4E44A

Crystal structure of the hmhf1/hmhf2 histone-fold tetramer
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
104
structure length
104
Chain Sequence
GSMEEEAETEEQQRFSYQQRLKAAVHYTVGCLCEEVALDKEMQFSKQTIAAISELTFRQCENFAKDLEMFARHAKRTTINTEDVKLLARRSNSLLKYITDKSEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Centromere protein S
publication title Crystal Structures Reveal that FANCM remodels the MHF Tetramer in favor of binding Branched DNA
rcsb
source organism Homo sapiens
molecule tags Dna binding protein
total genus 41
structure length 104
sequence length 104
chains with identical sequence C
ec nomenclature
pdb deposition date 2012-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF15630 CENP-S CENP-S protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4e44A00
2HIOB 3X1VD 4WNNB 3UTBD 3UTBA 1P3IB 2RVQC 1AOID 3WAAD 1H3OB 1AOIA 2CV5D 4UUZB 5B1MB 2HIOC 5GSUD 3LZ0C 2CV5A 3W96D 2AROB 3W96A 1P3IC 4JJND 5B1MC 4XZQB 4YS3B 2AROC 4R8PD 1KX3A 3AZJA 4XZQC 5CPIC 4YS3C 5B33B 3X1SB 3AN2D 3AN2A 5AY8D 4H9QA 5CPJA 5DNND 5DNNA 1P3MD 5B33C 3X1SC 1P3MA 3REHA 5KDMB 3RELA 1BH8A 5AVBA 4J8WD 3X1VB 3B0CW 2YFVA 3MNNA 4H9RB 3O62A 3MGSB 3WAAB 3MGQB 5GSUB 3X1VC 1A7WA 3R45B 2YFWA 1U35A 3W97D 4QLCB 3WAAC 4JJNB 3W97A 5B2IA 3AV1B 2JSSA 1P34A 5GSUC 1S32B 5B0ZD 4R8PB 5B40D 3AYWA 4JJNC 1M1AA 3AZKD 5AV6D 5AV8D 4R8PC 5B32D 4M6BA 4KHAA 5B32A 5AV9A 5F99D 3KUYA 5BNVA 5AY8B 5GXQD 1Q9CA 3AN2C 5AY8C 3VH6A 4J8VD 4J8WB 3AZFD 4J8VA 3AZFA 5DNNC 3W98D 3B0CT 2NZDD 4NE3A 1ID3D 4J8WC 4H9NA 3WTPA 1N1JA 4WZSB 3TU4B 1P3FA 4Z2MH 2F8NK 5CP6D 3AZEA 5B0ZB 1EQZD 5B40B 4Z5TD 1EQZA 4Z5TA 4H9PA 3AZKB 5AV6B 5AV8B 3REJB 3KWQA 5B0ZC 4XUJA 5B40C 1P3PA 3AZKC 4ZUXD 5AV6C 5B24A 5AV8C 5F99B 3REJC 1P3KD 4J8XB 4ZBJC 2F8ND 4KGCA 5GXQB 5FUGA 3A6ND 5F99C 4J8XC 5BS7A 3W99D 2BYKA 5GXQC 3W99A 3MGRD 2NZDB 3X1TB 1ID3B 4J8VC 5B1LD 1P3LA 3W98C 2NZDC 3X1TC 5CP6B 1ID3C 2FJ7B 4X23B 5CP6C 3B0BA 4X23C 4Z5TC 3LELD 3V9RA 4ZUXB 5CPKB 1HQ3D 1P3KB 2F8NB 3LZ1A 1P3BA 1B6WA 3A6NB 3AV2D 3AFAA 5E5AA 1P3AD 3B6GA 3AV2A 5DNMD 4ZUXC 5CPKC 1P3KC 1KX4D 5B32G 3A6NC 4Z2MG 3MGRB 3VH5A 4J8UA 5BS7C 3LZ0B 5JA4A 3C1CB 5C3IB 5B1LB 1BH9A 3MGRC 5BNXA 4YM6B 1JFIB 3C1CC 5C3IC 5B1LC 3B6FA 4WU9A 4CSRB 5CPIB 1KX3D 4YM6C 3WKJB 3WTPE 3AZJD 4Z66A 2BYMA 3WKJC 3AZLB 1HQ3B 3LELC 1P3AB 4WU8D 5DNMB 5CPJD 4WU8A 3UT9A 3MGSA 3AZLC 1HQ3C 3MGQA 3AZHD 1KX4B 4AWLB 3REHD 3AZHA 3NQJB 5GT3A 3RELD 1P3AC 5AVBD 4DRBA 5DNMC 3B0DB 4NE6A 4QLCA 3MNND 3REKA 2F8NG 3AV1A 3UTBB 3O62D 1KX4C 4AWLC 1P3OA 4H9SC 1AOIB 2CV5B 5JRGA 3B0DC 3W96B 3UTBC 1U35D 1M18A 5B2ID 1P34D 1AOIC 2CV5C 3W96C 5AV5A 3AZND 3AZMA 3AYWD 1KX3B 3AZNA 4KUDA 3AZJB 1M1AD 1KX3C 3X1UA 3AZJC 5AV9D 3AN2B 3KUYD 3C1BA 5B31A 4H9QB 5CPJB 5DNNB 1P3MB 3MVDA 3REHB 3TU4A 1BH8B 5AVBB 5CPJC 4LD9A 5B0YA 2YFVB 3MNNB 1F66A 3O62B 5G49A 1P3MC 3REHC 3WA9D 3RELC 3WA9A 5AVBC 3WTPD 1P3FD 3MNNC 2YFWB 3O62C 4E44A 1U35B 2PYOA 1TAFA 3W97B 5B2IB 1P34B 3AZED 5AVCA 3AYWB 3UTAD 1U35C 3UTAA 5B2JD 3NQUA 1M1AB 3W97C 5GT0A 5B2IC 5B2JA 1P34C 3KWQD 1P3GA 4XUJD 4ZBJB 3AZNC 3AYWC 4KHAB 1TZYD 5B32B 1P3PD 1TZYA 5AV9B 1M1AC 1KX5A 4NFTA 5B24D 3KUYB 5BNVB 4KGCD 5B32C 3AZIA 3LJAD 5AV9C 4WV4B 3LJAA 3KUYC 2NQBA 5BO0B 3MGPD 4J8VB 2HUEC 3AZFB 3MGPA 3W98B 1M19A 3AZGA 4H9NB 3WTPB 3AZFC 1P3LD 1R4VA 1N1JB 1P3FB 1ZLAA 1BFMA 3WTPC 3AZEB 1P3FC 1F1EA 4CAYA 3REID 1EQZB 3KXBA 1KU5A 3REIA 4Z5TB 4H9PB 3AZEC 3KWQB 4XUJB 1EQZC 4H9OA 1P3PB 3KWQC 1S32D 4XUJC 3LZ1D 1S32A 4KGCB 1P3BD 1TZYC 5FUGB 1P3PC 2HIOA 5E5AD 3LZ0A 2L5AA 4WNNA 3AFAD 3B6GD 1P3ID 5B24C 1P3IA 1H3OA 2BYKB 4KGCC 4UUZA 5B1MA 3LJAC 3W99B 2AROA 4J8UD 5B31G 3W99C 1P3LB 4XZQA 4YS3A 3B6FD 1P3LC 4WU9D 5B33D 5B33A 3X1SA 3REIC 4Z66D 3V9RB 3LELB 4DRAA 2IO5C 5BT1D 5KDMA 3LZ1B 1P3BB 1B67A 3B6GB 3AFAB 5E5AB 3X1VA 3AV2B 3UT9D 3MGSD 4H9RA 3MGQD 1S32C 3WAAA 3LZ1C 1P3BC 5GT3D 3B6GC 5GSUA 5E5AC 3AFAC 3AV2C 3R45A 4J8UB 3REKD 4E45A 4QLCD 5JA4B 4NE5A 4JJNA 3AV1D 1P3OD 1BH9B 4G92B 4R8PA 5JRGD 4J8UC 5BNXB 3B6FB 1M18D 4WU9B 4G92C 4G91B 5AV5D 3AZMD 4KUDD 3B6FC 4WU9C 5AY8A 4Z66B 2BYMB 4G91C 3X1UD 5CHLB 4Z66C 4J8WA 3VH5W 3C1BD 5B31D 4WU8B 3UT9B 1ULYA 5BT1C 3MVDD 3AZHB 3TU4D 5GT3B 2CWEA 3RELB 4WU8C 3UT9C 3MGSC 3REKB 5B0YD 4LD9D 3MGQC 1F66D 1P3OB 3AZHC 5GT3C 5B0ZA 5JRGB 5B40A 3REKC 4QLCC 3AV1C 3AZKA 3REJD 5AV6A 1P3OC 2PYOD 5AV8A 3REJA 1M18B 5JRGC 5AVCD 5AV5B 3AZMB 3AZNB 4KUDB 4J8XD 5F99A 5GT0D 1M18C 4J8XA 5GXQA 1P3GD 5AV5C 3X1UB 3AZMC 4KUDC 1KX5D 5BO0A 3VH5T 1HTAA 3C1BB 