1P34B

Crystallographic studies of nucleosome core particles containing histone 'sin' mutants
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
83
structure length
83
Chain Sequence
KVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords Palindromic 146bp Human Alpha-Satellite DNA fragment
publication title Crystal structures of histone Sin mutant nucleosomes reveal altered protein-DNA interactions
pubmed doi rcsb
source organism Homo sapiens
total genus 26
structure length 83
sequence length 83
chains with identical sequence F
ec nomenclature
pdb deposition date 2003-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1p34B00
1ID3B 5AVCD 1JFIB 4NE3A 4J8WB 5B32A 5B40C 3VH5T 3LZ1A 4UUZB 2CWEA 3LZ1C 3V9RB 3AZFD 5B33B 5JA4A 1P3PA 4Z5TD 3W99C 3REJB 1H3OA 4XUJC 3C1BD 5G49B 4Z2MH 3AZGC 3AYWC 5B31C 1WWIA 1AOIB 4KGCA 3AZEA 3WA9D 3X1SD 3X1UA 1P3MA 1P34C 3AV1C 2CV5B 3X1UC 3MGPC 3X1VA 1P3IC 5CP6B 3AZJC 4X23C 5JRGA 1KU5A 5B1MD 4JJND 5JRGC 3MNND 3KWQB 5AV8C 3O62A 3W96B 4J8XC 4LD9B 4WU9C 3LZ1D 3REIC 3UTBA 5B2JB 1P3BB 5KDMB 3WAAA 3WAAC 3REKA 3AN2A 3WTPA 3REKC 5AVCB 3AN2C 4WNNB 4XZQA 2F8NK 3AZGD 3AZFB 3AZLA 5B31D 4ZBJB 5B2IA 3AFAC 3KUYA 3AZED 4Z5TB 1S32A 3AV1D 4WU8C 4QLCA 3X1UD 1ID3C 3C1BB 4QLCC 4J8WC 1P3ID 1P3LA 4H9NB 2HIOA 5E5AA 5JRGD 5E5AC 3X1SB 5B33C 5DNMA 2AROC 3O62D 5GT3B 3REJC 3UTBD 4DRAA 3WAAD 5B1MB 4JJNB 3MNNB 3REKD 5AY8A 3AN2D 3UTAA 5AY8C 3UTAC 4H9RA 2CV5C 3LZ1B 2F8NA 5BNVB 3AFAD 3UT9A 5B2ID 2BYMA 5B0YA 3KUYD 1P3PB 4WU8D 1S32D 4E44A 1M19A 4QLCD 3KWQC 1KX3C 4J8WD 3AZGB 5B31B 5B1LA 1P3LD 1P3BC 4KGCB 4EO5B 4KHAA 5E5AD 3AZEB 1ZLAA 5B33D 1BH9A 3X1UB 2AROD 1P3MB 1P3GA 5DNMD 5AVCC 3VH5A 5B31G 3MGRA 3B6GA 3X1VB 5AV9A 5JRGB 4ZBJC 1BH8B 3RELA 5AY8D 5CPKA 3UTAD 4Z5TC 3O62B 5CPKC 2CV5D 5F99A 3C1BC 3UTBB 2F8ND 2JSSA 3WAAB 2LY8A 3REKB 3UT9D 3AN2B 3WTPB 5B0YD 3KWQD 4ZUXC 1KX3D 3B0CT 3VH6A 5GT3C 3AZLB 4NE6A 5GXQA 5B1LD 5B2IB 3KUYB 4JJNC 1ZLAD 1S32B 4QLCB 1P3GD 1R4VA 3B6GD 3A6NA 5B32C 2BYKA 