;  5AVB B;  5GT3 C;  5JRG A;  3B6G A;  4J8X A;  3MGP A;  4Z66 B;  5CPK A;  2HIO C;  5B24 B;  5JRG D;  3WTP D;  4J8W D;  1M18 B;  3B6G D;  5AV8 B;  3KWQ A;  2FJ7 A;  1F1E A;  4H9R A;  3UTB B;  1AOI B;  3AZF C;  4WU9 B;  3MGS B;  3W98 A;  2FJ7 D;  4NFT A;  4Z2M H;  4CAY A;  5B0Z B;  5AV9 C;  5AV5 A;  1BH9 A;  3MNN A;  4G91 C;  3REJ B;  4ZBJ B;  4Z66 C;  4EO5 B;  4XUJ C;  3KUY C;  1U35 A;  3REL A;  3UTA B;  1M18 C;  3AZE C;  5GSU A;  3X1S D;  1BH8 B;  4NE6 A;  5B40 D;  3B6F C;  3UTB C;  2F8N B;  1AOI C;  3AV2 A;  3AN2 A;  1A7W A;  3LZ0 A;  5GXQ D;  1P3P B;  3AZG A;  4KHA B;  3A6N B;  3AV1 A;  3LZ1 B;  4NE3 A;  5B0Z C;  1P3F A;  3KXB A;  4YM6 B;  4ZUX A;  3AN2 D;  3AZH A;  3AV2 D;  1HTA A;  3LZ0 D;  4WZS B;  3AZL C;  1EQZ B;  3AV1 D;  1P3F D;  4ZUX D;  3AZI A;  3AZH D;  2NQB B;  5BS7 C;  4X23 D;  3WKJ A;  5GT0 A;  5AY8 A;  4DRB A;  4KUD B;  5B0Y D;  3AZI D;  4XZQ C;  2RVQ D;  5CPJ A;  1P3P C;  3C1B B;  2NZD A;  3VH6 A;  5B2I C;  3A6N C;  3WKJ D;  5B31 G;  4CSR B;  4J8U B;  5KDM A;  3WA9 D;  1KX5 A;  3WTP B;  5JRG B;  4J8W B;  1TAF B;  1ULY A;  4H9Q A;  2NQB C;  3WAA A;  3AZN C;  5GT3 A;  3VH5 A;  4KUD C;  3X1T A;  3C1B C;  2FJ7 B;  2HIO A;  4UUZ B;  5GT3 D;  3X1V B;  5CPI B;  5DNN A;  4J8U C;  2YFW A;  2BYK B;  3AZF A;  3AZM B;  5DNM C;  3X1S B;  5B40 B;  3B0C T;  3AYW C;  5AV9 A;  5GXQ B;  1P3B D;  4Z66 A;  5AV9 D;  5JA4 B;  2CV5 C;  3AN2 B;  5B24 A;  3X1V C;  5CPI C;  1M18 A;  5AV8 A;  3AZJ C;  1P3M D;  3AV1 B;  4XUJ D;  3KUY D;  3UTB A;  1AOI A;  5F99 C;  4WU9 A;  1P3F B;  3AZM C;  4ZUX B;  3REK D;  4X23 B;  3AZE D;  3B6F D;  3B0D C;  5B0Z A;  3UTB D;  5B0Y B;  1TZY C;  5GXQ C;  3LJA D;  4DRA A;  4JJN B;  3UTA A;  3AZL D;  4AWL B;  5B1M C;  1JFI B;  1KX3 D;  3AFA D;  3WA9 B;  5B31 C;  5B2J D;  1P3P A;  4KHA A;  5KDM B;  4X23 C;  3A6N A;  3LZ1 A;  4QLC B;  4YM6 A;  4J8V B;  4XZQ D;  5B2I D;  3A6N D;  5B32 G;  4H9N B;  5GT3 B;  3W97 B;  4JJN C;  2NQB A;  3REI C;  4Z2M G;  4KUD A;  2NQB D;  3C1B A;  3AZN D;  4QLC C;  4KUD D;  4J8V C;  4J8U A;  1P3G C;  1P3B B;  3C1B D;  3MGR C;  5G49 B;  5AV9 B;  3WTP A;  4J8W A;  3W97 C;  1TAF A;  5DNM A;  4J8U D;  4G91 B;  2HUE C;  1P3M B;  4XUJ B;  3KUY B;  3W99 C;  3WTP E;  3REK B;  5DNM D;  1P3A B;  3AZE B;  3B6F B;  3W96 C;  3AYW D;  4UUZ A;  2CV5 A;  1Q9C A;  3X1V A;  5CPI A;  2BYM B;  1P3B C;  3LJA B;  5BNX B;  2BYK A;  5F99 A;  2CV5 D;  3AZM A;  3X1V D;  5CPI D;  2IO5 B;  3C1C B;  3AZL B;  