1P34B

Crystallographic studies of nucleosome core particles containing histone 'sin' mutants
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
83
structure length
83
Chain Sequence
KVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Palindromic 146bp Human Alpha-Satellite DNA fragment
publication title Crystal structures of histone Sin mutant nucleosomes reveal altered protein-DNA interactions
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 26
structure length 83
sequence length 83
chains with identical sequence F
ec nomenclature
pdb deposition date 2003-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1p34B00
5B0ZC 5E5AB 4J8VC 1B67A 4QLCB 1P34D 4XZQC 3AZGD 4YM6D 3AYWD 4R8PC 1P3PC 3B6GD 3MGPC 5AVBD 1N1JB 4CSRA 3B6FB 1S32C 1P34A 3MGSB 3X1TC 4J8XD 4YM6A 2F8NB 2LY8A 3MGPA 5B31G 3AYWA 3B6GA 3LZ0D 5B0ZB 3MGQB 4XZQB 1ID3D 3NQUA 1U35D 1KU5A 4R8PB 4J8XA 1P3PB 3REKC 3LZ0A 4H9SC 3AZKD 3W99C 2CV5C 1S32B 3X1TB 5AV6D 1ID3A 5GT3C 1U35A 1KX3C 3W96B 4Z2MH 4H9RB 4H9SA 5BNXB 3W99A 3AZEC 3AZKA 3AZMB 4DRAA 5B0YD 4J8WB 4G92B 4E45A 3AZFD 2CV5B 1R4VA 3LZ1C 5C3IC 3X1UC 5B0YA 5GT3B 1KX3B 1AOID 3V9RB 1P3ID 3UT9D 3MGRD 3MVDD 4HGAC 3AZEB 3AZNC 3AZFA 3AZID 3AZLD 3X1UA 3RELC 3C1BD 1BH8A 4XUJC 1M19D 2FJ7D 2RVQC 4X23B 3C1CD 5KDMB 1P3IA 3LZ1B 3UT9A 5C3IB 5B32B 2CWEA 3TU4C 4M6BA 4XUJA 4ZUXD 2HIOB 3AZLA 3KWQA 3C1BA 2JSSA 4LD9C 1M19A 4KUDD 3LJAB 2FJ7A 5B24C 3A6NB 1JFIA 4UUZB 4NE5A 3C1CA 4HGAB 3AZNB 1P3BB 3AN2B 5CPJD 3WA9C 4ZUXA 4Z66B 2NZDD 3UTAD 4KUDA 3X1VD 1TAFA 4G91C 5AVCD 4J8UD 5AV5C 3AFAC 5AV9C 4JJNC 3KUYC 1P3AC 1P3MB 4KGCD 5CPJA 4LD9B 3UTAA 3X1VA 3AZJC 1EQZD 5G49A 3REJC 5AVCA 3VH5A 3KSYA 4J8UA 3WA9B 5DNMB 1TZYB 4KGCA 1P3KD 4H9NA 5BNVA 3AZJA 4G91B 4AWLC 1P3GC 5E5AD 3LELC 3R45B 3AZHB 5AV5B 2AROB 4QLCD 1P3LC 1EQZA 3AFAB 5AV9B 1P3KA 3AV1C 1P3FD 4Z5TB 5E5AA 1ZLAD 4QLCA 3B6FD 5AY8D 1HTAA 3NQJB 2F8ND 3MGSC 5CP6D 5F99C 5B0ZD 3LELB 4J8VD 3REIB 4WV4B 1P3FA 1N1JA 3VH5W 4XZQD 3MGQC 1ZLAA 3B6FA 5AY8A 5CPKC 5B2IB 4R8PD 1P3PD 3WTPB 3O62B 3MGPD 1KX5B 5JRGB 2F8NA 2BYKB 3AV1B 3B0DC 5B1LC 5CP6A 3UTBB 5GSUC 5B0ZA 4J8VA 5B2JB 1M1AB 5B1MB 1S32D 3X1TD 4XZQA 2NQBC 2PYOB 3KXBC 4CAYB 1P3PA 4R8PA 5F99B 3W97B 3W96C 5FUGB 3WKJB 1S32A 5CPKB 3X1TA 3AZMC 3REKD 3WAAB 3B0DB 5B1LB 3W96A 5GSUB 4J8WC 3AZGC 4H9RA 4G92C 3W99D 2CV5D 1BH9B 3B0BA 2NQBB 4WU9B 3KXBB 5DNNB 4WNNB 5GT3D 1KX3D 5BO0A 3REKA 1M18C 2YFWB 2F8NG 3AZED 2CV5A 3VH6W 5GT3A 1P34B 1KX3A 4X23C 3V9RA 3AZGB 3LZ1D 3AYWB 3AZEA 3X1UD 4H9QB 5AVBB 5B32C 4H9OB 2HIOC 1M18B 3LJAC 5GT0C 3AZND 5KDMA 3A6NC 1H3OB 1F1EA 3LZ1A 2HUEB 5CPIC 3RELD 5B32A 3LZ0B 4XUJD 1P3BC 2HIOA 3KWQD 2RVQD 3AN2C 1F66C 4NE3A 4Z66C 1ID3B 3LJAA 3A6NA 4UUZA 2F8NK 3AZNA 3TU4D 3RELA 3AN2A 4KHAB 4LD9D 1P3MC 5B24D 5AV6B 5GT0B 5CPIB 3TU4A 3WA9D 2F8NH 1P3MA 1F66B 5DNMC 5AV8C 4LD9A 1TZYC 3AZIC 5B24A 2L5AA 3X1SC 5AV5D 3AFAD 5AV9D 4JJND 3KUYD 1P3AD 3AZHC 2AROC 3WA9A 3AZJD 3REJD 5JA4B 1AOIB 3R45A 3AV2C 5AV5A 4Z5TC 3AFAA 5AV9A 4JJNA 2BYMB 3KUYA 3MGRB 5BT1C 1P3AA 3MVDB 5AV8B 1WWSA 3AZIB 1A7WA 3AZLB 5B40C 3X1SB 1P3GD 3LELD 4E44A 2FJ7B 1P3LD 4ZBJB 3REJA 3REIC 5B33C 5B2IC 3AV1D 4ZUXB 3WTPC 3O62C 1KX5C 4H9PB 5JRGC 1P3GA 3LELA 3UTBC 1KX4C 3AV2B 1P3LA 5B2JC 1TAFB 1M1AC 5B1MC 4YS3C 3MGSD 1KX5A 5B40B 5F99D 3WTPA 2PYOC 5JRGA 2BYKA 5B31C 3MNNC 3AV1A 3W98C 1HQ3C 3W97C 2NZDB 5B33B 3MGQD 1M1AA 3WKJC 5CPKD 4WU8C 2PYOA 3MGSA 3REHC 4CAYA 5B1LD 5F99A 5GSUD 3WAAC 3W97A 1P3OC 4H9NB 5GXQC 1KX4B 5FUGA 2NQBD 3MGQA 4YS3B 3KXBD 5CPKA 1EQZB 4WU9C 5DNNC 3VH6A 3MNNB 5B31B 3W98B 3W96D 5B1LA 5GSUA 1HQ3B 3B0CW 1BH9A 3AZMD 2NQBA 4WU8B 4WU9A 4EO5C 5DNNA 3KXBA 4WNNA 3REHB 4J8WD 1P34C 2YFVB 5GXQB 1P3OB 2YFWA 4YM6C 5BNXA 3AYWC 3B6GC 1P3FB 3AZMA 5AVBC 1ZLAB 5AY8B 1M18D 4J8WA 3AZGA 4DRBA 4J8XC 5CP6B 5BS7C 4J8VB 2HUEC 4H9QA 5AVBA 4EO5B 3LZ0C 4H9OA 4CSRB 4X23D 1M18A 1ID3C 4YM6B 1WWIA 3MGPB 5BS7A 1H3OA 1U35C 3B6GB 5B32D 2HIOD 3AZKC 3LJAD 5GT0D 4X23A 3NQUB 3A6ND 5AV6C 2IO5C 4J8XB 5CPID 1P3BD 3AN2D 1F66D 4KHAA 4Z66D 3VH5T 5AV6A 5GT0A 5BO0B 5B0YC 3REKB 1U35B 5CPIA 1P3BA 1P3MD 3W99B 4NFTA 1F66A 3AZFC 3AZKB 4Z66A 2IO5B 1AOIC 3B0CT 5DNMD 5AV8D 1P3IC 1TZYD 3UT9C 3MGRC 3MVDC 3X1SD 4WZSB 3AZLC 5B0YB 3KWQC 3C1BC 1M19C 5JA4A 3AZHD 2AROD 1AOIA 4ZBJC 2FJ7C 2BYMA 3C1CC 3MGRA 5DNMA 5AV8A 3MVDA 3AZFB 1TZYA 3X1UB 3AZIA 5B32G 1BH8B 3X1SA 1B6WA 4ZUXC 3AV2D 4Z5TD 4KUDC 1BFMA 3AZHA 2AROA 5BT1D 1P3IB 3UT9B 5B40D 3RELB 4XUJB 3KWQB 3C1BB 4H9PA 5CPJC 3VH6T 3REID 1M19B 5B33D 3AV2A 1JFIB 2NZDC 4Z5TA 3UTAC 3X1VC 3C1CB 3TU4B 5B2ID 1KX5D 3NQJA 4NE6A 5AVCC 5B40A 3WTPD 5JRGD 3O62D 4J8UC 3UTBD 1KX4D 4KGCC 3WTPE 5B24B 3REIA 5CHLB 5B2JD 1M1AD 5B33A 4KUDB 5B1MD 1ULYA 4YS3D 2NZDA 2PYOD 1EQZC 3MNND 5B31D 5B2IA 3W98D 3O62A 5CPJB 1HQ3D 3W97D 3UTBA 1KX4A 3WKJD 3UTAB 1P3KC 5B2JA 3X1VB 4WU8D 5B1MA 4YS3A 5G49B 3REHD 5AVCB 5E5AC 4JJNB 3KUYB 4J8UB 1P3AB 4QLCC 3WAAD 3MNNA 5B31A 3W98A 1P3OD 5GXQD 4KGCB 1HQ3A 3WKJA 5BNVB 3AZJB 1Q9CA 3REJB 4WU8A 4WU9D 1P3FC 5DNND 3REHA 1ZLAC 4Z2MG 3B6FC 3WAAA 5AY8C 2YFVA 5GXQA 1P3OA 1P3KB 1P3GB 4AWLB 5CP6C 1P3LB