1P3LB 1P3FA 2L5AA 2IO5C 5E5AB 4J8VA 3REHA 3RELD 3REHC 2AROB 5DNMB 5CPKD 1P3PC 5GT0A 3W98A 5F99D 3AZNA 3W98C 1P3KA 2YFVA 1P3KC 2PYOA 4KGCC 5AY8B 4EO5C 3AZEC 3UTAB 1P3OA 4ZUXD 4H9SA 1P3OC 4H9RB 1P3MC 5GT3D 2F8NB 3B0CW 2FJ7A 1M1AA 3X1VC 3WKJA 3UT9B 3WKJC 5AV5A 4YM6A 2BYMB 5B0YB 1U35A 1HQ3A 1KX3B 1U35C 1M19B 1HQ3C 3O62C 5B32D 4WV4B 3A6ND 3UTBC 5B1LB 1P3FD 4KHAB 5AVBA 1ZLAB 4J8VD 3REHD 1P3GB 1P3PD 2NQBA 3WTPC 3MGRB 3NQJA 5GT0D 3B6GB 3W98D 3AZND 4XZQC 5CPJA 3KXBA 3AZLC 3AV2A 1P3KD 4KGCD 3RELB 5B2IC 3KUYC 5CPKB 1ULYA 1P3OD 1P3MD 1S32C 5F99B 4AWLB 4H9OB 3AZHA 4YS3A 3X1VD 3AZHC 1P3LC 1M1AD 3WKJD 2HIOC 4YM6D 4ZUXB 1U35D 1HQ3D 3LJAA 5BS7A 5DNMC 1N1JA 4J8UA 5GXQB 3NQUA 4E45A 3WTPD 5B24A 2NQBD 5B32B 3MGQA 4XZQD 3A6NB 3MGQC 2BYKB 5CPJD 5DNNA 1P3FB 2IO5B 5BNXA 3MGSA 5DNNC 3AZLD 4H9QA 3AV2D 4J8VB 3REHB 5GSUA 3UT9C 5JA4B 1P3AA 5GSUC 5B32G 5B0YC 5GT0B 3MVDA 3W98B 1H3OB 1M19C 3MVDC 3AZNB 3X1TA 3AZHD 3X1TC 1P3KB 5B1LC 2HIOD 2YFVB 1A7WA 5C3IC 3C1CA 1ZLAC 1B6WA 1P3OB 4HGAB 1P3GC 4KUDA 3MGRC 3AZKA 4KUDC 3B6GC 3AZKC 5CP6A 4J8UD 1M1AB 2FJ7B 4R8PA 3WKJB 5BT1C 5AV9C 4YM6B 3RELC 1U35B 1HQ3B 2RVQD 3AZMA 3R45A 3MGQD 4LD9A 5F99C 4Z66A 3KSYA 5DNND 4AWLC 4Z66C 3MGSD 3B6FA 1BFMA 5GSUD 1KX5A 1P3AD 2NQBB 3AZIA 1M19D 4WNNA 3MVDD 4XZQB 5CPJB 3AZFA 3X1TD 3AV2B 5GXQC 3C1CD 3MGRD 4KUDD 3AZKD 3AZHB 3A6NC 5B0ZA 1P3FC 2HIOB 3LZ0A 5BT1D 5AV9D 5B0ZC 4R8PD 3LZ0C 3WA9A 4J8VC 1F1EA 1M18A 3AZMD 1M18C 5GT0C 1N1JB 3AZNC 4J8UB 4Z66D 5B1MA 2YFWA 4G91B 3MNNA 1TAFA 2PYOC 1KX5D 5B24B 5B40A 5AV6A 3AZID 4H9SC 4CAYA 3MGQB 5AV6C 4HGAC 5DNNB 5BNVA 3LELA 5BNXB 3MGSB 4H9QB 5GXQD 3LELC 4G92C 4Z2MG 1F66A 3W97A 1M1AC 3WTPE 1F66C 5GSUB 2FJ7C 2NZDA 3W97C 5BO0A 1P3AB 3W99A 2NZDC 5AV5C 4YM6C 5CPIA 2F8NG 4XUJA 5CPIC 3MVDB 3AZGA 4H9PA 3X1TB 3AYWA 5B31A 1TZYA 3TU4A 5B0ZD 4CSRA 5C3IB 1TZYC 3LZ0D 3TU4C 2F8NH 4DRBA 3C1CB 5AVBC 1P34A 3AV1A 1BH9B 5FUGA 2NQBC 1M18D 4KUDB 3MGPA 3AZKB 1P3IA 3VH6T 3AZJA 4X23A 5CPJC 4R8PB 5AV9B 3KXBC 3AV2C 1BH8A 4M6BA 2PYOD 