4E44A

Crystal structure of the hmhf1/hmhf2 histone-fold tetramer
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
104
structure length
104
Chain Sequence
b'GSMEEEAETEEQQRFSYQQRLKAAVHYTVGCLCEEVALDKEMQFSKQTIAAISELTFRQCENFAKDLEMFARHAKRTTINTEDVKLLARRSNSLLKYITDKSEE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Centromere protein S
molecule tags Dna binding protein
source organism Homo sapiens
publication title Crystal Structures Reveal that FANCM remodels the MHF Tetramer in favor of binding Branched DNA
rcsb
total genus 41
structure length 104
sequence length 104
chains with identical sequence C
ec nomenclature
pdb deposition date 2012-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF15630 CENP-S CENP-S protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4e44A00
3TU4D 4QLCB 4G92B 4YM6B 3AZNC 3W96B 2BYMA 2HIOC 5DNMA 1HQ3C 3X1SB 5B24B 1P3BD 1P3MC 4Z5TC 4E44A 1S32D 3REID 4LD9B 3B6GD 3LZ1B 3REJB 4H9QA 2YFWA 4XZQD 3MGRA 1P3LC 3UTAA 5CPKA 3B0CW 3REKA 5G49B 2AROD 4WNNB 2IO5B 4H9OB 5C3IB 5GT0B 3O62C 5BS7A 4J8WB 5B40B 5E5AB 3REKB 5F99D 4ZBJB 3AV1A 4R8PD 3LJAD 5DNNB 3AZLB 2F8NK 1KX3C 3NQJA 1N1JB 3LJAA 4R8PA 3AV1D 2PYOB 5F99A 3TU4B 3LZ0C 5B1LB 3B0DC 5B32B 3NQUA 5B2JB 2AROA 5B31B 5CP6C 3REKD 3A6NC 3REIB 5CPKD 5BO0B 5G49A 3UTAD 3W99B 4XZQA 4HGAB 3MGRD 2NQBC 3MGQC 3B6GA 3REIA 1S32A 3VH6T 5B33C 1P3BA 5DNMD 1TZYB 1TZYC 4G91C 4J8UB 3UT9B 5FUGB 3TU4A 1M18C 3WKJA 3AZEA 1TAFA 5CPIA 4J8UA 4ZUXA 1M1AB 3LZ0D 3AZFA 3AV1B 4JJNC 4Z66C 4H9RA 1M19B 5AVBB 5AV6C 5B24A 1F66C 3W97C 3WAAB 1P3GD 3LJAC 3AYWA 4R8PC 3MGSB 3MGPC 2PYOA 3VH6A 4YS3C 3KXBD 5AV8C 3O62D 5BNXB 4DRAA 5B2JA 3V9RA 4KHAB 2BYKA 3A6NA 5GSUA 3MGSD 3X1UB 4LD9A 3WTPD 3AN2A 3KWQB 5CPJB 4M6BA 5AV8B 1P3IB 3KUYB 5B1LD 1P3OB 3MGQA 5GXQB 3B6GC 5CPKB 3REIC 4Z2MG 5B31D 3AFAC 3WAAC 1HQ3D 3R45A 1P3BC 3X1SD 1P3BB 3C1CB 3B0DB 3WTPC 1TZYA 5B40C 5BNVA 3X1TD 1JFIB 1M1AC 5GXQD 1U35A 3TU4C 3KSYA 4QLCD 3WKJC 3AZKD 4H9SA 4H9PB 4WV4B 4UUZA 3MNNB 1KX5A 5AV8D 5CPIC 1BH9A 4ZUXC 4YS3D 5BNXA 1N1JA 3LJAB 5B1MC 3C1BA 5BT1C 4J8VD 3RELC 4H9NA 5AY8A 2BYKB 1KU5A 3X1UA 3REJA 4Z66A 3W97A 5JA4B 5AV6A 4H9QB 1P3GC 1F66A 5B0ZA 1ZLAC 4CSRB 5GT3A 3LZ1D 3O62B 3AYWC 4AWLB 1P3PD 1P3OA 1ID3A 1S32B 4X23D 3MGQB 2NZDD 2CV5C 5KDMA 1P34A 5B32D 5GT3B 1ID3B 3V9RB 5GSUC 5BNVB 1P34B 4LD9C 3AZEB 5B33B 4EO5B 4H9PA 5B33D 4ZUXB 3C1CD 1P3MA 2JSSA 3B6FC 1BH9B 5E5AD 3B0BA 4Z2MH 5AVBA 4WU9B 3WAAA 3W96A 3MGRC 3R45B 3NQUB 5B0ZB 3UTAC 3WA9D 1B6WA 3WTPB 5CPIB 3REKC 1M1AA 5CP6D 3AFAB 1U35C 3LELA 5AVCB 5B0YA 4UUZB 3MNNA 1KX5C 1KX5B 3WTPE 3A6NB 1AOID 3C1BB 5AY8C 3AV2D 3AZED 5AY8B 3KWQA 3X1UC 1KX4D 3AZHD 1KX3D 5B0ZC 5CHLB 4WU9D 1P3OC 2CV5A 1P3FD 5KDMB 2IO5C 5C3IC 3X1VC 3UTBD 3NQJB 5DNND 3AZLD 2AROC 4CAYB 3AZJD 5E5AC 4JJNB 3B6FD 4H9RB 4J8WD 1P3LD 2NQBA 3MGPB 3AZHB 5DNMB 3AZMC 3AZIA 3MVDB 2F8ND 4Z5TD 1S32C 1M18B 5AVBC 5AV6B 1F66B 1BFMA 3W96C 1P3LB 5JRGA 2HIOD 3AZNB 2FJ7A 2YFWB 5AVCD 3MGRB 4J8XB 3AZND 3W99D 3VH5A 1P3KB 1P3KC 4J8VB 1ULYA 4Z5TB 1M18A 2F8NB 1P3PC 2CV5B 4WU8C 4WNNA 1M19D 3KUYA 5B31G 4XUJD 1ZLAD 4YM6C 3RELD 1H3OA 4J8VC 3UT9A 3X1TB 5B1MD 1P3AA 5FUGA 4YM6D 3W98A 4JJNA 3AZGD 4KGCA 1EQZD 4WU8D 3AZKC 5B32G 3REHD 5B2ID 4NE5A 3MGPA 5AV9A 1P3KD 3MVDA 3W99C 5B40D 3X1VA 4E45A 4KUDD 5CPJD 1P3ID 5AV5D 5B31C 5CP6B 5GT0D 3AFAD 4J8XA 2AROB 3AZMD 5JA4A 3X1VB 5B1LC 4KUDB 4J8WC 3AZMA 3AZIC 4J8XD 3REHB 5GT0A 3AFAA 5DNNC 3AZLC 5AV5A 4EO5C 5CPJA 1P3IA 1HTAA 5B40A 3UTBC 2CWEA 3X1VD 2FJ7C 4KUDA 3B0CT 3MVDD 1P3KA 5AV9D 5B2IA 3MGPD 3REHA 4WU8A 4WU9C 1EQZA 4KGCD 3KUYC 4R8PB 3AZGA 1P3MB 4JJND 3AV2B 1TAFB 4YM6A 5B1MA 1P3AC 1JFIA 3UT9D 1P3AD 3VH5W 3RELA 3W98C 3W98D 1R4VA 3REJC 2BYMB 1ZLAA 4XUJA 3AZFB 3KUYD 1M19A 2YFVA 1P3FB 1ID3C 1M18D 5B1MB 4YS3B 3W99A 5JRGB 3AZNA 5AVCA 4XZQB 2F8NG 3WA9C 2FJ7D 2HIOA 5JRGD 4CSRA 5DNMC 4AWLC 4Z5TA 4J8XC 2F8NA 3AZID 1B67A 5B2IB 3C1CC 1P3GB 2NQBD 1A7WA 1P3LA 3UTBB 4J8WA 3B6FA 3VH5T 3AZMB 5CPKC 3VH6W 3LZ0B 3AZJA 5DNNA 3AZLA 5AV5C 5CPJC 1P3IC 1ZLAB 3UTBA 4KUDC 5BS7C 1KX3B 5B32C 2YFVB 2CV5D 1P3FA 3REHC 1H3OB 1P3AB 3W98B 3LELC 4WU9A 5B0YC 4NE3A 3MNNC 2NQBB 1KX3A 4HGAC 3AZHA 1KX4A 3KWQD 3AV2A 1AOIA 3KWQC 5AV9B 4XUJC 3LELB 3MNND 4Z66B 1M19C 5B0YD 2FJ7B 3W97B 3LELD 3UTAB 5GXQC 5CP6A 3B6GB 1M1AD 3X1TC 3AN2B 5AVCC 3WA9A 1HQ3B 4XZQC 3X1SC 2HIOB 3W96D 3WAAD 2HUEC 5AVBD 5E5AA 1P3MD 3C1CA 5B33A 1Q9CA 5AV5B 3B6FB 4NE6A 1KX4B 3MGSC 1WWIA 3AZJC 1P3PB 3AZJB 5JRGC 3AZEC 3AYWB 1EQZB 5B32A 3KXBB 4J8UC 