chains in the Genus database with same CATH superfamily
5B0ZC 5E5AB 4J8VC 3H0MC 1B67A 4QLCB 1P34D 2W8SA 4XZQC 3AZGD 4YM6D 3AYWD 4R8PC 1P3PC 3B6GD 3MGPC 5AVBD 1N1JB 4CSRA 3B6FB 1S32C 1P34A 3MGSB 3X1TC 4J8XD 4YM6A 4DQYB 2F8NB 2LY8A 3MGPA 5B31G 3AYWA 3B6GA 3LZ0D 5B0ZB 3MGQB 4XZQB 1ID3D 3NQUA 1U35D 1KU5A 4R8PB 4J8XA 1P3PB 3REKC 3LZ0A 3EPLA 4H9SC 3AZKD 2Y2LA 3W99C 2CV5C 1S32B 3X1TB 5AV6D 1ID3A 5GT3C 1U35A 1KX3C 3W96B 4Z2MH 4H9RB 4H9SA 5BNXB 3W99A 3AZEC 3AZKA 3AZMB 4DRAA 5B0YD 4J8WB 4G92B 4E45A 3AZFD 2CV5B 1R4VA 3LZ1C 5C3IC 3X1UC 5B0YA 5GT3B 1KX3B 1AOID 3V9RB 2JE5A 1P3ID 3UT9D 3MGRD 3MVDD 4HGAC 3AZEB 3AZNC 3AZFA 3AZID 3AZLD 3X1UA 2Y2OA 3RELC 3C1BD 1BH8A 4XUJC 1M19D 2FJ7D 2RVQC 2XD5A 4X23B 3C1CD 5KDMB 1P3IA 3LZ1B 3UT9A 5C3IB 5B32B 2CWEA 3TU4C 4M6BA 4XUJA 4ZUXD 2HIOB 3AZLA 3KWQA 3C1BA 2JSSA 4LD9C 1M19A 4KUDD 3LJAB 2FJ7A 5B24C 3A6NB 1JFIA 4UUZB 4NE5A 3C1CA 4HGAB 3AZNB 1P3BB 3AN2B 5CPJD 3WA9C 4ZUXA 4Z66B 2NZDD 3UTAD 4KUDA 3X1VD 3H0RC 1TAFA 4G91C 5AVCD 4J8UD 5AV5C 3AFAC 5AV9C 4JJNC 3KUYC 1P3AC 1P3MB 2G5HC 1W2EA 5CPJA 4KGCD 4LD9B 3UTAA 3X1VA 3AZJC 1EQZD 5G49A 3REJC 5AVCA 3VH5A 3KSYA 4J8UA 3WA9B 5DNMB 1TZYB 4KGCA 1P3KD 4H9NA 2RIQA 5BNVA 3AZJA 4G91B 4AWLC 1P3GC 5E5AD 3LELC 3R45B 3AZHB 2AROB 4QLCD 5AV5B 1P3LC 1EQZA 3AFAB 5AV9B 1P3KA 3AV1C 1P3FD 4Z5TB 5E5AA 1ZLAD 4QLCA 3B6FD 5AY8D 1HTAA 4WJ3C 3NQJB 2F8ND 3MGSC 5CP6D 5F99C 5B0ZD 3LELB 4J8VD 3REIB 4WV4B 1P3FA 1N1JA 3VH5W 4XZQD 3MGQC 1ZLAA 3B6FA 5AY8A 5CPKC 5B2IB 4R8PD 1P3PD 3WTPB 3O62B 3MGPD 1KX5B 5JRGB 2F8NA 2BYKB 3AV1B 3B0DC 5B1LC 5CP6A 3UTBB 5GSUC 5B0ZA 4J8VA 5B2JB 1M1AB 5B1MB 1S32D 3X1TD 4XZQA 2NQBC 2PYOB 3KXBC 4CAYB 1P3PA 4R8PA 5F99B 3W97B 3W96C 3A1KA 5FUGB 3WKJB 1S32A 5CPKB 3X1TA 3AZMC 3REKD 3WAAB 3B0DB 5B1LB 3A1IA 3W96A 5GSUB 4J8WC 3AZGC 4H9RA 4G92C 3W99D 2CV5D 1BH9B 3B0BA 2NQBB 4WU9B 3KXBB 5DNNB 4WNNB 5GT3D 1KX3D 2Y2QA 5BO0A 3REKA 1M18C 2YFWB 2G5IC 2ZY4A 2F8NG 3AZED 3P5JB 2CV5A 3VH6W 2BG1A 2ZY2A 5GT3A 1P34B 1KX3A 4X23C 3V9RA 3AZGB 3LZ1D 3AYWB 3AZEA 3X1UD 4H9QB 5AVBB 5B32C 4H9OB 2HIOC 2J8PA 1M18B 3LJAC 5GT0C 3AZND 5KDMA 3A6NC 1H3OB 2Y2GA 1F1EA 3LZ1A 2HUEB 5CPIC 3RELD 5B32A 3LZ0B 4XUJD 1P3BC 2HIOA 3KWQD 2RVQD 3AN2C 1F66C 4NE3A 4Z66C 1ID3B 3LJAA 3A6NA 4UUZA 2F8NK 3AZNA 3TU4D 3RELA 3AN2A 4KHAB 4LD9D 1P3MC 5B24D 2Y2MA 5AV6B 5GT0B 5CPIB 2VQRA 3TU4A 3WA9D 2F8NH 1P3MA 1F66B 5DNMC 5AV8C 4LD9A 1TZYC 3AZIC 5B24A 2L5AA 3X1SC 5AV5D 3AFAD 5AV9D 4JJND 3KUYD 1P3AD 3AZHC 2AROC 3EPHA 3WA9A 2ZY3A 3EPJA 2Y2HA 2JCHA 4UPKA 3AZJD 3REJD 5JA4B 1AOIB 3R45A 3AV2C 5AV5A 4Z5TC 3AFAA 5AV9A 4JJNA 2BYMB 3KUYA 3MGRB 5BT1C 1P3AA 3MVDB 5AV8B 1WWSA 3AZIB 1A7WA 3AZLB 5B40C 3X1SB 1P3GD 3LELD 4E44A 2FJ7B 1P3LD 4ZBJB 3REJA 3REIC 5B33C 5B2IC 3AV1D 4ZUXB 3WTPC 3O62C 1KX5C 4H9PB 5JRGC 1P3GA 3LELA 3UTBC 1KX4C 3AV2B 2FFFB 1P3LA 3H0LC 5B2JC 1TAFB 1M1AC 5B1MC 4YS3C 3MGSD 1KX5A 5B40B 5F99D 3WTPA 2PYOC 5JRGA 2BYKA 5B31C 3MNNC 3AV1A 3W98C 1HQ3C 3W97C 2NZDB 5B33B 3MGQD 1M1AA 3WKJC 5CPKD 4WU8C 2PYOA 3MGSA 3REHC 4CAYA 5B1LD 5F99A 5GSUD 3WAAC 3W97A 1P3OC 4H9NB 1T3UA 5GXQC 1KX4B 5FUGA 2NQBD 3MGQA 4YS3B 3KXBD 5CPKA 1EQZB 4WU9C 5DNNC 3VH6A 3MNNB 5B31B 3W98B 3W96D 3AL0C 5B1LA 3EG5B 5GSUA 1HQ3B 3B0CW 1BH9A 2XD1A 3AZMD 2NQBA 4WU8B 4WU9A 4EO5C 5DNNA 3KXBA 4WNNA 3REHB 2DF4C 4J8WD 1P34C 2YFVB 5GXQB 1P3OB 2YFWA 4YM6C 5BNXA 3AYWC 3B6GC 1P3FB 3AZMA 5AVBC 1ZLAB 5AY8B 1M18D 2Y2KA 4J8WA 3AZGA 3KFUG 4DRBA 4J8XC 5CP6B 5BS7C 4J8VB 2HUEC 4H9QA 5AVBA 4EO5B 3LZ0C 4H9OA 4CSRB 2ZM5A 4X23D 1M18A 1ID3C 4YM6B 1WWIA 3MGPB 5BS7A 1H3OA 1U35C 3B6GB 5B32D 2HIOD 2Y2NA 3AZKC 3LJAD 5GT0D 4X23A 3NQUB 3A6ND 5AV6C 2IO5C 4J8XB 2UWXA 5CPID 1P3BD 3AN2D 1F66D 4KHAA 4Z66D 3VH5T 5AV6A 5GT0A 5BO0B 5B0YC 3REKB 1U35B 5CPIA 2Y2IA 3IP4C 1P3BA 1P3MD 3W99B 4NFTA 1F66A 3AZFC 3AZKB 4Z66A 3FDDA 2IO5B 1AOIC 3B0CT 5DNMD 5AV8D 1P3IC 1PZRA 1TZYD 3UT9C 3MGRC 3MVDC 3X1SD 