5B2JC

Human nucleosome containing cpg methylated dna
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
106
structure length
106
Chain Sequence
KAKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription/dna
molecule keywords Histone H3.1
publication title Crystal structure of human nucleosome core particle containing enzymatically introduced CpG methylation
doi rcsb
source organism Homo sapiens
total genus 31
structure length 106
sequence length 106
chains with identical sequence G
ec nomenclature
pdb deposition date 2016-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5b2jC00
1ULYA 3B0BA 2F8NA 1P3KD 3WAAB 3WTPA 5DNMD 4WU9A 3B0DC 1B6WA 4G92C 3W97B 5FUGB 5B1LC 3W96C 3REJB 5AVCD 1KX5D 5GXQC 5AV6A 1P3AB 4J8XB 1P3IB 4JJNA 1HQ3C 1S32A 4R8PA 3AZMA 3TU4D 4H9SA 5B1MD 1R4VA 5F99D 1KX4C 3AZNB 3AYWC 4J8VC 1P34C 3AV1D 3X1TB 1P3BA 4M6BA 4XUJB 3KXBD 2AROA 4Z2MH 5GT3B 5AV8D 3WA9A 1H3OB 4J8UB 4KUDD 3AZGD 1M1AD 5GT0C 3REIC 5B33C 4YS3C 5JRGD 5CPKC 3KWQC 5AV9B 4H9OA 4DRAA 5B40B 3UT9C 1P3LB 5B24A 3A6NA 3V9RB 4X23C 4ZUXC 2F8ND 3AZIC 5CPJD 3WTPD 1P3GC 4WU9D 3AZJA 5DNNA 2FJ7B 3WTPE 5B2IC 2F8NK 3X1VA 3MGPD 3KUYC 5CP6C 3MNNB 3LZ0A 2HIOC 5B32B 4J8WC 5AV6D 3MGRA 4E45A 4JJND 3LELC 5GSUD 4R8PD 1KX3D 3AZMD 3UTAB 3C1BB 4UUZB 1P3FA 4H9PA 4KGCC 3WKJC 3W98D 5CPIB 1P3OA 1AOIC 4QLCC 2AROD 3REKA 3WA9D 1U35D 3W99B 2BYKB 5B0ZD 5E5AB 4HGAC 3AZKC 3AZLA 3AZEC 3NQJB 3O62B 5AV5A 3AFAB 3LJAA 5AY8B 3AV2B 4H9NB 1P34B 5JA4A 4KHAB 3REHA 2CV5C 1M19A 3RELD 5B2JA 5DNND 4YM6A 1ZLAB 2PYOD 5GT0B 4LD9A 3MGQA 4ZBJB 3B6GA 2NZDC 3LZ0D 5BT1D 3MGRD 4XZQB 3WAAC 1P3FD 3R45B 3AZFA 3W97C 1WWIA 5C3IB 3B6FA 2YFVB 5B2IB 2F8NH 3REJC 3AYWA 3X1SB 1TZYA 1ID3C 2PYOA 1P3AC 4J8XC 3AZLD 1P3IC 1JFIA 5DNMB 1P3KA 5BO0A 3AZNC 3NQUA 3AZHA 5AVCB 3X1TC 4XUJC 5GT3C 4J8UC 1KX5B 4G91B 3MGSB 5AV9C 3TU4B 1EQZB 4LD9D 4H9QB 5B40C 1BH8A 5B1MA 5F99A 1P3LC 3B6GD 1F66B 5B0YB 3KXBB 2NQBA 5GXQD 4KUDB 3AZGB 5AV8A 1M1AB 2FJ7C 1Q9CA 5JRGB 4H9RB 1KX4D 3AYWD 3MNNC 4J8VD 4AWLB 5B32C 2F8NB 3WTPB 3VH6A 5BS7C 4WU9B 3X1UA 5CPJA 5B33D 4YS3D 3LZ1A 3C1BC 5G49A 3UTAC 5CPKD 3KWQD 4WU8A 3AZHD 5CPIC 3MGPA 4ZUXD 3W99C 5AV6B 5E5AC 3AZID 1P3GD 4JJNB 1S32B 1P3MA 1KU5A 5GSUA 5AVBA 1KX3A 3O62C 3AFAC 1P3BB 5CP6D 5AY8C 3AV2C 3W98A 3B0CT 2NQBD 1U35A 2LY8A 1ZLAC 5B0ZA 1M18A 5B31A 4H9OB 4KGCD 3WKJD 5B24B 4ZBJC 3A6NB 1P3PA 1AOID 5BNVA 3UTBC 4XZQC 3AZJB 5DNNB 3X1UD 3LZ1D 3AZKD 3RELA 3MVDA 4WU8D 5C3IC 3X1VB 3X1SC 3MGRB 2CV5D 4Z66A 5DNMC 1P3MD 1P3FB 4H9PB 5AVBD 3VH5A 2RVQC 5AVCC 1P3OB 2NZDD 3REKB 1N1JA 1KX5C 5CHLB 3AN2A 2BYMA 4G91C 3MGSC 3C1CA 5BNXA 3AZLB 1M18D 5B31D 3TU4C 1EQZC 5AV5B 3LJAB 1P3PD 3REJD 1F66C 5B0YC 3REHB 3KXBC 4Z5TA 1ID3A 1M19B 4KUDC 3AZGC 5B2JB 4YM6B 1P3AD 1M1AC 4J8XD 4WZSB 3MVDD 5JRGC 4LD9B 3MGQB 3AZND 3B6GB 5B1LA 1BH9A 3W96A 4AWLC 4XUJD 3VH6T 5B32G 4Z66D 3UTBB 3WTPC 4WU9C 5GXQA 3AZFB 5AV9D 3KSYA 3B6FB 1HQ3A 5KDMA 5B40D 1KX4A 1TZYB 4J8VA 1P34A 2PYOB 5AV6C 4EO5B 3AN2D 3C1CD 4JJNC 1S32C 1P3KB 1JFIB 3AZMC 5BO0B 4H9SC 4Z2MG 5GT0A 3REIA 5B33A 4YS3A 3NQUB 1TAFA 5CPKA 3KWQA 4WV4B 1P3BC 4WNNA 3MNND 3UT9A 2AROC 4Z5TD 1ID3D 3WA9C 4X23A 4ZUXA 3AZIA 1P3GA 3B0CW 3UTAD 1BH8B 5B1MB 5F99B 5B24C 5B2IA 5B1LD 3A6NC 3W96D 3KUYA 5CP6A 3AV1B 2NQBB 4DRBA 5AV8B 3AZJC 2HIOA 4J8WA 5DNNC 1A7WA 1HQ3D 3LELA 3X1VC 3O62D 4KGCA 3WKJA 3AV2D 1P34D 3MGRC 1AOIA 4QLCA 3X1UB 5CPJB 1ZLAD 3LZ1B 1P3FC 5G49B 5GT0D 3MGSA 3REID 3AZKA 4WU8B 3AZEA 3MGPB 1P3OC 3UT9D 3REKC 4X23D 2HUEB 3AZLC 2CV5A 1P3MB 1KX3B 5GSUB 5AVBB 4R8PB 3AZMB 4CSRA 5AV5C 5B2ID 3LJAC 3W98B 4CAYA 3KUYD 2YFWA 3REHC 2NZDA 2AROB 1M19C 3WA9B 1U35B 2HIOD 5B2JC 4YM6C 4J8WD 5B0ZB 1M18B 3LELD 5B31B 3WAAA 4LD9C 2L5AA 3MGQC 3W97A 2RVQD 5FUGA 1P3PB 3B6GC 3REJA 5BNVB 4QLCD 2F8NG 3AZFC 3RELB 3MVDB 3MGSD 1P3AA 4J8XA 1P3IA 1EQZD 3B6FC 3VH6W 3AZED 1HTAA 3AZNA 1TZYC 1F66D 5B0YD 3LZ0B 3X1TA 2PYOC 4EO5C 4Z66B 4XUJA 5GT3A 1P3KC 1H3OA 4J8UA 3AZHC 5AV9A 5B40A 1N1JB 1P3LA 3V9RA 4NFTA 1WWSA 3AN2B 2BYMB 1B67A 5BNXB 3C1CB 5B31G 3WAAD 2FJ7A 5B1MC 5F99C 3W97D 3AV1C 2NQBC 4Z5TB 1ID3B 3MNNA 2CWEA 5JA4B 2IO5B 5AV8C 5B32A 1S32D 1P3ID 5BS7A 3B0DB 3UTAA 3C1BA 4UUZA 4G92B 1P3BD 5B1LB 1BH9B 3W96B 3X1TD 5CPIA 5GT3D 4J8UD 5GXQB 3X1UC 5CPJC 2BYKA 3LZ1C 3W99A 5E5AA 1HQ3B 4WU8C 5KDMB 3NQJA 1KX4B 4NE6A 5B24D 3O62A 3MGPC 3A6ND 3AFAA 3AYWB 1P3LD 4J8VB 3VH5W 5AY8A 3AV2A 4H9NA 2HUEC 4KHAA 4E44A 3AZJD 1P3MC 1KX3C 5GSUC 4R8PC 5AVBC 3REIB 5B33B 4YS3B 1ZLAA 1TAFB 5CPKB 2FJ7D 3KWQB 3X1VD 3W98C 3AZHB 4WNNB 3UT9B 4X23B 1U35C 4ZUXB 5B32D 3UTBA 5B0ZC 3AZIB 1P3GB 4XZQA 1M18C 5B31C 2JSSA 1BFMA 3C1BD 3R45A 4NE3A 1P3PC 2YFVA 3KUYB 1P3OD 5CP6B 5CPID 3REKD 3X1SA 2HIOB 4J8WB 3W99D 3RELC 5E5AD 3MVDC 3LELB 5DNMA 5AV5D 4NE5A 4KGCB 3LJAD 3WKJB 3AFAD 5AY8D 5AVCA 3LZ0C 3REHD 1AOIB 4QLCB 4Z66C 5BT1C 1M19D 5B2JD 4YM6D 1KX5A 4HGAB 3AZKB 3VH5T 3MGQD 3AZEB 3TU4A 1EQZA 4H9QA 3AV1A 1F66A 5B0YA 3AN2C 3KXBA 3UTBD 3C1CC 4XZQD 2CV5B 4KUDA 3AZFD 3AZGA 4CSRB 1M1AA 3B6FD 5JRGA 4H9RA 4CAYB 2YFWB 1F1EA 1TZYD 4Z5TC 3X1SD 2NZDB 2IO5C