1P34D 3KXBC 1P3FC 1F1EA 4H9NB 4X23A 2NZDA 1P3OD 1P3PA 1ID3D 3AZFC 3RELB 4NFTA 3LZ1A 5GT3D 5B24C 5B0ZD 3WA9B 5AV6D 1F66D 3AZHC 4Z66D 2HUEB 3X1UD 3REJD 1KX4C 3W97D 2F8NH 5AY8D 3AV2C 4J8VA 3UT9C 3C1BD 2PYOC 4DRBA 1AOIC 4G92C 4YS3A 5AV8A 4KGCC 1KX5D 3AZKA 4QLCA 5B2JC 5GXQA 1U35D 5AV9C 3X1TA 3MVDC 3WKJB 2RVQD 1TZYD 3AN2C 3X1SA 3AZGB 1HQ3A 5B31A 4CAYA 1U35B 4X23B 3MGQD 2NZDB 4XUJB 5B1LA 2L5AA 3WTPA 3AN2D 2RVQC 4LD9D 5GSUD 3A6ND 3MGSA 1AOIB 3AZIB 5B2JD 5GT0C 5B0YB 4H9SC 5BO0A 1BH8A 3O62A 4ZBJC 3KXBA 3AZKB 4X23C 4KHAA 2NZDC 3C1BC 5B2IC 5GSUB 2PYOD 3AV1C 3AYWD 4WZSB 1P3GA 3LZ1C 1BH8B 1EQZC 5B24D 3AZGC 5GT3C 1WWSA 3AZFD 5F99B 5BT1D 2LY8A 5F99C 3LZ0A 4H9OA 4ZUXD 4J8UD 1P34C 5CPID 4WU8B 4G91B 4KGCB 3WKJD 4QLCC
chains in the Genus database with same CATH superfamily
3TU4D 4QLCB 2ZY2A 4G92B 4YM6B 2Y2MA 3AZNC 3H0RC 3W96B 2BYMA 2HIOC 5DNMA 1HQ3C 3X1SB 5B24B 1P3BD 1P3MC 4Z5TC 4E44A 1S32D 3REID 2Y2HA 4LD9B 3B6GD 3LZ1B 3REJB 2G5IC 4H9QA 2YFWA 4XZQD 3MGRA 1P3LC 3UTAA 5CPKA 3B0CW 3REKA 5G49B 2AROD 3EPJA 4WNNB 2IO5B 4H9OB 5C3IB 5GT0B 3O62C 5BS7A 3EPLA 4J8WB 5B40B 5E5AB 3REKB 5F99D 4ZBJB 3AV1A 4R8PD 3LJAD 5DNNB 3AZLB 2F8NK 1KX3C 4WJ3C 3NQJA 1N1JB 3LJAA 4R8PA 3AV1D 2PYOB 5F99A 3TU4B 3LZ0C 5B1LB 3B0DC 5B32B 3NQUA 5B2JB 2AROA 5B31B 5CP6C 3REKD 3A6NC 3REIB 5CPKD 5BO0B 5G49A 3UTAD 3W99B 4XZQA 4HGAB 3MGRD 2NQBC 3MGQC 3B6GA 3REIA 1S32A 3VH6T 5B33C 1P3BA 5DNMD 1TZYB 1TZYC 2DQNC 4G91C 4J8UB 3UT9B 5FUGB 3TU4A 1M18C 1T3UA 3WKJA 3AZEA 1TAFA 5CPIA 4J8UA 4ZUXA 1M1AB 3LZ0D 3AZFA 3AV1B 4JJNC 4Z66C 4H9RA 1M19B 5AVBB 5AV6C 5B24A 1F66C 3W97C 3WAAB 1P3GD 3LJAC 3AYWA 4R8PC 3MGSB 3MGPC 2PYOA 3VH6A 4YS3C 3KXBD 5AV8C 2JE5A 3O62D 5BNXB 4DRAA 2Y2OA 5B2JA 3V9RA 4KHAB 2BYKA 3A6NA 5GSUA 3MGSD 3X1UB 3P5JB 4LD9A 3WTPD 3AN2A 3KWQB 5CPJB 4M6BA 5AV8B 1P3IB 3KUYB 5B1LD 2RIQA 2ZY3A 1P3OB 3MGQA 5GXQB 3B6GC 5CPKB 3REIC 4Z2MG 5B31D 3AFAC 3WAAC 1HQ3D 3R45A 1P3BC 3X1SD 1P3BB 3C1CB 3B0DB 3WTPC 1TZYA 5B40C 2ZM5A 5BNVA 3X1TD 1JFIB 1M1AC 5GXQD 1U35A 3TU4C 2G5HC 3KSYA 4QLCD 3WKJC 3AZKD 4H9SA 4H9PB 4WV4B 4UUZA 3MNNB 1KX5A 5AV8D 3A1IA 5CPIC 1BH9A 4ZUXC 4YS3D 5BNXA 1N1JA 3LJAB 5B1MC 3C1BA 5BT1C 4J8VD 3RELC 4H9NA 5AY8A 2BYKB 1KU5A 3X1UA 3REJA 3W97A 5JA4B 4Z66A 5AV6A 4H9QB 1P3GC 1F66A 5B0ZA 1ZLAC 4CSRB 5GT3A 3LZ1D 3O62B 3AYWC 4AWLB 1P3PD 1P3OA 1ID3A 1S32B 4X23D 3MGQB 2NZDD 2CV5C 5KDMA 1P34A 5B32D 5GT3B 1ID3B 2J8PA 3V9RB 5GSUC 5BNVB 1P34B 4LD9C 3AZEB 5B33B 3A1KA 4EO5B 2Y2PA 4H9PA 5B33D 4ZUXB 2W8SA 3C1CD 1P3MA 2JSSA 3B6FC 1BH9B 5E5AD 3B0BA 2XD5A 4Z2MH 5AVBA 2Y2QA 4WU9B 3WAAA 3W96A 3MGRC 3R45B 3NQUB 5B0ZB 3UTAC 3WA9D 1B6WA 3WTPB 5CPIB 2Y2NA 3REKC 1M1AA 5CP6D 3AFAB 1U35C 3LELA 5AVCB 5B0YA 4UUZB 3MNNA 1KX5C 1KX5B 3WTPE 2JCHA 3A6NB 1AOID 3C1BB 5AY8C 3AV2D 3AZED 5AY8B 3KWQA 3X1UC 1KX4D 3AZHD 1KX3D 5B0ZC 5CHLB 1W2EA 4WU9D 1P3OC 2CV5A 1P3FD 5KDMB 2IO5C 5C3IC 3X1VC 3UTBD 3NQJB 5DNND 3AZLD 2AROC 4CAYB 3AZJD 5E5AC 4JJNB 3B6FD 4H9RB 4J8WD 1P3LD 2BG1A 2NQBA 2Y2GA 3MGPB 3AZHB 5DNMB 3AZMC 3AZIA 3MVDB 2F8ND 4Z5TD 1S32C 1M18B 5AVBC 5AV6B 1F66B 1BFMA 3W96C 1P3LB 5JRGA 2HIOD 3AZNB 2FJ7A 2Y2LA 2YFWB 5AVCD 3MGRB 4J8XB 3AZND 3W99D 3VH5A 1Z2CB 1P3KB 4J8VB 1P3KC 1ULYA 4Z5TB 1M18A 2F8NB 1P3PC 2CV5B 4WU8C 4WNNA 1M19D 3KUYA 5B31G 4XUJD 1ZLAD 4YM6C 3RELD 1H3OA 4J8VC 3UT9A 3X1TB 5B1MD 1P3AA 5FUGA 4YM6D 3W98A 4JJNA 3AZGD 4KGCA 1EQZD 4DQYB 4WU8D 3AZKC 5B32G 3REHD 5B2ID 4NE5A 3MGPA 5AV9A 1P3KD 3MVDA 3W99C 5B40D 3X1VA 4E45A 4KUDD 5CPJD 1P3ID 5AV5D 5B31C 5CP6B 5GT0D 3AFAD 4J8XA 2AROB 3AZMD 5JA4A 3X1VB 5B1LC 4KUDB 4J8WC 3AZMA 2VQRA 3AZIC 4J8XD 3REHB 2F2AC 5GT0A 5DNNC 3AFAA 3AZLC 5AV5A 4EO5C 5CPJA 1P3IA 1HTAA 5B40A 3UTBC 2CWEA 2UWXA 3X1VD 2FJ7C 3B0CT 4KUDA 3MVDD 1P3KA 5AV9D 3EPHA 3FDDA 5B2IA 3MGPD 3REHA 4WU8A 4WU9C 1EQZA 4KGCD 3KUYC 4R8PB 3AZGA 1P3MB 4JJND 3AV2B 1TAFB 4YM6A 5B1MA 1P3AC 1JFIA 3UT9D 1P3AD 3VH5W 3RELA 3W98C 3W98D 1R4VA 3REJC 2BYMB 2Y2IA 4XUJA 1ZLAA 3AZFB 3KUYD 1M19A 2YFVA 1P3FB 1ID3C 1M18D 5B1MB 2Y2JA 4YS3B 3W99A 5JRGB 3AZNA 5AVCA 4XZQB 2F8NG 2ZY4A 2FJ7D 3WA9C 2HIOA 5JRGD 4CSRA 5DNMC 4AWLC 4Z5TA 4J8XC 2F8NA 3F6TA 3EPKA 3AZID 1B67A 5B2IB 2XD1A 3C1CC 1P3GB 2NQBD 1A7WA 1P3LA 3UTBB 3EG5B 4J8WA 3B6FA 3VH5T 3AZMB 5CPKC 3VH6W 3LZ0B 3AZJA 5DNNA 3AZLA 5AV5C 5CPJC 1P3IC 1ZLAB 3UTBA 4KUDC 5BS7C 1KX3B 5B32C 2YFVB 2CV5D 1P3FA 3REHC 1H3OB 1P3AB 3W98B 3LELC 4WU9A 5B0YC 4NE3A 3MNNC 2NQBB 1KX3A 4HGAC 3AZHA 1KX4A 3KWQD 3AV2A 1AOIA 3KWQC 5AV9B 4XUJC 3LELB 3MNND 4Z66B 1M19C 5B0YD 2FJ7B 3W97B 