4WZSB 3AZLC 3F6TA 5B0YB 3KWQC 3C1BC 1M19C 5JA4A 3AZHD 2AROD 1AOIA 4ZBJC 2FJ7C 2BYMA 3C1CC 3MGRA 5DNMA 5AV8A 3MVDA 3AZFB 1TZYA 3X1UB 3AZIA 5B32G 1BH8B 1Z2CB 3X1SA 1B6WA 4ZUXC 3AV2D 4Z5TD 4KUDC 1BFMA 3AZHA 2AROA 5BT1D 1P3IB 3UT9B 2Y2PA 5B40D 3RELB 4XUJB 3KWQB 3C1BB 4H9PA 5CPJC 3VH6T 3REID 1M19B 5B33D 3AV2A 1JFIB 2NZDC 4Z5TA 3UTAC 2ZY5A 3X1VC 3C1CB 3TU4B 5B2ID 1KX5D 3NQJA 2DQNC 4NE6A 5B40A 5AVCC 5JRGD 3WTPD 3O62D 4J8UC 3UTBD 1KX4D 4KGCC 3WTPE 5B24B 3REIA 5CHLB 5B2JD 1M1AD 5B33A 4KUDB 5B1MD 1ULYA 4YS3D 2NZDA 2PYOD 1EQZC 3MNND 5B31D 5B2IA 3W98D 3O62A 2Y2JA 5CPJB 1HQ3D 3W97D 3UTBA 1KX4A 3WKJD 3UTAB 1P3KC 5B2JA 3X1VB 4WU8D 5B1MA 4YS3A 5G49B 3REHD 5AVCB 5E5AC 4JJNB 3KUYB 4J8UB 1P3AB 4QLCC 3WAAD 3MNNA 5B31A 3W98A 1P3OD 5GXQD 4KGCB 1HQ3A 2F2AC 3WKJA 5BNVB 3AZJB 1Q9CA 3REJB 4WU8A 4WU9D 1P3FC 5DNND 3REHA 1ZLAC 4Z2MG 3B6FC 3WAAA 5AY8C 2YFVA 5GXQA 1P3OA 3EPKA 1P3KB 1P3GB 4AWLB 5CP6C 1P3LB
chains in the Genus database with same CATH topology
5B0ZC 5E5AB 4J8VC 3H0MC 1B67A 4QLCB 1P34D 2W8SA 4XZQC 3AZGD 4YM6D 3AYWD 4R8PC 1P3PC 3B6GD 3MGPC 5AVBD 1N1JB 4CSRA 3B6FB 1S32C 1P34A 3MGSB 3X1TC 4J8XD 4YM6A 4DQYB 2F8NB 2LY8A 3MGPA 5B31G 3AYWA 3B6GA 3LZ0D 5B0ZB 3MGQB 4XZQB 1ID3D 3NQUA 1U35D 1KU5A 4R8PB 4J8XA 1P3PB 3REKC 3LZ0A 3EPLA 4H9SC 3AZKD 2Y2LA 3W99C 2CV5C 1S32B 3X1TB 5AV6D 1ID3A 5GT3C 1U35A 1KX3C 3W96B 4Z2MH 4H9RB 4H9SA 5BNXB 3W99A 3AZEC 3AZKA 3AZMB 4DRAA 5B0YD 4J8WB 4G92B 4E45A 3AZFD 2CV5B 1R4VA 3LZ1C 5C3IC 3X1UC 5B0YA 5GT3B 1KX3B 1AOID 3V9RB 2JE5A 1P3ID 3UT9D 3MGRD 3MVDD 4HGAC 3AZEB 3AZNC 3AZFA 3AZID 3AZLD 3X1UA 2Y2OA 3RELC 3C1BD 1BH8A 4XUJC 1M19D 2FJ7D 2RVQC 2XD5A 4X23B 3C1CD 5KDMB 1P3IA 3LZ1B 3UT9A 5C3IB 5B32B 2CWEA 3TU4C 4M6BA 4XUJA 4ZUXD 2HIOB 3AZLA 3KWQA 3C1BA 2JSSA 4LD9C 1M19A 4KUDD 3LJAB 2FJ7A 5B24C 3A6NB 1JFIA 4UUZB 4NE5A 3C1CA 4HGAB 3AZNB 1P3BB 3AN2B 5CPJD 3WA9C 4ZUXA 4Z66B 2NZDD 3UTAD 4KUDA 3X1VD 3H0RC 1TAFA 4G91C 5AVCD 4J8UD 5AV5C 3AFAC 5AV9C 4JJNC 3KUYC 1P3AC 1P3MB 2G5HC 1W2EA 5CPJA 4KGCD 4LD9B 3UTAA 3X1VA 3AZJC 1EQZD 5G49A 3REJC 5AVCA 3VH5A 3KSYA 4J8UA 3WA9B 5DNMB 1TZYB 4KGCA 1P3KD 4H9NA 2RIQA 5BNVA 3AZJA 4G91B 4AWLC 1P3GC 5E5AD 3LELC 3R45B 3AZHB 2AROB 4QLCD 5AV5B 1P3LC 1EQZA 3AFAB 5AV9B 1P3KA 3AV1C 1P3FD 4Z5TB 5E5AA 1ZLAD 4QLCA 3B6FD 5AY8D 1HTAA 4WJ3C 3NQJB 2F8ND 3MGSC 5CP6D 5F99C 5B0ZD 3LELB 4J8VD 3REIB 4WV4B 1P3FA 1N1JA 3VH5W 4XZQD 3MGQC 1ZLAA 3B6FA 5AY8A 5CPKC 5B2IB 4R8PD 1P3PD 3WTPB 3O62B 3MGPD 1KX5B 5JRGB 2F8NA 2BYKB 3AV1B 3B0DC 5B1LC 5CP6A 3UTBB 5GSUC 5B0ZA 4J8VA 5B2JB 1M1AB 5B1MB 1S32D 3X1TD 4XZQA 2NQBC 2PYOB 3KXBC 4CAYB 1P3PA 4R8PA 5F99B 3W97B 3W96C 3A1KA 5FUGB 3WKJB 1S32A 5CPKB 3X1TA 3AZMC 3REKD 3WAAB 3B0DB 5B1LB 3A1IA 3W96A 5GSUB 4J8WC 3AZGC 4H9RA 4G92C 3W99D 2CV5D 1BH9B 3B0BA 2NQBB 4WU9B 3KXBB 5DNNB 4WNNB 5GT3D 1KX3D 2Y2QA 5BO0A 3REKA 1M18C 2YFWB 2G5IC 2ZY4A 2F8NG 3AZED 3P5JB 2CV5A 3VH6W 2BG1A 2ZY2A 5GT3A 1P34B 1KX3A 4X23C 3V9RA 3AZGB 3LZ1D 3AYWB 3AZEA 3X1UD 4H9QB 5AVBB 5B32C 4H9OB 2HIOC 2J8PA 1M18B 3LJAC 5GT0C 3AZND 5KDMA 3A6NC 1H3OB 2Y2GA 1F1EA 3LZ1A 2HUEB 5CPIC 3RELD 5B32A 3LZ0B 4XUJD 1P3BC 2HIOA 3KWQD 2RVQD 3AN2C 1F66C 4NE3A 4Z66C 1ID3B 3LJAA 3A6NA 4UUZA 2F8NK 3AZNA 3TU4D 3RELA 3AN2A 4KHAB 4LD9D 1P3MC 5B24D 2Y2MA 5AV6B 5GT0B 5CPIB 2VQRA 3TU4A 3WA9D 2F8NH 1P3MA 1F66B 5DNMC 5AV8C 4LD9A 1TZYC 3AZIC 5B24A 2L5AA 3X1SC 5AV5D 3AFAD 5AV9D 4JJND 3KUYD 1P3AD 3AZHC 2AROC 3EPHA 3WA9A 2ZY3A 3EPJA 2Y2HA 2JCHA 4UPKA 3AZJD 3REJD 5JA4B 1AOIB 3R45A 3AV2C 5AV5A 4Z5TC 3AFAA 5AV9A 4JJNA 2BYMB 3KUYA 3MGRB 5BT1C 1P3AA 3MVDB 5AV8B 1WWSA 3AZIB 1A7WA 3AZLB 5B40C 3X1SB 1P3GD 3LELD 4E44A 2FJ7B 1P3LD 4ZBJB 3REJA 3REIC 5B33C 5B2IC 3AV1D 4ZUXB 3WTPC 3O62C 1KX5C 4H9PB 5JRGC 1P3GA 3LELA 3UTBC 1KX4C 3AV2B 2FFFB 1P3LA 3H0LC 5B2JC 1TAFB 1M1AC 5B1MC 4YS3C 3MGSD 1KX5A 5B40B 5F99D 3WTPA 2PYOC 5JRGA 2BYKA 5B31C 3MNNC 3AV1A 3W98C 1HQ3C 3W97C 2NZDB 5B33B 3MGQD 1M1AA 3WKJC 5CPKD 4WU8C 2PYOA 3MGSA 3REHC 4CAYA 5B1LD 5F99A 5GSUD 3WAAC 3W97A 1P3OC 4H9NB 1T3UA 5GXQC 1KX4B 5FUGA 2NQBD 3MGQA 4YS3B 3KXBD 5CPKA 1EQZB 4WU9C 5DNNC 3VH6A 3MNNB 5B31B 3W98B 3W96D 3AL0C 5B1LA 3EG5B 5GSUA 1HQ3B 3B0CW 1BH9A 2XD1A 3AZMD 2NQBA 4WU8B 4WU9A 4EO5C 5DNNA 3KXBA 4WNNA 3REHB 2DF4C 4J8WD 1P34C 2YFVB 5GXQB 1P3OB 2YFWA 4YM6C 5BNXA 3AYWC 3B6GC 1P3FB 3AZMA 5AVBC 1ZLAB 5AY8B 1M18D 2Y2KA 4J8WA 3AZGA 3KFUG 4DRBA 4J8XC 5CP6B 5BS7C 4J8VB 2HUEC 4H9QA 5AVBA 4EO5B 3LZ0C 4H9OA 4CSRB 2ZM5A 4X23D 1M18A 1ID3C 4YM6B 1WWIA 3MGPB 5BS7A 