3W98A 5B31B 3X1UC 3AZID 2NZDA 3X1TD 2HUEB 3X1TA 3MVDB 1ID3A 3C1BC 2NQBD 5B31C 2LY8A 4LD9B 5B0YB 5CP6A 1M19D 1F66B 5G49B 3MVDC 2FJ7D 3TU4C 3AZGD 4X23D 2FJ7A 3WA9B 4X23A 4LD9C 5B0YC 1F66C 1ZLAD 2PYOB 1TAFB 3WA9C 5AVCB 3KXBD 4ZUXA 5CPKD 3UTAB 2PYOC 3NQUB 5CPKA 5GT0B 5B2JB 1P3KA 2F8NA 4HGAB 1P3GB 3A6NA 5AVCC 3UTAC 1TZYB 5GT0C 5B2JC 1KX5B 3VH6W 4HGAC 2RVQD 5B24B 1P3GC 3MGRA 3AZIB 2HIOD 3LZ0D 3LJAB 1KX5C 3C1CD 4EO5B 3C1CA 5B1LA 2NQBB 1WWIA 5B1MD 3KSYA 3MGPB 3AZIC 2AROD 4YM6D 1M19B 2F8NH 4YM6A 4EO5C 1JFIA 3AZGB 2NQBC 1WWSA 4CSRA 4XZQD 3MGPC 5CPID 4YS3D 5CPIA 1M19C 3WKJD 3WKJA 1ZLAB 2FJ7C 3AZGC 3LELA 4CAYB 3AZLD 3KXBB 3REIB 3AZLA 1ZLAC 1HQ3A 3X1SD 1P3AA 2IO5B 3KXBC 4H9OB 5DNMA 3VH6T 1KX4A 3NQJA 4H9SA
chains in the Genus database with same CATH superfamily
2HIOB 3X1VD 4WNNB 3UTBD 3UTBA 1P3IB 2RVQC 1AOID 3WAAD 1H3OB 1AOIA 2CV5D 4UUZB 5B1MB 2HIOC 5GSUD 3LZ0C 2CV5A 3W96D 2AROB 3W96A 1P3IC 4JJND 2XD1A 5B1MC 4XZQB 4YS3B 2AROC 4R8PD 1KX3A 3AZJA 2ZY2A 3KFUG 4XZQC 5CPIC 4YS3C 5B33B 3X1SB 3AN2D 3AN2A 5AY8D 3EPLA 4H9QA 5CPJA 5DNND 5DNNA 1P3MD 5B33C 3X1SC 1P3MA 3REHA 5KDMB 3RELA 1BH8A 5AVBA 4J8WD 3X1VB 3B0CW 2YFVA 3MNNA 4H9RB 3O62A 3MGSB 2DQNC 3MGQB 3WAAB 5GSUB 3X1VC 1A7WA 3R45B 2YFWA 1T3UA 1U35A 3W97D 4QLCB 3WAAC 4JJNB 3W97A 5B2IA 3AV1B 2JSSA 1P34A 5GSUC 1S32B 5B0ZD 4R8PB 5B40D 3AYWA 4JJNC 1M1AA 3AZKD 5AV6D 5AV8D 4R8PC 5B32D 4M6BA 4KHAA 5B32A 5AV9A 5F99D 3KUYA 5BNVA 5AY8B 5GXQD 1Q9CA 3AN2C 5AY8C 3VH6A 4J8VD 4J8WB 3AZFD 4J8VA 3AZFA 5DNNC 3W98D 3B0CT 2NZDD 4NE3A 1ID3D 4J8WC 4H9NA 3WTPA 1N1JA 4WZSB 3TU4B 1P3FA 1W2EA 4Z2MH 2F8NK 5CP6D 3AZEA 3P5JB 5B0ZB 1EQZD 5B40B 3A1IA 4Z5TD 1EQZA 4Z5TA 4H9PA 3AZKB 3AL0C 5AV6B 5AV8B 3REJB 3KWQA 5B0ZC 4XUJA 5B40C 1P3PA 3AZKC 4ZUXD 5AV6C 5B24A 5AV8C 5F99B 3REJC 1P3KD 4J8XB 4ZBJC 2F8ND 4KGCA 5GXQB 5FUGA 3A6ND 2ZY4A 3H0LC 5F99C 4J8XC 5BS7A 3W99D 2BYKA 5GXQC 3W99A 3EG5B 3MGRD 2NZDB 3X1TB 1ID3B 4J8VC 5B1LD 1P3LA 3W98C 2Y2JA 2NZDC 3X1TC 5CP6B 1ID3C 2FJ7B 4X23B 5CP6C 3B0BA 2G5IC 4X23C 4Z5TC 3LELD 3V9RA 4ZUXB 2Y2OA 5CPKB 1HQ3D 1P3KB 2F8NB 3LZ1A 1P3BA 1B6WA 3A6NB 3AV2D 3AFAA 5E5AA 1P3AD 3B6GA 3AV2A 5DNMD 4ZUXC 2Y2GA 5CPKC 1P3KC 1KX4D 5B32G 3A6NC 4Z2MG 3MGRB 3VH5A 4J8UA 5BS7C 3LZ0B 5JA4A 3C1CB 5C3IB 5B1LB 1BH9A 3MGRC 5BNXA 2W8SA 4YM6B 1JFIB 3C1CC 5C3IC 2Y2PA 5B1LC 3B6FA 4WU9A 4CSRB 5CPIB 1KX3D 4YM6C 3WKJB 3WTPE 3AZJD 4Z66A 2BYMA 3WKJC 2ZY3A 3AZLB 1HQ3B 3LELC 1P3AB 4WU8D 5DNMB 5CPJD 4WU8A 3UT9A 3MGSA 3AZLC 1HQ3C 3MGQA 3AZHD 1KX4B 4AWLB 3REHD 3AZHA 3NQJB 5GT3A 3RELD 1P3AC 5AVBD 4DRBA 5DNMC 3B0DB 4NE6A 4QLCA 3MNND 3REKA 2F8NG 3AV1A 3UTBB 3O62D 1KX4C 3IP4C 3EPKA 4AWLC 1P3OA 4H9SC 1AOIB 2CV5B 5JRGA 3B0DC 3W96B 3UTBC 1U35D 3EPHA 1M18A 5B2ID 1P34D 1AOIC 2CV5C 2BG1A 3W96C 5AV5A 3AZND 3AZMA 3AYWD 1KX3B 3AZNA 4KUDA 3AZJB 1M1AD 1PZRA 1KX3C 3X1UA 3AZJC 5AV9D 3AN2B 3KUYD 3C1BA 5B31A 4H9QB 5CPJB 2Y2KA 5DNNB 1P3MB 3MVDA 3REHB 3TU4A 1BH8B 5AVBB 5CPJC 4LD9A 5B0YA 2YFVB 2Y2MA 3MNNB 2Y2IA 1F66A 3O62B 5G49A 1P3MC 3REHC 3WA9D 3RELC 3WA9A 5AVBC 3WTPD 1P3FD 3MNNC 2YFWB 3O62C 4E44A 1U35B 2PYOA 1TAFA 3W97B 5B2IB 1P34B 3AZED 5AVCA 3AYWB 3UTAD 1U35C 3UTAA 5B2JD 3NQUA 1M1AB 3W97C 5GT0A 5B2IC 5B2JA 1P34C 3KWQD 1P3GA 4XUJD 4ZBJB 3AZNC 3AYWC 4KHAB 1TZYD 5B32B 1P3PD 1TZYA 5AV9B 1M1AC 1KX5A 4NFTA 5B24D 3KUYB 5BNVB 4KGCD 5B32C 3AZIA 3LJAD 5AV9C 4WV4B 3LJAA 3KUYC 2NQBA 5BO0B 3MGPD 4J8VB 2HUEC 3AZFB 3MGPA 3W98B 1M19A 4WJ3C 3AZGA 4H9NB 3WTPB 3AZFC 1P3LD 1R4VA 1N1JB 1P3FB 1ZLAA 1BFMA 3WTPC 3AZEB 1P3FC 1F1EA 4CAYA 3REID 1EQZB 3KXBA 1KU5A 1Z2CB 4Z5TB 3REIA 4H9PB 3AZEC 3KWQB 4XUJB 1EQZC 4H9OA 1P3PB 3KWQC 1S32D 4XUJC 3LZ1D 1S32A 4KGCB 1P3BD 1TZYC 5FUGB 1P3PC 2HIOA 5E5AD 3LZ0A 2L5AA 4WNNA 3AFAD 3B6GD 1P3ID 5B24C 1P3IA 1H3OA 2BYKB 4KGCC 4UUZA 5B1MA 3LJAC 3W99B 2AROA 4J8UD 5B31G 3FDDA 3W99C 1P3LB 4XZQA 4YS3A 3B6FD 1P3LC 4WU9D 5B33D 5B33A 3X1SA 3REIC 4Z66D 3V9RB 3LELB 4DRAA 2IO5C 5BT1D 5KDMA 3LZ1B 1P3BB 1B67A 3B6GB 3AFAB 5E5AB 3X1VA 3AV2B 3UT9D 3MGSD 4H9RA 3MGQD 1S32C 3WAAA 3LZ1C 1P3BC 2ZM5A 5GT3D 3B6GC 5GSUA 5E5AC 3AFAC 3AV2C 3R45A 4J8UB 3REKD 4E45A 4QLCD 5JA4B 4NE5A 4JJNA 3AV1D 2FFFB 1P3OD 1BH9B 4G92B 4R8PA 5JRGD 4J8UC 5BNXB 3B6FB 1M18D 4WU9B 4G92C 4G91B 5AV5D 3AZMD 4KUDD 3B6FC 2G5HC 5AY8A 4WU9C 4Z66B 3H0MC 2BYMB 4G91C 2XD5A 3X1UD 5CHLB 4Z66C 4J8WA 3VH5W 3C1BD 5B31D 3F6TA 4WU8B 3UT9B 1ULYA 5BT1C 3MVDD 2JCHA 3AZHB 3TU4D 5GT3B 2CWEA 3RELB 4WU8C 3UT9C 3MGSC 3REKB 5B0YD 4LD9D 3MGQC 1F66D 1P3OB 3AZHC 5GT3C 5B0ZA 5JRGB 