3LELD 3UTAB 5GXQC 5CP6A 3B6GB 1M1AD 3X1TC 3AN2B 5AVCC 3WA9A 2Y2KA 1HQ3B 4XZQC 3X1SC 2HIOB 2FFFB 3WAAD 2HUEC 3W96D 5AVBD 5E5AA 1P3MD 3C1CA 5B33A 1Q9CA 5AV5B 3B6FB 4NE6A 1KX4B 3MGSC 1WWIA 3IP4C 3AZJC 1P3PB 3AZJB 5JRGC 3AZEC 3AYWB 1EQZB 5B32A 3KXBB 4J8UC 1P34D 3KXBC 1P3FC 1F1EA 4H9NB 4X23A 2NZDA 1P3OD 1P3PA 1ID3D 3AZFC 3RELB 4NFTA 3LZ1A 5GT3D 5B24C 5B0ZD 3WA9B 5AV6D 1F66D 3AZHC 4Z66D 2HUEB 3X1UD 3REJD 1KX4C 3W97D 2F8NH 5AY8D 3AV2C 4J8VA 3UT9C 4UPKA 3C1BD 2PYOC 4DRBA 1AOIC 4G92C 4YS3A 5AV8A 4KGCC 1KX5D 3AZKA 4QLCA 5B2JC 5GXQA 1U35D 5AV9C 2DF4C 3X1TA 3MVDC 3H0MC 2RVQD 3WKJB 1TZYD 3AN2C 3X1SA 3AZGB 1HQ3A 5B31A 3KFUG 3H0LC 4CAYA 1U35B 4X23B 3MGQD 2NZDB 4XUJB 5B1LA 2L5AA 3WTPA 3AN2D 2RVQC 1PZRA 4LD9D 5GSUD 3A6ND 3MGSA 1AOIB 3AZIB 3AL0C 5B2JD 5GT0C 5B0YB 4H9SC 5BO0A 1BH8A 3O62A 4ZBJC 3KXBA 3AZKB 4X23C 4KHAA 2NZDC 3C1BC 5B2IC 5GSUB 2PYOD 3AV1C 3AYWD 4WZSB 1P3GA 3LZ1C 1BH8B 1EQZC 5B24D 3AZGC 5GT3C 1WWSA 3AZFD 5F99B 5BT1D 2LY8A 5F99C 3LZ0A 2ZY5A 4H9OA 4ZUXD 4J8UD 1P34C 5CPID 4WU8B 4G91B 4KGCB 3WKJD 4QLCC
chains in the Genus database with same CATH topology
3TU4D 4QLCB 2ZY2A 4G92B 4YM6B 2Y2MA 3AZNC 3H0RC 3W96B 2BYMA 2HIOC 5DNMA 1HQ3C 3X1SB 5B24B 1P3BD 1P3MC 4Z5TC 4E44A 1S32D 3REID 2Y2HA 4LD9B 3B6GD 3LZ1B 3REJB 2G5IC 4H9QA 2YFWA 4XZQD 3MGRA 1P3LC 3UTAA 5CPKA 3B0CW 3REKA 5G49B 2AROD 3EPJA 4WNNB 2IO5B 4H9OB 5C3IB 5GT0B 3O62C 5BS7A 3EPLA 4J8WB 5B40B 5E5AB 3REKB 5F99D 4ZBJB 3AV1A 4R8PD 3LJAD 5DNNB 3AZLB 2F8NK 1KX3C 4WJ3C 3NQJA 1N1JB 3LJAA 4R8PA 3AV1D 2PYOB 5F99A 3TU4B 3LZ0C 5B1LB 3B0DC 5B32B 3NQUA 5B2JB 2AROA 5B31B 5CP6C 3REKD 3A6NC 3REIB 5CPKD 5BO0B 5G49A 3UTAD 3W99B 4XZQA 4HGAB 3MGRD 2NQBC 3MGQC 3B6GA 3REIA 1S32A 3VH6T 5B33C 1P3BA 5DNMD 1TZYB 1TZYC 2DQNC 4G91C 4J8UB 3UT9B 5FUGB 3TU4A 1M18C 1T3UA 3WKJA 3AZEA 1TAFA 5CPIA 4J8UA 4ZUXA 1M1AB 3LZ0D 3AZFA 3AV1B 4JJNC 4Z66C 4H9RA 1M19B 5AVBB 5AV6C 5B24A 1F66C 3W97C 3WAAB 1P3GD 3LJAC 3AYWA 4R8PC 3MGSB 3MGPC 2PYOA 3VH6A 4YS3C 3KXBD 5AV8C 2JE5A 3O62D 5BNXB 4DRAA 2Y2OA 5B2JA 3V9RA 4KHAB 2BYKA 3A6NA 5GSUA 3MGSD 3X1UB 3P5JB 4LD9A 3WTPD 3AN2A 3KWQB 5CPJB 4M6BA 5AV8B 1P3IB 3KUYB 5B1LD 2RIQA 2ZY3A 1P3OB 3MGQA 5GXQB 3B6GC 5CPKB 3REIC 4Z2MG 5B31D 3AFAC 3WAAC 1HQ3D 3R45A 1P3BC 3X1SD 1P3BB 3C1CB 3B0DB 3WTPC 1TZYA 5B40C 2ZM5A 5BNVA 3X1TD 1JFIB 1M1AC 5GXQD 1U35A 3TU4C 2G5HC 3KSYA 4QLCD 3WKJC 3AZKD 4H9SA 4H9PB 4WV4B 4UUZA 3MNNB 1KX5A 5AV8D 3A1IA 5CPIC 1BH9A 4ZUXC 4YS3D 5BNXA 1N1JA 3LJAB 5B1MC 3C1BA 5BT1C 4J8VD 3RELC 4H9NA 5AY8A 2BYKB 1KU5A 3X1UA 3REJA 3W97A 5JA4B 4Z66A 5AV6A 4H9QB 1P3GC 1F66A 5B0ZA 1ZLAC 4CSRB 5GT3A 3LZ1D 3O62B 3AYWC 4AWLB 1P3PD 1P3OA 1ID3A 1S32B 4X23D 3MGQB 2NZDD 2CV5C 5KDMA 1P34A 5B32D 5GT3B 1ID3B 2J8PA 3V9RB 5GSUC 5BNVB 1P34B 4LD9C 3AZEB 5B33B 3A1KA 4EO5B 2Y2PA 4H9PA 5B33D 4ZUXB 2W8SA 3C1CD 1P3MA 2JSSA 3B6FC 1BH9B 5E5AD 3B0BA 2XD5A 4Z2MH 5AVBA 2Y2QA 4WU9B 3WAAA 3W96A 3MGRC 3R45B 3NQUB 5B0ZB 3UTAC 3WA9D 1B6WA 3WTPB 5CPIB 2Y2NA 3REKC 1M1AA 5CP6D 3AFAB 1U35C 3LELA 5AVCB 5B0YA 4UUZB 3MNNA 1KX5C 1KX5B 3WTPE 2JCHA 3A6NB 1AOID 3C1BB 5AY8C 3AV2D 3AZED 5AY8B 3KWQA 3X1UC 1KX4D 3AZHD 1KX3D 5B0ZC 5CHLB 1W2EA 4WU9D 1P3OC 2CV5A 1P3FD 5KDMB 2IO5C 5C3IC 3X1VC 3UTBD 3NQJB 5DNND 3AZLD 2AROC 4CAYB 3AZJD 5E5AC 4JJNB 3B6FD 4H9RB 4J8WD 1P3LD 2BG1A 2NQBA 2Y2GA 3MGPB 3AZHB 5DNMB 3AZMC 3AZIA 3MVDB 2F8ND 4Z5TD 1S32C 1M18B 5AVBC 5AV6B 1F66B 1BFMA 3W96C 1P3LB 5JRGA 2HIOD 3AZNB 2FJ7A 2Y2LA 2YFWB 5AVCD 3MGRB 4J8XB 3AZND 3W99D 3VH5A 1Z2CB 1P3KB 4J8VB 1P3KC 1ULYA 4Z5TB 1M18A 2F8NB 1P3PC 2CV5B 4WU8C 4WNNA 1M19D 3KUYA 5B31G 4XUJD 1ZLAD 4YM6C 3RELD 1H3OA 4J8VC 3UT9A 3X1TB 5B1MD 1P3AA 5FUGA 4YM6D 3W98A 4JJNA 3AZGD 4KGCA 1EQZD 4DQYB 4WU8D 3AZKC 5B32G 3REHD 5B2ID 4NE5A 3MGPA 5AV9A 1P3KD 3MVDA 3W99C 5B40D 3X1VA 4E45A 4KUDD 5CPJD 1P3ID 5AV5D 5B31C 5CP6B 5GT0D 3AFAD 4J8XA 2AROB 3AZMD 5JA4A 3X1VB 5B1LC 4KUDB 4J8WC 3AZMA 2VQRA 3AZIC 4J8XD 3REHB 2F2AC 5GT0A 5DNNC 3AFAA 3AZLC 5AV5A 4EO5C 5CPJA 1P3IA 1HTAA 5B40A 3UTBC 2CWEA 2UWXA 3X1VD 2FJ7C 3B0CT 4KUDA 3MVDD 1P3KA 5AV9D 3EPHA 3FDDA 5B2IA 3MGPD 3REHA 4WU8A 4WU9C 1EQZA 4KGCD 3KUYC 4R8PB 3AZGA 1P3MB 4JJND 3AV2B 1TAFB 4YM6A 5B1MA 1P3AC 1JFIA 3UT9D 1P3AD 3VH5W 3RELA 3W98C 3W98D 1R4VA 3REJC 2BYMB 2Y2IA 4XUJA 1ZLAA 3AZFB 3KUYD 1M19A 2YFVA 1P3FB 1ID3C 1M18D 5B1MB 2Y2JA 4YS3B 3W99A 5JRGB 3AZNA 5AVCA 4XZQB 2F8NG 2ZY4A 2FJ7D 3WA9C 2HIOA 5JRGD 4CSRA 5DNMC 4AWLC 4Z5TA 4J8XC 2F8NA 3F6TA 3EPKA 3AZID 1B67A 5B2IB 2XD1A 3C1CC 1P3GB 2NQBD 1A7WA 1P3LA 3UTBB 