1H3OA 1U35C 3B6GB 5B32D 2HIOD 2Y2NA 3AZKC 3LJAD 5GT0D 4X23A 3NQUB 3A6ND 5AV6C 2IO5C 4J8XB 2UWXA 5CPID 1P3BD 3AN2D 1F66D 4KHAA 4Z66D 3VH5T 5AV6A 5GT0A 5BO0B 5B0YC 3REKB 1U35B 5CPIA 2Y2IA 3IP4C 1P3BA 1P3MD 3W99B 4NFTA 1F66A 3AZFC 3AZKB 4Z66A 3FDDA 2IO5B 1AOIC 3B0CT 5DNMD 5AV8D 1P3IC 1PZRA 1TZYD 3UT9C 3MGRC 3MVDC 3X1SD 4WZSB 3AZLC 3F6TA 5B0YB 3KWQC 3C1BC 1M19C 5JA4A 3AZHD 2AROD 1AOIA 4ZBJC 2FJ7C 2BYMA 3C1CC 3MGRA 5DNMA 5AV8A 3MVDA 3AZFB 1TZYA 3X1UB 3AZIA 5B32G 1BH8B 1Z2CB 3X1SA 1B6WA 4ZUXC 3AV2D 4Z5TD 4KUDC 1BFMA 3AZHA 2AROA 5BT1D 1P3IB 3UT9B 2Y2PA 5B40D 3RELB 4XUJB 3KWQB 3C1BB 4H9PA 5CPJC 3VH6T 3REID 1M19B 5B33D 3AV2A 1JFIB 2NZDC 4Z5TA 3UTAC 2ZY5A 3X1VC 3C1CB 3TU4B 5B2ID 1KX5D 3NQJA 2DQNC 4NE6A 5B40A 5AVCC 5JRGD 3WTPD 3O62D 4J8UC 3UTBD 1KX4D 4KGCC 3WTPE 5B24B 3REIA 5CHLB 5B2JD 1M1AD 5B33A 4KUDB 5B1MD 1ULYA 4YS3D 2NZDA 2PYOD 1EQZC 3MNND 5B31D 5B2IA 3W98D 3O62A 2Y2JA 5CPJB 1HQ3D 3W97D 3UTBA 1KX4A 3WKJD 3UTAB 1P3KC 5B2JA 3X1VB 4WU8D 5B1MA 4YS3A 5G49B 3REHD 5AVCB 5E5AC 4JJNB 3KUYB 4J8UB 1P3AB 4QLCC 3WAAD 3MNNA 5B31A 3W98A 1P3OD 5GXQD 4KGCB 1HQ3A 2F2AC 3WKJA 5BNVB 3AZJB 1Q9CA 3REJB 4WU8A 4WU9D 1P3FC 5DNND 3REHA 1ZLAC 4Z2MG 3B6FC 3WAAA 5AY8C 2YFVA 5GXQA 1P3OA 3EPKA 1P3KB 1P3GB 4AWLB 5CP6C 1P3LB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5B0Z C;  5E5A B;  4J8V C;  1B67 A;  4QLC B;  1P34 D;  4XZQ C;  3AZG D;  4YM6 D;  3AYW D;  4R8P C;  1P3P C;  3B6G D;  3MGP C;  5AVB D;  1N1J B;  4CSR A;  3B6F B;  1S32 C;  1P34 A;  3MGS B;  3X1T C;  4J8X D;  4YM6 A;  2F8N B;  2LY8 A;  3MGP A;  5B31 G;  3AYW A;  3B6G A;  3LZ0 D;  5B0Z B;  3MGQ B;  4XZQ B;  1ID3 D;  3NQU A;  1U35 D;  1KU5 A;  4R8P B;  4J8X A;  1P3P B;  3REK C;  3LZ0 A;  4H9S C;  3AZK D;  3W99 C;  2CV5 C;  1S32 B;  3X1T B;  5AV6 D;  1ID3 A;  5GT3 C;  1U35 A;  1KX3 C;  3W96 B;  4Z2M H;  4H9R B;  4H9S A;  5BNX B;  3W99 A;  3AZE C;  3AZK A;  3AZM B;  4DRA A;  5B0Y D;  4J8W B;  4G92 B;  4E45 A;  3AZF D;  2CV5 B;  1R4V A;  3LZ1 C;  5C3I C;  3X1U C;  5B0Y A;  5GT3 B;  1KX3 B;  1AOI D;  3V9R B;  1P3I D;  3UT9 D;  3MGR D;  3MVD D;  4HGA C;  3AZE B;  3AZN C;  3AZF A;  3AZI D;  3AZL D;  3X1U A;  3REL C;  3C1B D;  1BH8 A;  4XUJ C;  1M19 D;  2FJ7 D;  2RVQ C;  4X23 B;  3C1C D;  5KDM B;  1P3I A;  3LZ1 B;  3UT9 A;  5C3I B;  5B32 B;  2CWE A;  3TU4 C;  4M6B A;  4XUJ A;  4ZUX D;  2HIO B;  3AZL A;  3KWQ A;  3C1B A;  2JSS A;  4LD9 C;  1M19 A;  4KUD D;  3LJA B;  2FJ7 A;  5B24 C;  3A6N B;  1JFI A;  4UUZ B;  4NE5 A;  3C1C A;  4HGA B;  3AZN B;  1P3B B;  3AN2 B;  5CPJ D;  3WA9 C;  4ZUX A;  4Z66 B;  2NZD D;  3UTA D;  4KUD A;  3X1V D;  1TAF A;  4G91 C;  5AVC D;  4J8U D;  5AV5 C;  3AFA C;  5AV9 C;  4JJN C;  3KUY C;  1P3A C;  1P3M B;  4KGC D;  5CPJ A;  4LD9 B;  3UTA A;  3X1V A;  3AZJ C;  1EQZ D;  5G49 A;  3REJ C;  5AVC A;  3VH5 A;  3KSY A;  4J8U A;  3WA9 B;  5DNM B;  1TZY B;  4KGC A;  1P3K D;  4H9N A;  5BNV A;  3AZJ A;  4G91 B;  4AWL C;  1P3G C;  5E5A D;  3LEL C;  3R45 B;  3AZH B;  5AV5 B;  2ARO B;  4QLC D;  1P3L C;  1EQZ A;  3AFA B;  5AV9 B;  1P3K A;  3AV1 C;  1P3F D;  4Z5T B;  5E5A A;  1ZLA D;  4QLC A;  3B6F D;  5AY8 D;  1HTA A;  3NQJ B;  2F8N D;  3MGS C;  5CP6 D;  5F99 C;  5B0Z D;  3LEL B;  4J8V D;  3REI B;  4WV4 B;  1P3F A;  1N1J A;  3VH5 W;  4XZQ D;  3MGQ C;  1ZLA A;  3B6F A;  5AY8 A;  5CPK C;  5B2I B;  4R8P D;  1P3P D;  3WTP B;  3O62 B;  3MGP D;  1KX5 B;  5JRG B;  2F8N A;  2BYK B;  3AV1 B;  3B0D C;  5B1L C;  5CP6 A;  3UTB B;  5GSU C;  5B0Z A;  4J8V A;  5B2J B;  1M1A B;  5B1M B;  1S32 D;  3X1T D;  4XZQ A;  2NQB C;  2PYO B;  3KXB C;  4CAY B;  1P3P A;  4R8P A;  5F99 B;  3W97 B;  3W96 C;  5FUG B;  3WKJ B;  1S32 A;  5CPK B;  3X1T A;  3AZM C;  3REK D;  3WAA B;  3B0D B;  5B1L B;  3W96 A;  5GSU B;  4J8W C;  3AZG C;  4H9R A;  4G92 C;  3W99 D;  2CV5 D;  1BH9 B;  3B0B A;  2NQB B;  4WU9 B;  3KXB B;  5DNN B;  4WNN B;  5GT3 D;  1KX3 D;  5BO0 A;  3REK A;  1M18 C;  2YFW B;  2F8N G;  3AZE D;  2CV5 A;  3VH6 W;  5GT3 A;  1P34 B;  1KX3 A;  4X23 C;  3V9R A;  3AZG B;  3LZ1 D;  3AYW B;  3AZE A;  3X1U D;  4H9Q B;  5AVB B;  5B32 C;  4H9O B;  2HIO C;  1M18 B;  3LJA C;  5GT0 C;  3AZN D;  5KDM A;  3A6N C;  1H3O B;  1F1E A;  3LZ1 A;  2HUE B;  5CPI C;  3REL D;  5B32 A;  3LZ0 B;  4XUJ D;  1P3B C;  2HIO A;  3KWQ D;  2RVQ D;  3AN2 C;  1F66 C;  4NE3 A;  4Z66 C;  1ID3 B;  3LJA A;  3A6N A;  4UUZ A;  2F8N K;  3AZN A;  3TU4 D;  3REL A;  3AN2 A;  4KHA B;  4LD9 D;  1P3M