3AZJ D;  3R45 B;  3X1S A;  5B40 A;  3AFA B;  1P3M C;  1KX3 B;  5F99 D;  4WU8 B;  3AZM D;  5CP6 C;  5B2J B;  5GXQ A;  3REK C;  1P3A C;  1ZLA B;  3TU4 C;  2CWE A;  5JA4 A;  4XZQ B;  1TZY D;  3NQU B;  5E5A C;  5B2I B;  3AZK C;  5B31 A;  3LJA C;  1M19 C;  2IO5 C;  5B1M D;  3C1C C;  5B32 C;  4X23 A;  3REH D;  5B31 D;  1KX3 C;  3AFA C;  1P3I C;  4WU8 C;  5B0Y A;  5B2J C;  1WWS A;  3KSY A;  3AZN B;  1ZLA C;  4JJN A;  4H9P B;  1JFI A;  5FUG B;  3WA9 A;  3LEL B;  1KX4 B;  3VH6 T;  1B6W A;  4JJN D;  1P3K C;  3REI D;  4QLC A;  4J8V A;  5DNM B;  3MGR A;  3AYW B;  4QLC D;  4H9N A;  3W97 A;  4J8V D;  4LD9 B;  3VH5 T;  1P3G D;  3X1U C;  3LEL C;  3O62 C;  3MGR D;  1KX4 C;  2CV5 B;  3W97 D;  3V9R A;  3W96 A;  3AZJ B;  1HQ3 C;  3W99 D;  5F99 B;  1ID3 B;  5BO0 B;  2L5A A;  1P3B A;  3B0D B;  3W96 D;  5G49 A;  3UT9 C;  4LD9 C;  3MVD B;  1TZY B;  1KU5 A;  1P3O C;  1P3M A;  4XUJ A;  3KUY A;  5BNV B;  3REK A;  1P3A A;  5B1M B;  3REH B;  3AZE A;  3B6F A;  3TU4 A;  5B31 B;  1ID3 C;  2BYM A;  5CP6 D;  1P3A D;  5AV6 C;  5E5A A;  4KGC C;  3LJA A;  5BNX A;  3TU4 D;  2PYO C;  3MVD C;  5BT1 C;  3C1C A;  4J8X C;  3AZL A;  5E5A D;  1M19 D;  3R45 A;  3MGP C;  4G92 B;  3AZK D;  3AFA A;  1KX3 A;  4WU8 A;  5CPK C;  5B2J A;  3VH6 W;  5BS7 A;  5B32 D;  3C1C D;  4HGA B;  3REI B;  3REH C;  3KWQ C;  4YS3 D;  1ZLA A;  1P3I D;  4H9S C;  4WU8 D;  4XZQ A;  4Z5T C;  1ZLA D;  3NQU A;  5B2I A;  1M1A C;  1P3K A;  1P3G B;  3MNN C;  4G92 C;  3VH5 W;  3MGR B;  1U35 C;  1P3K D;  3REL C;  3AZN A;  2HUE B;  4HGA C;  5GSU C;  3W99 B;  1S32 C;  3V9R B;  4H9P A;  3X1U A;  5FUG A;  1P34 D;  3AZG C;  3W96 B;  3LEL A;  3O62 A;  3MGQ C;  1KX4 A;  3KXB C;  4M6B A;  3X1U D;  1R4V A;  1HQ3 A;  3LEL D;  3O62 D;  1KX4 D;  5C3I B;  1HQ3 D;  3AYW A;  1P3L B;  1F66 C;  4LD9 A;  5CP6 B;  5B1L C;  5CPJ C;  2NZD C;  3TU4 B;  3UT9 D;  4LD9 D;  4NE5 A;  4H9O A;  2F8N G;  5E5A B;  3AZJ A;  3AZK B;  1P3O D;  1M19 B;  1ID3 A;  5BO0 A;  1KX5 C;  5B33 D;  5B32 B;  2PYO A;  3WAA C;  5C3I C;  4YS3 B;  1P3I B;  1ID3 D;  3B0B A;  1P3L C;  3MVD A;  1TZY A;  5AV6 D;  4KGC D;  2PYO D;  3X1T C;  5BNV A;  3MVD D;  4R8P B;  5BT1 D;  5DNN C;  2LY8 A;  5B1M A;  4J8X D;  3MGP D;  3REH A;  4H9S A;  5CPK D;  4Z5T A;  1P3K B;  5AVB C;  3KWQ D;  1M1A A;  4YS3 C;  1H3O B;  2ARO B;  2F8N H;  4Z5T D;  3W98 D;  1P34 B;  1M1A D;  1BFM A;  5AV5 D;  5B24 C;  4R8P C;  3X1U B;  3REI A;  5AV8 C;  3MNN D;  3O62 B;  1S32 A;  1U35 D;  4WU9 