3EG5B 4J8WA 3B6FA 3VH5T 3AZMB 5CPKC 3VH6W 3LZ0B 3AZJA 5DNNA 3AZLA 5AV5C 5CPJC 1P3IC 1ZLAB 3UTBA 4KUDC 5BS7C 1KX3B 5B32C 2YFVB 2CV5D 1P3FA 3REHC 1H3OB 1P3AB 3W98B 3LELC 4WU9A 5B0YC 4NE3A 3MNNC 2NQBB 1KX3A 4HGAC 3AZHA 1KX4A 3KWQD 3AV2A 1AOIA 3KWQC 5AV9B 4XUJC 3LELB 3MNND 4Z66B 1M19C 5B0YD 2FJ7B 3W97B 3LELD 3UTAB 5GXQC 5CP6A 3B6GB 1M1AD 3X1TC 3AN2B 5AVCC 3WA9A 2Y2KA 1HQ3B 4XZQC 3X1SC 2HIOB 2FFFB 3WAAD 2HUEC 3W96D 5AVBD 5E5AA 1P3MD 3C1CA 5B33A 1Q9CA 5AV5B 3B6FB 4NE6A 1KX4B 3MGSC 1WWIA 3IP4C 3AZJC 1P3PB 3AZJB 5JRGC 3AZEC 3AYWB 1EQZB 5B32A 3KXBB 4J8UC 1P34D 3KXBC 1P3FC 1F1EA 4H9NB 4X23A 2NZDA 1P3OD 1P3PA 1ID3D 3AZFC 3RELB 4NFTA 3LZ1A 5GT3D 5B24C 5B0ZD 3WA9B 5AV6D 1F66D 3AZHC 4Z66D 2HUEB 3X1UD 3REJD 1KX4C 3W97D 2F8NH 5AY8D 3AV2C 4J8VA 3UT9C 4UPKA 3C1BD 2PYOC 4DRBA 1AOIC 4G92C 4YS3A 5AV8A 4KGCC 1KX5D 3AZKA 4QLCA 5B2JC 5GXQA 1U35D 5AV9C 2DF4C 3X1TA 3MVDC 3H0MC 2RVQD 3WKJB 1TZYD 3AN2C 3X1SA 3AZGB 1HQ3A 5B31A 3KFUG 3H0LC 4CAYA 1U35B 4X23B 3MGQD 2NZDB 4XUJB 5B1LA 2L5AA 3WTPA 3AN2D 2RVQC 1PZRA 4LD9D 5GSUD 3A6ND 3MGSA 1AOIB 3AZIB 3AL0C 5B2JD 5GT0C 5B0YB 4H9SC 5BO0A 1BH8A 3O62A 4ZBJC 3KXBA 3AZKB 4X23C 4KHAA 2NZDC 3C1BC 5B2IC 5GSUB 2PYOD 3AV1C 3AYWD 4WZSB 1P3GA 3LZ1C 1BH8B 1EQZC 5B24D 3AZGC 5GT3C 1WWSA 3AZFD 5F99B 5BT1D 2LY8A 5F99C 3LZ0A 2ZY5A 4H9OA 4ZUXD 4J8UD 1P34C 5CPID 4WU8B 4G91B 4KGCB 3WKJD 4QLCC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TU4 D;  4QLC B;  4G92 B;  4YM6 B;  3AZN C;  3W96 B;  2BYM A;  2HIO C;  5DNM A;  1HQ3 C;  3X1S B;  5B24 B;  1P3B D;  1P3M C;  4Z5T C;  4E44 A;  1S32 D;  3REI D;  4LD9 B;  3B6G D;  3LZ1 B;  3REJ B;  4H9Q A;  2YFW A;  4XZQ D;  3MGR A;  1P3L C;  3UTA A;  5CPK A;  3B0C W;  3REK A;  5G49 B;  2ARO D;  4WNN B;  2IO5 B;  4H9O B;  5C3I B;  5GT0 B;  3O62 C;  5BS7 A;  4J8W B;  5B40 B;  5E5A B;  3REK B;  5F99 D;  4ZBJ B;  3AV1 A;  4R8P D;  3LJA D;  5DNN B;  3AZL B;  2F8N K;  1KX3 C;  3NQJ A;  1N1J B;  3LJA A;  4R8P A;  3AV1 D;  2PYO B;  5F99 A;  3TU4 B;  3LZ0 C;  5B1L B;  3B0D C;  5B32 B;  3NQU A;  5B2J B;  2ARO A;  5B31 B;  5CP6 C;  3REK D;  3A6N C;  3REI B;  5CPK D;  5BO0 B;  5G49 A;  3UTA D;  3W99 B;  4XZQ A;  4HGA B;  3MGR D;  2NQB C;  3MGQ C;  3B6G A;  3REI A;  1S32 A;  3VH6 T;  5B33 C;  1P3B A;  5DNM D;  1TZY B;  1TZY C;  4G91 C;  4J8U B;  3UT9 B;  5FUG B;  3TU4 A;  1M18 C;  3WKJ A;  3AZE A;  1TAF A;  5CPI A;  4J8U A;  4ZUX A;  1M1A B;  3LZ0 D;  3AZF A;  3AV1 B;  4JJN C;  4Z66 C;  4H9R A;  1M19 B;  5AVB B;  5AV6 C;  5B24 A;  1F66 C;  3W97 C;  3WAA B;  1P3G D;  3LJA C;  3AYW A;  4R8P C;  3MGS B;  3MGP C;  2PYO A;  3VH6 A;  4YS3 C;  3KXB D;  5AV8 C;  3O62 D;  5BNX B;  4DRA A;  5B2J A;  3V9R A;  4KHA B;  2BYK A;  3A6N A;  5GSU A;  3MGS D;  3X1U B;  4LD9 A;  3WTP D;  3AN2 A;  3KWQ B;  5CPJ B;  4M6B A;  5AV8 B;  1P3I B;  3KUY B;  5B1L D;  1P3O B;  3MGQ A;  5GXQ B;  3B6G C;  5CPK B;  3REI C;  4Z2M G;  5B31 D;  3AFA C;  3WAA C;  1HQ3 D;  3R45 A;  1P3B C;  3X1S D;  1P3B B;  3C1C B;  3B0D B;  3WTP C;  1TZY A;  5B40 C;  5BNV A;  3X1T D;  1JFI B;  1M1A C;  5GXQ D;  1U35 A;  3TU4 C;  3KSY A;  4QLC D;  3WKJ C;  3AZK D;  4H9S A;  4H9P B;  4WV4 B;  4UUZ A;  3MNN B;  1KX5 A;  5AV8 D;  5CPI C;  1BH9 A;  4ZUX C;  4YS3 D;  5BNX A;  1N1J A;  3LJA B;  5B1M C;  3C1B A;  5BT1 C;  4J8V D;  3REL C;  4H9N A;  5AY8 A;  2BYK B;  1KU5 A;  3X1U A;  3REJ A;  4Z66 A;  3W97 A;  5JA4 B;  5AV6 A;  4H9Q B;  1P3G C;  1F66 A;  5B0Z A;  1ZLA C;  4CSR B;  5GT3 A;  3LZ1 D;  3O62 B;  3AYW C;  4AWL B;  1P3P D;  1P3O A;  1ID3 A;  1S32 B;  4X23 D;  3MGQ B;  2NZD D;  2CV5 C;  5KDM A;  1P34 A;  5B32 D;  5GT3 B;  1ID3 B;  3V9R B;  5GSU C;  5BNV B;  1P34 B;  4LD9 C;  3AZE B;  5B33 B;  4EO5 B;  4H9P A;  5B33 D;  4ZUX B;  3C1C D;  1P3M A;  2JSS A;  3B6F C;  1BH9 B;  5E5A D;  3B0B A;  4Z2M H;  5AVB A;  4WU9 B;  3WAA A;  3W96 A;  3MGR C;  3R45 B;  3NQU B;  5B0Z B;  3UTA C;  3WA9 D;  1B6W A;  3WTP B;  5CPI B;  3REK C;  1M1A A;  5CP6 D;  3AFA B;  1U35 C;  3LEL A;  5AVC B;  5B0Y A;  4UUZ B;  3MNN A;  1KX5 C;  1KX5 B;  3WTP E;  3A6N B;  1AOI D;  3C1B B;  5AY8 C;  3AV2 D;  3AZE D;  5AY8 B;  3KWQ A;  3X1U C;  1KX4 D;  3AZH D;  1KX3 D;  5B0Z C;  5CHL B;  4WU9 D;  1P3O C;  2CV5 A;  1P3F D;  5KDM B;  2IO5 C;  5C3I C;  3X1V C;  3UTB D;  3NQJ B;  5DNN D;  3AZL D;  2ARO C;  4CAY B;  3AZJ D;  5E5A C;  4JJN B;  3B6F D;  4H9R B;  4J8W D;  1P3L D;  2NQB A;  3MGP B;  3AZH B;  5DNM B;  3AZM C;  3AZI A;  3MVD B;  2F8N D;  