C;  5B24 D;  5AV6 B;  5GT0 B;  5CPI B;  3TU4 A;  3WA9 D;  2F8N H;  1P3M A;  1F66 B;  5DNM C;  5AV8 C;  4LD9 A;  1TZY C;  3AZI C;  5B24 A;  2L5A A;  3X1S C;  5AV5 D;  3AFA D;  5AV9 D;  4JJN D;  3KUY D;  1P3A D;  3AZH C;  2ARO C;  3WA9 A;  3AZJ D;  3REJ D;  5JA4 B;  1AOI B;  3R45 A;  3AV2 C;  5AV5 A;  4Z5T C;  3AFA A;  5AV9 A;  4JJN A;  2BYM B;  3KUY A;  3MGR B;  5BT1 C;  1P3A A;  3MVD B;  5AV8 B;  1WWS A;  3AZI B;  1A7W A;  3AZL B;  5B40 C;  3X1S B;  1P3G D;  3LEL D;  4E44 A;  2FJ7 B;  1P3L D;  4ZBJ B;  3REJ A;  3REI C;  5B33 C;  5B2I C;  3AV1 D;  4ZUX B;  3WTP C;  3O62 C;  1KX5 C;  4H9P B;  5JRG C;  1P3G A;  3LEL A;  3UTB C;  1KX4 C;  3AV2 B;  1P3L A;  5B2J C;  1TAF B;  1M1A C;  5B1M C;  4YS3 C;  3MGS D;  1KX5 A;  5B40 B;  5F99 D;  3WTP A;  2PYO C;  5JRG A;  2BYK A;  5B31 C;  3MNN C;  3AV1 A;  3W98 C;  1HQ3 C;  3W97 C;  2NZD B;  5B33 B;  3MGQ D;  1M1A A;  3WKJ C;  5CPK D;  4WU8 C;  2PYO A;  3MGS A;  3REH C;  4CAY A;  5B1L D;  5F99 A;  5GSU D;  3WAA C;  3W97 A;  1P3O C;  4H9N B;  5GXQ C;  1KX4 B;  5FUG A;  2NQB D;  3MGQ A;  4YS3 B;  3KXB D;  5CPK A;  1EQZ B;  4WU9 C;  5DNN C;  3VH6 A;  3MNN B;  5B31 B;  3W98 B;  3W96 D;  5B1L A;  5GSU A;  1HQ3 B;  3B0C W;  1BH9 A;  3AZM D;  2NQB A;  4WU8 B;  4WU9 A;  4EO5 C;  5DNN A;  3KXB A;  4WNN A;  3REH B;  4J8W D;  1P34 C;  2YFV B;  5GXQ B;  1P3O B;  2YFW A;  4YM6 C;  5BNX A;  3AYW C;  3B6G C;  1P3F B;  3AZM A;  5AVB C;  1ZLA B;  5AY8 B;  1M18 D;  4J8W A;  3AZG A;  4DRB A;  4J8X C;  5CP6 B;  5BS7 C;  4J8V B;  2HUE C;  4H9Q A;  5AVB A;  4EO5 B;  3LZ0 C;  4H9O A;  4CSR B;  4X23 D;  1M18 A;  1ID3 C;  4YM6 B;  1WWI A;  3MGP B;  5BS7 A;  1H3O A;  1U35 C;  3B6G B;  5B32 D;  2HIO D;  3AZK C;  3LJA D;  5GT0 D;  4X23 A;  3NQU B;  3A6N D;  5AV6 C;  2IO5 C;  4J8X B;  5CPI D;  1P3B D;  3AN2 D;  1F66 D;  4KHA A;  4Z66 D;  3VH5 T;  5AV6 A;  5GT0 A;  5BO0 B;  5B0Y C;  3REK B;  1U35 B;  5CPI A;  1P3B A;  1P3M D;  3W99 B;  4NFT A;  1F66 A;  3AZF C;  3AZK B;  4Z66 A;  2IO5 B;  1AOI C;  3B0C T;  5DNM D;  5AV8 D;  1P3I C;  1TZY D;  3UT9 C;  3MGR C;  3MVD C;  3X1S D;  4WZS B;  3AZL C;  5B0Y B;  3KWQ C;  3C1B C;  1M19 C;  5JA4 A;  3AZH D;  2ARO D;  1AOI A;  4ZBJ C;  2FJ7 C;  2BYM A;  3C1C C;  3MGR A;  5DNM A;  5AV8 A;  3MVD A;  3AZF B;  1TZY A;  3X1U B;  3AZI A;  5B32 G;  1BH8 B;  3X1S A;  1B6W A;  4ZUX C;  3AV2 D;  4Z5T D;  4KUD C;  1BFM A;  3AZH A;  2ARO A;  5BT1 D;  1P3I B;  3UT9 B;  5B40 D;  3REL B;  4XUJ B;  3KWQ B;  3C1B B;  4H9P A;  5CPJ C;  3VH6 T;  3REI D;  1M19 B;  5B33 D;  3AV2 A;  1JFI B;  2NZD C;  4Z5T A;  3UTA C;  3X1V C;  3C1C B;  3TU4 B;  5B2I D;  1KX5 D;  3NQJ A;  4NE6 A;  5AVC C;  5B40 A;  3WTP D;  5JRG D;  3O62 D;  4J8U C;  3UTB D;  1KX4 D;  4KGC C;  3WTP E;  5B24 B;  3REI A;  5CHL B;  5B2J D;  1M1A D;  5B33 A;  4KUD B;  5B1M D;  1ULY A;  4YS3 D;  2NZD A;  2PYO D;  1EQZ C;  3MNN D;  5B31 D;  5B2I A;  3W98 D;  3O62 A;  5CPJ B;  1HQ3 D;  3W97 D;  3UTB A;  1KX4 A;  3WKJ D;  3UTA B;  1P3K C;  5B2J A;  3X1V B;  4WU8 D;  5B1M A;  4YS3 A;  5G49 B;  3REH D;  5AVC B;  5E5A C;  4JJN B;  3KUY B;  4J8U B;  1P3A B;  4QLC C;  3WAA D;  3MNN A;  5B31 A;  3W98 A;  1P3O D;  5GXQ D;  4KGC B;  1HQ3 A;  3WKJ A;  5BNV B;  3AZJ B;  1Q9C A;  3REJ B;  4WU8 A;  4WU9 D;  1P3F C;  5DNN D;  3REH A;  1ZLA C;  4Z2M G;  3B6F C;  3WAA A;  5AY8 C;  2YFV A;  5GXQ A;  1P3O A;  1P3K B;  1P3G B;  4AWL B;  5CP6 C;  1P3L B; 
#chains in the Genus database with same CATH topology
 5B0Z C;  5E5A B;  4J8V C;  3H0M C;  1B67 A;  4QLC B;  1P34 D;  2W8S A;  4XZQ C;  3AZG D;  4YM6 D;  3AYW D;  4R8P C;  1P3P C;  3B6G D;  3MGP C;  5AVB D;  1N1J B;  4CSR A;  3B6F B;  1S32 C;  1P34 A;  3MGS B;  3X1T C;  4J8X D;  4YM6 A;  4DQY B;  2F8N B;  2LY8 A;  3MGP A;  5B31 G;  3AYW A;  3B6G A;  3LZ0 D;  5B0Z B;  3MGQ B;  4XZQ B;  1ID3 D;  3NQU A;  1U35 D;  1KU5 A;  4R8P B;  4J8X A;  1P3P B;  3REK C;  3LZ0 A;  3EPL A;  4H9S C;  3AZK D;  2Y2L A;  3W99 C;  2CV5 C;  1S32 B;  3X1T B;  5AV6 D;  1ID3 A;  5GT3 C;  1U35 A;  1KX3 C;  3W96 B;  4Z2M H;  4H9R B;  4H9S A;  5BNX B;  3W99 A;  3AZE C;  3AZK A;  3AZM B;  4DRA A;  5B0Y D;  4J8W B;  4G92 B;  4E45 A;  3AZF D;  2CV5 B;  1R4V A;  3LZ1 C;  5C3I C;  3X1U C;  5B0Y A;  5GT3 B;  1KX3 B;  1AOI D;  3V9R B;  2JE5 A;  1P3I D;  3UT9 D;  3MGR D;  3MVD D;  4HGA C;  3AZE B;  3AZN C;  3AZF A;  3AZI D;  3AZL D;  3X1U A;  2Y2O A;  3REL C;  3C1B D;  1BH8 A;  