C;  3MGS C;  3REL D;  3MGQ A;  5GSU D;  1HQ3 B;  2YFV B;  1S32 D;  5AVC B;  2ARO C;  1P3G A;  3AZG D;  1P34 C;  3MGQ D;  3REJ C;  2F8N K;  4ZBJ C;  4EO5 C;  3KXB D;  3NQJ B;  3UT9 B;  4E45 A;  3UTA C;  1P3O B;  3W99 A;  1F66 A;  5B33 B;  4H9O B;  5B1L A;  5GT0 D;  3LZ1 C;  1F66 D;  5AY8 D;  4WNN A;  4YM6 C;  5AVC C;  5AV6 B;  4KGC B;  5B1L D;  5CPJ D;  2NZD D;  4E44 A;  1EQZ C;  2PYO B;  1WWI A;  3B6G B;  4J8X B;  3MGP B;  1N1J A;  5CPK B;  1P3L A;  1KX5 D;  5B33 C;  5CP6 A;  4WV4 B;  3KWQ B;  2JSS A;  3WAA D;  4H9R B;  5CHL B;  1P3L D;  4Z5T B;  3W98 B; 
#chains in the Genus database with same CATH topology
 1M19 A;  3AZK A;  1M1A B;  3X1T D;  2HIO D;  4CAY B;  3A1I A;  5DNN D;  1BH9 B;  5JRG C;  5B32 A;  5AVB A;  5AV5 B;  3WTP C;  4J8W C;  3B6G C;  3MNN B;  4YS3 A;  2Y2N A;  1P3I A;  3AZF D;  1U35 B;  3REL B;  5AVB D;  2F2A C;  5GSU B;  2FJ7 C;  1S32 B;  3AV2 B;  4R8P A;  3LZ0 B;  3W98 C;  3AZG B;  3MGQ B;  4Z66 D;  3KXB B;  3MGS A;  2FFF B;  5B24 D;  3AZH B;  4R8P D;  5AV5 C;  1M18 D;  5AV8 D;  1H3O A;  3X1S C;  5B40 C;  1AOI D;  2ARO A;  4WU9 D;  3MGS D;  3AZI B;  1P34 A;  3REJ A;  3WKJ B;  5GT0 B;  5B0Z D;  1F66 B;  5AY8 B;  2ARO D;  1B67 A;  3AN2 C;  3AV2 C;  3LZ0 C;  2Y2L A;  5B1L B;  5CPJ B;  2NZD B;  1BH8 A;  3REJ D;  3AV1 C;  2F8N A;  1P3F C;  4WNN B;  4ZUX C;  3AZH C;  3UTA D;  2DQN C;  2YFV A;  1KX5 B;  2F8N D;  5AVC A;  5B0Y C;  3AZI C;  1P3P D;  4H9Q B;  2RVQ C;  1EQZ A;  1N1J B;  3WAA B;  3KFU G;  3LZ1 D;  3WKJ C;  5GT0 C;  3UT9 A;  3NQJ A;  5AVC D;  5AY8 C;  4YM6 D;  3EPH A;  2J8P A;  4AWL C;  1P3O A;  1EQZ D;  3X1T B;  2HIO B;  3WA9 C;  5B33 A;  5DNN B;  2YFW B;  3AZF B;  4CSR A;  5AV6 A;  3B0C W;  4KGC A;  5AVB B;  5GT3 C;  5JRG A;  3B6G A;  4J8X A;  3MGP A;  4Z66 B;  5CPK A;  2HIO C;  5B24 B;  5JRG D;  3WTP D;  4J8W D;  1M18 B;  3B6G D;  5AV8 B;  3KWQ A;  2FJ7 A;  1F1E A;  3H0L C;  4H9R A;  3UTB B;  3AZF C;  4WU9 B;  3MGS B;  1AOI B;  3W98 A;  2JCH A;  2FJ7 D;  4NFT A;  4Z2M H;  4CAY A;  5B0Z B;  5AV9 C;  5AV5 A;  1BH9 A;  3MNN A;  4G91 C;  3IP4 C;  3REJ B;  4ZBJ B;  4Z66 C;  2G5H C;  4EO5 B;  4XUJ C;  3KUY C;  1U35 A;  4DQY B;  3REL A;  3UTA B;  1M18 C;  3AZE C;  5GSU A;  3X1S D;  1BH8 B;  4NE6 A;  5B40 D;  3B6F C;  3UTB C;  2F8N B;  1PZR A;  3AV2 A;  3AN2 A;  1AOI C;  1A7W A;  3LZ0 A;  5GXQ D;  1P3P B;  3AZG A;  4KHA B;  3A6N B;  3AV1 A;  3LZ1 B;  4NE3 A;  5B0Z C;  1P3F A;  3KXB A;  4YM6 B;  4ZUX A;  3AN2 D;  