4Z5T D;  1S32 C;  1M18 B;  5AVB C;  5AV6 B;  1F66 B;  1BFM A;  3W96 C;  1P3L B;  5JRG A;  2HIO D;  3AZN B;  2FJ7 A;  2YFW B;  5AVC D;  3MGR B;  4J8X B;  3AZN D;  3W99 D;  3VH5 A;  1P3K B;  1P3K C;  4J8V B;  1ULY A;  4Z5T B;  1M18 A;  2F8N B;  1P3P C;  2CV5 B;  4WU8 C;  4WNN A;  1M19 D;  3KUY A;  5B31 G;  4XUJ D;  1ZLA D;  4YM6 C;  3REL D;  1H3O A;  4J8V C;  3UT9 A;  3X1T B;  5B1M D;  1P3A A;  5FUG A;  4YM6 D;  3W98 A;  4JJN A;  3AZG D;  4KGC A;  1EQZ D;  4WU8 D;  3AZK C;  5B32 G;  3REH D;  5B2I D;  4NE5 A;  3MGP A;  5AV9 A;  1P3K D;  3MVD A;  3W99 C;  5B40 D;  3X1V A;  4E45 A;  4KUD D;  5CPJ D;  1P3I D;  5AV5 D;  5B31 C;  5CP6 B;  5GT0 D;  3AFA D;  4J8X A;  2ARO B;  3AZM D;  5JA4 A;  3X1V B;  5B1L C;  4KUD B;  4J8W C;  3AZM A;  3AZI C;  4J8X D;  3REH B;  5GT0 A;  3AFA A;  5DNN C;  3AZL C;  5AV5 A;  4EO5 C;  5CPJ A;  1P3I A;  1HTA A;  5B40 A;  3UTB C;  2CWE A;  3X1V D;  2FJ7 C;  4KUD A;  3B0C T;  3MVD D;  1P3K A;  5AV9 D;  5B2I A;  3MGP D;  3REH A;  4WU8 A;  4WU9 C;  1EQZ A;  4KGC D;  3KUY C;  4R8P B;  3AZG A;  1P3M B;  4JJN D;  3AV2 B;  1TAF B;  4YM6 A;  5B1M A;  1P3A C;  1JFI A;  3UT9 D;  1P3A D;  3VH5 W;  3REL A;  3W98 C;  3W98 D;  1R4V A;  3REJ C;  2BYM B;  1ZLA A;  4XUJ A;  3AZF B;  3KUY D;  1M19 A;  2YFV A;  1P3F B;  1ID3 C;  1M18 D;  5B1M B;  4YS3 B;  3W99 A;  5JRG B;  3AZN A;  5AVC A;  4XZQ B;  2F8N G;  3WA9 C;  2FJ7 D;  2HIO A;  5JRG D;  4CSR A;  5DNM C;  4AWL C;  4Z5T A;  4J8X C;  2F8N A;  3AZI D;  1B67 A;  5B2I B;  3C1C C;  1P3G B;  2NQB D;  1A7W A;  1P3L A;  3UTB B;  4J8W A;  3B6F A;  3VH5 T;  3AZM B;  5CPK C;  3VH6 W;  3LZ0 B;  3AZJ A;  5DNN A;  3AZL A;  5AV5 C;  5CPJ C;  1P3I C;  1ZLA B;  3UTB A;  4KUD C;  5BS7 C;  1KX3 B;  5B32 C;  2YFV B;  2CV5 D;  1P3F A;  3REH C;  1H3O B;  1P3A B;  3W98 B;  3LEL C;  4WU9 A;  5B0Y C;  4NE3 A;  3MNN C;  2NQB B;  1KX3 A;  4HGA C;  3AZH A;  1KX4 A;  3KWQ D;  3AV2 A;  1AOI A;  3KWQ C;  5AV9 B;  4XUJ C;  3LEL B;  3MNN D;  4Z66 B;  1M19 C;  5B0Y D;  2FJ7 B;  3W97 B;  3LEL D;  3UTA B;  5GXQ C;  5CP6 A;  3B6G B;  1M1A D;  3X1T C;  3AN2 B;  5AVC C;  3WA9 A;  1HQ3 B;  4XZQ C;  3X1S C;  2HIO B;  3W96 D;  3WAA D;  2HUE C;  5AVB D;  5E5A A;  1P3M D;  3C1C A;  5B33 A;  1Q9C A;  5AV5 B;  3B6F B;  4NE6 A;  1KX4 B;  3MGS C;  1WWI A;  3AZJ C;  1P3P B;  3AZJ B;  5JRG C;  3AZE C;  3AYW B;  1EQZ B;  5B32 A;  3KXB B;  4J8U C;  1P34 D;  3KXB C;  1P3F C;  1F1E A;  4H9N B;  4X23 A;  2NZD A;  1P3O D;  1P3P A;  1ID3 D;  3AZF C;  3REL B;  4NFT A;  3LZ1 A;  5GT3 D;  5B24 C;  5B0Z D;  3WA9 B;  5AV6 D;  1F66 D;  3AZH C;  4Z66 D;  2HUE B;  3X1U D;  3REJ D;  1KX4 C;  3W97 D;  2F8N H;  5AY8 D;  3AV2 C;  4J8V A;  3UT9 C;  3C1B D;  2PYO C;  4DRB A;  1AOI C;  4G92 C;  4YS3 A;  5AV8 A;  4KGC C;  1KX5 D;  3AZK A;  4QLC A;  5B2J C;  5GXQ A;  1U35 D;  5AV9 C;  3X1T A;  3MVD C;  3WKJ B;  2RVQ D;  1TZY D;  3AN2 C;  3X1S A;  3AZG B;  1HQ3 A;  5B31 A;  4CAY A;  1U35 B;  4X23 B;  3MGQ D;  2NZD B;  4XUJ B;  5B1L A;  2L5A A;  3WTP A;  3AN2 D;  2RVQ C;  4LD9 D;  5GSU D;  3A6N D;  3MGS A;  1AOI B;  3AZI B;  5B2J D;  5GT0 C;  5B0Y B;  4H9S C;  5BO0 A;  1BH8 A;  3O62 A;  4ZBJ C;  3KXB A;  3AZK B;  4X23 C;  4KHA A;  2NZD C;  3C1B C;  5B2I C;  5GSU B;  2PYO D;  3AV1 C;  3AYW D;  4WZS B;  1P3G A;  3LZ1 C;  1BH8 B;  1EQZ C;  5B24 D;  3AZG C;  5GT3 C;  1WWS A;  3AZF D;  5F99 B;  5BT1 D;  2LY8 A;  5F99 C;  3LZ0 A;  4H9O A;  4ZUX D;  4J8U D;  1P34 C;  5CPI D;  4WU8 B;  4G91 B;  4KGC B;  3WKJ D;  4QLC C; 
#chains in the Genus database with same CATH topology
 3TU4 D;  4QLC B;  2ZY2 A;  4G92 B;  4YM6 B;  2Y2M A;  3AZN C;  3H0R C;  3W96 B;  2BYM A;  2HIO C;  5DNM A;  1HQ3 C;  3X1S B;  5B24 B;  1P3B D;  1P3M C;  4Z5T C;  4E44 A;  1S32 D;  3REI D;  2Y2H A;  4LD9 B;  3B6G D;  3LZ1 B;  3REJ B;  2G5I C;  4H9Q A;  2YFW A;  4XZQ D;  3MGR A;  1P3L C;  3UTA A;  5CPK A;  3B0C W;  3REK A;  5G49 B;  2ARO D;  3EPJ A;  4WNN B;  2IO5 B;  4H9O B;  5C3I B;  5GT0 B;  3O62 C;  5BS7 A;  3EPL A;  4J8W B;  5B40 B;  5E5A B;  3REK B;  5F99 D;  4ZBJ B;  3AV1 A;  4R8P D;  3LJA D;  5DNN B;  3AZL B;  2F8N K;  1KX3 C;  4WJ3 C;  3NQJ A;  1N1J B;  3LJA A;  4R8P A;  3AV1 D;  2PYO B;  5F99 A;  3TU4 B;  3LZ0 C;  5B1L B;  3B0D C;  5B32 B;  3NQU A;  5B2J B;  2ARO A;  5B31 B;  5CP6 C;  3REK D;  3A6N C;  3REI B;  5CPK D;  5BO0 B;  5G49 A;  3UTA D;  3W99 B;  4XZQ A;  4HGA B;  3MGR D;  2NQB C;  3MGQ C;  3B6G A;  3REI A;  1S32 