5B40A 3REKC 4QLCC 3AV1C 3AZKA 3REJD 5AV6A 1P3OC 2PYOD 5AV8A 3REJA 1M18B 5JRGC 5AVCD 5AV5B 3AZMB 3AZNB 4KUDB 2Y2NA 4J8XD 5F99A 5GT0D 1M18C 4J8XA 5GXQA 1P3GD 5AV5C 3X1UB 3AZMC 2RIQA 4KUDC 1KX5D 2JE5A 5BO0A 3VH5T 1HTAA 3C1BB 3W98A 5B31B 3X1UC 3AZID 2NZDA 3X1TD 2HUEB 3X1TA 3MVDB 1ID3A 2DF4C 3C1BC 2Y2QA 2F2AC 2NQBD 5B31C 2LY8A 2VQRA 4LD9B 5B0YB 4UPKA 5CP6A 1M19D 1F66B 5G49B 3MVDC 2FJ7D 3TU4C 3AZGD 4X23D 2FJ7A 3WA9B 4X23A 4LD9C 5B0YC 2J8PA 1F66C 1ZLAD 2PYOB 1TAFB 3WA9C 5AVCB 3KXBD 4ZUXA 5CPKD 3UTAB 2PYOC 3NQUB 5CPKA 5GT0B 5B2JB 2Y2LA 1P3KA 2F8NA 4HGAB 1P3GB 3A6NA 5AVCC 3UTAC 1TZYB 5GT0C 5B2JC 1KX5B 2UWXA 4HGAC 2RVQD 3VH6W 5B24B 1P3GC 3MGRA 3AZIB 2HIOD 3LZ0D 3LJAB 1KX5C 3C1CD 4EO5B 3C1CA 2ZY5A 5B1LA 2NQBB 1WWIA 5B1MD 3KSYA 3MGPB 3AZIC 3EPJA 2AROD 4YM6D 1M19B 2F8NH 4YM6A 3A1KA 4EO5C 1JFIA 3AZGB 2NQBC 1WWSA 4CSRA 4XZQD 3MGPC 5CPID 4YS3D 5CPIA 1M19C 3WKJD 3WKJA 1ZLAB 2FJ7C 3AZGC 3LELA 4CAYB 3AZLD 3KXBB 3REIB 3AZLA 1ZLAC 1HQ3A 3X1SD 1P3AA 2IO5B 3KXBC 4H9OB 5DNMA 4DQYB 2Y2HA 3VH6T 1KX4A 3NQJA 3H0RC 4H9SA
chains in the Genus database with same CATH topology
2HIOB 3X1VD 4WNNB 3UTBD 3UTBA 1P3IB 2RVQC 1AOID 3WAAD 1H3OB 1AOIA 2CV5D 4UUZB 5B1MB 2HIOC 5GSUD 3LZ0C 2CV5A 3W96D 2AROB 3W96A 1P3IC 4JJND 2XD1A 5B1MC 4XZQB 4YS3B 2AROC 4R8PD 1KX3A 3AZJA 2ZY2A 3KFUG 4XZQC 5CPIC 4YS3C 5B33B 3X1SB 3AN2D 3AN2A 5AY8D 3EPLA 4H9QA 5CPJA 5DNND 5DNNA 1P3MD 5B33C 3X1SC 1P3MA 3REHA 5KDMB 3RELA 1BH8A 5AVBA 4J8WD 3X1VB 3B0CW 2YFVA 3MNNA 4H9RB 3O62A 3MGSB 2DQNC 3MGQB 3WAAB 5GSUB 3X1VC 1A7WA 3R45B 2YFWA 1T3UA 1U35A 3W97D 4QLCB 3WAAC 4JJNB 3W97A 5B2IA 3AV1B 2JSSA 1P34A 5GSUC 1S32B 5B0ZD 4R8PB 5B40D 3AYWA 4JJNC 1M1AA 3AZKD 5AV6D 5AV8D 4R8PC 5B32D 4M6BA 4KHAA 5B32A 5AV9A 5F99D 3KUYA 5BNVA 5AY8B 5GXQD 1Q9CA 3AN2C 5AY8C 3VH6A 4J8VD 4J8WB 3AZFD 4J8VA 3AZFA 5DNNC 3W98D 3B0CT 2NZDD 4NE3A 1ID3D 4J8WC 4H9NA 3WTPA 1N1JA 4WZSB 3TU4B 1P3FA 1W2EA 4Z2MH 2F8NK 5CP6D 3AZEA 3P5JB 5B0ZB 1EQZD 5B40B 3A1IA 4Z5TD 1EQZA 4Z5TA 4H9PA 3AZKB 3AL0C 5AV6B 5AV8B 3REJB 3KWQA 5B0ZC 4XUJA 5B40C 1P3PA 3AZKC 4ZUXD 5AV6C 5B24A 5AV8C 5F99B 3REJC 1P3KD 4J8XB 4ZBJC 2F8ND 4KGCA 5GXQB 5FUGA 3A6ND 2ZY4A 3H0LC 5F99C 4J8XC 5BS7A 3W99D 2BYKA 5GXQC 3W99A 3EG5B 3MGRD 2NZDB 3X1TB 1ID3B 4J8VC 5B1LD 1P3LA 3W98C 2Y2JA 2NZDC 3X1TC 5CP6B 1ID3C 2FJ7B 4X23B 5CP6C 3B0BA 2G5IC 4X23C 4Z5TC 3LELD 3V9RA 4ZUXB 2Y2OA 5CPKB 1HQ3D 1P3KB 2F8NB 3LZ1A 1P3BA 1B6WA 3A6NB 3AV2D 3AFAA 5E5AA 1P3AD 3B6GA 3AV2A 5DNMD 4ZUXC 2Y2GA 5CPKC 1P3KC 1KX4D 5B32G 3A6NC 4Z2MG 3MGRB 3VH5A 4J8UA 5BS7C 3LZ0B 5JA4A 3C1CB 5C3IB 5B1LB 1BH9A 3MGRC 5BNXA 2W8SA 4YM6B 1JFIB 3C1CC 5C3IC 2Y2PA 5B1LC 3B6FA 4WU9A 4CSRB 5CPIB 1KX3D 4YM6C 3WKJB 3WTPE 3AZJD 4Z66A 2BYMA 3WKJC 2ZY3A 3AZLB 1HQ3B 3LELC 1P3AB 4WU8D 5DNMB 5CPJD 4WU8A 3UT9A 3MGSA 3AZLC 1HQ3C 3MGQA 3AZHD 1KX4B 4AWLB 3REHD 3AZHA 3NQJB 5GT3A 3RELD 1P3AC 5AVBD 4DRBA 5DNMC 3B0DB 4NE6A 4QLCA 3MNND 3REKA 2F8NG 3AV1A 3UTBB 3O62D 1KX4C 3IP4C 3EPKA 4AWLC 1P3OA 4H9SC 1AOIB 2CV5B 5JRGA 3B0DC 3W96B 3UTBC 1U35D 3EPHA 1M18A 5B2ID 1P34D 1AOIC 2CV5C 2BG1A 3W96C 5AV5A 3AZND 3AZMA 3AYWD 1KX3B 3AZNA 4KUDA 3AZJB 1M1AD 1PZRA 1KX3C 3X1UA 3AZJC 5AV9D 3AN2B 3KUYD 3C1BA 5B31A 4H9QB 5CPJB 2Y2KA 5DNNB 1P3MB 3MVDA 3REHB 3TU4A 1BH8B 5AVBB 5CPJC 4LD9A 5B0YA 2YFVB 2Y2MA 3MNNB 2Y2IA 1F66A 3O62B 5G49A 1P3MC 3REHC 3WA9D 3RELC 3WA9A 5AVBC 3WTPD 1P3FD 3MNNC 2YFWB 3O62C 4E44A 1U35B 2PYOA 1TAFA 3W97B 5B2IB 1P34B 3AZED 5AVCA 3AYWB 3UTAD 1U35C 3UTAA 5B2JD 3NQUA 1M1AB 3W97C 5GT0A 5B2IC 5B2JA 1P34C 3KWQD 1P3GA 4XUJD 4ZBJB 3AZNC 3AYWC 4KHAB 1TZYD 5B32B 1P3PD 1TZYA 5AV9B 1M1AC 1KX5A 4NFTA 5B24D 3KUYB 5BNVB 4KGCD 5B32C 3AZIA 3LJAD 5AV9C 4WV4B 3LJAA 3KUYC 2NQBA 5BO0B 3MGPD 4J8VB 2HUEC 3AZFB 3MGPA 3W98B 1M19A 4WJ3C 3AZGA 4H9NB 3WTPB 3AZFC 1P3LD 1R4VA 1N1JB 1P3FB 1ZLAA 1BFMA 3WTPC 3AZEB 1P3FC 1F1EA 4CAYA 3REID 1EQZB 3KXBA 1KU5A 1Z2CB 4Z5TB 3REIA 4H9PB 3AZEC 3KWQB 4XUJB 1EQZC 4H9OA 1P3PB 3KWQC 1S32D 4XUJC 3LZ1D 1S32A 4KGCB 1P3BD 1TZYC 5FUGB 1P3PC 2HIOA 5E5AD 3LZ0A 2L5AA 4WNNA 3AFAD 3B6GD 1P3ID 5B24C 1P3IA 1H3OA 2BYKB 4KGCC 4UUZA 5B1MA 3LJAC 3W99B 2AROA 4J8UD 5B31G 3FDDA 3W99C 1P3LB 4XZQA 4YS3A 3B6FD 1P3LC 4WU9D 5B33D 5B33A 3X1SA 3REIC 4Z66D 3V9RB 3LELB 4DRAA 2IO5C 5BT1D 5KDMA 3LZ1B 1P3BB 1B67A 3B6GB 3AFAB 5E5AB 3X1VA 3AV2B 3UT9D 3MGSD 4H9RA 3MGQD 1S32C 3WAAA 3LZ1C 1P3BC 2ZM5A 5GT3D 3B6GC 5GSUA 5E5AC 3AFAC 3AV2C 3R45A 4J8UB 3REKD 4E45A 4QLCD 5JA4B 4NE5A 4JJNA 3AV1D 2FFFB 1P3OD 1BH9B 4G92B 4R8PA 5JRGD 4J8UC 5BNXB 