1P34B

Crystallographic studies of nucleosome core particles containing histone 'sin' mutants
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
83
structure length
83
Chain Sequence
KVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Palindromic 146bp Human Alpha-Satellite DNA fragment
publication title Crystal structures of histone Sin mutant nucleosomes reveal altered protein-DNA interactions
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 26
structure length 83
sequence length 83
chains with identical sequence F
ec nomenclature
pdb deposition date 2003-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1p34B00
3R45B 4R8PA 1M1AA 5GSUA 5C3IB 4J8VB 3AZFC 1P3GC 3REHA 2PYOA 1AOID 1P3PA 4R8PC 3W96A 3MGRB 4DRAA 4NE3A 5AVCB 1M1AC 4KUDB 3MNNB 3AZND 2NZDB 4G92C 3REHC 5B1LC 2PYOC 3AZID 1P3PC 4Z66D 1U35A 3LELB 2YFVB 4E45A 4X23A 3WA9A 3AZLD 4WNNB 4Z5TD 1P3LC 1U35C 1M19B 2HUEC 1F66A 5CHLB 3X1TD 5AV6D 5GXQD 3WA9C 1S32D 3REID 3UTBA 1EQZC 1F66C 3WAAC 5AV6B 4WU9D 1P3MA 5DNMD 1P3OA 4M6BA 5GT0D 1ID3D 3A6ND 5FUGB 5DNNA 3X1SD 3NQUA 4AWLB 1P3IA 1P3OC 4YM6A 2NQBA 5CPJA 1KX4A 1HQ3D 5CPKA 5B0YC 5DNNC 4YM6C 2NQBC 5CPJC 3B6GA 5CPKC 3RELB 3O62B 3REJA 4XUJB 2CV5C 1TZYB 5E5AB 3C1CD 3AV1B 3AV2C 1KX3A 3B6GC 3KXBD 5B33B 1KX3C 1Q9CA 3VH5A 5AV8D 2AROD 1F1EA 5JA4B 4G91C 3AZGB 3KUYC 1ZLAD 1P3GD 4WV4B 5B32B 4R8PD 1M1AD 5GSUD 4CSRB 5F99A 4DRBA 2PYOD 1P3PD 1BFMA 3W96D 4H9PB 3W97A 5B31D 1JFIB 3AZEA 5AY8A 5B2JB 5F99C 4J8WC 5GT3A 3R45A 5BT1D 5B0ZB 4LD9D 3UTAC 1B6WA 1U35D 3NQJB 3W97C 3W98B 3AZKA 3WTPA 5AV5A 3AZEC 5AY8C 3WKJB 4X23D 2YFWB 5GT3C 4NE5A 5B32G 4HGAB 4J8VC 5C3IC 4WU8D 5B40A 3V9RB 3AZKC 3WTPC 5AV5C 3AZHA 3LZ0D 3MGSD 1P3KB 3UTBD 4KUDC 1M18A 3MNNC 4H9OA 3MGSB 4XZQB 3AZHC 1P3MD 1KX5B 3X1VB 4WNNA 5G49B 3LZ1B 1P3OD 4J8UA 3MGPA 1M19A 1M18C 5AVBB 3LELC 4YS3A 5DNND 5AV9A 4QLCB 1P3ID 4J8UC 2NQBD 3MGPC 5B2IB 1M19C 3B0CW 1KX4D 3AFAA 5CPKD 5B24B 4H9QA 2IO5B 5AV9C 5CP6A 3AFAC 3KWQB 3REJD 3REKB 4CAYA 1B67A 5CP6C 1KX3D 1WWSA 4KHAA 3TU4A 5CPIB 1P3BD 4AWLC 4J8XD 4KGCD 1A7WA 3TU4C 3W99A 3X1UA 1P34A 3VH6W 5E5AA 2F8NK 5JRGB 4KGCB 1P3BB 3RELC 2BYMB 3W99C 5B1LA 4XUJC 2FJ7A 3X1UC 1P34C 5E5AC 4UUZA 5F99D 3UT9A 2BYKA 3AZMA 1AOIB 2FJ7C 5B33C 3AZED 1P3LA 3AZNB 2LY8A 3UT9C 4EO5C 3AZMC 1P3FA 4ZUXA 3AZGC 3AZIB 4Z66B 3AZKD 3WTPD 4H9RB 5AV5D 1EQZA 3WAAA 5B32C 1P3FC 4ZUXC 3AZLB 2F8NA 5B40D 4Z5TB 1N1JA 3AZHD 3X1TB 5GXQB 1S32B 3REIB 3B0BA 3MVDA 4WU9B 5BNXA 5DNMB 5B0YA 3MGPD 3MGQA 3MVDC 5GT0B 3AN2A 1ID3B 4JJNA 4YS3D 3A6NB 3LJAA 3B6FD 5AV9D 3X1SB 2CV5A 3MGQC 3AFAD 3AN2C 2F8NH 4JJNC 1HQ3B 3AV2A 2HIOA 4Z2MH 3X1VA 3AZJD 1P3KC 3LJAC 5CP6D 4XZQC 3KSYA 2HIOC 1KX5C 3X1VC 4H9NA 3C1BA 5AVBC 3KUYA 3C1CB 1H3OA 5B24A 3AYWD 2RVQC 3KXBB 3TU4D 1BH9B 3C1BC 4ZBJB 5B2IC 1BH8B 3KWQA 1P3AA 3AZFD 5AV8B 5B24C 2AROB 3W99D 3X1UD 1ZLAB 3KWQC 5B1MA 1P3GB 1P3AC 4J8WA 3REHD 5B1LD 4R8PB 1M1AB 2FJ7D 5GSUB 5BO0A 3REKC 3UTAA 3UT9D 5B1MC 4NFTA 2PYOB 5CPIC 1P3PB 3W96B 4J8VA 5B31B 1P3LD 1P3FD 3WA9D 4ZUXD 4LD9B 2BYMA 3MGRA 1U35B 5AVCA 2HUEB 4KUDA 1EQZD 1F66D 3MNNA 3WAAD 4X23B 1TAFB 2NZDA 1AOIA 2F8ND 4WU8B 3MGRC 5AVCC 4E44A 3LELA 3LZ0B 2YFVA 2NZDC 1AOIC 3UTBB 3MVDD 3AZNC 5B31G 3VH6A 1P3MB 3AZIC 5B0YD 1P3OB 3MGQD 3AN2D 4YM6D 5CPJD 5AV6A 3LJAD 5DNNB 2CV5D 1P3IB 2NQBB 1KX4B 3AV2D 4WU9A 2HIOD 5CPKB 3X1TC 3B6GD 5AV6C 5FUGA 3REIC 4WU9C 2RVQD 3REJB 3C1BD 3KUYD 1KX3B 1WWIA 4G91B 3O62A 3RELA 3X1SC 4XUJA 1TZYA 4J8XB 3AV1A 1P3AD 3O62C 1TZYC 5B1MD 5B33A 3AV1C 4J8WD 3UTAD 5JA4A 3AZGA 3W97D 5F99B 5AY8D 2AROA 5GT3D 5B32A 4ZBJC 4CSRA 4J8VD 3W97B 3AZEB 5AY8B 5GT3B 2AROC 3MGRD 4KUDD 5AVCD 4H9PA 3AZKB 3WTPB 5AV5B 3MNND 1JFIA 1ZLAC 5BS7C 5B2JA 2NZDD 5B0ZA 5GSUC 5B31A 5B40B 1M18D 3NQJA 3LELD 3W98A 3AZHB 5B2JC 3WKJA 2YFWA 4LD9A 5B0ZC 3W96C 5KDMB 1M18B 5B31C 4J8UD 1M19D 4H9OB 3V9RA 3W98C 1TAFA 5BT1C 3WKJC 1P3KA 4LD9C 4WU8A 4J8UB 4HGAC 3MGPB 3LZ0A 4X23C 3MGSA 4YS3B 4XZQA 1KX5A 1ULYA 3B6FB 5AV9B 4WU8C 5G49A 3LZ1A 2JSSA 3AFAB 5BNVB 5AVBA 3LZ0C 3MGSC 3AZJB 4H9QB 3B0DB 3UTBC 4QLCA 5CP6B 3LZ1C 5B2IA 3WTPE 1P3MC 3VH5T 4CAYB 4QLCC 4KHAB 3AYWB 3RELD 3TU4B 3O62D 4XUJD 1TZYD 1P3IC 2IO5C 3REKA 1P34D 5E5AD 3AV1D 1KX4C 3AZFB 4WZSB 4H9SA 3W99B 5CPIA 3X1UB 1P34B 2L5AA 5B33D 3AZMD 3REJC 4G92B 3REHB 4H9SC 5B1LB 2FJ7B 3B0CT 3AZGD 4UUZB 4J8XA 5JRGA 2BYKB 4EO5B 3UT9B 3AZMB 5B32D 4KGCA 1P3BA 1HTAA 1P3LB 4J8XC 5JRGC 1P3FB 4KGCC 1P3BC 3WA9B 4ZUXB 1EQZB 5B2JD 3AZNA 1F66B 3WAAB 5B0ZD 2F8NB 3AZIA 4Z66A 1N1JB 3W98D 4H9RA 3WKJD 3VH6T 4NE6A 3AZLA 4Z66C 3MVDB 4Z5TA 4JJND 3X1TA 1P3KD 5GXQA 5BNXB 5B0YB 1S32A 3NQUB 3MGQB 3REIA 3VH5W 3AZLC 3AN2B 4Z5TC 4YM6B 4JJNB 5CPJB 4XZQD 3LJAB 1KX5D 3X1VD 5GXQC 5KDMA 3LZ1D 2CV5B 5B40C 5DNMA 1S32C 2F8NG 5AVBD 4Z2MG 5GT0A 3AV2B 2HIOB 1ID3A 3B6GB 3A6NA 2CWEA 4QLCD 3X1SA 5DNMC 5B2ID 5GT0C 1ID3C 1HQ3A 5B24D 3A6NC 3B6FA 4H9NB 3C1BB 3KUYB 5BNVA 1R4VA 3KWQD 1H3OB 4YS3C 1HQ3C 3AZJA 3B6FC 3REKD 3C1CA 1P3AB 3AZJC 3KXBA 3B0DC 5CPID 1BH9A 1KU5A 5B1MB 1BH8A 3C1CC 4J8WB 3AYWA 5AV8A 3KXBC 5BO0B 3UTAB 5JRGD 1ZLAA 3AZFA 1P3GA 3AYWC 5BS7A 5AV8C