chains in the Genus database with same CATH superfamily
1ULYA 3B0BA 2F8NA 1P3KD 3WAAB 3WTPA 5DNMD 4WU9A 3B0DC 1B6WA 4G92C 3W97B 5FUGB 5B1LC 3W96C 3REJB 5AVCD 2Y2PA 3EPHA 1KX5D 5GXQC 5AV6A 1P3AB 4J8XB 1P3IB 4JJNA 1HQ3C 1S32A 4R8PA 3AZMA 3TU4D 4H9SA 5B1MD 1R4VA 5F99D 1KX4C 2J8PA 3AZNB 3AYWC 4J8VC 1P34C 3AV1D 3X1TB 1P3BA 4M6BA 4XUJB 3KXBD 2AROA 4Z2MH 5GT3B 5AV8D 3WA9A 1H3OB 4J8UB 4KUDD 3AZGD 1M1AD 5GT0C 3REIC 5B33C 4YS3C 5JRGD 5CPKC 3KWQC 5AV9B 2Y2JA 4H9OA 4DRAA 5B40B 3UT9C 1P3LB 5B24A 3A6NA 3V9RB 4X23C 4ZUXC 2F8ND 3AZIC 5CPJD 3WTPD 1P3GC 4WU9D 3AZJA 5DNNA 2FJ7B 3WTPE 5B2IC 2F8NK 3X1VA 3MGPD 3KUYC 5CP6C 3MNNB 3LZ0A 2HIOC 5B32B 4J8WC 5AV6D 3MGRA 3H0RC 4E45A 4JJND 3LELC 5GSUD 4R8PD 1KX3D 2Y2IA 3AZMD 3UTAB 3C1BB 4UUZB 1P3FA 2DQNC 4H9PA 4KGCC 3WKJC 3W98D 5CPIB 2Y2GA 1P3OA 1AOIC 4QLCC 2AROD 3REKA 3WA9D 1U35D 3W99B 2BYKB 5B0ZD 5E5AB 4HGAC 3AZKC 3AZLA 2Y2OA 3AZEC 3NQJB 3O62B 5AV5A 3AFAB 3LJAA 5AY8B 3AV2B 3H0LC 4H9NB 4DQYB 1P34B 5JA4A 4KHAB 2JCHA 3REHA 2Y2QA 2CV5C 1M19A 3RELD 5B2JA 5DNND 4YM6A 1ZLAB 2PYOD 5GT0B 2DF4C 4LD9A 3MGQA 4ZBJB 3B6GA 2NZDC 3LZ0D 5BT1D 3MGRD 4XZQB 3WAAC 1P3FD 3R45B 3AZFA 3W97C 2G5HC 1WWIA 5C3IB 2ZM5A 2YFVB 5B2IB 3B6FA 2F8NH 3REJC 3AYWA 3X1SB 1TZYA 1ID3C 2PYOA 1P3AC 4J8XC 3AZLD 1P3IC 1JFIA 5DNMB 1P3KA 5BO0A 3AZNC 3NQUA 3AZHA 5AVCB 3X1TC 2G5IC 4XUJC 5GT3C 4J8UC 1KX5B 3IP4C 4G91B 3MGSB 5AV9C 3TU4B 1EQZB 4LD9D 4H9QB 5B40C 1BH8A 5B1MA 5F99A 1P3LC 3B6GD 1F66B 5B0YB 3KXBB 2NQBA 5GXQD 4KUDB 3AZGB 5AV8A 1M1AB 2FJ7C 1Q9CA 5JRGB 4H9RB 1KX4D 3AYWD 3MNNC 4J8VD 4AWLB 5B32C 2F8NB 3WTPB 3VH6A 5BS7C 4WU9B 3X1UA 5CPJA 5B33D 4YS3D 3LZ1A 3C1BC 5G49A 3UTAC 5CPKD 3KWQD 4WU8A 3AZHD 5CPIC 3MGPA 4ZUXD 3W99C 5AV6B 2UWXA 5E5AC 3AZID 1P3GD 4JJNB 1S32B 1P3MA 1KU5A 5GSUA 5AVBA 1KX3A 3O62C 3AFAC 1P3BB 5CP6D 5AY8C 3AV2C 3W98A 3B0CT 2NQBD 1U35A 2LY8A 1ZLAC 5B0ZA 1M18A 5B31A 4H9OB 4KGCD 3WKJD 5B24B 3A1IA 4ZBJC 3A6NB 1P3PA 1AOID 5BNVA 3UTBC 4XZQC 3AZJB 5DNNB 3X1UD 3LZ1D 3AZKD 3RELA 3MVDA 2VQRA 4WU8D 5C3IC 3X1VB 3X1SC 3MGRB 2CV5D 2Y2HA 4Z66A 5DNMC 2ZY5A 1P3MD 2ZY3A 1P3FB 4H9PB 5AVBD 3VH5A 2RVQC 2RIQA 5AVCC 3F6TA 1P3OB 2NZDD 3REKB 1N1JA 3EPLA 1KX5C 5CHLB 3AN2A 2BYMA 4G91C 3MGSC 3C1CA 5BNXA 3AZLB 1M18D 5B31D 3TU4C 1EQZC 3EPKA 5AV5B 3LJAB 1P3PD 3REJD 1F66C 5B0YC 3REHB 3KXBC 4Z5TA 1ID3A 2Y2NA 1M19B 4KUDC 3AZGC 5B2JB 4YM6B 1P3AD 1M1AC 4J8XD 4WZSB 3MVDD 5JRGC 4LD9B 3MGQB 3AZND 3B6GB 5B1LA 1BH9A 2XD1A 3W96A 4AWLC 3H0MC 4XUJD 3VH6T 5B32G 4Z66D 3UTBB 3WTPC 4WU9C 5GXQA 3AZFB 3EG5B 5AV9D 3KSYA 3B6FB 1HQ3A 5KDMA 5B40D 1KX4A 1TZYB 4J8VA 1P34A 2PYOB 5AV6C 4EO5B 3AN2D 3C1CD 4JJNC 1S32C 1P3KB 1JFIB 3AZMC 5BO0B 4H9SC 4Z2MG 5GT0A 3REIA 5B33A 4YS3A 3NQUB 1TAFA 5CPKA 3KWQA 4WV4B 1P3BC 4WNNA 3MNND 3UT9A 2AROC 4Z5TD 1ID3D 3WA9C 1Z2CB 4X23A 4ZUXA 3AZIA 1P3GA 3B0CW 3UTAD 2ZY4A 1BH8B 5B1MB 5F99B 5B24C 5B2IA 5B1LD 3A6NC 3KFUG 3W96D 3KUYA 5CP6A 3AV1B 2NQBB 4DRBA 5AV8B 3AZJC 2HIOA 4J8WA 5DNNC 1A7WA 1HQ3D 3LELA 3EPJA 3X1VC 3O62D 1W2EA 4KGCA 3WKJA 3AV2D 1P34D 3MGRC 1AOIA 4QLCA 3X1UB 5CPJB 1ZLAD 3LZ1B 1P3FC 5G49B 5GT0D 3MGSA 3REID 3AZKA 4WU8B 3AZEA 3MGPB 1P3OC 3UT9D 3REKC 4X23D 2HUEB 3AZLC 2CV5A 1P3MB 3AL0C 1KX3B 5GSUB 5AVBB 4R8PB 3AZMB 4CSRA 5AV5C 5B2ID 3LJAC 3W98B 4CAYA 3KUYD 2ZY2A 2YFWA 3REHC 2NZDA 2AROB 1M19C 3WA9B 1U35B 2HIOD 5B2JC 4YM6C 4J8WD 1PZRA 5B0ZB 1M18B 3LELD 5B31B 3WAAA 4LD9C 2L5AA 3MGQC 3W97A 2F2AC 2RVQD 5FUGA 1P3PB 3B6GC 3REJA 5BNVB 4QLCD 2F8NG 3AZFC 3RELB 3MVDB 3MGSD 1P3AA 4J8XA 1P3IA 1EQZD 3B6FC 3VH6W 3AZED 1HTAA 2Y2LA 3AZNA 1TZYC 2JE5A 1F66D 5B0YD 3LZ0B 3X1TA 2PYOC 4EO5C 4Z66B 4XUJA 5GT3A 1P3KC 1H3OA 4J8UA 3AZHC 5AV9A 5B40A 1N1JB 1P3LA 2Y2KA 3V9RA 4NFTA 1WWSA 3AN2B 2BYMB 1B67A 5BNXB 3C1CB 5B31G 3WAAD 2FJ7A 5B1MC 5F99C 3W97D 2Y2MA 3AV1C 2NQBC 4Z5TB 1ID3B 3MNNA 2CWEA 5JA4B 2IO5B 5AV8C 1T3UA 5B32A 1S32D 1P3ID 5BS7A 3B0DB 3UTAA 3C1BA 4UUZA 4G92B 1P3BD 5B1LB 1BH9B 