3B6FB 1M18D 4WU9B 4G92C 4G91B 5AV5D 3AZMD 4KUDD 3B6FC 2G5HC 5AY8A 4WU9C 4Z66B 3H0MC 2BYMB 4G91C 2XD5A 3X1UD 5CHLB 4Z66C 4J8WA 3VH5W 3C1BD 5B31D 3F6TA 4WU8B 3UT9B 1ULYA 5BT1C 3MVDD 2JCHA 3AZHB 3TU4D 5GT3B 2CWEA 3RELB 4WU8C 3UT9C 3MGSC 3REKB 5B0YD 4LD9D 3MGQC 1F66D 1P3OB 3AZHC 5GT3C 5B0ZA 5JRGB 5B40A 3REKC 4QLCC 3AV1C 3AZKA 3REJD 5AV6A 1P3OC 2PYOD 5AV8A 3REJA 1M18B 5JRGC 5AVCD 5AV5B 3AZMB 3AZNB 4KUDB 2Y2NA 4J8XD 5F99A 5GT0D 1M18C 4J8XA 5GXQA 1P3GD 5AV5C 3X1UB 3AZMC 2RIQA 4KUDC 1KX5D 2JE5A 5BO0A 3VH5T 1HTAA 3C1BB 3W98A 5B31B 3X1UC 3AZID 2NZDA 3X1TD 2HUEB 3X1TA 3MVDB 1ID3A 2DF4C 3C1BC 2Y2QA 2F2AC 2NQBD 5B31C 2LY8A 2VQRA 4LD9B 5B0YB 4UPKA 5CP6A 1M19D 1F66B 5G49B 3MVDC 2FJ7D 3TU4C 3AZGD 4X23D 2FJ7A 3WA9B 4X23A 4LD9C 5B0YC 2J8PA 1F66C 1ZLAD 2PYOB 1TAFB 3WA9C 5AVCB 3KXBD 4ZUXA 5CPKD 3UTAB 2PYOC 3NQUB 5CPKA 5GT0B 5B2JB 2Y2LA 1P3KA 2F8NA 4HGAB 1P3GB 3A6NA 5AVCC 3UTAC 1TZYB 5GT0C 5B2JC 1KX5B 2UWXA 4HGAC 2RVQD 3VH6W 5B24B 1P3GC 3MGRA 3AZIB 2HIOD 3LZ0D 3LJAB 1KX5C 3C1CD 4EO5B 3C1CA 2ZY5A 5B1LA 2NQBB 1WWIA 5B1MD 3KSYA 3MGPB 3AZIC 3EPJA 2AROD 4YM6D 1M19B 2F8NH 4YM6A 3A1KA 4EO5C 1JFIA 3AZGB 2NQBC 1WWSA 4CSRA 4XZQD 3MGPC 5CPID 4YS3D 5CPIA 1M19C 3WKJD 3WKJA 1ZLAB 2FJ7C 3AZGC 3LELA 4CAYB 3AZLD 3KXBB 3REIB 3AZLA 1ZLAC 1HQ3A 3X1SD 1P3AA 2IO5B 3KXBC 4H9OB 5DNMA 4DQYB 2Y2HA 3VH6T 1KX4A 3NQJA 3H0RC 4H9SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HIO B;  3X1V D;  4WNN B;  3UTB D;  3UTB A;  1P3I B;  2RVQ C;  1AOI D;  3WAA D;  1H3O B;  1AOI A;  2CV5 D;  4UUZ B;  5B1M B;  2HIO C;  5GSU D;  3LZ0 C;  2CV5 A;  3W96 D;  2ARO B;  3W96 A;  1P3I C;  4JJN D;  5B1M C;  4XZQ B;  4YS3 B;  2ARO C;  4R8P D;  1KX3 A;  3AZJ A;  4XZQ C;  5CPI C;  4YS3 C;  5B33 B;  3X1S B;  3AN2 D;  3AN2 A;  5AY8 D;  4H9Q A;  5CPJ A;  5DNN D;  5DNN A;  1P3M D;  5B33 C;  3X1S C;  1P3M A;  3REH A;  5KDM B;  3REL A;  1BH8 A;  5AVB A;  4J8W D;  3X1V B;  3B0C W;  2YFV A;  3MNN A;  4H9R B;  3O62 A;  3MGS B;  3WAA B;  3MGQ B;  5GSU B;  3X1V C;  1A7W A;  3R45 B;  2YFW A;  1U35 A;  3W97 D;  4QLC B;  3WAA C;  4JJN B;  3W97 A;  5B2I A;  3AV1 B;  2JSS A;  1P34 A;  5GSU C;  1S32 B;  5B0Z D;  4R8P B;  5B40 D;  3AYW A;  4JJN C;  1M1A A;  3AZK D;  5AV6 D;  5AV8 D;  4R8P C;  5B32 D;  4M6B A;  4KHA A;  5B32 A;  5AV9 A;  5F99 D;  3KUY A;  5BNV A;  5AY8 B;  5GXQ D;  1Q9C A;  3AN2 C;  5AY8 C;  3VH6 A;  4J8V D;  4J8W B;  3AZF D;  4J8V A;  3AZF A;  5DNN C;  3W98 D;  3B0C T;  2NZD D;  4NE3 A;  1ID3 D;  4J8W C;  4H9N A;  3WTP A;  1N1J A;  4WZS B;  3TU4 B;  1P3F A;  4Z2M H;  2F8N K;  5CP6 D;  3AZE A;  5B0Z B;  1EQZ D;  5B40 B;  4Z5T D;  1EQZ A;  4Z5T A;  4H9P A;  3AZK B;  5AV6 B;  5AV8 B;  3REJ B;  3KWQ A;  5B0Z C;  4XUJ A;  5B40 C;  1P3P A;  3AZK C;  4ZUX D;  5AV6 C;  5B24 A;  5AV8 C;  5F99 B;  3REJ C;  1P3K D;  4J8X B;  4ZBJ C;  2F8N D;  4KGC A;  5GXQ B;  5FUG A;  3A6N D;  5F99 C;  4J8X C;  5BS7 A;  3W99 D;  2BYK A;  5GXQ C;  3W99 A;  3MGR D;  2NZD B;  3X1T B;  1ID3 B;  4J8V C;  5B1L D;  1P3L A;  3W98 C;  2NZD C;  3X1T C;  5CP6 B;  1ID3 C;  2FJ7 B;  4X23 B;  5CP6 C;  3B0B A;  4X23 C;  4Z5T C;  3LEL D;  3V9R A;  4ZUX B;  5CPK B;  1HQ3 D;  1P3K B;  2F8N B;  3LZ1 A;  1P3B A;  1B6W A;  3A6N B;  3AV2 D;  3AFA A;  5E5A A;  1P3A D;  3B6G A;  3AV2 A;  5DNM D;  4ZUX C;  5CPK C;  1P3K C;  1KX4 D;  5B32 G;  3A6N C;  4Z2M G;  3MGR B;  3VH5 A;  4J8U A;  5BS7 C;  3LZ0 B;  5JA4 A;  3C1C B;  5C3I B;  5B1L B;  1BH9 A;  3MGR C;  5BNX A;  4YM6 B;  1JFI B;  3C1C C;  5C3I C;  5B1L C;  3B6F A;  4WU9 A;  4CSR B;  5CPI B;  1KX3 D;  4YM6 C;  3WKJ B;  3WTP E;  3AZJ D;  4Z66 A;  2BYM A;  3WKJ C;  3AZL B;  1HQ3 B;  3LEL C;  1P3A B;  4WU8 D;  5DNM B;  5CPJ D;  4WU8 A;  3UT9 A;  3MGS A;  3AZL C;  1HQ3 C;  3MGQ A;  3AZH D;  1KX4 B;  4AWL B;  3REH D;  3AZH A;  3NQJ B;  5GT3 A;  3REL D;  1P3A C;  5AVB D;  4DRB A;  5DNM C;  3B0D B;  4NE6 A;  4QLC A;  3MNN D;  3REK A;  2F8N G;  3AV1 A;  3UTB B;  3O62 D;  1KX4 C;  4AWL C;  1P3O A;  4H9S C;  1AOI B;  2CV5 B;  5JRG A;  3B0D C;  3W96 B;  3UTB C;  1U35 D;  1M18 A;  5B2I D;  1P34 D;  1AOI C;  2CV5 C;  3W96 C;  5AV5 A;  3AZN D;  3AZM A;  3AYW D;  1KX3 B;  3AZN A;  4KUD A;  3AZJ B;  1M1A D;  1KX3 C;  3X1U A;  3AZJ C;  5AV9 D;  3AN2 B;  3KUY D;  3C1B A;  5B31 A;  4H9Q B;  5CPJ B;  5DNN B;  1P3M B;  3MVD A;  3REH B;  3TU4 A;  1BH8 B;  5AVB B;  5CPJ C;  4LD9 A;  5B0Y A;  2YFV B;  3MNN B;  1F66 A;  3O62 B;  5G49 A;  1P3M C;  3REH C;  3WA9 D;  