chains in the Genus database with same CATH superfamily
3R45B 4R8PA 1M1AA 5GSUA 5C3IB 4J8VB 3AZFC 1P3GC 3REHA 2PYOA 1AOID 1P3PA 4R8PC 3W96A 3MGRB 4DRAA 4NE3A 5AVCB 1M1AC 4KUDB 3AL0C 2DF4C 3MNNB 3AZND 2NZDB 4G92C 3REHC 5B1LC 2PYOC 3AZID 1P3PC 2ZY3A 4Z66D 4DQYB 1U35A 3LELB 2YFVB 4E45A 4X23A 3WA9A 3AZLD 4WNNB 4Z5TD 1P3LC 2XD5A 1U35C 1M19B 2HUEC 1F66A 5CHLB 3X1TD 5AV6D 5GXQD 3WA9C 1S32D 3REID 3UTBA 2XD1A 1EQZC 1F66C 2Y2JA 3WAAC 5AV6B 4WU9D 1P3MA 2RIQA 5DNMD 1P3OA 4M6BA 5GT0D 1ID3D 3A6ND 5FUGB 5DNNA 3X1SD 3NQUA 4AWLB 1P3IA 1P3OC 2Y2PA 4YM6A 2NQBA 5CPJA 1KX4A 1HQ3D 2Y2IA 5CPKA 5B0YC 5DNNC 3EPJA 4YM6C 2NQBC 5CPJC 3B6GA 2UWXA 5CPKC 3RELB 3O62B 3REJA 4XUJB 2CV5C 1TZYB 5E5AB 3C1CD 3AV1B 3AV2C 1KX3A 3B6GC 3KXBD 5B33B 1KX3C 1Q9CA 3VH5A 5AV8D 2AROD 1F1EA 5JA4B 4G91C 3AZGB 3KUYC 1ZLAD 1P3GD 1W2EA 4WV4B 5B32B 4R8PD 1M1AD 5GSUD 4CSRB 3A1KA 5F99A 4DRBA 2PYOD 1P3PD 1BFMA 3W96D 4H9PB 3W97A 5B31D 1JFIB 3AZEA 5AY8A 5B2JB 5F99C 4J8WC 5GT3A 3R45A 2W8SA 5BT1D 5B0ZB 4LD9D 2Y2KA 3UTAC 1B6WA 1U35D 3NQJB 3W97C 3W98B 3AZKA 3WTPA 5AV5A 3AZEC 5AY8C 3WKJB 4X23D 2YFWB 5GT3C 4NE5A 5B32G 4HGAB 3A1IA 4J8VC 5C3IC 4WU8D 5B40A 3V9RB 3AZKC 3WTPC 5AV5C 3AZHA 3LZ0D 3MGSD 1P3KB 2J8PA 3UTBD 4KUDC 1M18A 3MNNC 4H9OA 3MGSB 2ZY5A 4XZQB 3AZHC 1P3MD 1KX5B 3X1VB 4WNNA 5G49B 3LZ1B 1P3OD 4J8UA 3MGPA 1M19A 1M18C 5AVBB 3LELC 4YS3A 5DNND 5AV9A 4QLCB 1P3ID 3EPKA 4J8UC 3MGPC 5B2IB 1M19C 3B0CW 1KX4D 3AFAA 2NQBD 5CPKD 5B24B 4H9QA 2IO5B 5AV9C 2Y2MA 5CP6A 3AFAC 3KWQB 3REJD 3REKB 4CAYA 1B67A 5CP6C 1KX3D 1WWSA 4KHAA 3TU4A 3F6TA 5CPIB 1P3BD 4AWLC 4J8XD 3H0RC 4KGCD 1A7WA 3TU4C 3W99A 3X1UA 1P34A 3VH6W 5E5AA 2F8NK 5JRGB 4KGCB 1P3BB 3RELC 2BYMB 3W99C 5B1LA 4XUJC 2FJ7A 3X1UC 1P34C 5E5AC 4UUZA 5F99D 3UT9A 2BYKA 3AZMA 1AOIB 3EPHA 2FJ7C 2VQRA 5B33C 3AZED 1P3LA 3AZNB 2LY8A 3UT9C 4EO5C 3AZMC 1P3FA 4ZUXA 3AZGC 3AZIB 4Z66B 3AZKD 3WTPD 4H9RB 5AV5D 1EQZA 3WAAA 5B32C 1P3FC 4ZUXC 3AZLB 2F8NA 5B40D 4Z5TB 1N1JA 3AZHD 3X1TB 5GXQB 1S32B 3REIB 3B0BA 3MVDA 4WU9B 5BNXA 5DNMB 5B0YA 3MGPD 3MGQA 3MVDC 5GT0B 3AN2A 1ID3B 4JJNA 4YS3D 3A6NB 2Y2LA 3LJAA 3B6FD 5AV9D 3X1SB 2CV5A 3MGQC 3AFAD 3AN2C 2F8NH 4JJNC 1HQ3B 3AV2A 2HIOA 3P5JB 4Z2MH 3X1VA 3AZJD 1P3KC 3LJAC 2FFFB 5CP6D 4XZQC 3KSYA 2HIOC 1KX5C 3X1VC 4H9NA 3C1BA 2Y2GA 5AVBC 3KUYA 3C1CB 1H3OA 5B24A 3AYWD 2RVQC 3KXBB 2ZY4A 3TU4D 1BH9B 3C1BC 4ZBJB 5B2IC 1BH8B 2G5IC 3KWQA 1P3AA 3AZFD 5AV8B 5B24C 2AROB 3W99D 3FDDA 3X1UD 1ZLAB 3KWQC 2BG1A 5B1MA 1P3GB 1P3AC 4WJ3C 4J8WA 3REHD 5B1LD 4R8PB 1M1AB 2FJ7D 5GSUB 5BO0A 3REKC 3UTAA 3UT9D 5B1MC 4NFTA 2PYOB 5CPIC 1P3PB 3W96B 4J8VA 5B31B 1P3LD 1P3FD 3WA9D 4ZUXD 4LD9B 2BYMA 3MGRA 1U35B 5AVCA 2HUEB 4KUDA 2F2AC 1EQZD 1F66D 3MNNA 3WAAD 4X23B 1TAFB 2NZDA 1AOIA 2F8ND 4WU8B 3MGRC 5AVCC 4E44A 3LELA 3LZ0B 2YFVA 2NZDC 1AOIC 3UTBB 3MVDD 3AZNC 5B31G 3VH6A 1P3MB 3AZIC 5B0YD 1P3OB 3MGQD 3AN2D 4YM6D 5CPJD 5AV6A 3LJAD 5DNNB 2CV5D 1P3IB 2NQBB 1KX4B 3AV2D 4WU9A 2HIOD 5CPKB 3X1TC 3B6GD 5AV6C 5FUGA 3REIC 4WU9C 2RVQD 3REJB 3C1BD 3KUYD 1KX3B 1WWIA 4G91B 3O62A 3RELA 3X1SC 4XUJA 1TZYA 4J8XB 3AV1A 1P3AD 3O62C 2Y2HA 1TZYC 5B1MD 5B33A 3AV1C 4J8WD 3UTAD 5JA4A 3AZGA 3W97D 5F99B 5AY8D 2ZY2A 2AROA 5GT3D 3KFUG 5B32A 4ZBJC 4CSRA 4J8VD 3W97B 3AZEB 5AY8B 5GT3B 2AROC 4UPKA 3MGRD 4KUDD 5AVCD 4H9PA 3AZKB 3WTPB 5AV5B 3MNND 1JFIA 1ZLAC 5BS7C 5B2JA 2NZDD 5B0ZA 5GSUC 5B31A 5B40B 1M18D 3NQJA 3LELD 3W98A 3AZHB 1PZRA 5B2JC 3WKJA 2YFWA 4LD9A 5B0ZC 3W96C 5KDMB 1M18B 5B31C 4J8UD 1M19D 4H9OB 3V9RA 3W98C 1TAFA 5BT1C 3WKJC 1P3KA 2ZM5A 4LD9C 4WU8A 4J8UB 4HGAC 3MGPB 3LZ0A 4X23C 3MGSA 4YS3B 4XZQA 1KX5A 1ULYA 3B6FB 5AV9B 4WU8C 5G49A 3LZ1A 2JSSA 3AFAB 5BNVB 5AVBA 3LZ0C 3MGSC 3AZJB 4H9QB 3B0DB 1T3UA 3UTBC 4QLCA 5CP6B 3LZ1C 5B2IA 3WTPE 1P3MC 3VH5T 4CAYB 4QLCC 2JE5A 4KHAB 3AYWB 3RELD 3TU4B 3O62D 4XUJD 1TZYD 1P3IC 2IO5C 3REKA 1P34D 5E5AD 3AV1D 1KX4C 3AZFB 4WZSB 4H9SA 