3W96B 3X1TD 5CPIA 3P5JB 5GT3D 4J8UD 5GXQB 3X1UC 5CPJC 2BYKA 3LZ1C 3W99A 5E5AA 1HQ3B 4WU8C 5KDMB 3NQJA 1KX4B 4NE6A 5B24D 3O62A 3MGPC 3A6ND 3AFAA 3AYWB 1P3LD 4J8VB 3VH5W 5AY8A 2FFFB 3AV2A 4H9NA 2HUEC 2XD5A 2BG1A 4KHAA 4E44A 3AZJD 1P3MC 1KX3C 5GSUC 4R8PC 5AVBC 3REIB 5B33B 4YS3B 1ZLAA 1TAFB 5CPKB 2FJ7D 3KWQB 3X1VD 3W98C 3AZHB 4WNNB 3UT9B 2W8SA 4X23B 3A1KA 4ZUXB 5B32D 1U35C 3UTBA 5B0ZC 3AZIB 1P3GB 4XZQA 1M18C 5B31C 2JSSA 1BFMA 3C1BD 3R45A 4NE3A 1P3PC 4WJ3C 2YFVA 3KUYB 1P3OD 5CP6B 5CPID 3REKD 3X1SA 4UPKA 2HIOB 4J8WB 3W99D 3RELC 5E5AD 3MVDC 3LELB 5DNMA 5AV5D 4NE5A 4KGCB 3LJAD 3WKJB 3AFAD 5AY8D 5AVCA 3LZ0C 3REHD 1AOIB 4QLCB 4Z66C 5BT1C 1M19D 5B2JD 4YM6D 1KX5A 4HGAB 3AZKB 3VH5T 3MGQD 3AZEB 3TU4A 1EQZA 4H9QA 3AV1A 1F66A 5B0YA 3AN2C 3FDDA 3KXBA 3UTBD 3C1CC 4XZQD 2CV5B 4KUDA 3AZFD 3AZGA 4CSRB 1M1AA 3B6FD 5JRGA 4H9RA 4CAYB 2YFWB 1F1EA 1TZYD 4Z5TC 3X1SD 2NZDB 2IO5C
chains in the Genus database with same CATH topology
1ULYA 3B0BA 2F8NA 1P3KD 3WAAB 3WTPA 5DNMD 4WU9A 3B0DC 1B6WA 4G92C 3W97B 5FUGB 5B1LC 3W96C 3REJB 5AVCD 2Y2PA 3EPHA 1KX5D 5GXQC 5AV6A 1P3AB 4J8XB 1P3IB 4JJNA 1HQ3C 1S32A 4R8PA 3AZMA 3TU4D 4H9SA 5B1MD 1R4VA 5F99D 1KX4C 2J8PA 3AZNB 3AYWC 4J8VC 1P34C 3AV1D 3X1TB 1P3BA 4M6BA 4XUJB 3KXBD 2AROA 4Z2MH 5GT3B 5AV8D 3WA9A 1H3OB 4J8UB 4KUDD 3AZGD 1M1AD 5GT0C 3REIC 5B33C 4YS3C 5JRGD 5CPKC 3KWQC 5AV9B 2Y2JA 4H9OA 4DRAA 5B40B 3UT9C 1P3LB 5B24A 3A6NA 3V9RB 4X23C 4ZUXC 2F8ND 3AZIC 5CPJD 3WTPD 1P3GC 4WU9D 3AZJA 5DNNA 2FJ7B 3WTPE 5B2IC 2F8NK 3X1VA 3MGPD 3KUYC 5CP6C 3MNNB 3LZ0A 2HIOC 5B32B 4J8WC 5AV6D 3MGRA 3H0RC 4E45A 4JJND 3LELC 5GSUD 4R8PD 1KX3D 2Y2IA 3AZMD 3UTAB 3C1BB 4UUZB 1P3FA 2DQNC 4H9PA 4KGCC 3WKJC 3W98D 5CPIB 2Y2GA 1P3OA 1AOIC 4QLCC 2AROD 3REKA 3WA9D 1U35D 3W99B 2BYKB 5B0ZD 5E5AB 4HGAC 3AZKC 3AZLA 2Y2OA 3AZEC 3NQJB 3O62B 5AV5A 3AFAB 3LJAA 5AY8B 3AV2B 3H0LC 4H9NB 4DQYB 1P34B 5JA4A 4KHAB 2JCHA 3REHA 2Y2QA 2CV5C 1M19A 3RELD 5B2JA 5DNND 4YM6A 1ZLAB 2PYOD 5GT0B 2DF4C 4LD9A 3MGQA 4ZBJB 3B6GA 2NZDC 3LZ0D 5BT1D 3MGRD 4XZQB 3WAAC 1P3FD 3R45B 3AZFA 3W97C 2G5HC 1WWIA 5C3IB 2ZM5A 2YFVB 5B2IB 3B6FA 2F8NH 3REJC 3AYWA 3X1SB 1TZYA 1ID3C 2PYOA 1P3AC 4J8XC 3AZLD 1P3IC 1JFIA 5DNMB 1P3KA 5BO0A 3AZNC 3NQUA 3AZHA 5AVCB 3X1TC 2G5IC 4XUJC 5GT3C 4J8UC 1KX5B 3IP4C 4G91B 3MGSB 5AV9C 3TU4B 1EQZB 4LD9D 4H9QB 5B40C 1BH8A 5B1MA 5F99A 1P3LC 3B6GD 1F66B 5B0YB 3KXBB 2NQBA 5GXQD 4KUDB 3AZGB 5AV8A 1M1AB 2FJ7C 1Q9CA 5JRGB 4H9RB 1KX4D 3AYWD 3MNNC 4J8VD 4AWLB 5B32C 2F8NB 3WTPB 3VH6A 5BS7C 4WU9B 3X1UA 5CPJA 5B33D 4YS3D 3LZ1A 3C1BC 5G49A 3UTAC 5CPKD 3KWQD 4WU8A 3AZHD 5CPIC 3MGPA 4ZUXD 3W99C 5AV6B 2UWXA 5E5AC 3AZID 1P3GD 4JJNB 1S32B 1P3MA 1KU5A 5GSUA 5AVBA 1KX3A 3O62C 3AFAC 1P3BB 5CP6D 5AY8C 3AV2C 3W98A 3B0CT 2NQBD 1U35A 2LY8A 1ZLAC 5B0ZA 1M18A 5B31A 4H9OB 4KGCD 3WKJD 5B24B 3A1IA 4ZBJC 3A6NB 1P3PA 1AOID 5BNVA 3UTBC 4XZQC 3AZJB 5DNNB 3X1UD 3LZ1D 3AZKD 3RELA 3MVDA 2VQRA 4WU8D 5C3IC 3X1VB 3X1SC 3MGRB 2CV5D 2Y2HA 4Z66A 5DNMC 2ZY5A 1P3MD 2ZY3A 1P3FB 4H9PB 5AVBD 3VH5A 2RVQC 2RIQA 5AVCC 3F6TA 1P3OB 2NZDD 3REKB 1N1JA 3EPLA 1KX5C 5CHLB 3AN2A 2BYMA 4G91C 3MGSC 3C1CA 5BNXA 3AZLB 1M18D 5B31D 3TU4C 1EQZC 3EPKA 5AV5B 3LJAB 1P3PD 3REJD 1F66C 5B0YC 3REHB 3KXBC 4Z5TA 1ID3A 2Y2NA 1M19B 4KUDC 3AZGC 5B2JB 4YM6B 1P3AD 1M1AC 4J8XD 4WZSB 3MVDD 5JRGC 4LD9B 3MGQB 3AZND 3B6GB 5B1LA 1BH9A 2XD1A 3W96A 4AWLC 3H0MC 4XUJD 3VH6T 5B32G 4Z66D 3UTBB 3WTPC 4WU9C 5GXQA 3AZFB 3EG5B 5AV9D 3KSYA 3B6FB 1HQ3A 5KDMA 5B40D 1KX4A 1TZYB 4J8VA 1P34A 2PYOB 5AV6C 4EO5B 3AN2D 3C1CD 4JJNC 1S32C 1P3KB 1JFIB 3AZMC 5BO0B 4H9SC 4Z2MG 5GT0A 3REIA 5B33A 4YS3A 3NQUB 1TAFA 5CPKA 3KWQA 4WV4B 1P3BC 4WNNA 3MNND 3UT9A 2AROC 4Z5TD 1ID3D 3WA9C 1Z2CB 4X23A 4ZUXA 3AZIA 1P3GA 3B0CW 3UTAD 2ZY4A 1BH8B 5B1MB 5F99B 5B24C 5B2IA 5B1LD 3A6NC 3KFUG 3W96D 3KUYA 5CP6A 3AV1B 2NQBB 4DRBA 5AV8B 3AZJC 2HIOA 4J8WA 5DNNC 1A7WA 1HQ3D 3LELA 3EPJA 3X1VC 3O62D 1W2EA 4KGCA 3WKJA 3AV2D 1P34D 3MGRC 1AOIA 4QLCA 3X1UB 5CPJB 1ZLAD 3LZ1B 1P3FC 5G49B 5GT0D 3MGSA 3REID 3AZKA 4WU8B 3AZEA 3MGPB 1P3OC 3UT9D 3REKC 4X23D 2HUEB 3AZLC 2CV5A 1P3MB 3AL0C 1KX3B 5GSUB 5AVBB 4R8PB 3AZMB 4CSRA 5AV5C 5B2ID 3LJAC 3W98B 4CAYA 3KUYD 2ZY2A 2YFWA 3REHC 2NZDA 2AROB 1M19C 3WA9B 1U35B 2HIOD 5B2JC 4YM6C 4J8WD 1PZRA 5B0ZB 1M18B 3LELD 5B31B 3WAAA 4LD9C 2L5AA 3MGQC 3W97A 2F2AC 2RVQD 5FUGA 1P3PB 3B6GC 3REJA 5BNVB 4QLCD 2F8NG 3AZFC 3RELB 3MVDB 3MGSD 1P3AA 4J8XA 1P3IA 1EQZD 3B6FC 3VH6W 3AZED 1HTAA 2Y2LA 3AZNA 1TZYC 2JE5A 1F66D 