4XUJ C;  1M19 D;  2FJ7 D;  2RVQ C;  2XD5 A;  4X23 B;  3C1C D;  5KDM B;  1P3I A;  3LZ1 B;  3UT9 A;  5C3I B;  5B32 B;  2CWE A;  3TU4 C;  4M6B A;  4XUJ A;  4ZUX D;  2HIO B;  3AZL A;  3KWQ A;  3C1B A;  2JSS A;  4LD9 C;  1M19 A;  4KUD D;  3LJA B;  2FJ7 A;  5B24 C;  3A6N B;  1JFI A;  4UUZ B;  4NE5 A;  3C1C A;  4HGA B;  3AZN B;  1P3B B;  3AN2 B;  5CPJ D;  3WA9 C;  4ZUX A;  4Z66 B;  2NZD D;  3UTA D;  4KUD A;  3X1V D;  3H0R C;  1TAF A;  4G91 C;  5AVC D;  4J8U D;  5AV5 C;  3AFA C;  5AV9 C;  4JJN C;  3KUY C;  1P3A C;  1P3M B;  2G5H C;  1W2E A;  5CPJ A;  4KGC D;  4LD9 B;  3UTA A;  3X1V A;  3AZJ C;  1EQZ D;  5G49 A;  3REJ C;  5AVC A;  3VH5 A;  3KSY A;  4J8U A;  3WA9 B;  5DNM B;  1TZY B;  4KGC A;  1P3K D;  4H9N A;  2RIQ A;  5BNV A;  3AZJ A;  4G91 B;  4AWL C;  1P3G C;  5E5A D;  3LEL C;  3R45 B;  3AZH B;  2ARO B;  4QLC D;  5AV5 B;  1P3L C;  1EQZ A;  3AFA B;  5AV9 B;  1P3K A;  3AV1 C;  1P3F D;  4Z5T B;  5E5A A;  1ZLA D;  4QLC A;  3B6F D;  5AY8 D;  1HTA A;  4WJ3 C;  3NQJ B;  2F8N D;  3MGS C;  5CP6 D;  5F99 C;  5B0Z D;  3LEL B;  4J8V D;  3REI B;  4WV4 B;  1P3F A;  1N1J A;  3VH5 W;  4XZQ D;  3MGQ C;  1ZLA A;  3B6F A;  5AY8 A;  5CPK C;  5B2I B;  4R8P D;  1P3P D;  3WTP B;  3O62 B;  3MGP D;  1KX5 B;  5JRG B;  2F8N A;  2BYK B;  3AV1 B;  3B0D C;  5B1L C;  5CP6 A;  3UTB B;  5GSU C;  5B0Z A;  4J8V A;  5B2J B;  1M1A B;  5B1M B;  1S32 D;  3X1T D;  4XZQ A;  2NQB C;  2PYO B;  3KXB C;  4CAY B;  1P3P A;  4R8P A;  5F99 B;  3W97 B;  3W96 C;  3A1K A;  5FUG B;  3WKJ B;  1S32 A;  5CPK B;  3X1T A;  3AZM C;  3REK D;  3WAA B;  3B0D B;  5B1L B;  3A1I A;  3W96 A;  5GSU B;  4J8W C;  3AZG C;  4H9R A;  4G92 C;  3W99 D;  2CV5 D;  1BH9 B;  3B0B A;  2NQB B;  4WU9 B;  3KXB B;  5DNN B;  4WNN B;  5GT3 D;  1KX3 D;  2Y2Q A;  5BO0 A;  3REK A;  1M18 C;  2YFW B;  2G5I C;  2ZY4 A;  2F8N G;  3AZE D;  3P5J B;  2CV5 A;  3VH6 W;  2BG1 A;  2ZY2 A;  5GT3 A;  1P34 B;  1KX3 A;  4X23 C;  3V9R A;  3AZG B;  3LZ1 D;  3AYW B;  3AZE A;  3X1U D;  4H9Q B;  5AVB B;  5B32 C;  4H9O B;  2HIO C;  2J8P A;  1M18 B;  3LJA C;  5GT0 C;  3AZN D;  5KDM A;  3A6N C;  1H3O B;  2Y2G A;  1F1E A;  3LZ1 A;  2HUE B;  5CPI C;  3REL D;  5B32 A;  3LZ0 B;  4XUJ D;  1P3B C;  2HIO A;  3KWQ D;  2RVQ D;  3AN2 C;  1F66 C;  4NE3 A;  4Z66 C;  1ID3 B;  3LJA A;  3A6N A;  4UUZ A;  2F8N K;  3AZN A;  3TU4 D;  3REL A;  3AN2 A;  4KHA B;  4LD9 D;  1P3M C;  5B24 D;  2Y2M A;  5AV6 B;  5GT0 B;  5CPI B;  2VQR A;  3TU4 A;  3WA9 D;  2F8N H;  1P3M A;  1F66 B;  5DNM C;  5AV8 C;  4LD9 A;  1TZY C;  3AZI C;  5B24 A;  2L5A A;  3X1S C;  5AV5 D;  3AFA D;  5AV9 D;  4JJN D;  3KUY D;  1P3A D;  3AZH C;  2ARO C;  3EPH A;  3WA9 A;  2ZY3 A;  3EPJ A;  2Y2H A;  2JCH A;  4UPK A;  3AZJ D;  3REJ D;  5JA4 B;  1AOI B;  3R45 A;  3AV2 C;  5AV5 A;  4Z5T C;  3AFA A;  5AV9 A;  4JJN A;  2BYM B;  3KUY A;  3MGR B;  5BT1 C;  1P3A A;  3MVD B;  5AV8 B;  1WWS A;  3AZI B;  1A7W A;  3AZL B;  5B40 C;  3X1S B;  1P3G D;  3LEL D;  4E44 A;  2FJ7 B;  1P3L D;  4ZBJ B;  3REJ A;  3REI C;  5B33 C;  5B2I C;  3AV1 D;  4ZUX B;  3WTP C;  3O62 C;  1KX5 C;  4H9P B;  5JRG C;  1P3G A;  3LEL A;  3UTB C;  1KX4 C;  3AV2 B;  2FFF B;  1P3L A;  3H0L C;  5B2J C;  1TAF B;  1M1A C;  5B1M C;  4YS3 C;  3MGS D;  1KX5 A;  5B40 B;  5F99 D;  3WTP A;  2PYO C;  5JRG A;  2BYK A;  5B31 C;  3MNN C;  3AV1 A;  3W98 C;  1HQ3 C;  3W97 C;  2NZD B;  5B33 B;  3MGQ D;  1M1A A;  3WKJ C;  5CPK D;  4WU8 C;  2PYO A;  3MGS A;  3REH C;  4CAY A;  5B1L D;  5F99 A;  5GSU D;  3WAA C;  3W97 A;  1P3O C;  4H9N B;  1T3U A;  5GXQ C;  1KX4 B;  5FUG A;  2NQB D;  3MGQ A;  4YS3 B;  3KXB D;  5CPK A;  1EQZ B;  4WU9 C;  5DNN C;  3VH6 A;  3MNN B;  5B31 B;  3W98 B;  3W96 D;  3AL0 C;  5B1L A;  3EG5 B;  5GSU A;  1HQ3 B;  3B0C W;  1BH9 A;  2XD1 A;  3AZM D;  2NQB A;  4WU8 B;  4WU9 A;  4EO5 C;  5DNN A;  3KXB A;  4WNN A;  3REH B;  2DF4 C;  4J8W D;  1P34 C;  2YFV B;  5GXQ B;  1P3O B;  2YFW A;  4YM6 C;  5BNX A;  3AYW C;  3B6G C;  1P3F B;  3AZM A;  5AVB C;  1ZLA B;  5AY8 B;  1M18 D;  2Y2K A;  4J8W A;  3AZG A;  3KFU G;  4DRB A;  4J8X C;  5CP6 B;  5BS7 C;  4J8V B;  2HUE C;  4H9Q A;  5AVB A;  4EO5 B;  3LZ0 C;  4H9O A;  4CSR B;  2ZM5 A;  4X23 D;  1M18 A;  1ID3 C;  4YM6 B;  1WWI A;  3MGP B;  5BS7 A;  1H3O A;  1U35 C;  3B6G B;  5B32 D;  2HIO D;  2Y2N A;  3AZK C;  3LJA D;  5GT0 D;  4X23 A;  3NQU B;  3A6N D;  5AV6 C;  2IO5 C;  4J8X B;  2UWX A;  5CPI D;  1P3B D;  3AN2 D;  1F66 D;  4KHA A;  4Z66 