3REL C;  3WA9 A;  5AVB C;  3WTP D;  1P3F D;  3MNN C;  2YFW B;  3O62 C;  4E44 A;  1U35 B;  2PYO A;  1TAF A;  3W97 B;  5B2I B;  1P34 B;  3AZE D;  5AVC A;  3AYW B;  3UTA D;  1U35 C;  3UTA A;  5B2J D;  3NQU A;  1M1A B;  3W97 C;  5GT0 A;  5B2I C;  5B2J A;  1P34 C;  3KWQ D;  1P3G A;  4XUJ D;  4ZBJ B;  3AZN C;  3AYW C;  4KHA B;  1TZY D;  5B32 B;  1P3P D;  1TZY A;  5AV9 B;  1M1A C;  1KX5 A;  4NFT A;  5B24 D;  3KUY B;  5BNV B;  4KGC D;  5B32 C;  3AZI A;  3LJA D;  5AV9 C;  4WV4 B;  3LJA A;  3KUY C;  2NQB A;  5BO0 B;  3MGP D;  4J8V B;  2HUE C;  3AZF B;  3MGP A;  3W98 B;  1M19 A;  3AZG A;  4H9N B;  3WTP B;  3AZF C;  1P3L D;  1R4V A;  1N1J B;  1P3F B;  1ZLA A;  1BFM A;  3WTP C;  3AZE B;  1P3F C;  1F1E A;  4CAY A;  3REI D;  1EQZ B;  3KXB A;  1KU5 A;  3REI A;  4Z5T B;  4H9P B;  3AZE C;  3KWQ B;  4XUJ B;  1EQZ C;  4H9O A;  1P3P B;  3KWQ C;  1S32 D;  4XUJ C;  3LZ1 D;  1S32 A;  4KGC B;  1P3B D;  1TZY C;  5FUG B;  1P3P C;  2HIO A;  5E5A D;  3LZ0 A;  2L5A A;  4WNN A;  3AFA D;  3B6G D;  1P3I D;  5B24 C;  1P3I A;  1H3O A;  2BYK B;  4KGC C;  4UUZ A;  5B1M A;  3LJA C;  3W99 B;  2ARO A;  4J8U D;  5B31 G;  3W99 C;  1P3L B;  4XZQ A;  4YS3 A;  3B6F D;  1P3L C;  4WU9 D;  5B33 D;  5B33 A;  3X1S A;  3REI C;  4Z66 D;  3V9R B;  3LEL B;  4DRA A;  2IO5 C;  5BT1 D;  5KDM A;  3LZ1 B;  1P3B B;  1B67 A;  3B6G B;  3AFA B;  5E5A B;  3X1V A;  3AV2 B;  3UT9 D;  3MGS D;  4H9R A;  3MGQ D;  1S32 C;  3WAA A;  3LZ1 C;  1P3B C;  5GT3 D;  3B6G C;  5GSU A;  5E5A C;  3AFA C;  3AV2 C;  3R45 A;  4J8U B;  3REK D;  4E45 A;  4QLC D;  5JA4 B;  4NE5 A;  4JJN A;  3AV1 D;  1P3O D;  1BH9 B;  4G92 B;  4R8P A;  5JRG D;  4J8U C;  5BNX B;  3B6F B;  1M18 D;  4WU9 B;  4G92 C;  4G91 B;  5AV5 D;  3AZM D;  4KUD D;  3B6F C;  4WU9 C;  5AY8 A;  4Z66 B;  2BYM B;  4G91 C;  3X1U D;  5CHL B;  4Z66 C;  4J8W A;  3VH5 W;  3C1B D;  5B31 D;  4WU8 B;  3UT9 B;  1ULY A;  5BT1 C;  3MVD D;  3AZH B;  3TU4 D;  5GT3 B;  2CWE A;  3REL B;  4WU8 C;  3UT9 C;  3MGS C;  3REK B;  5B0Y D;  4LD9 D;  3MGQ C;  1F66 D;  1P3O B;  3AZH C;  5GT3 C;  5B0Z A;  5JRG B;  5B40 A;  3REK C;  4QLC C;  3AV1 C;  3AZK A;  3REJ D;  5AV6 A;  1P3O C;  2PYO D;  5AV8 A;  3REJ A;  1M18 B;  5JRG C;  5AVC D;  5AV5 B;  3AZM B;  3AZN B;  4KUD B;  4J8X D;  5F99 A;  5GT0 D;  1M18 C;  4J8X A;  5GXQ A;  1P3G D;  5AV5 C;  3X1U B;  3AZM C;  4KUD C;  1KX5 D;  5BO0 A;  3VH5 T;  1HTA A;  3C1B B;  3W98 A;  5B31 B;  3X1U C;  3AZI D;  2NZD A;  3X1T D;  2HUE B;  3X1T A;  3MVD B;  1ID3 A;  3C1B C;  2NQB D;  5B31 C;  2LY8 A;  4LD9 B;  5B0Y B;  5CP6 A;  1M19 D;  1F66 B;  5G49 B;  3MVD C;  2FJ7 D;  3TU4 C;  3AZG D;  4X23 D;  2FJ7 A;  3WA9 B;  4X23 A;  4LD9 C;  5B0Y C;  1F66 C;  1ZLA D;  2PYO B;  1TAF B;  3WA9 C;  5AVC B;  3KXB D;  4ZUX A;  5CPK D;  3UTA B;  2PYO C;  3NQU B;  5CPK A;  5GT0 B;  5B2J B;  1P3K A;  2F8N A;  4HGA B;  1P3G B;  3A6N A;  5AVC C;  3UTA C;  1TZY B;  5GT0 C;  5B2J C;  1KX5 B;  3VH6 W;  4HGA C;  2RVQ D;  5B24 B;  1P3G C;  3MGR A;  3AZI B;  2HIO D;  3LZ0 D;  3LJA B;  1KX5 C;  3C1C D;  4EO5 B;  3C1C A;  5B1L A;  2NQB B;  1WWI A;  5B1M D;  3KSY A;  3MGP B;  3AZI C;  2ARO D;  4YM6 D;  1M19 B;  2F8N H;  4YM6 A;  4EO5 C;  1JFI A;  3AZG B;  2NQB C;  1WWS A;  4CSR A;  4XZQ D;  3MGP C;  5CPI D;  4YS3 D;  5CPI A;  1M19 C;  3WKJ D;  3WKJ A;  1ZLA B;  2FJ7 C;  3AZG C;  3LEL A;  4CAY B;  3AZL D;  3KXB B;  3REI B;  3AZL A;  1ZLA C;  1HQ3 A;  3X1S D;  1P3A A;  2IO5 B;  3KXB C;  4H9O B;  5DNM A;  3VH6 T;  1KX4 A;  3NQJ A;  4H9S A; 
#chains in the Genus database with same CATH topology
 2HIO B;  3X1V D;  4WNN B;  3UTB D;  3UTB A;  1P3I B;  2RVQ C;  1AOI D;  3WAA D;  1H3O B;  1AOI A;  2CV5 D;  4UUZ B;  5B1M B;  2HIO C;  5GSU D;  3LZ0 C;  2CV5 A;  3W96 D;  2ARO B;  3W96 A;  1P3I C;  4JJN D;  2XD1 A;  5B1M C;  4XZQ B;  4YS3 B;  2ARO C;  4R8P D;  1KX3 A;  3AZJ A;  2ZY2 A;  3KFU G;  4XZQ C;  5CPI C;  4YS3 C;  5B33 B;  3X1S B;  3AN2 D;  3AN2 A;  5AY8 D;  3EPL A;  4H9Q A;  5CPJ A;  5DNN D;  5DNN A;  1P3M D;  5B33 C;  3X1S C;  1P3M A;  3REH A;  5KDM B;  3REL A;  1BH8 A;  5AVB A;  4J8W D;  3X1V B;  3B0C W;  2YFV A;  3MNN A;  4H9R B;  3O62 A;  3MGS B;  2DQN C;  3MGQ B;  3WAA B;  5GSU B;  3X1V C;  1A7W A;  3R45 B;  2YFW A;  1T3U A;  1U35 A;  3W97 D;  4QLC B;  3WAA C;  4JJN B;  3W97 A;  5B2I A;  3AV1 B;  2JSS A;  1P34 A;  5GSU C;  1S32 B;  5B0Z D;  4R8P B;  5B40 D;  3AYW A;  4JJN C;  1M1A A;  3AZK D;  5AV6 D;  5AV8 D;  4R8P