5B0YD 3LZ0B 3X1TA 2PYOC 4EO5C 4Z66B 4XUJA 5GT3A 1P3KC 1H3OA 4J8UA 3AZHC 5AV9A 5B40A 1N1JB 1P3LA 2Y2KA 3V9RA 4NFTA 1WWSA 3AN2B 2BYMB 1B67A 5BNXB 3C1CB 5B31G 3WAAD 2FJ7A 5B1MC 5F99C 3W97D 2Y2MA 3AV1C 2NQBC 4Z5TB 1ID3B 3MNNA 2CWEA 5JA4B 2IO5B 5AV8C 1T3UA 5B32A 1S32D 1P3ID 5BS7A 3B0DB 3UTAA 3C1BA 4UUZA 4G92B 1P3BD 5B1LB 1BH9B 3W96B 3X1TD 5CPIA 3P5JB 5GT3D 4J8UD 5GXQB 3X1UC 5CPJC 2BYKA 3LZ1C 3W99A 5E5AA 1HQ3B 4WU8C 5KDMB 3NQJA 1KX4B 4NE6A 5B24D 3O62A 3MGPC 3A6ND 3AFAA 3AYWB 1P3LD 4J8VB 3VH5W 5AY8A 2FFFB 3AV2A 4H9NA 2HUEC 2XD5A 2BG1A 4KHAA 4E44A 3AZJD 1P3MC 1KX3C 5GSUC 4R8PC 5AVBC 3REIB 5B33B 4YS3B 1ZLAA 1TAFB 5CPKB 2FJ7D 3KWQB 3X1VD 3W98C 3AZHB 4WNNB 3UT9B 2W8SA 4X23B 3A1KA 4ZUXB 5B32D 1U35C 3UTBA 5B0ZC 3AZIB 1P3GB 4XZQA 1M18C 5B31C 2JSSA 1BFMA 3C1BD 3R45A 4NE3A 1P3PC 4WJ3C 2YFVA 3KUYB 1P3OD 5CP6B 5CPID 3REKD 3X1SA 4UPKA 2HIOB 4J8WB 3W99D 3RELC 5E5AD 3MVDC 3LELB 5DNMA 5AV5D 4NE5A 4KGCB 3LJAD 3WKJB 3AFAD 5AY8D 5AVCA 3LZ0C 3REHD 1AOIB 4QLCB 4Z66C 5BT1C 1M19D 5B2JD 4YM6D 1KX5A 4HGAB 3AZKB 3VH5T 3MGQD 3AZEB 3TU4A 1EQZA 4H9QA 3AV1A 1F66A 5B0YA 3AN2C 3FDDA 3KXBA 3UTBD 3C1CC 4XZQD 2CV5B 4KUDA 3AZFD 3AZGA 4CSRB 1M1AA 3B6FD 5JRGA 4H9RA 4CAYB 2YFWB 1F1EA 1TZYD 4Z5TC 3X1SD 2NZDB 2IO5C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ULY A;  3B0B A;  2F8N A;  1P3K D;  3WAA B;  3WTP A;  5DNM D;  4WU9 A;  3B0D C;  1B6W A;  4G92 C;  3W97 B;  5FUG B;  5B1L C;  3W96 C;  3REJ B;  5AVC D;  1KX5 D;  5GXQ C;  5AV6 A;  1P3A B;  4J8X B;  1P3I B;  4JJN A;  1HQ3 C;  1S32 A;  4R8P A;  3AZM A;  3TU4 D;  4H9S A;  5B1M D;  1R4V A;  5F99 D;  1KX4 C;  3AZN B;  3AYW C;  4J8V C;  1P34 C;  3AV1 D;  3X1T B;  1P3B A;  4M6B A;  4XUJ B;  3KXB D;  2ARO A;  4Z2M H;  5GT3 B;  5AV8 D;  3WA9 A;  1H3O B;  4J8U B;  4KUD D;  3AZG D;  1M1A D;  5GT0 C;  3REI C;  5B33 C;  4YS3 C;  5JRG D;  5CPK C;  3KWQ C;  5AV9 B;  4H9O A;  4DRA A;  5B40 B;  3UT9 C;  1P3L B;  5B24 A;  3A6N A;  3V9R B;  4X23 C;  4ZUX C;  2F8N D;  3AZI C;  5CPJ D;  3WTP D;  1P3G C;  4WU9 D;  3AZJ A;  5DNN A;  2FJ7 B;  3WTP E;  5B2I C;  2F8N K;  3X1V A;  3MGP D;  3KUY C;  5CP6 C;  3MNN B;  3LZ0 A;  2HIO C;  5B32 B;  4J8W C;  5AV6 D;  3MGR A;  4E45 A;  4JJN D;  3LEL C;  5GSU D;  4R8P D;  1KX3 D;  3AZM D;  3UTA B;  3C1B B;  4UUZ B;  1P3F A;  4H9P A;  4KGC C;  3WKJ C;  3W98 D;  5CPI B;  1P3O A;  1AOI C;  4QLC C;  2ARO D;  3REK A;  3WA9 D;  1U35 D;  3W99 B;  2BYK B;  5B0Z D;  5E5A B;  4HGA C;  3AZK C;  3AZL A;  3AZE C;  3NQJ B;  3O62 B;  5AV5 A;  3AFA B;  3LJA A;  5AY8 B;  3AV2 B;  4H9N B;  1P34 B;  5JA4 A;  4KHA B;  3REH A;  2CV5 C;  1M19 A;  3REL D;  5B2J A;  5DNN D;  4YM6 A;  1ZLA B;  2PYO D;  5GT0 B;  4LD9 A;  3MGQ A;  4ZBJ B;  3B6G A;  2NZD C;  3LZ0 D;  5BT1 D;  3MGR D;  4XZQ B;  3WAA C;  1P3F D;  3R45 B;  3AZF A;  3W97 C;  1WWI A;  5C3I B;  3B6F A;  2YFV B;  5B2I B;  2F8N H;  3REJ C;  3AYW A;  3X1S B;  1TZY A;  1ID3 C;  2PYO A;  1P3A C;  4J8X C;  3AZL D;  1P3I C;  1JFI A;  5DNM B;  1P3K A;  5BO0 A;  3AZN C;  3NQU A;  3AZH A;  5AVC B;  3X1T C;  4XUJ C;  5GT3 C;  4J8U C;  1KX5 B;  4G91 B;  3MGS B;  5AV9 C;  3TU4 B;  1EQZ B;  4LD9 D;  4H9Q B;  5B40 C;  1BH8 A;  5B1M A;  5F99 A;  1P3L C;  3B6G D;  1F66 B;  5B0Y B;  3KXB B;  2NQB A;  5GXQ D;  4KUD B;  3AZG B;  5AV8 A;  1M1A B;  2FJ7 C;  1Q9C A;  5JRG B;  4H9R B;  1KX4 D;  3AYW D;  3MNN C;  4J8V D;  4AWL B;  5B32 C;  2F8N B;  3WTP B;  3VH6 A;  5BS7 C;  4WU9 B;  3X1U A;  5CPJ A;  5B33 D;  4YS3 D;  3LZ1 A;  3C1B C;  5G49 A;  3UTA C;  5CPK D;  3KWQ D;  4WU8 A;  3AZH D;  5CPI C;  3MGP A;  4ZUX D;  3W99 C;  5AV6 B;  5E5A C;  3AZI D;  1P3G D;  4JJN B;  1S32 B;  1P3M A;  1KU5 A;  5GSU A;  5AVB A;  1KX3 A;  3O62 C;  3AFA C;  1P3B B;  5CP6 D;  5AY8 C;  3AV2 C;  3W98 A;  3B0C T;  2NQB D;  1U35 A;  2LY8 A;  1ZLA C;  5B0Z A;  1M18 A;  5B31 A;  4H9O B;  4KGC D;  3WKJ D;  5B24 B;  4ZBJ C;  3A6N B;  1P3P A;  1AOI D;  5BNV A;  3UTB C;  4XZQ C;  3AZJ B;  5DNN B;  3X1U D;  3LZ1 D;  3AZK D;  3REL A;  3MVD A;  4WU8 D;  5C3I C;  3X1V B;  3X1S C;  3MGR B;  2CV5 D;  4Z66 A;  5DNM C;  1P3M D;  1P3F B;  4H9P B;  5AVB D;  3VH5 A;  2RVQ C;  5AVC C;  1P3O B;  2NZD D;  3REK B;  1N1J A;  1KX5 C;  5CHL B;  3AN2 A;  2BYM A;  4G91 C;  3MGS C;  3C1C A;  5BNX A;  3AZL B;  1M18 D;  5B31 D;  3TU4 C;  1EQZ C;  5AV5 B;  3LJA B;  1P3P D;  3REJ D;  1F66 C;  5B0Y C;  3REH B;  3KXB C;  4Z5T A;  1ID3 A;  1M19 B;  4KUD C;  3AZG C;  5B2J