3W99B 5CPIA 3X1UB 1P34B 2L5AA 3EG5B 5B33D 2JCHA 3AZMD 3REJC 4G92B 3REHB 4H9SC 5B1LB 2FJ7B 3B0CT 3AZGD 4UUZB 4J8XA 5JRGA 2BYKB 4EO5B 3UT9B 3AZMB 5B32D 1Z2CB 1P3BA 4KGCA 1HTAA 1P3LB 4J8XC 5JRGC 1P3FB 4KGCC 1P3BC 3WA9B 4ZUXB 1EQZB 5B2JD 3AZNA 1F66B 3WAAB 3H0MC 5B0ZD 2F8NB 3EPLA 3AZIA 4Z66A 1N1JB 3W98D 4H9RA 3WKJD 3VH6T 4NE6A 3AZLA 4Z66C 3MVDB 4Z5TA 4JJND 2Y2OA 2DQNC 2Y2NA 3X1TA 1P3KD 5GXQA 5BNXB 5B0YB 1S32A 3NQUB 3MGQB 3REIA 3VH5W 3AZLC 3AN2B 4Z5TC 4YM6B 4JJNB 5CPJB 4XZQD 3LJAB 1KX5D 3X1VD 5GXQC 5KDMA 3LZ1D 2CV5B 5B40C 5DNMA 1S32C 2F8NG 2Y2QA 5AVBD 4Z2MG 5GT0A 3AV2B 2HIOB 1ID3A 3B6GB 3A6NA 2CWEA 4QLCD 3X1SA 5DNMC 5B2ID 5GT0C 1ID3C 1HQ3A 5B24D 3A6NC 3B6FA 4H9NB 2G5HC 3C1BB 3KUYB 5BNVA 1R4VA 3KWQD 1H3OB 4YS3C 1HQ3C 3AZJA 3B6FC 3REKD 3C1CA 1P3AB 3AZJC 3KXBA 3B0DC 5CPID 1BH9A 1KU5A 5B1MB 3H0LC 1BH8A 3C1CC 4J8WB 3AYWA 5AV8A 3KXBC 5BO0B 3UTAB 3IP4C 5JRGD 1ZLAA 3AZFA 1P3GA 3AYWC 5BS7A 5AV8C
chains in the Genus database with same CATH topology
3R45B 4R8PA 1M1AA 5GSUA 5C3IB 4J8VB 3AZFC 1P3GC 3REHA 2PYOA 1AOID 1P3PA 4R8PC 3W96A 3MGRB 4DRAA 4NE3A 5AVCB 1M1AC 4KUDB 3AL0C 2DF4C 3MNNB 3AZND 2NZDB 4G92C 3REHC 5B1LC 2PYOC 3AZID 1P3PC 2ZY3A 4Z66D 4DQYB 1U35A 3LELB 2YFVB 4E45A 4X23A 3WA9A 3AZLD 4WNNB 4Z5TD 1P3LC 2XD5A 1U35C 1M19B 2HUEC 1F66A 5CHLB 3X1TD 5AV6D 5GXQD 3WA9C 1S32D 3REID 3UTBA 2XD1A 1EQZC 1F66C 2Y2JA 3WAAC 5AV6B 4WU9D 1P3MA 2RIQA 5DNMD 1P3OA 4M6BA 5GT0D 1ID3D 3A6ND 5FUGB 5DNNA 3X1SD 3NQUA 4AWLB 1P3IA 1P3OC 2Y2PA 4YM6A 2NQBA 5CPJA 1KX4A 1HQ3D 2Y2IA 5CPKA 5B0YC 5DNNC 3EPJA 4YM6C 2NQBC 5CPJC 3B6GA 2UWXA 5CPKC 3RELB 3O62B 3REJA 4XUJB 2CV5C 1TZYB 5E5AB 3C1CD 3AV1B 3AV2C 1KX3A 3B6GC 3KXBD 5B33B 1KX3C 1Q9CA 3VH5A 5AV8D 2AROD 1F1EA 5JA4B 4G91C 3AZGB 3KUYC 1ZLAD 1P3GD 1W2EA 4WV4B 5B32B 4R8PD 1M1AD 5GSUD 4CSRB 3A1KA 5F99A 4DRBA 2PYOD 1P3PD 1BFMA 3W96D 4H9PB 3W97A 5B31D 1JFIB 3AZEA 5AY8A 5B2JB 5F99C 4J8WC 5GT3A 3R45A 2W8SA 5BT1D 5B0ZB 4LD9D 2Y2KA 3UTAC 1B6WA 1U35D 3NQJB 3W97C 3W98B 3AZKA 3WTPA 5AV5A 3AZEC 5AY8C 3WKJB 4X23D 2YFWB 5GT3C 4NE5A 5B32G 4HGAB 3A1IA 4J8VC 5C3IC 4WU8D 5B40A 3V9RB 3AZKC 3WTPC 5AV5C 3AZHA 3LZ0D 3MGSD 1P3KB 2J8PA 3UTBD 4KUDC 1M18A 3MNNC 4H9OA 3MGSB 2ZY5A 4XZQB 3AZHC 1P3MD 1KX5B 3X1VB 4WNNA 5G49B 3LZ1B 1P3OD 4J8UA 3MGPA 1M19A 1M18C 5AVBB 3LELC 4YS3A 5DNND 5AV9A 4QLCB 1P3ID 3EPKA 4J8UC 3MGPC 5B2IB 1M19C 3B0CW 1KX4D 3AFAA 2NQBD 5CPKD 5B24B 4H9QA 2IO5B 5AV9C 2Y2MA 5CP6A 3AFAC 3KWQB 3REJD 3REKB 4CAYA 1B67A 5CP6C 1KX3D 1WWSA 4KHAA 3TU4A 3F6TA 5CPIB 1P3BD 4AWLC 4J8XD 3H0RC 4KGCD 1A7WA 3TU4C 3W99A 3X1UA 1P34A 3VH6W 5E5AA 2F8NK 5JRGB 4KGCB 1P3BB 3RELC 2BYMB 3W99C 5B1LA 4XUJC 2FJ7A 3X1UC 1P34C 5E5AC 4UUZA 5F99D 3UT9A 2BYKA 3AZMA 1AOIB 3EPHA 2FJ7C 2VQRA 5B33C 3AZED 1P3LA 3AZNB 2LY8A 3UT9C 4EO5C 3AZMC 1P3FA 4ZUXA 3AZGC 3AZIB 4Z66B 3AZKD 3WTPD 4H9RB 5AV5D 1EQZA 3WAAA 5B32C 1P3FC 4ZUXC 3AZLB 2F8NA 5B40D 4Z5TB 1N1JA 3AZHD 3X1TB 5GXQB 1S32B 3REIB 3B0BA 3MVDA 4WU9B 5BNXA 5DNMB 5B0YA 3MGPD 3MGQA 3MVDC 5GT0B 3AN2A 1ID3B 4JJNA 4YS3D 3A6NB 2Y2LA 3LJAA 3B6FD 5AV9D 3X1SB 2CV5A 3MGQC 3AFAD 3AN2C 2F8NH 4JJNC 1HQ3B 3AV2A 2HIOA 3P5JB 4Z2MH 3X1VA 3AZJD 1P3KC 3LJAC 2FFFB 5CP6D 4XZQC 3KSYA 2HIOC 1KX5C 3X1VC 4H9NA 3C1BA 2Y2GA 5AVBC 3KUYA 3C1CB 1H3OA 5B24A 3AYWD 2RVQC 3KXBB 2ZY4A 3TU4D 1BH9B 3C1BC 4ZBJB 5B2IC 1BH8B 2G5IC 3KWQA 1P3AA 3AZFD 5AV8B 5B24C 2AROB 3W99D 3FDDA 3X1UD 1ZLAB 3KWQC 2BG1A 5B1MA 1P3GB 1P3AC 4WJ3C 4J8WA 3REHD 5B1LD 4R8PB 1M1AB 2FJ7D 5GSUB 5BO0A 3REKC 3UTAA 3UT9D 5B1MC 4NFTA 2PYOB 5CPIC 1P3PB 3W96B 4J8VA 5B31B 1P3LD 1P3FD 3WA9D 4ZUXD 4LD9B 2BYMA 3MGRA 1U35B 5AVCA 2HUEB 4KUDA 2F2AC 1EQZD 1F66D 3MNNA 3WAAD 4X23B 1TAFB 2NZDA 1AOIA 2F8ND 4WU8B 3MGRC 5AVCC 4E44A 3LELA 3LZ0B 2YFVA 2NZDC 1AOIC 3UTBB 3MVDD 3AZNC 5B31G 3VH6A 1P3MB 3AZIC 5B0YD 1P3OB 3MGQD 3AN2D 4YM6D 5CPJD 5AV6A 3LJAD 5DNNB 2CV5D 1P3IB 2NQBB 1KX4B 3AV2D 4WU9A 2HIOD 5CPKB 3X1TC 3B6GD 5AV6C 5FUGA 3REIC 4WU9C 2RVQD 3REJB 3C1BD 3KUYD 1KX3B 1WWIA 4G91B 3O62A 3RELA 3X1SC 4XUJA 1TZYA 4J8XB 3AV1A 1P3AD 3O62C 2Y2HA 1TZYC 5B1MD 5B33A 3AV1C 4J8WD 3UTAD 5JA4A 3AZGA 3W97D 5F99B 5AY8D 2ZY2A 2AROA 5GT3D 3KFUG 5B32A 4ZBJC 4CSRA 4J8VD 3W97B 3AZEB 5AY8B 5GT3B 2AROC 4UPKA 3MGRD 4KUDD 5AVCD 4H9PA 3AZKB 3WTPB 5AV5B 3MNND 1JFIA 1ZLAC 5BS7C 5B2JA 2NZDD 5B0ZA 5GSUC 5B31A 5B40B 1M18D 3NQJA 3LELD 3W98A 3AZHB 1PZRA 5B2JC 3WKJA 2YFWA 4LD9A 5B0ZC 3W96C 5KDMB 1M18B 5B31C 4J8UD 1M19D 4H9OB 3V9RA 3W98C 1TAFA 5BT1C 3WKJC 1P3KA 2ZM5A 4LD9C 4WU8A 4J8UB 