3AZH A;  3AV2 D;  1HTA A;  3LZ0 D;  4WZS B;  3AZL C;  1EQZ B;  3AV1 D;  1P3F D;  4ZUX D;  3AZI A;  3AZH D;  2NQB B;  5BS7 C;  4X23 D;  3WKJ A;  5GT0 A;  5AY8 A;  4DRB A;  4KUD B;  5B0Y D;  3AZI D;  4XZQ C;  2RVQ D;  5CPJ A;  1P3P C;  3C1B B;  2NZD A;  3VH6 A;  5B2I C;  3A6N C;  3WKJ D;  5B31 G;  4CSR B;  4J8U B;  5KDM A;  3WA9 D;  1KX5 A;  3WTP B;  5JRG B;  4J8W B;  1TAF B;  1ULY A;  4H9Q A;  2NQB C;  3WAA A;  3AZN C;  5GT3 A;  3VH5 A;  4KUD C;  3H0R C;  3X1T A;  3C1B C;  2FJ7 B;  2HIO A;  4UUZ B;  5GT3 D;  3X1V B;  2UWX A;  5CPI B;  5DNN A;  4J8U C;  2YFW A;  2BYK B;  3AZF A;  3AZM B;  5DNM C;  3X1S B;  5B40 B;  3B0C T;  3AYW C;  5AV9 A;  5GXQ B;  1P3B D;  4Z66 A;  5AV9 D;  5JA4 B;  2CV5 C;  3AN2 B;  5B24 A;  3X1V C;  5CPI C;  1M18 A;  5AV8 A;  3AZJ C;  1P3M D;  3EPK A;  3AV1 B;  4XUJ D;  3KUY D;  3UTB A;  1AOI A;  5F99 C;  4WU9 A;  1P3F B;  3AZM C;  4ZUX B;  3REK D;  4X23 B;  3AZE D;  3B6F D;  3B0D C;  3H0M C;  5B0Z A;  3UTB D;  5B0Y B;  1TZY C;  5GXQ C;  2Y2P A;  3LJA D;  4DRA A;  4JJN B;  3UTA A;  3AZL D;  4AWL B;  2RIQ A;  5B1M C;  1JFI B;  2JE5 A;  1Z2C B;  1KX3 D;  3AFA D;  3WA9 B;  5B31 C;  5B2J D;  1P3P A;  4KHA A;  5KDM B;  4X23 C;  3A6N A;  3LZ1 A;  4QLC B;  4YM6 A;  4J8V B;  4XZQ D;  5B2I D;  3A6N D;  2Y2O A;  5B32 G;  4H9N B;  5GT3 B;  3W97 B;  2G5I C;  4JJN C;  2NQB A;  3REI C;  4Z2M G;  4KUD A;  2NQB D;  3C1B A;  3AZN D;  3F6T A;  4QLC C;  4KUD D;  4J8V C;  4J8U A;  1P3G C;  1P3B B;  3C1B D;  3MGR C;  5G49 B;  5AV9 B;  2Y2K A;  3WTP A;  4J8W A;  3W97 C;  1TAF A;  5DNM A;  4J8U D;  4G91 B;  2HUE C;  1P3M B;  4XUJ B;  3KUY B;  3W99 C;  3WTP E;  3REK B;  5DNM D;  1P3A B;  3AZE B;  3B6F B;  3W96 C;  3AYW D;  4UUZ A;  2CV5 A;  1Q9C A;  3X1V A;  5CPI A;  2BYM B;  2Y2M A;  1P3B C;  3LJA B;  5BNX B;  2BYK A;  5F99 A;  2CV5 D;  3AZM A;  3X1V D;  5CPI D;  2IO5 B;  3C1C B;  3AZL B;  3AZJ D;  3R45 B;  3X1S A;  5B40 A;  3AFA B;  1P3M C;  1KX3 B;  5F99 D;  4WU8 B;  3AZM D;  5CP6 C;  5B2J B;  5GXQ A;  3REK C;  1P3A C;  1ZLA B;  3TU4 C;  2CWE A;  5JA4 A;  4XZQ B;  1TZY D;  3NQU B;  5E5A C;  5B2I B;  3AZK C;  5B31 A;  3LJA C;  1M19 C;  2IO5 C;  5B1M D;  3C1C C;  5B32 C;  4X23 A;  3REH D;  5B31 D;  1KX3 C;  3AFA C;  1P3I C;  4WU8 C;  5B0Y A;  5B2J C;  1WWS A;  3KSY A;  3AZN B;  1ZLA C;  2Y2J A;  4JJN A;  4H9P B;  1JFI A;  5FUG B;  3WA9 A;  3LEL B;  1KX4 B;  3VH6 T;  1B6W A;  4JJN D;  1P3K C;  3REI D;  4QLC A;  4J8V A;  2DF4 C;  