B;  4YM6 B;  1P3A D;  1M1A C;  4J8X D;  4WZS B;  3MVD D;  5JRG C;  4LD9 B;  3MGQ B;  3AZN D;  3B6G B;  5B1L A;  1BH9 A;  3W96 A;  4AWL C;  4XUJ D;  3VH6 T;  5B32 G;  4Z66 D;  3UTB B;  3WTP C;  4WU9 C;  5GXQ A;  3AZF B;  5AV9 D;  3KSY A;  3B6F B;  1HQ3 A;  5KDM A;  5B40 D;  1KX4 A;  1TZY B;  4J8V A;  1P34 A;  2PYO B;  5AV6 C;  4EO5 B;  3AN2 D;  3C1C D;  4JJN C;  1S32 C;  1P3K B;  1JFI B;  3AZM C;  5BO0 B;  4H9S C;  4Z2M G;  5GT0 A;  3REI A;  5B33 A;  4YS3 A;  3NQU B;  1TAF A;  5CPK A;  3KWQ A;  4WV4 B;  1P3B C;  4WNN A;  3MNN D;  3UT9 A;  2ARO C;  4Z5T D;  1ID3 D;  3WA9 C;  4X23 A;  4ZUX A;  3AZI A;  1P3G A;  3B0C W;  3UTA D;  1BH8 B;  5B1M B;  5F99 B;  5B24 C;  5B2I A;  5B1L D;  3A6N C;  3W96 D;  3KUY A;  5CP6 A;  3AV1 B;  2NQB B;  4DRB A;  5AV8 B;  3AZJ C;  2HIO A;  4J8W A;  5DNN C;  1A7W A;  1HQ3 D;  3LEL A;  3X1V C;  3O62 D;  4KGC A;  3WKJ A;  3AV2 D;  1P34 D;  3MGR C;  1AOI A;  4QLC A;  3X1U B;  5CPJ B;  1ZLA D;  3LZ1 B;  1P3F C;  5G49 B;  5GT0 D;  3MGS A;  3REI D;  3AZK A;  4WU8 B;  3AZE A;  3MGP B;  1P3O C;  3UT9 D;  3REK C;  4X23 D;  2HUE B;  3AZL C;  2CV5 A;  1P3M B;  1KX3 B;  5GSU B;  5AVB B;  4R8P B;  3AZM B;  4CSR A;  5AV5 C;  5B2I D;  3LJA C;  3W98 B;  4CAY A;  3KUY D;  2YFW A;  3REH C;  2NZD A;  2ARO B;  1M19 C;  3WA9 B;  1U35 B;  2HIO D;  5B2J C;  4YM6 C;  4J8W D;  5B0Z B;  1M18 B;  3LEL D;  5B31 B;  3WAA A;  4LD9 C;  2L5A A;  3MGQ C;  3W97 A;  2RVQ D;  5FUG A;  1P3P B;  3B6G C;  3REJ A;  5BNV B;  4QLC D;  2F8N G;  3AZF C;  3REL B;  3MVD B;  3MGS D;  1P3A A;  4J8X A;  1P3I A;  1EQZ D;  3B6F C;  3VH6 W;  3AZE D;  1HTA A;  3AZN A;  1TZY C;  1F66 D;  5B0Y D;  3LZ0 B;  3X1T A;  2PYO C;  4EO5 C;  4Z66 B;  4XUJ A;  5GT3 A;  1P3K C;  1H3O A;  4J8U A;  3AZH C;  5AV9 A;  5B40 A;  1N1J B;  1P3L A;  3V9R A;  4NFT A;  1WWS A;  3AN2 B;  2BYM B;  1B67 A;  5BNX B;  3C1C B;  5B31 G;  3WAA D;  2FJ7 A;  5B1M C;  5F99 C;  3W97 D;  3AV1 C;  2NQB C;  4Z5T B;  1ID3 B;  3MNN A;  2CWE A;  5JA4 B;  2IO5 B;  5AV8 C;  5B32 A;  1S32 D;  1P3I D;  5BS7 A;  3B0D B;  3UTA A;  3C1B A;  4UUZ A;  4G92 B;  1P3B D;  5B1L B;  1BH9 B;  3W96 B;  3X1T D;  5CPI A;  5GT3 D;  4J8U D;  5GXQ B;  3X1U C;  5CPJ C;  2BYK A;  3LZ1 C;  3W99 A;  5E5A A;  1HQ3 B;  4WU8 C;  5KDM B;  3NQJ A;  1KX4 B;  4NE6 A;  5B24 D;  3O62 A;  3MGP C;  3A6N D;  3AFA A;  3AYW B;  1P3L D;  4J8V B;  3VH5 W;  5AY8 A;  3AV2 A;  4H9N A;  2HUE C;  4KHA A;  4E44 A;  3AZJ D;  1P3M C;  1KX3 C;  5GSU C;  4R8P C;  5AVB C;  3REI B;  5B33 B;  4YS3 B;  1ZLA A;  1TAF B;  5CPK B;  2FJ7 D;  3KWQ B;  3X1V D;  3W98 C;  3AZH B;  4WNN B;  3UT9 B;  4X23 B;  1U35 C;  4ZUX B;  5B32 D;  3UTB A;  5B0Z C;  3AZI B;  1P3G B;  4XZQ A;  1M18 C;  5B31 C;  2JSS A;  1BFM A;  3C1B D;  3R45 A;  4NE3 A;  1P3P C;  2YFV A;  3KUY B;  1P3O D;  5CP6 B;  5CPI D;  3REK D;  3X1S A;  2HIO B;  4J8W B;  3W99 D;  3REL C;  5E5A D;  3MVD C;  3LEL B;  5DNM A;  5AV5 D;  4NE5 A;  4KGC B;  3LJA D;  3WKJ B;  3AFA D;  5AY8 D;  5AVC A;  3LZ0 C;  3REH D;  1AOI B;  4QLC B;  4Z66 C;  5BT1 C;  1M19 D;  5B2J D;  4YM6 D;  1KX5 A;  4HGA B;  3AZK B;  3VH5 T;  3MGQ D;  3AZE B;  3TU4 A;  1EQZ A;  4H9Q A;  3AV1 A;  1F66 A;  5B0Y A;  3AN2 C;  3KXB A;  3UTB D;  3C1C C;  4XZQ D;  2CV5 B;  4KUD A;  3AZF D;  3AZG A;  4CSR B;  1M1A A;  3B6F D;  5JRG A;  4H9R A;  4CAY B;  2YFW B;  1F1E A;  1TZY D;  4Z5T C;  3X1S D;  2NZD B;  2IO5 C; 
#chains in the Genus database with same CATH topology
 1ULY A;  3B0B A;  2F8N A;  1P3K D;  3WAA B;  3WTP A;  5DNM D;  4WU9 A;  3B0D C;  1B6W A;  4G92 C;  3W97 B;  5FUG B;  5B1L C;  3W96 C;  3REJ B;  5AVC D;  2Y2P A;  3EPH A;  1KX5 D;  5GXQ C;  5AV6 A;  1P3A B;  4J8X B;  1P3I B;  4JJN A;  1HQ3 C;  1S32 A;  4R8P A;  3AZM A;  3TU4 D;  4H9S A;  5B1M D;  1R4V A;  5F99 D;  1KX4 C;  2J8P A;  3AZN B;  3AYW C;  4J8V C;  1P34 C;  3AV1 D;  3X1T B;  1P3B A;  4M6B A;  4XUJ B;  3KXB D;  2ARO A;  4Z2M H;  5GT3 B;  5AV8 D;  3WA9 A;  1H3O B;  4J8U B;  4KUD D;  3AZG D;  1M1A D;  5GT0 C;  3REI C;  5B33 C;  4YS3 C;  5JRG D;  5CPK C;  3KWQ C;  5AV9 B;  2Y2J A;  4H9O A;  4DRA A;  5B40 B;  3UT9 C;  1P3L B;  5B24 A;  3A6N A;  3V9R B;  4X23 C;  4ZUX C;  2F8N D;  3AZI C;  5CPJ D;  3WTP D;  1P3G C;  4WU9 D;  3AZJ A;  5DNN A;  2FJ7 B;  3WTP E;  5B2I C;  2F8N K;  3X1V A;  3MGP D;  3KUY C;  5CP6 C;  3MNN B;  3LZ0 A;  2HIO C;  5B32 B;  4J8W C;  5AV6 D;  3MGR A;  3H0R C;  4E45 A;  4JJN