4HGAC 3MGPB 3LZ0A 4X23C 3MGSA 4YS3B 4XZQA 1KX5A 1ULYA 3B6FB 5AV9B 4WU8C 5G49A 3LZ1A 2JSSA 3AFAB 5BNVB 5AVBA 3LZ0C 3MGSC 3AZJB 4H9QB 3B0DB 1T3UA 3UTBC 4QLCA 5CP6B 3LZ1C 5B2IA 3WTPE 1P3MC 3VH5T 4CAYB 4QLCC 2JE5A 4KHAB 3AYWB 3RELD 3TU4B 3O62D 4XUJD 1TZYD 1P3IC 2IO5C 3REKA 1P34D 5E5AD 3AV1D 1KX4C 3AZFB 4WZSB 4H9SA 3W99B 5CPIA 3X1UB 1P34B 2L5AA 3EG5B 5B33D 2JCHA 3AZMD 3REJC 4G92B 3REHB 4H9SC 5B1LB 2FJ7B 3B0CT 3AZGD 4UUZB 4J8XA 5JRGA 2BYKB 4EO5B 3UT9B 3AZMB 5B32D 1Z2CB 1P3BA 4KGCA 1HTAA 1P3LB 4J8XC 5JRGC 1P3FB 4KGCC 1P3BC 3WA9B 4ZUXB 1EQZB 5B2JD 3AZNA 1F66B 3WAAB 3H0MC 5B0ZD 2F8NB 3EPLA 3AZIA 4Z66A 1N1JB 3W98D 4H9RA 3WKJD 3VH6T 4NE6A 3AZLA 4Z66C 3MVDB 4Z5TA 4JJND 2Y2OA 2DQNC 2Y2NA 3X1TA 1P3KD 5GXQA 5BNXB 5B0YB 1S32A 3NQUB 3MGQB 3REIA 3VH5W 3AZLC 3AN2B 4Z5TC 4YM6B 4JJNB 5CPJB 4XZQD 3LJAB 1KX5D 3X1VD 5GXQC 5KDMA 3LZ1D 2CV5B 5B40C 5DNMA 1S32C 2F8NG 2Y2QA 5AVBD 4Z2MG 5GT0A 3AV2B 2HIOB 1ID3A 3B6GB 3A6NA 2CWEA 4QLCD 3X1SA 5DNMC 5B2ID 5GT0C 1ID3C 1HQ3A 5B24D 3A6NC 3B6FA 4H9NB 2G5HC 3C1BB 3KUYB 5BNVA 1R4VA 3KWQD 1H3OB 4YS3C 1HQ3C 3AZJA 3B6FC 3REKD 3C1CA 1P3AB 3AZJC 3KXBA 3B0DC 5CPID 1BH9A 1KU5A 5B1MB 3H0LC 1BH8A 3C1CC 4J8WB 3AYWA 5AV8A 3KXBC 5BO0B 3UTAB 3IP4C 5JRGD 1ZLAA 3AZFA 1P3GA 3AYWC 5BS7A 5AV8C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3R45 B;  4R8P A;  1M1A A;  5GSU A;  5C3I B;  4J8V B;  3AZF C;  1P3G C;  3REH A;  2PYO A;  1AOI D;  1P3P A;  4R8P C;  3W96 A;  3MGR B;  4DRA A;  4NE3 A;  5AVC B;  1M1A C;  4KUD B;  3MNN B;  3AZN D;  2NZD B;  4G92 C;  3REH C;  5B1L C;  2PYO C;  3AZI D;  1P3P C;  4Z66 D;  1U35 A;  3LEL B;  2YFV B;  4E45 A;  4X23 A;  3WA9 A;  3AZL D;  4WNN B;  4Z5T D;  1P3L C;  1U35 C;  1M19 B;  2HUE C;  1F66 A;  5CHL B;  3X1T D;  5AV6 D;  5GXQ D;  3WA9 C;  1S32 D;  3REI D;  3UTB A;  1EQZ C;  1F66 C;  3WAA C;  5AV6 B;  4WU9 D;  1P3M A;  5DNM D;  1P3O A;  4M6B A;  5GT0 D;  1ID3 D;  3A6N D;  5FUG B;  5DNN A;  3X1S D;  3NQU A;  4AWL B;  1P3I A;  1P3O C;  4YM6 A;  2NQB A;  5CPJ A;  1KX4 A;  1HQ3 D;  5CPK A;  5B0Y C;  5DNN C;  4YM6 C;  2NQB C;  5CPJ C;  3B6G A;  5CPK C;  3REL B;  3O62 B;  3REJ A;  4XUJ B;  2CV5 C;  1TZY B;  5E5A B;  3C1C D;  3AV1 B;  3AV2 C;  1KX3 A;  3B6G C;  3KXB D;  5B33 B;  1KX3 C;  1Q9C A;  3VH5 A;  5AV8 D;  2ARO D;  1F1E A;  5JA4 B;  4G91 C;  3AZG B;  3KUY C;  1ZLA D;  1P3G D;  4WV4 B;  5B32 B;  4R8P D;  1M1A D;  5GSU D;  4CSR B;  5F99 A;  4DRB A;  2PYO D;  1P3P D;  1BFM A;  3W96 D;  4H9P B;  3W97 A;  5B31 D;  1JFI B;  3AZE A;  5AY8 A;  5B2J B;  5F99 C;  4J8W C;  5GT3 A;  3R45 A;  5BT1 D;  5B0Z B;  4LD9 D;  3UTA C;  1B6W A;  1U35 D;  3NQJ B;  3W97 C;  3W98 B;  3AZK A;  3WTP A;  5AV5 A;  3AZE C;  5AY8 C;  3WKJ B;  4X23 D;  2YFW B;  5GT3 C;  4NE5 A;  5B32 G;  4HGA B;  4J8V C;  5C3I C;  4WU8 D;  5B40 A;  3V9R B;  3AZK C;  3WTP C;  5AV5 C;  3AZH A;  3LZ0 D;  3MGS D;  1P3K B;  3UTB D;  4KUD C;  1M18 A;  3MNN C;  4H9O A;  3MGS B;  4XZQ B;  3AZH C;  1P3M D;  1KX5 B;  3X1V B;  4WNN A;  5G49 B;  3LZ1 B;  1P3O D;  4J8U A;  3MGP A;  1M19 A;  1M18 C;  5AVB B;  3LEL C;  4YS3 A;  5DNN D;  5AV9 A;  4QLC B;  1P3I D;  4J8U C;  2NQB D;  3MGP C;  5B2I B;  1M19 C;  3B0C W;  1KX4 D;  3AFA A;  5CPK D;  5B24 B;  4H9Q A;  2IO5 B;  5AV9 C;  5CP6 A;  3AFA C;  3KWQ B;  3REJ D;  3REK B;  4CAY A;  1B67 A;  5CP6 C;  1KX3 D;  1WWS A;  4KHA A;  3TU4 A;  5CPI B;  1P3B D;  4AWL C;  4J8X D;  4KGC D;  1A7W A;  3TU4 C;  3W99 A;  3X1U A;  1P34 A;  3VH6 W;  5E5A A;  2F8N K;  5JRG B;  4KGC B;  1P3B B;  3REL C;  2BYM B;  3W99 C;  5B1L A;  4XUJ C;  2FJ7 A;  3X1U C;  1P34 C;  5E5A C;  4UUZ A;  5F99 D;  3UT9 A;  2BYK A;  3AZM A;  1AOI B;  2FJ7 C;  5B33 C;  3AZE D;  1P3L A;  3AZN B;  2LY8 A;  3UT9 C;  4EO5 C;  3AZM C;  1P3F A;  4ZUX A;  3AZG C;  3AZI B;  4Z66 B;  3AZK D;  3WTP D;  4H9R B;  5AV5 D;  1EQZ A;  3WAA A;  5B32 C;  1P3F C;  4ZUX C;  3AZL B;  2F8N A;  5B40 D;  4Z5T B;  1N1J A;  3AZH D;  3X1T B;  5GXQ B;  1S32 B;  3REI B;  3B0B A;  3MVD A;  4WU9 B;  5BNX A;  5DNM B;  5B0Y A;  3MGP D;  3MGQ A;  3MVD C;  5GT0 B;  3AN2 A;  1ID3 B;  4JJN A;  4YS3 D;  3A6N B;  3LJA A;  3B6F D;  5AV9 D;  3X1S B;  2CV5 A;  3MGQ C;  3AFA D;  3AN2 C;  2F8N H;  4JJN C;  1HQ3 B;  3AV2 A;  2HIO A;  4Z2M H;  3X1V A;  3AZJ D;  1P3K C;  3LJA C;  5CP6 D;  4XZQ C;  3KSY A;  2HIO C;  1KX5 C;  3X1V C;  4H9N A;  3C1B A;  5AVB C;  3KUY A;  3C1C B;  1H3O A;  5B24 A;  3AYW D;  2RVQ C;  3KXB B;  3TU4 