A;  3VH6 T;  5B33 C;  1P3B A;  5DNM D;  1TZY B;  1TZY C;  2DQN C;  4G91 C;  4J8U B;  3UT9 B;  5FUG B;  3TU4 A;  1M18 C;  1T3U A;  3WKJ A;  3AZE A;  1TAF A;  5CPI A;  4J8U A;  4ZUX A;  1M1A B;  3LZ0 D;  3AZF A;  3AV1 B;  4JJN C;  4Z66 C;  4H9R A;  1M19 B;  5AVB B;  5AV6 C;  5B24 A;  1F66 C;  3W97 C;  3WAA B;  1P3G D;  3LJA C;  3AYW A;  4R8P C;  3MGS B;  3MGP C;  2PYO A;  3VH6 A;  4YS3 C;  3KXB D;  5AV8 C;  2JE5 A;  3O62 D;  5BNX B;  4DRA A;  2Y2O A;  5B2J A;  3V9R A;  4KHA B;  2BYK A;  3A6N A;  5GSU A;  3MGS D;  3X1U B;  3P5J B;  4LD9 A;  3WTP D;  3AN2 A;  3KWQ B;  5CPJ B;  4M6B A;  5AV8 B;  1P3I B;  3KUY B;  5B1L D;  2RIQ A;  2ZY3 A;  1P3O B;  3MGQ A;  5GXQ B;  3B6G C;  5CPK B;  3REI C;  4Z2M G;  5B31 D;  3AFA C;  3WAA C;  1HQ3 D;  3R45 A;  1P3B C;  3X1S D;  1P3B B;  3C1C B;  3B0D B;  3WTP C;  1TZY A;  5B40 C;  2ZM5 A;  5BNV A;  3X1T D;  1JFI B;  1M1A C;  5GXQ D;  1U35 A;  3TU4 C;  2G5H C;  3KSY A;  4QLC D;  3WKJ C;  3AZK D;  4H9S A;  4H9P B;  4WV4 B;  4UUZ A;  3MNN B;  1KX5 A;  5AV8 D;  3A1I A;  5CPI C;  1BH9 A;  4ZUX C;  4YS3 D;  5BNX A;  1N1J A;  3LJA B;  5B1M C;  3C1B A;  5BT1 C;  4J8V D;  3REL C;  4H9N A;  5AY8 A;  2BYK B;  1KU5 A;  3X1U A;  3REJ A;  3W97 A;  5JA4 B;  4Z66 A;  5AV6 A;  4H9Q B;  1P3G C;  1F66 A;  5B0Z A;  1ZLA C;  4CSR B;  5GT3 A;  3LZ1 D;  3O62 B;  3AYW C;  4AWL B;  1P3P D;  1P3O A;  1ID3 A;  1S32 B;  4X23 D;  3MGQ B;  2NZD D;  2CV5 C;  5KDM A;  1P34 A;  5B32 D;  5GT3 B;  1ID3 B;  2J8P A;  3V9R B;  5GSU C;  5BNV B;  1P34 B;  4LD9 C;  3AZE B;  5B33 B;  3A1K A;  4EO5 B;  2Y2P A;  4H9P A;  5B33 D;  4ZUX B;  2W8S A;  3C1C D;  1P3M A;  2JSS A;  3B6F C;  1BH9 B;  5E5A D;  3B0B A;  2XD5 A;  4Z2M H;  5AVB A;  2Y2Q A;  4WU9 B;  3WAA A;  3W96 A;  3MGR C;  3R45 B;  3NQU B;  5B0Z B;  3UTA C;  3WA9 D;  1B6W A;  3WTP B;  5CPI B;  2Y2N A;  3REK C;  1M1A A;  5CP6 D;  3AFA B;  1U35 C;  3LEL A;  5AVC B;  5B0Y A;  4UUZ B;  3MNN A;  1KX5 C;  1KX5 B;  3WTP E;  2JCH A;  3A6N B;  1AOI D;  3C1B B;  5AY8 C;  3AV2 D;  3AZE D;  5AY8 B;  3KWQ A;  3X1U C;  1KX4 D;  3AZH D;  1KX3 D;  5B0Z C;  5CHL B;  1W2E A;  4WU9 D;  1P3O C;  2CV5 A;  1P3F D;  5KDM B;  2IO5 C;  5C3I C;  3X1V C;  3UTB D;  3NQJ B;  5DNN D;  3AZL D;  2ARO C;  4CAY B;  3AZJ D;  5E5A C;  4JJN B;  3B6F D;  4H9R B;  4J8W D;  1P3L D;  2BG1 A;  2NQB A;  2Y2G A;  3MGP B;  3AZH B;  5DNM B;  3AZM C;  3AZI A;  3MVD B;  2F8N D;  4Z5T D;  1S32 C;  1M18 B;  5AVB C;  5AV6 B;  1F66 B;  1BFM A;  3W96 C;  1P3L B;  5JRG A;  2HIO D;  3AZN B;  2FJ7 A;  2Y2L A;  2YFW B;  5AVC D;  3MGR B;  4J8X B;  3AZN D;  3W99 D;  3VH5 A;  1Z2C B;  1P3K B;  4J8V B;  1P3K C;  1ULY A;  4Z5T B;  1M18 A;  2F8N B;  1P3P C;  2CV5 B;  4WU8 C;  4WNN A;  1M19 D;  3KUY A;  5B31 G;  4XUJ D;  1ZLA D;  4YM6 C;  3REL D;  1H3O A;  4J8V C;  3UT9 A;  3X1T B;  5B1M D;  1P3A A;  5FUG A;  4YM6 D;  3W98 A;  4JJN A;  3AZG D;  4KGC A;  1EQZ D;  4DQY B;  4WU8 D;  3AZK C;  5B32 G;  3REH D;  5B2I D;  4NE5 A;  3MGP A;  5AV9 A;  1P3K D;  3MVD A;  3W99 C;  5B40 D;  3X1V A;  4E45 A;  4KUD D;  5CPJ D;  1P3I D;  5AV5 D;  5B31 C;  5CP6 B;  5GT0 D;  3AFA D;  4J8X A;  2ARO B;  3AZM D;  5JA4 A;  3X1V B;  5B1L C;  4KUD B;  4J8W C;  3AZM A;  2VQR A;  3AZI C;  4J8X D;  3REH B;  2F2A C;  5GT0 A;  5DNN C;  3AFA A;  3AZL C;  5AV5 A;  4EO5 C;  5CPJ A;  1P3I A;  1HTA A;  5B40 A;  3UTB C;  2CWE A;  2UWX A;  3X1V D;  2FJ7 C;  3B0C T;  4KUD A;  3MVD D;  1P3K A;  5AV9 D;  3EPH A;  3FDD A;  5B2I A;  3MGP D;  3REH A;  4WU8 A;  4WU9 C;  1EQZ A;  4KGC D;  3KUY C;  4R8P B;  3AZG A;  1P3M B;  4JJN D;  3AV2 B;  1TAF B;  4YM6 A;  5B1M A;  1P3A C;  1JFI A;  3UT9 D;  1P3A D;  3VH5 W;  3REL A;  3W98 C;  3W98 D;  1R4V A;  3REJ C;  2BYM B;  2Y2I A;  4XUJ A;  1ZLA A;  3AZF B;  3KUY D;  1M19 A;  2YFV A;  1P3F B;  1ID3 C;  1M18 D;  5B1M B;  2Y2J A;  4YS3 B;  3W99 A;  5JRG B;  3AZN A;  5AVC A;  4XZQ B;  2F8N G;  2ZY4 A;  2FJ7 D;  3WA9 C;  2HIO A;  5JRG D;  4CSR A;  5DNM C;  4AWL C;  4Z5T A;  4J8X C;  2F8N A;  3F6T A;  3EPK A;  3AZI D;  1B67 A;  5B2I B;  2XD1 A;  3C1C C;  1P3G B;  2NQB D;  1A7W A;  1P3L A;  3UTB B;  3EG5 B;  4J8W A;  3B6F A;  3VH5 T;  3AZM B;  5CPK C;  3VH6 W;  3LZ0 B;  3AZJ A;  5DNN A;  3AZL A;  5AV5 C;  5CPJ C;  1P3I C;  1ZLA B;  3UTB A;  4KUD C;  5BS7 C;  1KX3 B;  5B32 C;  2YFV B;  2CV5 D;  1P3F A;  3REH C;  1H3O B;  1P3A B;  3W98 B;  3LEL C;  4WU9 A;  5B0Y C;  4NE3 A;  3MNN C;  2NQB B;  1KX3 A;  4HGA