D;  3LEL C;  5GSU D;  4R8P D;  1KX3 D;  2Y2I A;  3AZM D;  3UTA B;  3C1B B;  4UUZ B;  1P3F A;  2DQN C;  4H9P A;  4KGC C;  3WKJ C;  3W98 D;  5CPI B;  2Y2G A;  1P3O A;  1AOI C;  4QLC C;  2ARO D;  3REK A;  3WA9 D;  1U35 D;  3W99 B;  2BYK B;  5B0Z D;  5E5A B;  4HGA C;  3AZK C;  3AZL A;  2Y2O A;  3AZE C;  3NQJ B;  3O62 B;  5AV5 A;  3AFA B;  3LJA A;  5AY8 B;  3AV2 B;  3H0L C;  4H9N B;  4DQY B;  1P34 B;  5JA4 A;  4KHA B;  2JCH A;  3REH A;  2Y2Q A;  2CV5 C;  1M19 A;  3REL D;  5B2J A;  5DNN D;  4YM6 A;  1ZLA B;  2PYO D;  5GT0 B;  2DF4 C;  4LD9 A;  3MGQ A;  4ZBJ B;  3B6G A;  2NZD C;  3LZ0 D;  5BT1 D;  3MGR D;  4XZQ B;  3WAA C;  1P3F D;  3R45 B;  3AZF A;  3W97 C;  2G5H C;  1WWI A;  5C3I B;  2ZM5 A;  2YFV B;  5B2I B;  3B6F A;  2F8N H;  3REJ C;  3AYW A;  3X1S B;  1TZY A;  1ID3 C;  2PYO A;  1P3A C;  4J8X C;  3AZL D;  1P3I C;  1JFI A;  5DNM B;  1P3K A;  5BO0 A;  3AZN C;  3NQU A;  3AZH A;  5AVC B;  3X1T C;  2G5I C;  4XUJ C;  5GT3 C;  4J8U C;  1KX5 B;  3IP4 C;  4G91 B;  3MGS B;  5AV9 C;  3TU4 B;  1EQZ B;  4LD9 D;  4H9Q B;  5B40 C;  1BH8 A;  5B1M A;  5F99 A;  1P3L C;  3B6G D;  1F66 B;  5B0Y B;  3KXB B;  2NQB A;  5GXQ D;  4KUD B;  3AZG B;  5AV8 A;  1M1A B;  2FJ7 C;  1Q9C A;  5JRG B;  4H9R B;  1KX4 D;  3AYW D;  3MNN C;  4J8V D;  4AWL B;  5B32 C;  2F8N B;  3WTP B;  3VH6 A;  5BS7 C;  4WU9 B;  3X1U A;  5CPJ A;  5B33 D;  4YS3 D;  3LZ1 A;  3C1B C;  5G49 A;  3UTA C;  5CPK D;  3KWQ D;  4WU8 A;  3AZH D;  5CPI C;  3MGP A;  4ZUX D;  3W99 C;  5AV6 B;  2UWX A;  5E5A C;  3AZI D;  1P3G D;  4JJN B;  1S32 B;  1P3M A;  1KU5 A;  5GSU A;  5AVB A;  1KX3 A;  3O62 C;  3AFA C;  1P3B B;  5CP6 D;  5AY8 C;  3AV2 C;  3W98 A;  3B0C T;  2NQB D;  1U35 A;  2LY8 A;  1ZLA C;  5B0Z A;  1M18 A;  5B31 A;  4H9O B;  4KGC D;  3WKJ D;  5B24 B;  3A1I A;  4ZBJ C;  3A6N B;  1P3P A;  1AOI D;  5BNV A;  3UTB C;  4XZQ C;  3AZJ B;  5DNN B;  3X1U D;  3LZ1 D;  3AZK D;  3REL A;  3MVD A;  2VQR A;  4WU8 D;  5C3I C;  3X1V B;  3X1S C;  3MGR B;  2CV5 D;  2Y2H A;  4Z66 A;  5DNM C;  2ZY5 A;  1P3M D;  2ZY3 A;  1P3F B;  4H9P B;  5AVB D;  3VH5 A;  2RVQ C;  2RIQ A;  5AVC C;  3F6T A;  1P3O B;  2NZD D;  3REK B;  1N1J A;  3EPL A;  1KX5 C;  5CHL B;  3AN2 A;  2BYM A;  4G91 C;  3MGS C;  3C1C A;  5BNX A;  3AZL B;  1M18 D;  5B31 D;  3TU4 C;  1EQZ C;  3EPK A;  5AV5 B;  3LJA B;  1P3P D;  3REJ D;  1F66 C;  5B0Y C;  3REH B;  3KXB C;  4Z5T A;  1ID3 A;  2Y2N A;  1M19 B;  4KUD C;  3AZG C;  5B2J B;  4YM6 B;  1P3A D;  1M1A C;  4J8X D;  4WZS B;  3MVD D;  5JRG C;  4LD9 B;  3MGQ B;  3AZN D;  3B6G B;  5B1L A;  1BH9 A;  2XD1 A;  3W96 A;  4AWL C;  3H0M C;  4XUJ D;  3VH6 T;  5B32 G;  4Z66 D;  3UTB B;  3WTP C;  4WU9 C;  5GXQ A;  3AZF B;  3EG5 B;  5AV9 D;  3KSY A;  3B6F B;  1HQ3 A;  5KDM A;  5B40 D;  1KX4 A;  1TZY B;  4J8V A;  1P34 A;  2PYO B;  5AV6 C;  4EO5 B;  3AN2 D;  3C1C D;  4JJN C;  1S32 C;  1P3K B;  1JFI B;  3AZM C;  5BO0 B;  4H9S C;  4Z2M G;  5GT0 A;  3REI A;  5B33 A;  4YS3 A;  3NQU B;  1TAF A;  5CPK A;  3KWQ A;  4WV4 B;  1P3B C;  4WNN A;  3MNN D;  3UT9 A;  2ARO C;  4Z5T D;  1ID3 D;  3WA9 C;  1Z2C B;  4X23 A;  4ZUX A;  3AZI A;  1P3G A;  3B0C W;  3UTA D;  2ZY4 A;  1BH8 B;  5B1M B;  5F99 B;  5B24 C;  5B2I A;  5B1L D;  3A6N C;  3KFU G;  3W96 D;  3KUY A;  5CP6 A;  3AV1 B;  2NQB B;  4DRB A;  5AV8 B;  3AZJ C;  2HIO A;  4J8W A;  5DNN C;  1A7W A;  1HQ3 D;  3LEL A;  3EPJ A;  3X1V C;  3O62 D;  1W2E A;  4KGC A;  3WKJ A;  3AV2 D;  1P34 D;  3MGR C;  1AOI A;  4QLC A;  3X1U B;  5CPJ B;  1ZLA D;  3LZ1 B;  1P3F C;  5G49 B;  5GT0 D;  3MGS A;  3REI D;  3AZK A;  4WU8 B;  3AZE A;  3MGP B;  1P3O C;  3UT9 D;  3REK C;  4X23 D;  2HUE B;  3AZL C;  2CV5 A;  1P3M B;  3AL0 C;  1KX3 B;  5GSU B;  5AVB B;  4R8P B;  3AZM B;  4CSR A;  5AV5 C;  5B2I D;  3LJA C;  3W98 B;  4CAY A;  3KUY D;  2ZY2 A;  2YFW A;  3REH C;  2NZD A;  2ARO B;  1M19 C;  3WA9 B;  1U35 B;  2HIO D;  5B2J C;  4YM6 C;  4J8W D;  1PZR A;  5B0Z B;  1M18 B;  3LEL D;  5B31 B;  3WAA A;  4LD9 C;  2L5A A;  3MGQ C;  3W97 A;  2F2A C;  2RVQ D;  5FUG A;  1P3P B;  3B6G C;  3REJ A;  5BNV B;  4QLC D;  2F8N G;  3AZF C;  3REL B;  3MVD B;  3MGS D;  1P3A A;  4J8X A;  1P3I A;  1EQZ D;  3B6F C;  3VH6 W;  3AZE D;  1HTA A;  2Y2L A;  3AZN A;  1TZY C;  2JE5 A;  1F66 D;  5B0Y D;  3LZ0 B;  3X1T A;  2PYO C;  4EO5 C;  4Z66 B;  4XUJ A;  5GT3 A;  1P3K C;  1H3O A;  4J8U A;  3AZH C;  5AV9 A;  5B40 A;  1N1J B;  1P3L A;  2Y2K A;  3V9R A;  4NFT A;  1WWS