D;  1BH9 B;  3C1B C;  4ZBJ B;  5B2I C;  1BH8 B;  3KWQ A;  1P3A A;  3AZF D;  5AV8 B;  5B24 C;  2ARO B;  3W99 D;  3X1U D;  1ZLA B;  3KWQ C;  5B1M A;  1P3G B;  1P3A C;  4J8W A;  3REH D;  5B1L D;  4R8P B;  1M1A B;  2FJ7 D;  5GSU B;  5BO0 A;  3REK C;  3UTA A;  3UT9 D;  5B1M C;  4NFT A;  2PYO B;  5CPI C;  1P3P B;  3W96 B;  4J8V A;  5B31 B;  1P3L D;  1P3F D;  3WA9 D;  4ZUX D;  4LD9 B;  2BYM A;  3MGR A;  1U35 B;  5AVC A;  2HUE B;  4KUD A;  1EQZ D;  1F66 D;  3MNN A;  3WAA D;  4X23 B;  1TAF B;  2NZD A;  1AOI A;  2F8N D;  4WU8 B;  3MGR C;  5AVC C;  4E44 A;  3LEL A;  3LZ0 B;  2YFV A;  2NZD C;  1AOI C;  3UTB B;  3MVD D;  3AZN C;  5B31 G;  3VH6 A;  1P3M B;  3AZI C;  5B0Y D;  1P3O B;  3MGQ D;  3AN2 D;  4YM6 D;  5CPJ D;  5AV6 A;  3LJA D;  5DNN B;  2CV5 D;  1P3I B;  2NQB B;  1KX4 B;  3AV2 D;  4WU9 A;  2HIO D;  5CPK B;  3X1T C;  3B6G D;  5AV6 C;  5FUG A;  3REI C;  4WU9 C;  2RVQ D;  3REJ B;  3C1B D;  3KUY D;  1KX3 B;  1WWI A;  4G91 B;  3O62 A;  3REL A;  3X1S C;  4XUJ A;  1TZY A;  4J8X B;  3AV1 A;  1P3A D;  3O62 C;  1TZY C;  5B1M D;  5B33 A;  3AV1 C;  4J8W D;  3UTA D;  5JA4 A;  3AZG A;  3W97 D;  5F99 B;  5AY8 D;  2ARO A;  5GT3 D;  5B32 A;  4ZBJ C;  4CSR A;  4J8V D;  3W97 B;  3AZE B;  5AY8 B;  5GT3 B;  2ARO C;  3MGR D;  4KUD D;  5AVC D;  4H9P A;  3AZK B;  3WTP B;  5AV5 B;  3MNN D;  1JFI A;  1ZLA C;  5BS7 C;  5B2J A;  2NZD D;  5B0Z A;  5GSU C;  5B31 A;  5B40 B;  1M18 D;  3NQJ A;  3LEL D;  3W98 A;  3AZH B;  5B2J C;  3WKJ A;  2YFW A;  4LD9 A;  5B0Z C;  3W96 C;  5KDM B;  1M18 B;  5B31 C;  4J8U D;  1M19 D;  4H9O B;  3V9R A;  3W98 C;  1TAF A;  5BT1 C;  3WKJ C;  1P3K A;  4LD9 C;  4WU8 A;  4J8U B;  4HGA C;  3MGP B;  3LZ0 A;  4X23 C;  3MGS A;  4YS3 B;  4XZQ A;  1KX5 A;  1ULY A;  3B6F B;  5AV9 B;  4WU8 C;  5G49 A;  3LZ1 A;  2JSS A;  3AFA B;  5BNV B;  5AVB A;  3LZ0 C;  3MGS C;  3AZJ B;  4H9Q B;  3B0D B;  3UTB C;  4QLC A;  5CP6 B;  3LZ1 C;  5B2I A;  3WTP E;  1P3M C;  3VH5 T;  4CAY B;  4QLC C;  4KHA B;  3AYW B;  3REL D;  3TU4 B;  3O62 D;  4XUJ D;  1TZY D;  1P3I C;  2IO5 C;  3REK A;  1P34 D;  5E5A D;  3AV1 D;  1KX4 C;  3AZF B;  4WZS B;  4H9S A;  3W99 B;  5CPI A;  3X1U B;  1P34 B;  2L5A A;  5B33 D;  3AZM D;  3REJ C;  4G92 B;  3REH B;  4H9S C;  5B1L B;  2FJ7 B;  3B0C T;  3AZG D;  4UUZ B;  4J8X A;  5JRG A;  2BYK B;  4EO5 B;  3UT9 B;  3AZM B;  5B32 D;  4KGC A;  1P3B A;  1HTA A;  1P3L B;  4J8X C;  5JRG C;  1P3F B;  4KGC C;  1P3B C;  3WA9 B;  4ZUX B;  1EQZ B;  5B2J D;  3AZN A;  1F66 B;  3WAA B;  5B0Z D;  2F8N B;  3AZI A;  4Z66 A;  1N1J B;  3W98 D;  4H9R A;  3WKJ D;  3VH6 T;  4NE6 A;  3AZL A;  4Z66 C;  3MVD B;  4Z5T A;  4JJN D;  3X1T A;  1P3K D;  5GXQ A;  5BNX B;  5B0Y B;  1S32 A;  3NQU B;  3MGQ B;  3REI A;  3VH5 W;  3AZL C;  3AN2 B;  4Z5T C;  4YM6 B;  4JJN B;  5CPJ B;  4XZQ D;  3LJA B;  1KX5 D;  3X1V D;  5GXQ C;  5KDM A;  3LZ1 D;  2CV5 B;  5B40 C;  5DNM A;  1S32 C;  2F8N G;  5AVB D;  4Z2M G;  5GT0 A;  3AV2 B;  2HIO B;  1ID3 A;  3B6G B;  3A6N A;  2CWE A;  4QLC D;  3X1S A;  5DNM C;  5B2I D;  5GT0 C;  1ID3 C;  1HQ3 A;  5B24 D;  3A6N C;  3B6F A;  4H9N B;  3C1B B;  3KUY B;  5BNV A;  1R4V A;  3KWQ D;  1H3O B;  4YS3 C;  1HQ3 C;  3AZJ A;  3B6F C;  3REK D;  3C1C A;  1P3A B;  3AZJ C;  3KXB A;  3B0D C;  5CPI D;  1BH9 A;  1KU5 A;  5B1M B;  1BH8 A;  3C1C C;  4J8W B;  3AYW A;  5AV8 A;  3KXB C;  5BO0 B;  3UTA B;  5JRG D;  1ZLA A;  3AZF A;  1P3G A;  3AYW C;  5BS7 A;  5AV8 C; 
#chains in the Genus database with same CATH topology
 3R45 B;  4R8P A;  1M1A A;  5GSU A;  5C3I B;  4J8V B;  3AZF C;  1P3G C;  3REH A;  2PYO A;  1AOI D;  1P3P A;  4R8P C;  3W96 A;  3MGR B;  4DRA A;  4NE3 A;  5AVC B;  1M1A C;  4KUD B;  3AL0 C;  2DF4 C;  3MNN B;  3AZN D;  2NZD B;  4G92 C;  3REH C;  5B1L C;  2PYO C;  3AZI D;  1P3P C;  2ZY3 A;  4Z66 D;  4DQY B;  1U35 A;  3LEL B;  2YFV B;  4E45 A;  4X23 A;  3WA9 A;  3AZL D;  4WNN B;  4Z5T D;  1P3L C;  2XD5 A;  1U35 C;  1M19 B;  2HUE C;  1F66 A;  5CHL B;  3X1T D;  5AV6 D;  5GXQ D;  3WA9 C;  1S32 D;  3REI D;  3UTB A;  2XD1 A;  1EQZ C;  1F66 C;  2Y2J A;  3WAA C;  5AV6 B;  4WU9 D;  1P3M A;  2RIQ A;  5DNM D;  1P3O A;  4M6B A;  5GT0 D;  1ID3 D;  3A6N D;  5FUG B;  5DNN A;  3X1S D;  3NQU A;  4AWL B;  1P3I A;  1P3O C;  2Y2P A;  4YM6 A;  2NQB A;  5CPJ A;  1KX4 A;  1HQ3 D;  2Y2I A;  5CPK A;  5B0Y C;  5DNN C;  3EPJ A;  4YM6 C;  2NQB C;  5CPJ C;  3B6G A;  2UWX A;  5CPK C;  3REL B;  3O62 B;  3REJ A;  4XUJ B;  