D;  3VH5 T;  5AV6 A;  5GT0 A;  5BO0 B;  5B0Y C;  3REK B;  1U35 B;  5CPI A;  2Y2I A;  3IP4 C;  1P3B A;  1P3M D;  3W99 B;  4NFT A;  1F66 A;  3AZF C;  3AZK B;  4Z66 A;  3FDD A;  2IO5 B;  1AOI C;  3B0C T;  5DNM D;  5AV8 D;  1P3I C;  1PZR A;  1TZY D;  3UT9 C;  3MGR C;  3MVD C;  3X1S D;  4WZS B;  3AZL C;  3F6T A;  5B0Y B;  3KWQ C;  3C1B C;  1M19 C;  5JA4 A;  3AZH D;  2ARO D;  1AOI A;  4ZBJ C;  2FJ7 C;  2BYM A;  3C1C C;  3MGR A;  5DNM A;  5AV8 A;  3MVD A;  3AZF B;  1TZY A;  3X1U B;  3AZI A;  5B32 G;  1BH8 B;  1Z2C B;  3X1S A;  1B6W A;  4ZUX C;  3AV2 D;  4Z5T D;  4KUD C;  1BFM A;  3AZH A;  2ARO A;  5BT1 D;  1P3I B;  3UT9 B;  2Y2P A;  5B40 D;  3REL B;  4XUJ B;  3KWQ B;  3C1B B;  4H9P A;  5CPJ C;  3VH6 T;  3REI D;  1M19 B;  5B33 D;  3AV2 A;  1JFI B;  2NZD C;  4Z5T A;  3UTA C;  2ZY5 A;  3X1V C;  3C1C B;  3TU4 B;  5B2I D;  1KX5 D;  3NQJ A;  2DQN C;  4NE6 A;  5B40 A;  5AVC C;  5JRG D;  3WTP D;  3O62 D;  4J8U C;  3UTB D;  1KX4 D;  4KGC C;  3WTP E;  5B24 B;  3REI A;  5CHL B;  5B2J D;  1M1A D;  5B33 A;  4KUD B;  5B1M D;  1ULY A;  4YS3 D;  2NZD A;  2PYO D;  1EQZ C;  3MNN D;  5B31 D;  5B2I A;  3W98 D;  3O62 A;  2Y2J A;  5CPJ B;  1HQ3 D;  3W97 D;  3UTB A;  1KX4 A;  3WKJ D;  3UTA B;  1P3K C;  5B2J A;  3X1V B;  4WU8 D;  5B1M A;  4YS3 A;  5G49 B;  3REH D;  5AVC B;  5E5A C;  4JJN B;  3KUY B;  4J8U B;  1P3A B;  4QLC C;  3WAA D;  3MNN A;  5B31 A;  3W98 A;  1P3O D;  5GXQ D;  4KGC B;  1HQ3 A;  2F2A C;  3WKJ A;  5BNV B;  3AZJ B;  1Q9C A;  3REJ B;  4WU8 A;  4WU9 D;  1P3F C;  5DNN D;  3REH A;  1ZLA C;  4Z2M G;  3B6F C;  3WAA A;  5AY8 C;  2YFV A;  5GXQ A;  1P3O A;  3EPK A;  1P3K B;  1P3G B;  4AWL B;  5CP6 C;  1P3L B; 
#chains in the Genus database with same CATH homology
 5B0Z C;  5E5A B;  4J8V C;  3H0M C;  1B67 A;  4QLC B;  1P34 D;  2W8S A;  4XZQ C;  3AZG D;  4YM6 D;  3AYW D;  4R8P C;  1P3P C;  3B6G D;  3MGP C;  5AVB D;  1N1J B;  4CSR A;  3B6F B;  1S32 C;  1P34 A;  3MGS B;  3X1T C;  4J8X D;  4YM6 A;  4DQY B;  2F8N B;  2LY8 A;  3MGP A;  5B31 G;  3AYW A;  3B6G A;  3LZ0 D;  5B0Z B;  3MGQ B;  4XZQ B;  1ID3 D;  3NQU A;  1U35 D;  1KU5 A;  4R8P B;  4J8X A;  1P3P B;  3REK C;  3LZ0 A;  3EPL A;  4H9S C;  3AZK D;  2Y2L A;  3W99 C;  2CV5 C;  1S32 B;  3X1T B;  5AV6 D;  1ID3 A;  5GT3 C;  1U35 A;  1KX3 C;  3W96 B;  4Z2M H;  4H9R B;  4H9S A;  5BNX B;  3W99 A;  3AZE C;  3AZK A;  3AZM B;  4DRA A;  5B0Y D;  4J8W B;  4G92 B;  4E45 A;  3AZF D;  2CV5 B;  1R4V A;  3LZ1 C;  5C3I C;  3X1U C;  5B0Y A;  5GT3 B;  1KX3 B;  1AOI D;  3V9R B;  2JE5 A;  1P3I D;  3UT9 D;  3MGR D;  3MVD D;  4HGA C;  3AZE B;  3AZN C;  3AZF A;  3AZI D;  3AZL D;  3X1U A;  2Y2O A;  3REL C;  3C1B D;  1BH8 A;  4XUJ C;  1M19 D;  2FJ7 D;  2RVQ C;  2XD5 A;  4X23 B;  3C1C D;  5KDM B;  1P3I A;  3LZ1 B;  3UT9 A;  5C3I B;  5B32 B;  2CWE A;  3TU4 C;  4M6B A;  4XUJ A;  4ZUX D;  2HIO B;  3AZL A;  3KWQ A;  3C1B A;  2JSS A;  4LD9 C;  1M19 A;  4KUD D;  3LJA B;  2FJ7 A;  5B24 C;  3A6N B;  1JFI A;  4UUZ B;  4NE5 A;  3C1C A;  4HGA B;  3AZN B;  1P3B B;  3AN2 B;  5CPJ D;  3WA9 C;  4ZUX A;  4Z66 B;  2NZD D;  3UTA D;  4KUD A;  3X1V D;  3H0R C;  1TAF A;  4G91 C;  5AVC D;  4J8U D;  5AV5 C;  3AFA C;  5AV9 C;  4JJN C;  3KUY C;  1P3A C;  1P3M B;  2G5H C;  1W2E A;  5CPJ A;  4KGC D;  4LD9 B;  3UTA A;  3X1V A;  3AZJ C;  1EQZ D;  5G49 A;  3REJ C;  5AVC A;  3VH5 A;  3KSY A;  4J8U A;  3WA9 B;  5DNM B;  1TZY B;  4KGC A;  1P3K D;  4H9N A;  2RIQ A;  5BNV A;  3AZJ A;  4G91 B;  4AWL C;  1P3G C;  5E5A D;  3LEL C;  3R45 B;  3AZH B;  2ARO B;  4QLC D;  5AV5 B;  1P3L C;  1EQZ A;  3AFA B;  5AV9 B;  1P3K A;  3AV1 C;  1P3F D;  4Z5T B;  5E5A A;  1ZLA D;  4QLC A;  3B6F D;  5AY8 D;  1HTA A;  4WJ3 C;  3NQJ B;  2F8N D;  3MGS C;  5CP6 D;  5F99 C;  5B0Z D;  3LEL B;  4J8V D;  3REI B;  4WV4 B;  1P3F A;  1N1J A;  3VH5 W;  4XZQ D;  3MGQ C;  1ZLA A;  3B6F A;  5AY8 A;  5CPK C;  5B2I B;  4R8P D;  1P3P D;  3WTP B;  3O62 B;  3MGP D;  1KX5 B;  5JRG B;  2F8N A;  2BYK B;  3AV1 B;  3B0D C;  5B1L C;  5CP6 A;  3UTB B;  5GSU C;  5B0Z A;  4J8V A;  5B2J B;  1M1A B;  5B1M B;  1S32 D;  3X1T D;  4XZQ A;  2NQB C;  2PYO B;  3KXB C;  4CAY B;  1P3P A;  4R8P A;  5F99 B;  3W97 B;  3W96 C;  3A1K A;  5FUG B;  3WKJ B;  1S32 A;  5CPK B;  3X1T A;  3AZM C;  3REK D;  3WAA B;  3B0D B;  5B1L B;  3A1I A;  3W96 A;  5GSU B;  4J8W C;  3AZG C;  4H9R A;  4G92 C;  3W99 D;  2CV5 D;  1BH9 B;  3B0B A;  2NQB B;  4WU9 B;  3KXB B;  5DNN B;  