A;  3AN2 B;  2BYM B;  1B67 A;  5BNX B;  3C1C B;  5B31 G;  3WAA D;  2FJ7 A;  5B1M C;  5F99 C;  3W97 D;  2Y2M A;  3AV1 C;  2NQB C;  4Z5T B;  1ID3 B;  3MNN A;  2CWE A;  5JA4 B;  2IO5 B;  5AV8 C;  1T3U A;  5B32 A;  1S32 D;  1P3I D;  5BS7 A;  3B0D B;  3UTA A;  3C1B A;  4UUZ A;  4G92 B;  1P3B D;  5B1L B;  1BH9 B;  3W96 B;  3X1T D;  5CPI A;  3P5J B;  5GT3 D;  4J8U D;  5GXQ B;  3X1U C;  5CPJ C;  2BYK A;  3LZ1 C;  3W99 A;  5E5A A;  1HQ3 B;  4WU8 C;  5KDM B;  3NQJ A;  1KX4 B;  4NE6 A;  5B24 D;  3O62 A;  3MGP C;  3A6N D;  3AFA A;  3AYW B;  1P3L D;  4J8V B;  3VH5 W;  5AY8 A;  2FFF B;  3AV2 A;  4H9N A;  2HUE C;  2XD5 A;  2BG1 A;  4KHA A;  4E44 A;  3AZJ D;  1P3M C;  1KX3 C;  5GSU C;  4R8P C;  5AVB C;  3REI B;  5B33 B;  4YS3 B;  1ZLA A;  1TAF B;  5CPK B;  2FJ7 D;  3KWQ B;  3X1V D;  3W98 C;  3AZH B;  4WNN B;  3UT9 B;  2W8S A;  4X23 B;  3A1K A;  4ZUX B;  5B32 D;  1U35 C;  3UTB A;  5B0Z C;  3AZI B;  1P3G B;  4XZQ A;  1M18 C;  5B31 C;  2JSS A;  1BFM A;  3C1B D;  3R45 A;  4NE3 A;  1P3P C;  4WJ3 C;  2YFV A;  3KUY B;  1P3O D;  5CP6 B;  5CPI D;  3REK D;  3X1S A;  4UPK A;  2HIO B;  4J8W B;  3W99 D;  3REL C;  5E5A D;  3MVD C;  3LEL B;  5DNM A;  5AV5 D;  4NE5 A;  4KGC B;  3LJA D;  3WKJ B;  3AFA D;  5AY8 D;  5AVC A;  3LZ0 C;  3REH D;  1AOI B;  4QLC B;  4Z66 C;  5BT1 C;  1M19 D;  5B2J D;  4YM6 D;  1KX5 A;  4HGA B;  3AZK B;  3VH5 T;  3MGQ D;  3AZE B;  3TU4 A;  1EQZ A;  4H9Q A;  3AV1 A;  1F66 A;  5B0Y A;  3AN2 C;  3FDD A;  3KXB A;  3UTB D;  3C1C C;  4XZQ D;  2CV5 B;  4KUD A;  3AZF D;  3AZG A;  4CSR B;  1M1A A;  3B6F D;  5JRG A;  4H9R A;  4CAY B;  2YFW B;  1F1E A;  1TZY D;  4Z5T C;  3X1S D;  2NZD B;  2IO5 C; 
#chains in the Genus database with same CATH homology
 1ULY A;  3B0B A;  2F8N A;  1P3K D;  3WAA B;  3WTP A;  5DNM D;  4WU9 A;  3B0D C;  1B6W A;  4G92 C;  3W97 B;  5FUG B;  5B1L C;  3W96 C;  3REJ B;  5AVC D;  2Y2P A;  3EPH A;  1KX5 D;  5GXQ C;  5AV6 A;  1P3A B;  4J8X B;  1P3I B;  4JJN A;  1HQ3 C;  1S32 A;  4R8P A;  3AZM A;  3TU4 D;  4H9S A;  5B1M D;  1R4V A;  5F99 D;  1KX4 C;  2J8P A;  3AZN B;  3AYW C;  4J8V C;  1P34 C;  3AV1 D;  3X1T B;  1P3B A;  4M6B A;  4XUJ B;  3KXB D;  2ARO A;  4Z2M H;  5GT3 B;  5AV8 D;  3WA9 A;  1H3O B;  4J8U B;  4KUD D;  3AZG D;  1M1A D;  5GT0 C;  3REI C;  5B33 C;  4YS3 C;  5JRG D;  5CPK C;  3KWQ C;  5AV9 B;  2Y2J A;  4H9O A;  4DRA A;  5B40 B;  3UT9 C;  1P3L B;  5B24 A;  3A6N A;  3V9R B;  4X23 C;  4ZUX C;  2F8N D;  3AZI C;  5CPJ D;  3WTP D;  1P3G C;  4WU9 D;  3AZJ A;  5DNN A;  2FJ7 B;  3WTP E;  5B2I C;  2F8N K;  3X1V A;  3MGP D;  3KUY C;  5CP6 C;  3MNN B;  3LZ0 A;  2HIO C;  5B32 B;  4J8W C;  5AV6 D;  3MGR A;  3H0R C;  4E45 A;  4JJN D;  3LEL C;  5GSU D;  4R8P D;  1KX3 D;  2Y2I A;  3AZM D;  3UTA B;  3C1B B;  4UUZ B;  1P3F A;  2DQN C;  4H9P A;  4KGC C;  3WKJ C;  3W98 D;  5CPI B;  2Y2G A;  1P3O A;  1AOI C;  4QLC C;  2ARO D;  3REK A;  3WA9 D;  1U35 D;  3W99 B;  2BYK B;  5B0Z D;  5E5A B;  4HGA C;  3AZK C;  3AZL A;  2Y2O A;  3AZE C;  3NQJ B;  3O62 B;  5AV5 A;  3AFA B;  3LJA A;  5AY8 B;  3AV2 B;  3H0L C;  4H9N B;  4DQY B;  1P34 B;  5JA4 A;  4KHA B;  2JCH A;  3REH A;  2Y2Q A;  2CV5 C;  1M19 A;  3REL D;  5B2J A;  5DNN D;  4YM6 A;  1ZLA B;  2PYO D;  5GT0 B;  2DF4 C;  4LD9 A;  3MGQ A;  4ZBJ B;  3B6G A;  2NZD C;  3LZ0 D;  5BT1 D;  3MGR D;  4XZQ B;  3WAA C;  1P3F D;  3R45 B;  3AZF A;  3W97 C;  2G5H C;  1WWI A;  5C3I B;  2ZM5 A;  2YFV B;  5B2I B;  3B6F A;  2F8N H;  3REJ C;  3AYW A;  3X1S B;  1TZY A;  1ID3 C;  2PYO A;  1P3A C;  4J8X C;  3AZL D;  1P3I C;  1JFI A;  5DNM B;  1P3K A;  5BO0 A;  3AZN C;  3NQU A;  3AZH A;  5AVC B;  3X1T C;  2G5I C;  4XUJ C;  5GT3 C;  4J8U C;  1KX5 B;  3IP4 C;  4G91 B;  3MGS B;  5AV9 C;  3TU4 B;  1EQZ B;  4LD9 D;  4H9Q B;  5B40 C;  1BH8 A;  5B1M A;  5F99 A;  1P3L C;  3B6G D;  1F66 B;  5B0Y B;  3KXB B;  2NQB A;  5GXQ D;  4KUD B;  3AZG B;  5AV8 A;  1M1A B;  2FJ7 C;  1Q9C A;  5JRG B;  4H9R B;  1KX4 D;  3AYW D;  3MNN C;  4J8V D;  4AWL B;  5B32 C;  2F8N B;  3WTP B;  3VH6 A;  5BS7 C;  4WU9 B;  3X1U A;  5CPJ A;  5B33 D;  4YS3 D;  3LZ1 A;  3C1B C;  5G49 A;  3UTA C;  5CPK D;  3KWQ D;  4WU8 A;  3AZH D;  5CPI C;  3MGP A;  4ZUX D;  3W99 C;  5AV6 B;  2UWX A;  5E5A C;  3AZI D;  1P3G D;  4JJN B;  1S32 B;  1P3M A;  1KU5 A;  5GSU A;  5AVB A;  1KX3 A;  3O62 C;  3AFA C;  1P3B B;  5CP6 D;  5AY8 C;  3AV2 C;  3W98 A;  3B0C T;  2NQB D;  1U35 A;  2LY8 A;  1ZLA C;  5B0Z