2CV5 C;  1TZY B;  5E5A B;  3C1C D;  3AV1 B;  3AV2 C;  1KX3 A;  3B6G C;  3KXB D;  5B33 B;  1KX3 C;  1Q9C A;  3VH5 A;  5AV8 D;  2ARO D;  1F1E A;  5JA4 B;  4G91 C;  3AZG B;  3KUY C;  1ZLA D;  1P3G D;  1W2E A;  4WV4 B;  5B32 B;  4R8P D;  1M1A D;  5GSU D;  4CSR B;  3A1K A;  5F99 A;  4DRB A;  2PYO D;  1P3P D;  1BFM A;  3W96 D;  4H9P B;  3W97 A;  5B31 D;  1JFI B;  3AZE A;  5AY8 A;  5B2J B;  5F99 C;  4J8W C;  5GT3 A;  3R45 A;  2W8S A;  5BT1 D;  5B0Z B;  4LD9 D;  2Y2K A;  3UTA C;  1B6W A;  1U35 D;  3NQJ B;  3W97 C;  3W98 B;  3AZK A;  3WTP A;  5AV5 A;  3AZE C;  5AY8 C;  3WKJ B;  4X23 D;  2YFW B;  5GT3 C;  4NE5 A;  5B32 G;  4HGA B;  3A1I A;  4J8V C;  5C3I C;  4WU8 D;  5B40 A;  3V9R B;  3AZK C;  3WTP C;  5AV5 C;  3AZH A;  3LZ0 D;  3MGS D;  1P3K B;  2J8P A;  3UTB D;  4KUD C;  1M18 A;  3MNN C;  4H9O A;  3MGS B;  2ZY5 A;  4XZQ B;  3AZH C;  1P3M D;  1KX5 B;  3X1V B;  4WNN A;  5G49 B;  3LZ1 B;  1P3O D;  4J8U A;  3MGP A;  1M19 A;  1M18 C;  5AVB B;  3LEL C;  4YS3 A;  5DNN D;  5AV9 A;  4QLC B;  1P3I D;  3EPK A;  4J8U C;  3MGP C;  5B2I B;  1M19 C;  3B0C W;  1KX4 D;  3AFA A;  2NQB D;  5CPK D;  5B24 B;  4H9Q A;  2IO5 B;  5AV9 C;  2Y2M A;  5CP6 A;  3AFA C;  3KWQ B;  3REJ D;  3REK B;  4CAY A;  1B67 A;  5CP6 C;  1KX3 D;  1WWS A;  4KHA A;  3TU4 A;  3F6T A;  5CPI B;  1P3B D;  4AWL C;  4J8X D;  3H0R C;  4KGC D;  1A7W A;  3TU4 C;  3W99 A;  3X1U A;  1P34 A;  3VH6 W;  5E5A A;  2F8N K;  5JRG B;  4KGC B;  1P3B B;  3REL C;  2BYM B;  3W99 C;  5B1L A;  4XUJ C;  2FJ7 A;  3X1U C;  1P34 C;  5E5A C;  4UUZ A;  5F99 D;  3UT9 A;  2BYK A;  3AZM A;  1AOI B;  3EPH A;  2FJ7 C;  2VQR A;  5B33 C;  3AZE D;  1P3L A;  3AZN B;  2LY8 A;  3UT9 C;  4EO5 C;  3AZM C;  1P3F A;  4ZUX A;  3AZG C;  3AZI B;  4Z66 B;  3AZK D;  3WTP D;  4H9R B;  5AV5 D;  1EQZ A;  3WAA A;  5B32 C;  1P3F C;  4ZUX C;  3AZL B;  2F8N A;  5B40 D;  4Z5T B;  1N1J A;  3AZH D;  3X1T B;  5GXQ B;  1S32 B;  3REI B;  3B0B A;  3MVD A;  4WU9 B;  5BNX A;  5DNM B;  5B0Y A;  3MGP D;  3MGQ A;  3MVD C;  5GT0 B;  3AN2 A;  1ID3 B;  4JJN A;  4YS3 D;  3A6N B;  2Y2L A;  3LJA A;  3B6F D;  5AV9 D;  3X1S B;  2CV5 A;  3MGQ C;  3AFA D;  3AN2 C;  2F8N H;  4JJN C;  1HQ3 B;  3AV2 A;  2HIO A;  3P5J B;  4Z2M H;  3X1V A;  3AZJ D;  1P3K C;  3LJA C;  2FFF B;  5CP6 D;  4XZQ C;  3KSY A;  2HIO C;  1KX5 C;  3X1V C;  4H9N A;  3C1B A;  2Y2G A;  5AVB C;  3KUY A;  3C1C B;  1H3O A;  5B24 A;  3AYW D;  2RVQ C;  3KXB B;  2ZY4 A;  3TU4 D;  1BH9 B;  3C1B C;  4ZBJ B;  5B2I C;  1BH8 B;  2G5I C;  3KWQ A;  1P3A A;  3AZF D;  5AV8 B;  5B24 C;  2ARO B;  3W99 D;  3FDD A;  3X1U D;  1ZLA B;  3KWQ C;  2BG1 A;  5B1M A;  1P3G B;  1P3A C;  4WJ3 C;  4J8W A;  3REH D;  5B1L D;  4R8P B;  1M1A B;  2FJ7 D;  5GSU B;  5BO0 A;  3REK C;  3UTA A;  3UT9 D;  5B1M C;  4NFT A;  2PYO B;  5CPI C;  1P3P B;  3W96 B;  4J8V A;  5B31 B;  1P3L D;  1P3F D;  3WA9 D;  4ZUX D;  4LD9 B;  2BYM A;  3MGR A;  1U35 B;  5AVC A;  2HUE B;  4KUD A;  2F2A C;  1EQZ D;  1F66 D;  3MNN A;  3WAA D;  4X23 B;  1TAF B;  2NZD A;  1AOI A;  2F8N D;  4WU8 B;  3MGR C;  5AVC C;  4E44 A;  3LEL A;  3LZ0 B;  2YFV A;  2NZD C;  1AOI C;  3UTB B;  3MVD D;  3AZN C;  5B31 G;  3VH6 A;  1P3M B;  3AZI C;  5B0Y D;  1P3O B;  3MGQ D;  3AN2 D;  4YM6 D;  5CPJ D;  5AV6 A;  3LJA D;  5DNN B;  2CV5 D;  1P3I B;  2NQB B;  1KX4 B;  3AV2 D;  4WU9 A;  2HIO D;  5CPK B;  3X1T C;  3B6G D;  5AV6 C;  5FUG A;  3REI C;  4WU9 C;  2RVQ D;  3REJ B;  3C1B D;  3KUY D;  1KX3 B;  1WWI A;  4G91 B;  3O62 A;  3REL A;  3X1S C;  4XUJ A;  1TZY A;  4J8X B;  3AV1 A;  1P3A D;  3O62 C;  2Y2H A;  1TZY C;  5B1M D;  5B33 A;  3AV1 C;  4J8W D;  3UTA D;  5JA4 A;  3AZG A;  3W97 D;  5F99 B;  5AY8 D;  2ZY2 A;  2ARO A;  5GT3 D;  3KFU G;  5B32 A;  4ZBJ C;  4CSR A;  4J8V D;  3W97 B;  3AZE B;  5AY8 B;  5GT3 B;  2ARO C;  4UPK A;  3MGR D;  4KUD D;  5AVC D;  4H9P A;  3AZK B;  3WTP B;  5AV5 B;  3MNN D;  1JFI A;  1ZLA C;  5BS7 C;  5B2J A;  2NZD D;  5B0Z A;  5GSU C;  5B31 A;  5B40 B;  1M18 D;  3NQJ A;  3LEL D;  3W98 A;  3AZH B;  1PZR A;  5B2J C;  3WKJ A;  2YFW A;  4LD9 A;  5B0Z C;  3W96 C;  5KDM B;  1M18 B;  5B31 C;  4J8U D;  1M19 D;  4H9O B;  3V9R A;  3W98 C;  1TAF A;  5BT1 C;  3WKJ C;  1P3K A;  2ZM5 A;  4LD9 C;  4WU8 A;  4J8U B;  4HGA C;  3MGP B;  3LZ0 A;  4X23 C;  3MGS A;  4YS3 B;  4XZQ A;  1KX5 A;  1ULY A;  3B6F B;  5AV9 B;  4WU8 C;  5G49 A;  3LZ1 A;  2JSS A;  3AFA B;  5BNV B;  5AVB A;  3LZ0 C;  3MGS C;  3AZJ B;  4H9Q