5DNM B;  3MGR A;  3AYW B;  4QLC D;  4H9N A;  3W97 A;  4J8V D;  4LD9 B;  3VH5 T;  1P3G D;  3X1U C;  3LEL C;  3O62 C;  3MGR D;  1KX4 C;  2CV5 B;  3W97 D;  3V9R A;  3W96 A;  3AZJ B;  2W8S A;  1HQ3 C;  3W99 D;  5F99 B;  1ID3 B;  5BO0 B;  2L5A A;  1P3B A;  3B0D B;  3W96 D;  5G49 A;  3UT9 C;  3FDD A;  3MVD B;  4LD9 C;  1TZY B;  1KU5 A;  1P3O C;  1P3M A;  4XUJ A;  3KUY A;  5BNV B;  2ZM5 A;  3REK A;  2VQR A;  1P3A A;  5B1M B;  3REH B;  3AZE A;  3B6F A;  2XD5 A;  3TU4 A;  5B31 B;  1ID3 C;  2BYM A;  5CP6 D;  1P3A D;  5AV6 C;  5E5A A;  4KGC C;  3LJA A;  5BNX A;  3TU4 D;  2PYO C;  3MVD C;  5BT1 C;  3C1C A;  4J8X C;  3AZL A;  5E5A D;  1M19 D;  3R45 A;  3MGP C;  4G92 B;  3AZK D;  3AFA A;  1KX3 A;  4WU8 A;  5CPK C;  5B2J A;  3VH6 W;  5BS7 A;  3EG5 B;  5B32 D;  4HGA B;  3C1C D;  3REH C;  3KWQ C;  4YS3 D;  3REI B;  1ZLA A;  1P3I D;  4H9S C;  4WU8 D;  4XZQ A;  4Z5T C;  2ZY3 A;  1ZLA D;  3NQU A;  5B2I A;  1M1A C;  3EPJ A;  1P3K A;  1P3G B;  3MNN C;  4G92 C;  3VH5 W;  3MGR B;  4UPK A;  1U35 C;  1W2E A;  1P3K D;  3REL C;  3AZN A;  2HUE B;  4HGA C;  5GSU C;  3W99 B;  1S32 C;  3V9R B;  4H9P A;  3X1U A;  5FUG A;  1P34 D;  3AZG C;  3W96 B;  3LEL A;  3O62 A;  3MGQ C;  1KX4 A;  3KXB C;  4M6B A;  3X1U D;  1R4V A;  1HQ3 A;  3LEL D;  3O62 D;  1KX4 D;  3AL0 C;  2ZY2 A;  5C3I B;  1HQ3 D;  3AYW A;  1P3L B;  1F66 C;  4LD9 A;  5CP6 B;  5B1L C;  5CPJ C;  2NZD C;  3TU4 B;  3UT9 D;  4LD9 D;  4NE5 A;  4H9O A;  2F8N G;  5E5A B;  3AZJ A;  3AZK B;  1P3O D;  1M19 B;  1ID3 A;  2Y2G A;  2XD1 A;  5BO0 A;  5B33 D;  1KX5 C;  1T3U A;  5B32 B;  2PYO A;  3WAA C;  5C3I C;  4YS3 B;  1P3I B;  1ID3 D;  3B0B A;  1P3L C;  3EPL A;  3MVD A;  1TZY A;  5AV6 D;  4KGC D;  2PYO D;  3X1T C;  5BNV A;  3P5J B;  3MVD D;  5BT1 D;  4R8P B;  5DNN C;  2LY8 A;  5B1M A;  4J8X D;  3MGP D;  3REH A;  4H9S A;  5CPK D;  4Z5T A;  1P3K B;  4WJ3 C;  5AVB C;  3KWQ D;  1M1A A;  4YS3 C;  1H3O B;  2ARO B;  2Y2Q A;  2F8N H;  4Z5T D;  3W98 D;  1P34 B;  1M1A D;  1BFM A;  5AV5 D;  5B24 C;  4R8P C;  3X1U B;  3REI A;  5AV8 C;  3MNN D;  3O62 B;  1S32 A;  1U35 D;  4WU9 C;  3MGS C;  3REL D;  3MGQ A;  5GSU D;  1HQ3 B;  2YFV B;  1S32 D;  5AVC B;  2ARO C;  1P3G A;  3AZG D;  1P34 C;  3MGQ D;  3REJ C;  2F8N K;  4ZBJ C;  4EO5 C;  3KXB D;  3NQJ B;  3UT9 B;  4E45 A;  3UTA C;  1P3O B;  3A1K A;  2BG1 A;  3W99 A;  1F66 A;  5B33 B;  4H9O B;  5B1L A;  5GT0 D;  3LZ1 C;  1F66 D;  5AY8 D;  2ZY4 A;  2Y2I A;  4WNN A;  5AVC C;  4YM6 C;  5AV6 B;  4KGC B;  5B1L D;  5CPJ D;  2NZD D;  4E44 A;  1EQZ C;  2PYO B;  1WWI A;  3B6G B;  4J8X B;  2ZY5 A;  1N1J A;  3MGP B;  5CPK B;  1P3L A;  1KX5 D;  5B33 C;  5CP6 A;  4WV4 B;  3KWQ B;  2JSS A;  3WAA D;  2Y2H A;  4H9R B;  5CHL B;  1P3L D;  4Z5T B;  3W98 B; 