C;  3AZH A;  1KX4 A;  3KWQ D;  3AV2 A;  1AOI A;  3KWQ C;  5AV9 B;  4XUJ C;  3LEL B;  3MNN D;  4Z66 B;  1M19 C;  5B0Y D;  2FJ7 B;  3W97 B;  3LEL D;  3UTA B;  5GXQ C;  5CP6 A;  3B6G B;  1M1A D;  3X1T C;  3AN2 B;  5AVC C;  3WA9 A;  2Y2K A;  1HQ3 B;  4XZQ C;  3X1S C;  2HIO B;  2FFF B;  3WAA D;  2HUE C;  3W96 D;  5AVB D;  5E5A A;  1P3M D;  3C1C A;  5B33 A;  1Q9C A;  5AV5 B;  3B6F B;  4NE6 A;  1KX4 B;  3MGS C;  1WWI A;  3IP4 C;  3AZJ C;  1P3P B;  3AZJ B;  5JRG C;  3AZE C;  3AYW B;  1EQZ B;  5B32 A;  3KXB B;  4J8U C;  1P34 D;  3KXB C;  1P3F C;  1F1E A;  4H9N B;  4X23 A;  2NZD A;  1P3O D;  1P3P A;  1ID3 D;  3AZF C;  3REL B;  4NFT A;  3LZ1 A;  5GT3 D;  5B24 C;  5B0Z D;  3WA9 B;  5AV6 D;  1F66 D;  3AZH C;  4Z66 D;  2HUE B;  3X1U D;  3REJ D;  1KX4 C;  3W97 D;  2F8N H;  5AY8 D;  3AV2 C;  4J8V A;  3UT9 C;  4UPK A;  3C1B D;  2PYO C;  4DRB A;  1AOI C;  4G92 C;  4YS3 A;  5AV8 A;  4KGC C;  1KX5 D;  3AZK A;  4QLC A;  5B2J C;  5GXQ A;  1U35 D;  5AV9 C;  2DF4 C;  3X1T A;  3MVD C;  3H0M C;  2RVQ D;  3WKJ B;  1TZY D;  3AN2 C;  3X1S A;  3AZG B;  1HQ3 A;  5B31 A;  3KFU G;  3H0L C;  4CAY A;  1U35 B;  4X23 B;  3MGQ D;  2NZD B;  4XUJ B;  5B1L A;  2L5A A;  3WTP A;  3AN2 D;  2RVQ C;  1PZR A;  4LD9 D;  5GSU D;  3A6N D;  3MGS A;  1AOI B;  3AZI B;  3AL0 C;  5B2J D;  5GT0 C;  5B0Y B;  4H9S C;  5BO0 A;  1BH8 A;  3O62 A;  4ZBJ C;  3KXB A;  3AZK B;  4X23 C;  4KHA A;  2NZD C;  3C1B C;  5B2I C;  5GSU B;  2PYO D;  3AV1 C;  3AYW D;  4WZS B;  1P3G A;  3LZ1 C;  1BH8 B;  1EQZ C;  5B24 D;  3AZG C;  5GT3 C;  1WWS A;  3AZF D;  5F99 B;  5BT1 D;  2LY8 A;  5F99 C;  3LZ0 A;  2ZY5 A;  4H9O A;  4ZUX D;  4J8U D;  1P34 C;  5CPI D;  4WU8 B;  4G91 B;  4KGC B;  3WKJ D;  4QLC C; 
#chains in the Genus database with same CATH homology
 3TU4 D;  4QLC B;  2ZY2 A;  4G92 B;  4YM6 B;  2Y2M A;  3AZN C;  3H0R C;  3W96 B;  2BYM A;  2HIO C;  5DNM A;  1HQ3 C;  3X1S B;  5B24 B;  1P3B D;  1P3M C;  4Z5T C;  4E44 A;  1S32 D;  3REI D;  2Y2H A;  4LD9 B;  3B6G D;  3LZ1 B;  3REJ B;  2G5I C;  4H9Q A;  2YFW A;  4XZQ D;  3MGR A;  1P3L C;  3UTA A;  5CPK A;  3B0C W;  3REK A;  5G49 B;  2ARO D;  3EPJ A;  4WNN B;  2IO5 B;  4H9O B;  5C3I B;  5GT0 B;  3O62 C;  5BS7 A;  3EPL A;  4J8W B;  5B40 B;  5E5A B;  3REK B;  5F99 D;  4ZBJ B;  3AV1 A;  4R8P D;  3LJA D;  5DNN B;  3AZL B;  2F8N K;  1KX3 C;  4WJ3 C;  3NQJ A;  1N1J B;  3LJA A;  4R8P A;  3AV1 D;  2PYO B;  5F99 A;  3TU4 B;  3LZ0 C;  5B1L B;  3B0D C;  5B32 B;  3NQU A;  5B2J B;  2ARO A;  5B31 B;  5CP6 C;  3REK D;  3A6N C;  3REI B;  5CPK D;  5BO0 B;  5G49 A;  3UTA D;  3W99 B;  4XZQ A;  4HGA B;  3MGR D;  2NQB C;  3MGQ C;  3B6G A;  3REI A;  1S32 A;  3VH6 T;  5B33 C;  1P3B A;  5DNM D;  1TZY B;  1TZY C;  2DQN C;  4G91 C;  4J8U B;  3UT9 B;  5FUG B;  3TU4 A;  1M18 C;  1T3U A;  3WKJ A;  3AZE A;  1TAF A;  5CPI A;  4J8U A;  4ZUX A;  1M1A B;  3LZ0 D;  3AZF A;  3AV1 B;  4JJN C;  4Z66 C;  4H9R A;  1M19 B;  5AVB B;  5AV6 C;  5B24 A;  1F66 C;  3W97 C;  3WAA B;  1P3G D;  3LJA C;  3AYW A;  4R8P C;  3MGS B;  3MGP C;  2PYO A;  3VH6 A;  4YS3 C;  3KXB D;  5AV8 C;  2JE5 A;  3O62 D;  5BNX B;  4DRA A;  2Y2O A;  5B2J A;  3V9R A;  4KHA B;  2BYK A;  3A6N A;  5GSU A;  3MGS D;  3X1U B;  3P5J B;  4LD9 A;  3WTP D;  3AN2 A;  3KWQ B;  5CPJ B;  4M6B A;  5AV8 B;  1P3I B;  3KUY B;  5B1L D;  2RIQ A;  2ZY3 A;  1P3O B;  3MGQ A;  5GXQ B;  3B6G C;  5CPK B;  3REI C;  4Z2M G;  5B31 D;  3AFA C;  3WAA C;  1HQ3 D;  3R45 A;  1P3B C;  3X1S D;  1P3B B;  3C1C B;  3B0D B;  3WTP C;  1TZY A;  5B40 C;  2ZM5 A;  5BNV A;  3X1T D;  1JFI B;  1M1A C;  5GXQ D;  1U35 A;  3TU4 C;  2G5H C;  3KSY A;  4QLC D;  3WKJ C;  3AZK D;  4H9S A;  4H9P B;  4WV4 B;  4UUZ A;  3MNN B;  1KX5 A;  5AV8 D;  3A1I A;  5CPI C;  1BH9 A;  4ZUX C;  4YS3 D;  5BNX A;  1N1J A;  3LJA B;  5B1M C;  3C1B A;  5BT1 C;  4J8V D;  3REL C;  4H9N A;  5AY8 A;  2BYK B;  1KU5 A;  3X1U A;  3REJ A;  3W97 A;  5JA4 B;  4Z66 A;  5AV6 A;  4H9Q B;  1P3G C;  1F66 A;  5B0Z A;  1ZLA C;  4CSR B;  5GT3 A;  3LZ1 D;  3O62 B;  3AYW C;  4AWL B;  1P3P D;  1P3O A;  1ID3 A;  1S32 B;  4X23 D;  3MGQ B;  2NZD D;  2CV5 C;  5KDM A;  1P34 A;  5B32 D;  5GT3 B;  1ID3 B;  2J8P A;  3V9R B;  5GSU C;  5BNV B;  1P34 B;  4LD9 C;  3AZE B;  5B33 B;  3A1K A;  4EO5 B;  2Y2P A;  4H9P A;  5B33 D;  4ZUX B;  2W8S A;  3C1C D;  1P3M A;  2JSS A;  3B6F C;  1BH9 B;  5E5A D;  3B0B A;  2XD5 A;  4Z2M H;  5AVB A;  2Y2Q A;  4WU9 B;  3WAA A;  3W96 A;  3MGR C;  3R45 B;  