C;  5B32 D;  4M6B A;  4KHA A;  5B32 A;  5AV9 A;  5F99 D;  3KUY A;  5BNV A;  5AY8 B;  5GXQ D;  1Q9C A;  3AN2 C;  5AY8 C;  3VH6 A;  4J8V D;  4J8W B;  3AZF D;  4J8V A;  3AZF A;  5DNN C;  3W98 D;  3B0C T;  2NZD D;  4NE3 A;  1ID3 D;  4J8W C;  4H9N A;  3WTP A;  1N1J A;  4WZS B;  3TU4 B;  1P3F A;  1W2E A;  4Z2M H;  2F8N K;  5CP6 D;  3AZE A;  3P5J B;  5B0Z B;  1EQZ D;  5B40 B;  3A1I A;  4Z5T D;  1EQZ A;  4Z5T A;  4H9P A;  3AZK B;  3AL0 C;  5AV6 B;  5AV8 B;  3REJ B;  3KWQ A;  5B0Z C;  4XUJ A;  5B40 C;  1P3P A;  3AZK C;  4ZUX D;  5AV6 C;  5B24 A;  5AV8 C;  5F99 B;  3REJ C;  1P3K D;  4J8X B;  4ZBJ C;  2F8N D;  4KGC A;  5GXQ B;  5FUG A;  3A6N D;  2ZY4 A;  3H0L C;  5F99 C;  4J8X C;  5BS7 A;  3W99 D;  2BYK A;  5GXQ C;  3W99 A;  3EG5 B;  3MGR D;  2NZD B;  3X1T B;  1ID3 B;  4J8V C;  5B1L D;  1P3L A;  3W98 C;  2Y2J A;  2NZD C;  3X1T C;  5CP6 B;  1ID3 C;  2FJ7 B;  4X23 B;  5CP6 C;  3B0B A;  2G5I C;  4X23 C;  4Z5T C;  3LEL D;  3V9R A;  4ZUX B;  2Y2O A;  5CPK B;  1HQ3 D;  1P3K B;  2F8N B;  3LZ1 A;  1P3B A;  1B6W A;  3A6N B;  3AV2 D;  3AFA A;  5E5A A;  1P3A D;  3B6G A;  3AV2 A;  5DNM D;  4ZUX C;  2Y2G A;  5CPK C;  1P3K C;  1KX4 D;  5B32 G;  3A6N C;  4Z2M G;  3MGR B;  3VH5 A;  4J8U A;  5BS7 C;  3LZ0 B;  5JA4 A;  3C1C B;  5C3I B;  5B1L B;  1BH9 A;  3MGR C;  5BNX A;  2W8S A;  4YM6 B;  1JFI B;  3C1C C;  5C3I C;  2Y2P A;  5B1L C;  3B6F A;  4WU9 A;  4CSR B;  5CPI B;  1KX3 D;  4YM6 C;  3WKJ B;  3WTP E;  3AZJ D;  4Z66 A;  2BYM A;  3WKJ C;  2ZY3 A;  3AZL B;  1HQ3 B;  3LEL C;  1P3A B;  4WU8 D;  5DNM B;  5CPJ D;  4WU8 A;  3UT9 A;  3MGS A;  3AZL C;  1HQ3 C;  3MGQ A;  3AZH D;  1KX4 B;  4AWL B;  3REH D;  3AZH A;  3NQJ B;  5GT3 A;  3REL D;  1P3A C;  5AVB D;  4DRB A;  5DNM C;  3B0D B;  4NE6 A;  4QLC A;  3MNN D;  3REK A;  2F8N G;  3AV1 A;  3UTB B;  3O62 D;  1KX4 C;  3IP4 C;  3EPK A;  4AWL C;  1P3O A;  4H9S C;  1AOI B;  2CV5 B;  5JRG A;  3B0D C;  3W96 B;  3UTB C;  1U35 D;  3EPH A;  1M18 A;  5B2I D;  1P34 D;  1AOI C;  2CV5 C;  2BG1 A;  3W96 C;  5AV5 A;  3AZN D;  3AZM A;  3AYW D;  1KX3 B;  3AZN A;  4KUD A;  3AZJ B;  1M1A D;  1PZR A;  1KX3 C;  3X1U A;  3AZJ C;  5AV9 D;  3AN2 B;  3KUY D;  3C1B A;  5B31 A;  4H9Q B;  5CPJ B;  2Y2K A;  5DNN B;  1P3M B;  3MVD A;  3REH B;  3TU4 A;  1BH8 B;  5AVB B;  5CPJ C;  4LD9 A;  5B0Y A;  2YFV B;  2Y2M A;  3MNN B;  2Y2I A;  1F66 A;  3O62 B;  5G49 A;  1P3M C;  3REH C;  3WA9 D;  3REL C;  3WA9 A;  5AVB C;  3WTP D;  1P3F D;  3MNN C;  2YFW B;  3O62 C;  4E44 A;  1U35 B;  2PYO A;  1TAF A;  3W97 B;  5B2I B;  1P34 B;  3AZE D;  5AVC A;  3AYW B;  3UTA D;  1U35 C;  3UTA A;  5B2J D;  3NQU A;  1M1A B;  3W97 C;  5GT0 A;  5B2I C;  5B2J A;  1P34 C;  3KWQ D;  1P3G A;  4XUJ D;  4ZBJ B;  3AZN C;  3AYW C;  4KHA B;  1TZY D;  5B32 B;  1P3P D;  1TZY A;  5AV9 B;  1M1A C;  1KX5 A;  4NFT A;  5B24 D;  3KUY B;  5BNV B;  4KGC D;  5B32 C;  3AZI A;  3LJA D;  5AV9 C;  4WV4 B;  3LJA A;  3KUY C;  2NQB A;  5BO0 B;  3MGP D;  4J8V B;  2HUE C;  3AZF B;  3MGP A;  3W98 B;  1M19 A;  4WJ3 C;  3AZG A;  4H9N B;  3WTP B;  3AZF C;  1P3L D;  1R4V A;  1N1J B;  1P3F B;  1ZLA A;  1BFM A;  3WTP C;  3AZE B;  1P3F C;  1F1E A;  4CAY A;  3REI D;  1EQZ B;  3KXB A;  1KU5 A;  1Z2C B;  4Z5T B;  3REI A;  4H9P B;  3AZE C;  3KWQ B;  4XUJ B;  1EQZ C;  4H9O A;  1P3P B;  3KWQ C;  1S32 D;  4XUJ C;  3LZ1 D;  1S32 A;  4KGC B;  1P3B D;  1TZY C;  5FUG B;  1P3P C;  2HIO A;  5E5A D;  3LZ0 A;  2L5A A;  4WNN A;  3AFA D;  3B6G D;  1P3I D;  5B24 C;  1P3I A;  1H3O A;  2BYK B;  4KGC C;  4UUZ A;  5B1M A;  3LJA C;  3W99 B;  2ARO A;  4J8U D;  5B31 G;  3FDD A;  3W99 C;  1P3L B;  4XZQ A;  4YS3 A;  3B6F D;  1P3L C;  4WU9 D;  5B33 D;  5B33 A;  3X1S A;  3REI C;  4Z66 D;  3V9R B;  3LEL B;  4DRA A;  2IO5 C;  5BT1 D;  5KDM A;  3LZ1 B;  1P3B B;  1B67 A;  3B6G B;  3AFA B;  5E5A B;  3X1V A;  3AV2 B;  3UT9 D;  3MGS D;  4H9R A;  3MGQ D;  1S32 C;  3WAA A;  3LZ1 C;  1P3B C;  2ZM5 A;  5GT3 D;  3B6G C;  5GSU A;  5E5A C;  3AFA C;  3AV2 C;  3R45 A;  4J8U B;  3REK D;  4E45 A;  4QLC D;  5JA4 B;  4NE5 A;  4JJN A;  3AV1 D;  2FFF B;  1P3O D;  1BH9 B;  4G92 B;  4R8P A;  5JRG D;  4J8U C;  5BNX B;  3B6F B;  1M18 D;  4WU9 B;  4G92 C;  4G91 B;  5AV5 D;  3AZM D;  4KUD D;  3B6F C;  2G5H C;  5AY8 A;  4WU9 C;  4Z66 B;  3H0M C;  2BYM B;  4G91 C;  2XD5 A;  3X1U D;  5CHL B;  4Z66 C;  4J8W A;  3VH5 W;  3C1B D;  5B31 D;  3F6T A;  4WU8 B;  3UT9 B;  1ULY A;  5BT1 C;  3MVD D;  2JCH A;  3AZH B;  3TU4 D;  5GT3 