#chains in the Genus database with same CATH homology
 1M19 A;  3AZK A;  1M1A B;  3X1T D;  2HIO D;  4CAY B;  3A1I A;  5DNN D;  1BH9 B;  5JRG C;  5B32 A;  5AVB A;  5AV5 B;  3WTP C;  4J8W C;  3B6G C;  3MNN B;  4YS3 A;  2Y2N A;  1P3I A;  3AZF D;  1U35 B;  3REL B;  5AVB D;  2F2A C;  5GSU B;  2FJ7 C;  1S32 B;  3AV2 B;  4R8P A;  3LZ0 B;  3W98 C;  3AZG B;  3MGQ B;  4Z66 D;  3KXB B;  3MGS A;  2FFF B;  5B24 D;  3AZH B;  4R8P D;  5AV5 C;  1M18 D;  5AV8 D;  1H3O A;  3X1S C;  5B40 C;  1AOI D;  2ARO A;  4WU9 D;  3MGS D;  3AZI B;  1P34 A;  3REJ A;  3WKJ B;  5GT0 B;  5B0Z D;  1F66 B;  5AY8 B;  2ARO D;  1B67 A;  3AN2 C;  3AV2 C;  3LZ0 C;  2Y2L A;  5B1L B;  5CPJ B;  2NZD B;  1BH8 A;  3REJ D;  3AV1 C;  2F8N A;  1P3F C;  4WNN B;  4ZUX C;  3AZH C;  3UTA D;  2DQN C;  2YFV A;  1KX5 B;  2F8N D;  5AVC A;  5B0Y C;  3AZI C;  1P3P D;  4H9Q B;  2RVQ C;  1EQZ A;  1N1J B;  3WAA B;  3KFU G;  3LZ1 D;  3WKJ C;  5GT0 C;  3UT9 A;  3NQJ A;  5AVC D;  5AY8 C;  4YM6 D;  3EPH A;  2J8P A;  4AWL C;  1P3O A;  1EQZ D;  3X1T B;  2HIO B;  3WA9 C;  5B33 A;  5DNN B;  2YFW B;  3AZF B;  4CSR A;  5AV6 A;  3B0C W;  4KGC A;  5AVB B;  5GT3 C;  5JRG A;  3B6G A;  4J8X A;  3MGP A;  4Z66 B;  5CPK A;  2HIO C;  5B24 B;  5JRG D;  3WTP D;  4J8W D;  1M18 B;  3B6G D;  5AV8 B;  3KWQ A;  2FJ7 A;  1F1E A;  3H0L C;  4H9R A;  3UTB B;  3AZF C;  4WU9 B;  3MGS B;  1AOI B;  3W98 A;  2JCH A;  2FJ7 D;  4NFT A;  4Z2M H;  4CAY A;  5B0Z B;  5AV9 C;  5AV5 A;  1BH9 A;  3MNN A;  4G91 C;  3IP4 C;  3REJ B;  4ZBJ B;  4Z66 C;  2G5H C;  4EO5 B;  4XUJ C;  3KUY C;  1U35 A;  4DQY B;  3REL A;  3UTA B;  1M18 C;  3AZE C;  5GSU A;  3X1S D;  1BH8 B;  4NE6 A;  5B40 D;  3B6F C;  3UTB C;  2F8N B;  1PZR A;  3AV2 A;  3AN2 A;  1AOI C;  1A7W A;  3LZ0 A;  5GXQ D;  1P3P B;  3AZG A;  4KHA B;  3A6N B;  3AV1 A;  3LZ1 B;  4NE3 A;  5B0Z C;  1P3F A;  3KXB A;  4YM6 B;  4ZUX A;  3AN2 D;  3AZH A;  3AV2 D;  1HTA A;  3LZ0 D;  4WZS B;  3AZL C;  1EQZ B;  3AV1 D;  1P3F D;  4ZUX D;  3AZI A;  3AZH D;  2NQB B;  5BS7 C;  4X23 D;  3WKJ A;  5GT0 A;  5AY8 A;  4DRB A;  4KUD B;  5B0Y D;  3AZI D;  4XZQ C;  2RVQ D;  5CPJ A;  1P3P C;  3C1B B;  2NZD A;  3VH6 A;  5B2I C;  3A6N C;  3WKJ D;  5B31 G;  4CSR B;  