4WNN B;  5GT3 D;  1KX3 D;  2Y2Q A;  5BO0 A;  3REK A;  1M18 C;  2YFW B;  2G5I C;  2ZY4 A;  2F8N G;  3AZE D;  3P5J B;  2CV5 A;  3VH6 W;  2BG1 A;  2ZY2 A;  5GT3 A;  1P34 B;  1KX3 A;  4X23 C;  3V9R A;  3AZG B;  3LZ1 D;  3AYW B;  3AZE A;  3X1U D;  4H9Q B;  5AVB B;  5B32 C;  4H9O B;  2HIO C;  2J8P A;  1M18 B;  3LJA C;  5GT0 C;  3AZN D;  5KDM A;  3A6N C;  1H3O B;  2Y2G A;  1F1E A;  3LZ1 A;  2HUE B;  5CPI C;  3REL D;  5B32 A;  3LZ0 B;  4XUJ D;  1P3B C;  2HIO A;  3KWQ D;  2RVQ D;  3AN2 C;  1F66 C;  4NE3 A;  4Z66 C;  1ID3 B;  3LJA A;  3A6N A;  4UUZ A;  2F8N K;  3AZN A;  3TU4 D;  3REL A;  3AN2 A;  4KHA B;  4LD9 D;  1P3M C;  5B24 D;  2Y2M A;  5AV6 B;  5GT0 B;  5CPI B;  2VQR A;  3TU4 A;  3WA9 D;  2F8N H;  1P3M A;  1F66 B;  5DNM C;  5AV8 C;  4LD9 A;  1TZY C;  3AZI C;  5B24 A;  2L5A A;  3X1S C;  5AV5 D;  3AFA D;  5AV9 D;  4JJN D;  3KUY D;  1P3A D;  3AZH C;  2ARO C;  3EPH A;  3WA9 A;  2ZY3 A;  3EPJ A;  2Y2H A;  2JCH A;  4UPK A;  3AZJ D;  3REJ D;  5JA4 B;  1AOI B;  3R45 A;  3AV2 C;  5AV5 A;  4Z5T C;  3AFA A;  5AV9 A;  4JJN A;  2BYM B;  3KUY A;  3MGR B;  5BT1 C;  1P3A A;  3MVD B;  5AV8 B;  1WWS A;  3AZI B;  1A7W A;  3AZL B;  5B40 C;  3X1S B;  1P3G D;  3LEL D;  4E44 A;  2FJ7 B;  1P3L D;  4ZBJ B;  3REJ A;  3REI C;  5B33 C;  5B2I C;  3AV1 D;  4ZUX B;  3WTP C;  3O62 C;  1KX5 C;  4H9P B;  5JRG C;  1P3G A;  3LEL A;  3UTB C;  1KX4 C;  3AV2 B;  2FFF B;  1P3L A;  3H0L C;  5B2J C;  1TAF B;  1M1A C;  5B1M C;  4YS3 C;  3MGS D;  1KX5 A;  5B40 B;  5F99 D;  3WTP A;  2PYO C;  5JRG A;  2BYK A;  5B31 C;  3MNN C;  3AV1 A;  3W98 C;  1HQ3 C;  3W97 C;  2NZD B;  5B33 B;  3MGQ D;  1M1A A;  3WKJ C;  5CPK D;  4WU8 C;  2PYO A;  3MGS A;  3REH C;  4CAY A;  5B1L D;  5F99 A;  5GSU D;  3WAA C;  3W97 A;  1P3O C;  4H9N B;  1T3U A;  5GXQ C;  1KX4 B;  5FUG A;  2NQB D;  3MGQ A;  4YS3 B;  3KXB D;  5CPK A;  1EQZ B;  4WU9 C;  5DNN C;  3VH6 A;  3MNN B;  5B31 B;  3W98 B;  3W96 D;  3AL0 C;  5B1L A;  3EG5 B;  5GSU A;  1HQ3 B;  3B0C W;  1BH9 A;  2XD1 A;  3AZM D;  2NQB A;  4WU8 B;  4WU9 A;  4EO5 C;  5DNN A;  3KXB A;  4WNN A;  3REH B;  2DF4 C;  4J8W D;  1P34 C;  2YFV B;  5GXQ B;  1P3O B;  2YFW A;  4YM6 C;  5BNX A;  3AYW C;  3B6G C;  1P3F B;  3AZM A;  5AVB C;  1ZLA B;  5AY8 B;  1M18 D;  2Y2K A;  4J8W A;  3AZG A;  3KFU G;  4DRB A;  4J8X C;  5CP6 B;  5BS7 C;  4J8V B;  2HUE C;  4H9Q A;  5AVB A;  4EO5 B;  3LZ0 C;  4H9O A;  4CSR B;  2ZM5 A;  4X23 D;  1M18 A;  1ID3 C;  4YM6 B;  1WWI A;  3MGP B;  5BS7 A;  1H3O A;  1U35 C;  3B6G B;  5B32 D;  2HIO D;  2Y2N A;  3AZK C;  3LJA D;  5GT0 D;  4X23 A;  3NQU B;  3A6N D;  5AV6 C;  2IO5 C;  4J8X B;  2UWX A;  5CPI D;  1P3B D;  3AN2 D;  1F66 D;  4KHA A;  4Z66 D;  3VH5 T;  5AV6 A;  5GT0 A;  5BO0 B;  5B0Y C;  3REK B;  1U35 B;  5CPI A;  2Y2I A;  3IP4 C;  1P3B A;  1P3M D;  3W99 B;  4NFT A;  1F66 A;  3AZF C;  3AZK B;  4Z66 A;  3FDD A;  2IO5 B;  1AOI C;  3B0C T;  5DNM D;  5AV8 D;  1P3I C;  1PZR A;  1TZY D;  3UT9 C;  3MGR C;  3MVD C;  3X1S D;  4WZS B;  3AZL C;  3F6T A;  5B0Y B;  3KWQ C;  3C1B C;  1M19 C;  5JA4 A;  3AZH D;  2ARO D;  1AOI A;  4ZBJ C;  2FJ7 C;  2BYM A;  3C1C C;  3MGR A;  5DNM A;  5AV8 A;  3MVD A;  3AZF B;  1TZY A;  3X1U B;  3AZI A;  5B32 G;  1BH8 B;  1Z2C B;  3X1S A;  1B6W A;  4ZUX C;  3AV2 D;  4Z5T D;  4KUD C;  1BFM A;  3AZH A;  2ARO A;  5BT1 D;  1P3I B;  3UT9 B;  2Y2P A;  5B40 D;  3REL B;  4XUJ B;  3KWQ B;  3C1B B;  4H9P A;  5CPJ C;  3VH6 T;  3REI D;  1M19 B;  5B33 D;  3AV2 A;  1JFI B;  2NZD C;  4Z5T A;  3UTA C;  2ZY5 A;  3X1V C;  3C1C B;  3TU4 B;  5B2I D;  1KX5 D;  3NQJ A;  2DQN C;  4NE6 A;  5B40 A;  5AVC C;  5JRG D;  3WTP D;  3O62 D;  4J8U C;  3UTB D;  1KX4 D;  4KGC C;  3WTP E;  5B24 B;  3REI A;  5CHL B;  5B2J D;  1M1A D;  5B33 A;  4KUD B;  5B1M D;  1ULY A;  4YS3 D;  2NZD A;  2PYO D;  1EQZ C;  3MNN D;  5B31 D;  5B2I A;  3W98 D;  3O62 A;  2Y2J A;  5CPJ B;  1HQ3 D;  3W97 D;  3UTB A;  1KX4 A;  3WKJ D;  3UTA B;  1P3K C;  5B2J A;  3X1V B;  4WU8 D;  5B1M A;  4YS3 A;  5G49 B;  3REH D;  5AVC B;  5E5A C;  4JJN B;  3KUY B;  4J8U B;  1P3A B;  4QLC C;  3WAA D;  3MNN A;  5B31 A;  3W98 A;  1P3O D;  5GXQ D;  4KGC B;  1HQ3 A;  2F2A C;  3WKJ A;  5BNV B;  3AZJ B;  1Q9C A;  3REJ B;  4WU8 A;  4WU9 D;  1P3F C;  5DNN D;  3REH A;  1ZLA C;  4Z2M G;  3B6F C;  3WAA A;  5AY8 C;  2YFV A;  5GXQ A;  1P3O A;  3EPK A;  1P3K B;  1P3G B;  4AWL B;  5CP6 C;  1P3L B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...