B;  2CWE A;  3REL B;  4WU8 C;  3UT9 C;  3MGS C;  3REK B;  5B0Y D;  4LD9 D;  3MGQ C;  1F66 D;  1P3O B;  3AZH C;  5GT3 C;  5B0Z A;  5JRG B;  5B40 A;  3REK C;  4QLC C;  3AV1 C;  3AZK A;  3REJ D;  5AV6 A;  1P3O C;  2PYO D;  5AV8 A;  3REJ A;  1M18 B;  5JRG C;  5AVC D;  5AV5 B;  3AZM B;  3AZN B;  4KUD B;  2Y2N A;  4J8X D;  5F99 A;  5GT0 D;  1M18 C;  4J8X A;  5GXQ A;  1P3G D;  5AV5 C;  3X1U B;  3AZM C;  2RIQ A;  4KUD C;  1KX5 D;  2JE5 A;  5BO0 A;  3VH5 T;  1HTA A;  3C1B B;  3W98 A;  5B31 B;  3X1U C;  3AZI D;  2NZD A;  3X1T D;  2HUE B;  3X1T A;  3MVD B;  1ID3 A;  2DF4 C;  3C1B C;  2Y2Q A;  2F2A C;  2NQB D;  5B31 C;  2LY8 A;  2VQR A;  4LD9 B;  5B0Y B;  4UPK A;  5CP6 A;  1M19 D;  1F66 B;  5G49 B;  3MVD C;  2FJ7 D;  3TU4 C;  3AZG D;  4X23 D;  2FJ7 A;  3WA9 B;  4X23 A;  4LD9 C;  5B0Y C;  2J8P A;  1F66 C;  1ZLA D;  2PYO B;  1TAF B;  3WA9 C;  5AVC B;  3KXB D;  4ZUX A;  5CPK D;  3UTA B;  2PYO C;  3NQU B;  5CPK A;  5GT0 B;  5B2J B;  2Y2L A;  1P3K A;  2F8N A;  4HGA B;  1P3G B;  3A6N A;  5AVC C;  3UTA C;  1TZY B;  5GT0 C;  5B2J C;  1KX5 B;  2UWX A;  4HGA C;  2RVQ D;  3VH6 W;  5B24 B;  1P3G C;  3MGR A;  3AZI B;  2HIO D;  3LZ0 D;  3LJA B;  1KX5 C;  3C1C D;  4EO5 B;  3C1C A;  2ZY5 A;  5B1L A;  2NQB B;  1WWI A;  5B1M D;  3KSY A;  3MGP B;  3AZI C;  3EPJ A;  2ARO D;  4YM6 D;  1M19 B;  2F8N H;  4YM6 A;  3A1K A;  4EO5 C;  1JFI A;  3AZG B;  2NQB C;  1WWS A;  4CSR A;  4XZQ D;  3MGP C;  5CPI D;  4YS3 D;  5CPI A;  1M19 C;  3WKJ D;  3WKJ A;  1ZLA B;  2FJ7 C;  3AZG C;  3LEL A;  4CAY B;  3AZL D;  3KXB B;  3REI B;  3AZL A;  1ZLA C;  1HQ3 A;  3X1S D;  1P3A A;  2IO5 B;  3KXB C;  4H9O B;  5DNM A;  4DQY B;  2Y2H A;  3VH6 T;  1KX4 A;  3NQJ A;  3H0R C;  4H9S A; 
#chains in the Genus database with same CATH homology
 2HIO B;  3X1V D;  4WNN B;  3UTB D;  3UTB A;  1P3I B;  2RVQ C;  1AOI D;  3WAA D;  1H3O B;  1AOI A;  2CV5 D;  4UUZ B;  5B1M B;  2HIO C;  5GSU D;  3LZ0 C;  2CV5 A;  3W96 D;  2ARO B;  3W96 A;  1P3I C;  4JJN D;  2XD1 A;  5B1M C;  4XZQ B;  4YS3 B;  2ARO C;  4R8P D;  1KX3 A;  3AZJ A;  2ZY2 A;  3KFU G;  4XZQ C;  5CPI C;  4YS3 C;  5B33 B;  3X1S B;  3AN2 D;  3AN2 A;  5AY8 D;  3EPL A;  4H9Q A;  5CPJ A;  5DNN D;  5DNN A;  1P3M D;  5B33 C;  3X1S C;  1P3M A;  3REH A;  5KDM B;  3REL A;  1BH8 A;  5AVB A;  4J8W D;  3X1V B;  3B0C W;  2YFV A;  3MNN A;  4H9R B;  3O62 A;  3MGS B;  2DQN C;  3MGQ B;  3WAA B;  5GSU B;  3X1V C;  1A7W A;  3R45 B;  2YFW A;  1T3U A;  1U35 A;  3W97 D;  4QLC B;  3WAA C;  4JJN B;  3W97 A;  5B2I A;  3AV1 B;  2JSS A;  1P34 A;  5GSU C;  1S32 B;  5B0Z D;  4R8P B;  5B40 D;  3AYW A;  4JJN C;  1M1A A;  3AZK D;  5AV6 D;  5AV8 D;  4R8P C;  5B32 D;  4M6B A;  4KHA A;  5B32 A;  5AV9 A;  5F99 D;  3KUY A;  5BNV A;  5AY8 B;  5GXQ D;  1Q9C A;  3AN2 C;  5AY8 C;  3VH6 A;  4J8V D;  4J8W B;  3AZF D;  4J8V A;  3AZF A;  5DNN C;  3W98 D;  3B0C T;  2NZD D;  4NE3 A;  1ID3 D;  4J8W C;  4H9N A;  3WTP A;  1N1J A;  4WZS B;  3TU4 B;  1P3F A;  1W2E A;  4Z2M H;  2F8N K;  5CP6 D;  3AZE A;  3P5J B;  5B0Z B;  1EQZ D;  5B40 B;  3A1I A;  4Z5T D;  1EQZ A;  4Z5T A;  4H9P A;  3AZK B;  3AL0 C;  5AV6 B;  5AV8 B;  3REJ B;  3KWQ A;  5B0Z C;  4XUJ A;  5B40 C;  1P3P A;  3AZK C;  4ZUX D;  5AV6 C;  5B24 A;  5AV8 C;  5F99 B;  3REJ C;  1P3K D;  4J8X B;  4ZBJ C;  2F8N D;  4KGC A;  5GXQ B;  5FUG A;  3A6N D;  2ZY4 A;  3H0L C;  5F99 C;  4J8X C;  5BS7 A;  3W99 D;  2BYK A;  5GXQ C;  3W99 A;  3EG5 B;  3MGR D;  2NZD B;  3X1T B;  1ID3 B;  4J8V C;  5B1L D;  1P3L A;  3W98 C;  2Y2J A;  2NZD C;  3X1T C;  5CP6 B;  1ID3 C;  2FJ7 B;  4X23 B;  5CP6 C;  3B0B A;  2G5I C;  4X23 C;  4Z5T C;  3LEL D;  3V9R A;  4ZUX B;  2Y2O A;  5CPK B;  1HQ3 D;  1P3K B;  2F8N B;  3LZ1 A;  1P3B A;  1B6W A;  3A6N B;  3AV2 D;  3AFA A;  5E5A A;  1P3A D;  3B6G A;  3AV2 A;  5DNM D;  4ZUX C;  2Y2G A;  5CPK C;  1P3K C;  1KX4 D;  5B32 G;  3A6N C;  4Z2M G;  3MGR B;  3VH5 A;  4J8U A;  5BS7 C;  3LZ0 B;  5JA4 A;  3C1C B;  5C3I B;  5B1L B;  1BH9 A;  3MGR C;  5BNX A;  2W8S A;  4YM6 B;  1JFI B;  3C1C C;  5C3I C;  2Y2P A;  5B1L C;  3B6F A;  4WU9 A;  4CSR B;  5CPI B;  1KX3 D;  4YM6 C;  3WKJ B;  3WTP E;  3AZJ D;  4Z66 A;  2BYM A;  3WKJ C;  2ZY3 A;  3AZL B;  1HQ3 B;  3LEL C;  1P3A B;  4WU8 D;  5DNM B;  5CPJ D;  4WU8 A;  3UT9 A;  3MGS A;  3AZL C;  1HQ3 C;  3MGQ A;  3AZH D;  1KX4 B;  4AWL B;  3REH D;  3AZH A;  3NQJ B;  5GT3 A;  3REL D;  1P3A C;  5AVB D;  4DRB A;  5DNM C;  3B0D B;  4NE6 A;  4QLC A;  3MNN D;  