3NQU B;  5B0Z B;  3UTA C;  3WA9 D;  1B6W A;  3WTP B;  5CPI B;  2Y2N A;  3REK C;  1M1A A;  5CP6 D;  3AFA B;  1U35 C;  3LEL A;  5AVC B;  5B0Y A;  4UUZ B;  3MNN A;  1KX5 C;  1KX5 B;  3WTP E;  2JCH A;  3A6N B;  1AOI D;  3C1B B;  5AY8 C;  3AV2 D;  3AZE D;  5AY8 B;  3KWQ A;  3X1U C;  1KX4 D;  3AZH D;  1KX3 D;  5B0Z C;  5CHL B;  1W2E A;  4WU9 D;  1P3O C;  2CV5 A;  1P3F D;  5KDM B;  2IO5 C;  5C3I C;  3X1V C;  3UTB D;  3NQJ B;  5DNN D;  3AZL D;  2ARO C;  4CAY B;  3AZJ D;  5E5A C;  4JJN B;  3B6F D;  4H9R B;  4J8W D;  1P3L D;  2BG1 A;  2NQB A;  2Y2G A;  3MGP B;  3AZH B;  5DNM B;  3AZM C;  3AZI A;  3MVD B;  2F8N D;  4Z5T D;  1S32 C;  1M18 B;  5AVB C;  5AV6 B;  1F66 B;  1BFM A;  3W96 C;  1P3L B;  5JRG A;  2HIO D;  3AZN B;  2FJ7 A;  2Y2L A;  2YFW B;  5AVC D;  3MGR B;  4J8X B;  3AZN D;  3W99 D;  3VH5 A;  1Z2C B;  1P3K B;  4J8V B;  1P3K C;  1ULY A;  4Z5T B;  1M18 A;  2F8N B;  1P3P C;  2CV5 B;  4WU8 C;  4WNN A;  1M19 D;  3KUY A;  5B31 G;  4XUJ D;  1ZLA D;  4YM6 C;  3REL D;  1H3O A;  4J8V C;  3UT9 A;  3X1T B;  5B1M D;  1P3A A;  5FUG A;  4YM6 D;  3W98 A;  4JJN A;  3AZG D;  4KGC A;  1EQZ D;  4DQY B;  4WU8 D;  3AZK C;  5B32 G;  3REH D;  5B2I D;  4NE5 A;  3MGP A;  5AV9 A;  1P3K D;  3MVD A;  3W99 C;  5B40 D;  3X1V A;  4E45 A;  4KUD D;  5CPJ D;  1P3I D;  5AV5 D;  5B31 C;  5CP6 B;  5GT0 D;  3AFA D;  4J8X A;  2ARO B;  3AZM D;  5JA4 A;  3X1V B;  5B1L C;  4KUD B;  4J8W C;  3AZM A;  2VQR A;  3AZI C;  4J8X D;  3REH B;  2F2A C;  5GT0 A;  5DNN C;  3AFA A;  3AZL C;  5AV5 A;  4EO5 C;  5CPJ A;  1P3I A;  1HTA A;  5B40 A;  3UTB C;  2CWE A;  2UWX A;  3X1V D;  2FJ7 C;  3B0C T;  4KUD A;  3MVD D;  1P3K A;  5AV9 D;  3EPH A;  3FDD A;  5B2I A;  3MGP D;  3REH A;  4WU8 A;  4WU9 C;  1EQZ A;  4KGC D;  3KUY C;  4R8P B;  3AZG A;  1P3M B;  4JJN D;  3AV2 B;  1TAF B;  4YM6 A;  5B1M A;  1P3A C;  1JFI A;  3UT9 D;  1P3A D;  3VH5 W;  3REL A;  3W98 C;  3W98 D;  1R4V A;  3REJ C;  2BYM B;  2Y2I A;  4XUJ A;  1ZLA A;  3AZF B;  3KUY D;  1M19 A;  2YFV A;  1P3F B;  1ID3 C;  1M18 D;  5B1M B;  2Y2J A;  4YS3 B;  3W99 A;  5JRG B;  3AZN A;  5AVC A;  4XZQ B;  2F8N G;  2ZY4 A;  2FJ7 D;  3WA9 C;  2HIO A;  5JRG D;  4CSR A;  5DNM C;  4AWL C;  4Z5T A;  4J8X C;  2F8N A;  3F6T A;  3EPK A;  3AZI D;  1B67 A;  5B2I B;  2XD1 A;  3C1C C;  1P3G B;  2NQB D;  1A7W A;  1P3L A;  3UTB B;  3EG5 B;  4J8W A;  3B6F A;  3VH5 T;  3AZM B;  5CPK C;  3VH6 W;  3LZ0 B;  3AZJ A;  5DNN A;  3AZL A;  5AV5 C;  5CPJ C;  1P3I C;  1ZLA B;  3UTB A;  4KUD C;  5BS7 C;  1KX3 B;  5B32 C;  2YFV B;  2CV5 D;  1P3F A;  3REH C;  1H3O B;  1P3A B;  3W98 B;  3LEL C;  4WU9 A;  5B0Y C;  4NE3 A;  3MNN C;  2NQB B;  1KX3 A;  4HGA C;  3AZH A;  1KX4 A;  3KWQ D;  3AV2 A;  1AOI A;  3KWQ C;  5AV9 B;  4XUJ C;  3LEL B;  3MNN D;  4Z66 B;  1M19 C;  5B0Y D;  2FJ7 B;  3W97 B;  3LEL D;  3UTA B;  5GXQ C;  5CP6 A;  3B6G B;  1M1A D;  3X1T C;  3AN2 B;  5AVC C;  3WA9 A;  2Y2K A;  1HQ3 B;  4XZQ C;  3X1S C;  2HIO B;  2FFF B;  3WAA D;  2HUE C;  3W96 D;  5AVB D;  5E5A A;  1P3M D;  3C1C A;  5B33 A;  1Q9C A;  5AV5 B;  3B6F B;  4NE6 A;  1KX4 B;  3MGS C;  1WWI A;  3IP4 C;  3AZJ C;  1P3P B;  3AZJ B;  5JRG C;  3AZE C;  3AYW B;  1EQZ B;  5B32 A;  3KXB B;  4J8U C;  1P34 D;  3KXB C;  1P3F C;  1F1E A;  4H9N B;  4X23 A;  2NZD A;  1P3O D;  1P3P A;  1ID3 D;  3AZF C;  3REL B;  4NFT A;  3LZ1 A;  5GT3 D;  5B24 C;  5B0Z D;  3WA9 B;  5AV6 D;  1F66 D;  3AZH C;  4Z66 D;  2HUE B;  3X1U D;  3REJ D;  1KX4 C;  3W97 D;  2F8N H;  5AY8 D;  3AV2 C;  4J8V A;  3UT9 C;  4UPK A;  3C1B D;  2PYO C;  4DRB A;  1AOI C;  4G92 C;  4YS3 A;  5AV8 A;  4KGC C;  1KX5 D;  3AZK A;  4QLC A;  5B2J C;  5GXQ A;  1U35 D;  5AV9 C;  2DF4 C;  3X1T A;  3MVD C;  3H0M C;  2RVQ D;  3WKJ B;  1TZY D;  3AN2 C;  3X1S A;  3AZG B;  1HQ3 A;  5B31 A;  3KFU G;  3H0L C;  4CAY A;  1U35 B;  4X23 B;  3MGQ D;  2NZD B;  4XUJ B;  5B1L A;  2L5A A;  3WTP A;  3AN2 D;  2RVQ C;  1PZR A;  4LD9 D;  5GSU D;  3A6N D;  3MGS A;  1AOI B;  3AZI B;  3AL0 C;  5B2J D;  5GT0 C;  5B0Y B;  4H9S C;  5BO0 A;  1BH8 A;  3O62 A;  4ZBJ C;  3KXB A;  3AZK B;  4X23 C;  4KHA A;  2NZD C;  3C1B C;  5B2I C;  5GSU B;  2PYO D;  3AV1 C;  3AYW D;  4WZS B;  1P3G A;  3LZ1 C;  1BH8 B;  1EQZ C;  5B24 D;  3AZG C;  5GT3 C;  1WWS A;  3AZF D;  5F99 B;  5BT1 D;  2LY8 A;  5F99 C;  3LZ0 A;  2ZY5 A;  4H9O A;  4ZUX D;  4J8U D;  1P34 C;  5CPI D;  4WU8 B;  4G91 B;  4KGC B;  3WKJ D;  4QLC C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...