B;  3B0D B;  1T3U A;  3UTB C;  4QLC A;  5CP6 B;  3LZ1 C;  5B2I A;  3WTP E;  1P3M C;  3VH5 T;  4CAY B;  4QLC C;  2JE5 A;  4KHA B;  3AYW B;  3REL D;  3TU4 B;  3O62 D;  4XUJ D;  1TZY D;  1P3I C;  2IO5 C;  3REK A;  1P34 D;  5E5A D;  3AV1 D;  1KX4 C;  3AZF B;  4WZS B;  4H9S A;  3W99 B;  5CPI A;  3X1U B;  1P34 B;  2L5A A;  3EG5 B;  5B33 D;  2JCH A;  3AZM D;  3REJ C;  4G92 B;  3REH B;  4H9S C;  5B1L B;  2FJ7 B;  3B0C T;  3AZG D;  4UUZ B;  4J8X A;  5JRG A;  2BYK B;  4EO5 B;  3UT9 B;  3AZM B;  5B32 D;  1Z2C B;  1P3B A;  4KGC A;  1HTA A;  1P3L B;  4J8X C;  5JRG C;  1P3F B;  4KGC C;  1P3B C;  3WA9 B;  4ZUX B;  1EQZ B;  5B2J D;  3AZN A;  1F66 B;  3WAA B;  3H0M C;  5B0Z D;  2F8N B;  3EPL A;  3AZI A;  4Z66 A;  1N1J B;  3W98 D;  4H9R A;  3WKJ D;  3VH6 T;  4NE6 A;  3AZL A;  4Z66 C;  3MVD B;  4Z5T A;  4JJN D;  2Y2O A;  2DQN C;  2Y2N A;  3X1T A;  1P3K D;  5GXQ A;  5BNX B;  5B0Y B;  1S32 A;  3NQU B;  3MGQ B;  3REI A;  3VH5 W;  3AZL C;  3AN2 B;  4Z5T C;  4YM6 B;  4JJN B;  5CPJ B;  4XZQ D;  3LJA B;  1KX5 D;  3X1V D;  5GXQ C;  5KDM A;  3LZ1 D;  2CV5 B;  5B40 C;  5DNM A;  1S32 C;  2F8N G;  2Y2Q A;  5AVB D;  4Z2M G;  5GT0 A;  3AV2 B;  2HIO B;  1ID3 A;  3B6G B;  3A6N A;  2CWE A;  4QLC D;  3X1S A;  5DNM C;  5B2I D;  5GT0 C;  1ID3 C;  1HQ3 A;  5B24 D;  3A6N C;  3B6F A;  4H9N B;  2G5H C;  3C1B B;  3KUY B;  5BNV A;  1R4V A;  3KWQ D;  1H3O B;  4YS3 C;  1HQ3 C;  3AZJ A;  3B6F C;  3REK D;  3C1C A;  1P3A B;  3AZJ C;  3KXB A;  3B0D C;  5CPI D;  1BH9 A;  1KU5 A;  5B1M B;  3H0L C;  1BH8 A;  3C1C C;  4J8W B;  3AYW A;  5AV8 A;  3KXB C;  5BO0 B;  3UTA B;  3IP4 C;  5JRG D;  1ZLA A;  3AZF A;  1P3G A;  3AYW C;  5BS7 A;  5AV8 C; 
#chains in the Genus database with same CATH homology
 3R45 B;  4R8P A;  1M1A A;  5GSU A;  5C3I B;  4J8V B;  3AZF C;  1P3G C;  3REH A;  2PYO A;  1AOI D;  1P3P A;  4R8P C;  3W96 A;  3MGR B;  4DRA A;  4NE3 A;  5AVC B;  1M1A C;  4KUD B;  3AL0 C;  2DF4 C;  3MNN B;  3AZN D;  2NZD B;  4G92 C;  3REH C;  5B1L C;  2PYO C;  3AZI D;  1P3P C;  2ZY3 A;  4Z66 D;  4DQY B;  1U35 A;  3LEL B;  2YFV B;  4E45 A;  4X23 A;  3WA9 A;  3AZL D;  4WNN B;  4Z5T D;  1P3L C;  2XD5 A;  1U35 C;  1M19 B;  2HUE C;  1F66 A;  5CHL B;  3X1T D;  5AV6 D;  5GXQ D;  3WA9 C;  1S32 D;  3REI D;  3UTB A;  2XD1 A;  1EQZ C;  1F66 C;  2Y2J A;  3WAA C;  5AV6 B;  4WU9 D;  1P3M A;  2RIQ A;  5DNM D;  1P3O A;  4M6B A;  5GT0 D;  1ID3 D;  3A6N D;  5FUG B;  5DNN A;  3X1S D;  3NQU A;  4AWL B;  1P3I A;  1P3O C;  2Y2P A;  4YM6 A;  2NQB A;  5CPJ A;  1KX4 A;  1HQ3 D;  2Y2I A;  5CPK A;  5B0Y C;  5DNN C;  3EPJ A;  4YM6 C;  2NQB C;  5CPJ C;  3B6G A;  2UWX A;  5CPK C;  3REL B;  3O62 B;  3REJ A;  4XUJ B;  2CV5 C;  1TZY B;  5E5A B;  3C1C D;  3AV1 B;  3AV2 C;  1KX3 A;  3B6G C;  3KXB D;  5B33 B;  1KX3 C;  1Q9C A;  3VH5 A;  5AV8 D;  2ARO D;  1F1E A;  5JA4 B;  4G91 C;  3AZG B;  3KUY C;  1ZLA D;  1P3G D;  1W2E A;  4WV4 B;  5B32 B;  4R8P D;  1M1A D;  5GSU D;  4CSR B;  3A1K A;  5F99 A;  4DRB A;  2PYO D;  1P3P D;  1BFM A;  3W96 D;  4H9P B;  3W97 A;  5B31 D;  1JFI B;  3AZE A;  5AY8 A;  5B2J B;  5F99 C;  4J8W C;  5GT3 A;  3R45 A;  2W8S A;  5BT1 D;  5B0Z B;  4LD9 D;  2Y2K A;  3UTA C;  1B6W A;  1U35 D;  3NQJ B;  3W97 C;  3W98 B;  3AZK A;  3WTP A;  5AV5 A;  3AZE C;  5AY8 C;  3WKJ B;  4X23 D;  2YFW B;  5GT3 C;  4NE5 A;  5B32 G;  4HGA B;  3A1I A;  4J8V C;  5C3I C;  4WU8 D;  5B40 A;  3V9R B;  3AZK C;  3WTP C;  5AV5 C;  3AZH A;  3LZ0 D;  3MGS D;  1P3K B;  2J8P A;  3UTB D;  4KUD C;  1M18 A;  3MNN C;  4H9O A;  3MGS B;  2ZY5 A;  4XZQ B;  3AZH C;  1P3M D;  1KX5 B;  3X1V B;  4WNN A;  5G49 B;  3LZ1 B;  1P3O D;  4J8U A;  3MGP A;  1M19 A;  1M18 C;  5AVB B;  3LEL C;  4YS3 A;  5DNN D;  5AV9 A;  4QLC B;  1P3I D;  3EPK A;  4J8U C;  3MGP C;  5B2I B;  1M19 C;  3B0C W;  1KX4 D;  3AFA A;  2NQB D;  5CPK D;  5B24 B;  4H9Q A;  2IO5 B;  5AV9 C;  2Y2M A;  5CP6 A;  3AFA C;  3KWQ B;  3REJ D;  3REK B;  4CAY A;  1B67 A;  5CP6 C;  1KX3 D;  1WWS A;  4KHA A;  3TU4 A;  3F6T A;  5CPI B;  1P3B D;  4AWL C;  4J8X D;  3H0R C;  4KGC D;  1A7W A;  3TU4 C;  3W99 A;  3X1U A;  1P34 A;  3VH6 W;  5E5A A;  2F8N K;  5JRG B;  4KGC B;  1P3B B;  3REL C;  2BYM B;  3W99 C;  5B1L A;  4XUJ C;  2FJ7 A;  3X1U C;  1P34 C;  5E5A C;  4UUZ A;  5F99 D;  3UT9 A;  2BYK A;  3AZM A;  1AOI B;  3EPH A;  2FJ7 C;  2VQR A;  5B33 C;  3AZE D;  1P3L A;  3AZN B;  2LY8 A;  3UT9 C;  4EO5 C;  3AZM C;  1P3F A;  4ZUX A;  3AZG C;  