4J8U B;  5KDM A;  3WA9 D;  1KX5 A;  3WTP B;  5JRG B;  4J8W B;  1TAF B;  1ULY A;  4H9Q A;  2NQB C;  3WAA A;  3AZN C;  5GT3 A;  3VH5 A;  4KUD C;  3H0R C;  3X1T A;  3C1B C;  2FJ7 B;  2HIO A;  4UUZ B;  5GT3 D;  3X1V B;  2UWX A;  5CPI B;  5DNN A;  4J8U C;  2YFW A;  2BYK B;  3AZF A;  3AZM B;  5DNM C;  3X1S B;  5B40 B;  3B0C T;  3AYW C;  5AV9 A;  5GXQ B;  1P3B D;  4Z66 A;  5AV9 D;  5JA4 B;  2CV5 C;  3AN2 B;  5B24 A;  3X1V C;  5CPI C;  1M18 A;  5AV8 A;  3AZJ C;  1P3M D;  3EPK A;  3AV1 B;  4XUJ D;  3KUY D;  3UTB A;  1AOI A;  5F99 C;  4WU9 A;  1P3F B;  3AZM C;  4ZUX B;  3REK D;  4X23 B;  3AZE D;  3B6F D;  3B0D C;  3H0M C;  5B0Z A;  3UTB D;  5B0Y B;  1TZY C;  5GXQ C;  2Y2P A;  3LJA D;  4DRA A;  4JJN B;  3UTA A;  3AZL D;  4AWL B;  2RIQ A;  5B1M C;  1JFI B;  2JE5 A;  1Z2C B;  1KX3 D;  3AFA D;  3WA9 B;  5B31 C;  5B2J D;  1P3P A;  4KHA A;  5KDM B;  4X23 C;  3A6N A;  3LZ1 A;  4QLC B;  4YM6 A;  4J8V B;  4XZQ D;  5B2I D;  3A6N D;  2Y2O A;  5B32 G;  4H9N B;  5GT3 B;  3W97 B;  2G5I C;  4JJN C;  2NQB A;  3REI C;  4Z2M G;  4KUD A;  2NQB D;  3C1B A;  3AZN D;  3F6T A;  4QLC C;  4KUD D;  4J8V C;  4J8U A;  1P3G C;  1P3B B;  3C1B D;  3MGR C;  5G49 B;  5AV9 B;  2Y2K A;  3WTP A;  4J8W A;  3W97 C;  1TAF A;  5DNM A;  4J8U D;  4G91 B;  2HUE C;  1P3M B;  4XUJ B;  3KUY B;  3W99 C;  3WTP E;  3REK B;  5DNM D;  1P3A B;  3AZE B;  3B6F B;  3W96 C;  3AYW D;  4UUZ A;  2CV5 A;  1Q9C A;  3X1V A;  5CPI A;  2BYM B;  2Y2M A;  1P3B C;  3LJA B;  5BNX B;  2BYK A;  5F99 A;  2CV5 D;  3AZM A;  3X1V D;  5CPI D;  2IO5 B;  3C1C B;  3AZL B;  3AZJ D;  3R45 B;  3X1S A;  5B40 A;  3AFA B;  1P3M C;  1KX3 B;  5F99 D;  4WU8 B;  3AZM D;  5CP6 C;  5B2J B;  5GXQ A;  3REK C;  1P3A C;  1ZLA B;  3TU4 C;  2CWE A;  5JA4 A;  4XZQ B;  1TZY D;  3NQU B;  5E5A C;  5B2I B;  3AZK C;  5B31 A;  3LJA C;  1M19 C;  2IO5 C;  5B1M D;  3C1C C;  5B32 C;  4X23 A;  3REH D;  5B31 D;  1KX3 C;  3AFA C;  1P3I C;  4WU8 C;  5B0Y A;  5B2J C;  1WWS A;  3KSY A;  3AZN B;  1ZLA C;  2Y2J A;  4JJN A;  4H9P B;  1JFI A;  5FUG B;  3WA9 A;  3LEL B;  1KX4 B;  3VH6 T;  1B6W A;  4JJN D;  1P3K C;  3REI D;  4QLC A;  4J8V A;  2DF4 C;  5DNM B;  3MGR A;  3AYW B;  4QLC D;  4H9N A;  3W97 A;  4J8V D;  4LD9 B;  3VH5 T;  1P3G D;  3X1U C;  3LEL C;  3O62 C;  3MGR D;  1KX4 C;  2CV5 B;  3W97 D;  3V9R A;  3W96 A;  3AZJ B;  2W8S A;  1HQ3 C;  3W99 D;  5F99 B;  1ID3 B;  5BO0 B;  2L5A A;  1P3B A;  3B0D B;  3W96 D;  5G49 A;  3UT9 C;  3FDD A;  3MVD B;  4LD9 