3REK A;  2F8N G;  3AV1 A;  3UTB B;  3O62 D;  1KX4 C;  3IP4 C;  3EPK A;  4AWL C;  1P3O A;  4H9S C;  1AOI B;  2CV5 B;  5JRG A;  3B0D C;  3W96 B;  3UTB C;  1U35 D;  3EPH A;  1M18 A;  5B2I D;  1P34 D;  1AOI C;  2CV5 C;  2BG1 A;  3W96 C;  5AV5 A;  3AZN D;  3AZM A;  3AYW D;  1KX3 B;  3AZN A;  4KUD A;  3AZJ B;  1M1A D;  1PZR A;  1KX3 C;  3X1U A;  3AZJ C;  5AV9 D;  3AN2 B;  3KUY D;  3C1B A;  5B31 A;  4H9Q B;  5CPJ B;  2Y2K A;  5DNN B;  1P3M B;  3MVD A;  3REH B;  3TU4 A;  1BH8 B;  5AVB B;  5CPJ C;  4LD9 A;  5B0Y A;  2YFV B;  2Y2M A;  3MNN B;  2Y2I A;  1F66 A;  3O62 B;  5G49 A;  1P3M C;  3REH C;  3WA9 D;  3REL C;  3WA9 A;  5AVB C;  3WTP D;  1P3F D;  3MNN C;  2YFW B;  3O62 C;  4E44 A;  1U35 B;  2PYO A;  1TAF A;  3W97 B;  5B2I B;  1P34 B;  3AZE D;  5AVC A;  3AYW B;  3UTA D;  1U35 C;  3UTA A;  5B2J D;  3NQU A;  1M1A B;  3W97 C;  5GT0 A;  5B2I C;  5B2J A;  1P34 C;  3KWQ D;  1P3G A;  4XUJ D;  4ZBJ B;  3AZN C;  3AYW C;  4KHA B;  1TZY D;  5B32 B;  1P3P D;  1TZY A;  5AV9 B;  1M1A C;  1KX5 A;  4NFT A;  5B24 D;  3KUY B;  5BNV B;  4KGC D;  5B32 C;  3AZI A;  3LJA D;  5AV9 C;  4WV4 B;  3LJA A;  3KUY C;  2NQB A;  5BO0 B;  3MGP D;  4J8V B;  2HUE C;  3AZF B;  3MGP A;  3W98 B;  1M19 A;  4WJ3 C;  3AZG A;  4H9N B;  3WTP B;  3AZF C;  1P3L D;  1R4V A;  1N1J B;  1P3F B;  1ZLA A;  1BFM A;  3WTP C;  3AZE B;  1P3F C;  1F1E A;  4CAY A;  3REI D;  1EQZ B;  3KXB A;  1KU5 A;  1Z2C B;  4Z5T B;  3REI A;  4H9P B;  3AZE C;  3KWQ B;  4XUJ B;  1EQZ C;  4H9O A;  1P3P B;  3KWQ C;  1S32 D;  4XUJ C;  3LZ1 D;  1S32 A;  4KGC B;  1P3B D;  1TZY C;  5FUG B;  1P3P C;  2HIO A;  5E5A D;  3LZ0 A;  2L5A A;  4WNN A;  3AFA D;  3B6G D;  1P3I D;  5B24 C;  1P3I A;  1H3O A;  2BYK B;  4KGC C;  4UUZ A;  5B1M A;  3LJA C;  3W99 B;  2ARO A;  4J8U D;  5B31 G;  3FDD A;  3W99 C;  1P3L B;  4XZQ A;  4YS3 A;  3B6F D;  1P3L C;  4WU9 D;  5B33 D;  5B33 A;  3X1S A;  3REI C;  4Z66 D;  3V9R B;  3LEL B;  4DRA A;  2IO5 C;  5BT1 D;  5KDM A;  3LZ1 B;  1P3B B;  1B67 A;  3B6G B;  3AFA B;  5E5A B;  3X1V A;  3AV2 B;  3UT9 D;  3MGS D;  4H9R A;  3MGQ D;  1S32 C;  3WAA A;  3LZ1 C;  1P3B C;  2ZM5 A;  5GT3 D;  3B6G C;  5GSU A;  5E5A C;  3AFA C;  3AV2 C;  3R45 A;  4J8U B;  3REK D;  4E45 A;  4QLC D;  5JA4 B;  4NE5 A;  4JJN A;  3AV1 D;  2FFF B;  1P3O D;  1BH9 B;  4G92 B;  4R8P A;  5JRG D;  4J8U C;  5BNX B;  3B6F B;  1M18 D;  4WU9 B;  4G92 C;  4G91 B;  5AV5 D;  3AZM D;  4KUD D;  3B6F C;  2G5H C;  5AY8 A;  4WU9 C;  4Z66 B;  3H0M C;  2BYM B;  4G91 C;  2XD5 A;  3X1U D;  5CHL B;  4Z66 C;  4J8W A;  3VH5 W;  3C1B D;  5B31 D;  3F6T A;  4WU8 B;  3UT9 B;  1ULY A;  5BT1 C;  3MVD D;  2JCH A;  3AZH B;  3TU4 D;  5GT3 B;  2CWE A;  3REL B;  4WU8 C;  3UT9 C;  3MGS C;  3REK B;  5B0Y D;  4LD9 D;  3MGQ C;  1F66 D;  1P3O B;  3AZH C;  5GT3 C;  5B0Z A;  5JRG B;  5B40 A;  3REK C;  4QLC C;  3AV1 C;  3AZK A;  3REJ D;  5AV6 A;  1P3O C;  2PYO D;  5AV8 A;  3REJ A;  1M18 B;  5JRG C;  5AVC D;  5AV5 B;  3AZM B;  3AZN B;  4KUD B;  2Y2N A;  4J8X D;  5F99 A;  5GT0 D;  1M18 C;  4J8X A;  5GXQ A;  1P3G D;  5AV5 C;  3X1U B;  3AZM C;  2RIQ A;  4KUD C;  1KX5 D;  2JE5 A;  5BO0 A;  3VH5 T;  1HTA A;  3C1B B;  3W98 A;  5B31 B;  3X1U C;  3AZI D;  2NZD A;  3X1T D;  2HUE B;  3X1T A;  3MVD B;  1ID3 A;  2DF4 C;  3C1B C;  2Y2Q A;  2F2A C;  2NQB D;  5B31 C;  2LY8 A;  2VQR A;  4LD9 B;  5B0Y B;  4UPK A;  5CP6 A;  1M19 D;  1F66 B;  5G49 B;  3MVD C;  2FJ7 D;  3TU4 C;  3AZG D;  4X23 D;  2FJ7 A;  3WA9 B;  4X23 A;  4LD9 C;  5B0Y C;  2J8P A;  1F66 C;  1ZLA D;  2PYO B;  1TAF B;  3WA9 C;  5AVC B;  3KXB D;  4ZUX A;  5CPK D;  3UTA B;  2PYO C;  3NQU B;  5CPK A;  5GT0 B;  5B2J B;  2Y2L A;  1P3K A;  2F8N A;  4HGA B;  1P3G B;  3A6N A;  5AVC C;  3UTA C;  1TZY B;  5GT0 C;  5B2J C;  1KX5 B;  2UWX A;  4HGA C;  2RVQ D;  3VH6 W;  5B24 B;  1P3G C;  3MGR A;  3AZI B;  2HIO D;  3LZ0 D;  3LJA B;  1KX5 C;  3C1C D;  4EO5 B;  3C1C A;  2ZY5 A;  5B1L A;  2NQB B;  1WWI A;  5B1M D;  3KSY A;  3MGP B;  3AZI C;  3EPJ A;  2ARO D;  4YM6 D;  1M19 B;  2F8N H;  4YM6 A;  3A1K A;  4EO5 C;  1JFI A;  3AZG B;  2NQB C;  1WWS A;  4CSR A;  4XZQ D;  3MGP C;  5CPI D;  4YS3 D;  5CPI A;  1M19 C;  3WKJ D;  3WKJ A;  1ZLA B;  2FJ7 C;  3AZG C;  3LEL A;  4CAY B;  3AZL D;  3KXB B;  3REI B;  3AZL A;  1ZLA C;  1HQ3 A;  3X1S D;  1P3A A;  2IO5 B;  3KXB C;  4H9O B;  5DNM A;  4DQY B;  2Y2H A;  3VH6 T;  1KX4 A;  3NQJ A;  3H0R C;  4H9S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...