3AZI B;  4Z66 B;  3AZK D;  3WTP D;  4H9R B;  5AV5 D;  1EQZ A;  3WAA A;  5B32 C;  1P3F C;  4ZUX C;  3AZL B;  2F8N A;  5B40 D;  4Z5T B;  1N1J A;  3AZH D;  3X1T B;  5GXQ B;  1S32 B;  3REI B;  3B0B A;  3MVD A;  4WU9 B;  5BNX A;  5DNM B;  5B0Y A;  3MGP D;  3MGQ A;  3MVD C;  5GT0 B;  3AN2 A;  1ID3 B;  4JJN A;  4YS3 D;  3A6N B;  2Y2L A;  3LJA A;  3B6F D;  5AV9 D;  3X1S B;  2CV5 A;  3MGQ C;  3AFA D;  3AN2 C;  2F8N H;  4JJN C;  1HQ3 B;  3AV2 A;  2HIO A;  3P5J B;  4Z2M H;  3X1V A;  3AZJ D;  1P3K C;  3LJA C;  2FFF B;  5CP6 D;  4XZQ C;  3KSY A;  2HIO C;  1KX5 C;  3X1V C;  4H9N A;  3C1B A;  2Y2G A;  5AVB C;  3KUY A;  3C1C B;  1H3O A;  5B24 A;  3AYW D;  2RVQ C;  3KXB B;  2ZY4 A;  3TU4 D;  1BH9 B;  3C1B C;  4ZBJ B;  5B2I C;  1BH8 B;  2G5I C;  3KWQ A;  1P3A A;  3AZF D;  5AV8 B;  5B24 C;  2ARO B;  3W99 D;  3FDD A;  3X1U D;  1ZLA B;  3KWQ C;  2BG1 A;  5B1M A;  1P3G B;  1P3A C;  4WJ3 C;  4J8W A;  3REH D;  5B1L D;  4R8P B;  1M1A B;  2FJ7 D;  5GSU B;  5BO0 A;  3REK C;  3UTA A;  3UT9 D;  5B1M C;  4NFT A;  2PYO B;  5CPI C;  1P3P B;  3W96 B;  4J8V A;  5B31 B;  1P3L D;  1P3F D;  3WA9 D;  4ZUX D;  4LD9 B;  2BYM A;  3MGR A;  1U35 B;  5AVC A;  2HUE B;  4KUD A;  2F2A C;  1EQZ D;  1F66 D;  3MNN A;  3WAA D;  4X23 B;  1TAF B;  2NZD A;  1AOI A;  2F8N D;  4WU8 B;  3MGR C;  5AVC C;  4E44 A;  3LEL A;  3LZ0 B;  2YFV A;  2NZD C;  1AOI C;  3UTB B;  3MVD D;  3AZN C;  5B31 G;  3VH6 A;  1P3M B;  3AZI C;  5B0Y D;  1P3O B;  3MGQ D;  3AN2 D;  4YM6 D;  5CPJ D;  5AV6 A;  3LJA D;  5DNN B;  2CV5 D;  1P3I B;  2NQB B;  1KX4 B;  3AV2 D;  4WU9 A;  2HIO D;  5CPK B;  3X1T C;  3B6G D;  5AV6 C;  5FUG A;  3REI C;  4WU9 C;  2RVQ D;  3REJ B;  3C1B D;  3KUY D;  1KX3 B;  1WWI A;  4G91 B;  3O62 A;  3REL A;  3X1S C;  4XUJ A;  1TZY A;  4J8X B;  3AV1 A;  1P3A D;  3O62 C;  2Y2H A;  1TZY C;  5B1M D;  5B33 A;  3AV1 C;  4J8W D;  3UTA D;  5JA4 A;  3AZG A;  3W97 D;  5F99 B;  5AY8 D;  2ZY2 A;  2ARO A;  5GT3 D;  3KFU G;  5B32 A;  4ZBJ C;  4CSR A;  4J8V D;  3W97 B;  3AZE B;  5AY8 B;  5GT3 B;  2ARO C;  4UPK A;  3MGR D;  4KUD D;  5AVC D;  4H9P A;  3AZK B;  3WTP B;  5AV5 B;  3MNN D;  1JFI A;  1ZLA C;  5BS7 C;  5B2J A;  2NZD D;  5B0Z A;  5GSU C;  5B31 A;  5B40 B;  1M18 D;  3NQJ A;  3LEL D;  3W98 A;  3AZH B;  1PZR A;  5B2J C;  3WKJ A;  2YFW A;  4LD9 A;  5B0Z C;  3W96 C;  5KDM B;  1M18 B;  5B31 C;  4J8U D;  1M19 D;  4H9O B;  3V9R A;  3W98 C;  1TAF A;  5BT1 C;  3WKJ C;  1P3K A;  2ZM5 A;  4LD9 C;  4WU8 A;  4J8U B;  4HGA C;  3MGP B;  3LZ0 A;  4X23 C;  3MGS A;  4YS3 B;  4XZQ A;  1KX5 A;  1ULY A;  3B6F B;  5AV9 B;  4WU8 C;  5G49 A;  3LZ1 A;  2JSS A;  3AFA B;  5BNV B;  5AVB A;  3LZ0 C;  3MGS C;  3AZJ B;  4H9Q B;  3B0D B;  1T3U A;  3UTB C;  4QLC A;  5CP6 B;  3LZ1 C;  5B2I A;  3WTP E;  1P3M C;  3VH5 T;  4CAY B;  4QLC C;  2JE5 A;  4KHA B;  3AYW B;  3REL D;  3TU4 B;  3O62 D;  4XUJ D;  1TZY D;  1P3I C;  2IO5 C;  3REK A;  1P34 D;  5E5A D;  3AV1 D;  1KX4 C;  3AZF B;  4WZS B;  4H9S A;  3W99 B;  5CPI A;  3X1U B;  1P34 B;  2L5A A;  3EG5 B;  5B33 D;  2JCH A;  3AZM D;  3REJ C;  4G92 B;  3REH B;  4H9S C;  5B1L B;  2FJ7 B;  3B0C T;  3AZG D;  4UUZ B;  4J8X A;  5JRG A;  2BYK B;  4EO5 B;  3UT9 B;  3AZM B;  5B32 D;  1Z2C B;  1P3B A;  4KGC A;  1HTA A;  1P3L B;  4J8X C;  5JRG C;  1P3F B;  4KGC C;  1P3B C;  3WA9 B;  4ZUX B;  1EQZ B;  5B2J D;  3AZN A;  1F66 B;  3WAA B;  3H0M C;  5B0Z D;  2F8N B;  3EPL A;  3AZI A;  4Z66 A;  1N1J B;  3W98 D;  4H9R A;  3WKJ D;  3VH6 T;  4NE6 A;  3AZL A;  4Z66 C;  3MVD B;  4Z5T A;  4JJN D;  2Y2O A;  2DQN C;  2Y2N A;  3X1T A;  1P3K D;  5GXQ A;  5BNX B;  5B0Y B;  1S32 A;  3NQU B;  3MGQ B;  3REI A;  3VH5 W;  3AZL C;  3AN2 B;  4Z5T C;  4YM6 B;  4JJN B;  5CPJ B;  4XZQ D;  3LJA B;  1KX5 D;  3X1V D;  5GXQ C;  5KDM A;  3LZ1 D;  2CV5 B;  5B40 C;  5DNM A;  1S32 C;  2F8N G;  2Y2Q A;  5AVB D;  4Z2M G;  5GT0 A;  3AV2 B;  2HIO B;  1ID3 A;  3B6G B;  3A6N A;  2CWE A;  4QLC D;  3X1S A;  5DNM C;  5B2I D;  5GT0 C;  1ID3 C;  1HQ3 A;  5B24 D;  3A6N C;  3B6F A;  4H9N B;  2G5H C;  3C1B B;  3KUY B;  5BNV A;  1R4V A;  3KWQ D;  1H3O B;  4YS3 C;  1HQ3 C;  3AZJ A;  3B6F C;  3REK D;  3C1C A;  1P3A B;  3AZJ C;  3KXB A;  3B0D C;  5CPI D;  1BH9 A;  1KU5 A;  5B1M B;  3H0L C;  1BH8 A;  3C1C C;  4J8W B;  3AYW A;  5AV8 A;  3KXB C;  5BO0 B;  3UTA B;  3IP4 C;  5JRG D;  1ZLA A;  3AZF A;  1P3G A;  3AYW C;  5BS7 A;  5AV8 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...