C;  1TZY B;  1KU5 A;  1P3O C;  1P3M A;  4XUJ A;  3KUY A;  5BNV B;  2ZM5 A;  3REK A;  2VQR A;  1P3A A;  5B1M B;  3REH B;  3AZE A;  3B6F A;  2XD5 A;  3TU4 A;  5B31 B;  1ID3 C;  2BYM A;  5CP6 D;  1P3A D;  5AV6 C;  5E5A A;  4KGC C;  3LJA A;  5BNX A;  3TU4 D;  2PYO C;  3MVD C;  5BT1 C;  3C1C A;  4J8X C;  3AZL A;  5E5A D;  1M19 D;  3R45 A;  3MGP C;  4G92 B;  3AZK D;  3AFA A;  1KX3 A;  4WU8 A;  5CPK C;  5B2J A;  3VH6 W;  5BS7 A;  3EG5 B;  5B32 D;  4HGA B;  3C1C D;  3REH C;  3KWQ C;  4YS3 D;  3REI B;  1ZLA A;  1P3I D;  4H9S C;  4WU8 D;  4XZQ A;  4Z5T C;  2ZY3 A;  1ZLA D;  3NQU A;  5B2I A;  1M1A C;  3EPJ A;  1P3K A;  1P3G B;  3MNN C;  4G92 C;  3VH5 W;  3MGR B;  4UPK A;  1U35 C;  1W2E A;  1P3K D;  3REL C;  3AZN A;  2HUE B;  4HGA C;  5GSU C;  3W99 B;  1S32 C;  3V9R B;  4H9P A;  3X1U A;  5FUG A;  1P34 D;  3AZG C;  3W96 B;  3LEL A;  3O62 A;  3MGQ C;  1KX4 A;  3KXB C;  4M6B A;  3X1U D;  1R4V A;  1HQ3 A;  3LEL D;  3O62 D;  1KX4 D;  3AL0 C;  2ZY2 A;  5C3I B;  1HQ3 D;  3AYW A;  1P3L B;  1F66 C;  4LD9 A;  5CP6 B;  5B1L C;  5CPJ C;  2NZD C;  3TU4 B;  3UT9 D;  4LD9 D;  4NE5 A;  4H9O A;  2F8N G;  5E5A B;  3AZJ A;  3AZK B;  1P3O D;  1M19 B;  1ID3 A;  2Y2G A;  2XD1 A;  5BO0 A;  5B33 D;  1KX5 C;  1T3U A;  5B32 B;  2PYO A;  3WAA C;  5C3I C;  4YS3 B;  1P3I B;  1ID3 D;  3B0B A;  1P3L C;  3EPL A;  3MVD A;  1TZY A;  5AV6 D;  4KGC D;  2PYO D;  3X1T C;  5BNV A;  3P5J B;  3MVD D;  5BT1 D;  4R8P B;  5DNN C;  2LY8 A;  5B1M A;  4J8X D;  3MGP D;  3REH A;  4H9S A;  5CPK D;  4Z5T A;  1P3K B;  4WJ3 C;  5AVB C;  3KWQ D;  1M1A A;  4YS3 C;  1H3O B;  2ARO B;  2Y2Q A;  2F8N H;  4Z5T D;  3W98 D;  1P34 B;  1M1A D;  1BFM A;  5AV5 D;  5B24 C;  4R8P C;  3X1U B;  3REI A;  5AV8 C;  3MNN D;  3O62 B;  1S32 A;  1U35 D;  4WU9 C;  3MGS C;  3REL D;  3MGQ A;  5GSU D;  1HQ3 B;  2YFV B;  1S32 D;  5AVC B;  2ARO C;  1P3G A;  3AZG D;  1P34 C;  3MGQ D;  3REJ C;  2F8N K;  4ZBJ C;  4EO5 C;  3KXB D;  3NQJ B;  3UT9 B;  4E45 A;  3UTA C;  1P3O B;  3A1K A;  2BG1 A;  3W99 A;  1F66 A;  5B33 B;  4H9O B;  5B1L A;  5GT0 D;  3LZ1 C;  1F66 D;  5AY8 D;  2ZY4 A;  2Y2I A;  4WNN A;  5AVC C;  4YM6 C;  5AV6 B;  4KGC B;  5B1L D;  5CPJ D;  2NZD D;  4E44 A;  1EQZ C;  2PYO B;  1WWI A;  3B6G B;  4J8X B;  2ZY5 A;  1N1J A;  3MGP B;  5CPK B;  1P3L A;  1KX5 D;  5B33 C;  5CP6 A;  4WV4 B;  3KWQ B;  2JSS A;  3WAA D;  2Y2H A;  4H9R B;  5CHL B;  1P3L D;  4Z5T B;  3W98 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...