A;  1M18 A;  5B31 A;  4H9O B;  4KGC D;  3WKJ D;  5B24 B;  3A1I A;  4ZBJ C;  3A6N B;  1P3P A;  1AOI D;  5BNV A;  3UTB C;  4XZQ C;  3AZJ B;  5DNN B;  3X1U D;  3LZ1 D;  3AZK D;  3REL A;  3MVD A;  2VQR A;  4WU8 D;  5C3I C;  3X1V B;  3X1S C;  3MGR B;  2CV5 D;  2Y2H A;  4Z66 A;  5DNM C;  2ZY5 A;  1P3M D;  2ZY3 A;  1P3F B;  4H9P B;  5AVB D;  3VH5 A;  2RVQ C;  2RIQ A;  5AVC C;  3F6T A;  1P3O B;  2NZD D;  3REK B;  1N1J A;  3EPL A;  1KX5 C;  5CHL B;  3AN2 A;  2BYM A;  4G91 C;  3MGS C;  3C1C A;  5BNX A;  3AZL B;  1M18 D;  5B31 D;  3TU4 C;  1EQZ C;  3EPK A;  5AV5 B;  3LJA B;  1P3P D;  3REJ D;  1F66 C;  5B0Y C;  3REH B;  3KXB C;  4Z5T A;  1ID3 A;  2Y2N A;  1M19 B;  4KUD C;  3AZG C;  5B2J B;  4YM6 B;  1P3A D;  1M1A C;  4J8X D;  4WZS B;  3MVD D;  5JRG C;  4LD9 B;  3MGQ B;  3AZN D;  3B6G B;  5B1L A;  1BH9 A;  2XD1 A;  3W96 A;  4AWL C;  3H0M C;  4XUJ D;  3VH6 T;  5B32 G;  4Z66 D;  3UTB B;  3WTP C;  4WU9 C;  5GXQ A;  3AZF B;  3EG5 B;  5AV9 D;  3KSY A;  3B6F B;  1HQ3 A;  5KDM A;  5B40 D;  1KX4 A;  1TZY B;  4J8V A;  1P34 A;  2PYO B;  5AV6 C;  4EO5 B;  3AN2 D;  3C1C D;  4JJN C;  1S32 C;  1P3K B;  1JFI B;  3AZM C;  5BO0 B;  4H9S C;  4Z2M G;  5GT0 A;  3REI A;  5B33 A;  4YS3 A;  3NQU B;  1TAF A;  5CPK A;  3KWQ A;  4WV4 B;  1P3B C;  4WNN A;  3MNN D;  3UT9 A;  2ARO C;  4Z5T D;  1ID3 D;  3WA9 C;  1Z2C B;  4X23 A;  4ZUX A;  3AZI A;  1P3G A;  3B0C W;  3UTA D;  2ZY4 A;  1BH8 B;  5B1M B;  5F99 B;  5B24 C;  5B2I A;  5B1L D;  3A6N C;  3KFU G;  3W96 D;  3KUY A;  5CP6 A;  3AV1 B;  2NQB B;  4DRB A;  5AV8 B;  3AZJ C;  2HIO A;  4J8W A;  5DNN C;  1A7W A;  1HQ3 D;  3LEL A;  3EPJ A;  3X1V C;  3O62 D;  1W2E A;  4KGC A;  3WKJ A;  3AV2 D;  1P34 D;  3MGR C;  1AOI A;  4QLC A;  3X1U B;  5CPJ B;  1ZLA D;  3LZ1 B;  1P3F C;  5G49 B;  5GT0 D;  3MGS A;  3REI D;  3AZK A;  4WU8 B;  3AZE A;  3MGP B;  1P3O C;  3UT9 D;  3REK C;  4X23 D;  2HUE B;  3AZL C;  2CV5 A;  1P3M B;  3AL0 C;  1KX3 B;  5GSU B;  5AVB B;  4R8P B;  3AZM B;  4CSR A;  5AV5 C;  5B2I D;  3LJA C;  3W98 B;  4CAY A;  3KUY D;  2ZY2 A;  2YFW A;  3REH C;  2NZD A;  2ARO B;  1M19 C;  3WA9 B;  1U35 B;  2HIO D;  5B2J C;  4YM6 C;  4J8W D;  1PZR A;  5B0Z B;  1M18 B;  3LEL D;  5B31 B;  3WAA A;  4LD9 C;  2L5A A;  3MGQ C;  3W97 A;  2F2A C;  2RVQ D;  5FUG A;  1P3P B;  3B6G C;  3REJ A;  5BNV B;  4QLC D;  2F8N G;  3AZF C;  3REL B;  3MVD B;  3MGS D;  1P3A A;  4J8X A;  1P3I A;  1EQZ D;  3B6F C;  3VH6 W;  3AZE D;  1HTA A;  2Y2L A;  3AZN A;  1TZY C;  2JE5 A;  1F66 D;  5B0Y D;  3LZ0 B;  3X1T A;  2PYO C;  4EO5 C;  4Z66 B;  4XUJ A;  5GT3 A;  1P3K C;  1H3O A;  4J8U A;  3AZH C;  5AV9 A;  5B40 A;  1N1J B;  1P3L A;  2Y2K A;  3V9R A;  4NFT A;  1WWS A;  3AN2 B;  2BYM B;  1B67 A;  5BNX B;  3C1C B;  5B31 G;  3WAA D;  2FJ7 A;  5B1M C;  5F99 C;  3W97 D;  2Y2M A;  3AV1 C;  2NQB C;  4Z5T B;  1ID3 B;  3MNN A;  2CWE A;  5JA4 B;  2IO5 B;  5AV8 C;  1T3U A;  5B32 A;  1S32 D;  1P3I D;  5BS7 A;  3B0D B;  3UTA A;  3C1B A;  4UUZ A;  4G92 B;  1P3B D;  5B1L B;  1BH9 B;  3W96 B;  3X1T D;  5CPI A;  3P5J B;  5GT3 D;  4J8U D;  5GXQ B;  3X1U C;  5CPJ C;  2BYK A;  3LZ1 C;  3W99 A;  5E5A A;  1HQ3 B;  4WU8 C;  5KDM B;  3NQJ A;  1KX4 B;  4NE6 A;  5B24 D;  3O62 A;  3MGP C;  3A6N D;  3AFA A;  3AYW B;  1P3L D;  4J8V B;  3VH5 W;  5AY8 A;  2FFF B;  3AV2 A;  4H9N A;  2HUE C;  2XD5 A;  2BG1 A;  4KHA A;  4E44 A;  3AZJ D;  1P3M C;  1KX3 C;  5GSU C;  4R8P C;  5AVB C;  3REI B;  5B33 B;  4YS3 B;  1ZLA A;  1TAF B;  5CPK B;  2FJ7 D;  3KWQ B;  3X1V D;  3W98 C;  3AZH B;  4WNN B;  3UT9 B;  2W8S A;  4X23 B;  3A1K A;  4ZUX B;  5B32 D;  1U35 C;  3UTB A;  5B0Z C;  3AZI B;  1P3G B;  4XZQ A;  1M18 C;  5B31 C;  2JSS A;  1BFM A;  3C1B D;  3R45 A;  4NE3 A;  1P3P C;  4WJ3 C;  2YFV A;  3KUY B;  1P3O D;  5CP6 B;  5CPI D;  3REK D;  3X1S A;  4UPK A;  2HIO B;  4J8W B;  3W99 D;  3REL C;  5E5A D;  3MVD C;  3LEL B;  5DNM A;  5AV5 D;  4NE5 A;  4KGC B;  3LJA D;  3WKJ B;  3AFA D;  5AY8 D;  5AVC A;  3LZ0 C;  3REH D;  1AOI B;  4QLC B;  4Z66 C;  5BT1 C;  1M19 D;  5B2J D;  4YM6 D;  1KX5 A;  4HGA B;  3AZK B;  3VH5 T;  3MGQ D;  3AZE B;  3TU4 A;  1EQZ A;  4H9Q A;  3AV1 A;  1F66 A;  5B0Y A;  3AN2 C;  3FDD A;  3KXB A;  3UTB D;  3C1C C;  4XZQ D;  2CV5 B;  4KUD A;  3AZF D;  3AZG A;  4CSR B;  1M1A A;  3B6F D;  5JRG A;  4H9R A;  4CAY B;  2YFW B;  1F1E A;  1TZY D;  4Z5T C;  3X1S D;  2NZD B;  2IO5 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...