5AV8A 4J8XA 3AZMB 3R45B 5B40D 5AV6D 4WU9A 3REIA 1B67A 1WWSA 4Z66B 3LELD 4YS3C 2HUEB 3VH5W 2FJ7D 1F66D 3B6FB 3W97D 2NZDD 5AV5D 1KX5B 3W99D 5CPID 3AZIB 1KX4A 4XUJD 3LJAC 5BS7C 1KX4C 1EQZA 1EQZC 3AYWD 3B0DC 1TZYD 3AFAA 4J8UC 3TU4D 5AVBD 4WU8A 4G91C 1P34D 1ID3A 1JFIA 2RVQC 4J8WA 5B24C 3MGPD 4UUZA 3V9RA 3AZJD 4X23D 3KXBD 1Q9CA 5B0ZB 3LZ0B 3MGSC 3WA9B 3VH6W 5B33A 2AROA 5AV8D 1P3AC 1M18B 4J8XD 3REJA 4WU9D 5G49A 3REID 4YS3D 1AOIA 2PYOB 2YFWB 1AOIC 1TAFB 3C1CC 5B40B 5AV6B 2CV5A 3LJAD 1KX4D 4CAYB 1EQZD 3LELB 4G92B 1F66B 5CP6C 5CHLB 3W97B 2NZDB 4R8PC 5AV5B 5BO0B 3W99B 3KWQA 5CPIB 1KX3A 1ID3D 3W96A 4XUJB 5B24D 4NFTA 3W96C 3AZMC 4H9PB 3B0BA 4LD9C 3AYWB 5B2JA 1P3BA 5KDMA 1TZYB 5B2JC 3TU4B 4CSRB 5AVBB 2HUEC 3B6FC 1P34B 3AV1B 4NE5A 5FUGB 5AVCA 1KX5C 3NQJB 4WZSB 3REJD 3MGPB 3AZIC 1P3IB 3AZJB 4X23B 3KXBB 3AZFC 1AOID 5AV8B 4Z5TA 4J8XB 4WU9B 3C1BA 3REIB 4H9OA 4YS3B 4H9NA 5CP6D 3WA9C 3X1SA 4ZUXA 3X1SC 3LJAB 1KX4B 3W96D 5GT3A 1EQZB 4LD9D 3B0DB 5B2JD 1HTAA 1P3BD 3NQUB 3AFAB 4JJNA 3B6FD 5B1MC 4WU8B 3MNNC
chains in the Genus database with same CATH superfamily
1ID3B 5AVCD 3EPKA 1JFIB 4NE3A 2VQRA 4J8WB 5B32A 5B40C 3VH5T 3LZ1A 4UUZB 2CWEA 3LZ1C 3V9RB 3AZFD 2W8SA 5B33B 5JA4A 1P3PA 4Z5TD 3W99C 3REJB 1H3OA 4XUJC 3C1BD 5G49B 4Z2MH 3AZGC 3AYWC 5B31C 1WWIA 4WJ3C 3H0LC 1AOIB 4KGCA 3AZEA 3WA9D 3X1SD 3X1UA 1P3MA 1P34C 3AV1C 2CV5B 3X1UC 3MGPC 3X1VA 1T3UA 1P3IC 5CP6B 3AZJC 4X23C 5JRGA 1KU5A 5B1MD 4JJND 5JRGC 3MNND 3KWQB 5AV8C 2JCHA 3O62A 3W96B 4J8XC 4LD9B 4WU9C 3LZ1D 3REIC 3UTBA 2G5HC 5B2JB 1P3BB 5KDMB 3WAAA 3WAAC 3REKA 3AN2A 3WTPA 3REKC 5AVCB 3AN2C 4WNNB 4XZQA 2F8NK 3AZGD 3AZFB 3AZLA 5B31D 4ZBJB 5B2IA 3AFAC 3KUYA 3AZED 4Z5TB 1S32A 3AV1D 4WU8C 4QLCA 3X1UD 1ID3C 3C1BB 4QLCC 4J8WC 1P3ID 1P3LA 4H9NB 2HIOA 5E5AA 5JRGD 5E5AC 3X1SB 5B33C 5DNMA 2AROC 3O62D 5GT3B 3REJC 3UTBD 4DRAA 3WAAD 5B1MB 4JJNB 3MNNB 3REKD 5AY8A 2Y2PA 3UTAA 3AN2D 5AY8C 3UTAC 4H9RA 2CV5C 3LZ1B 2F8NA 5BNVB 3AFAD 3UT9A 5B2ID 2BYMA 5B0YA 3KUYD 1P3PB 4WU8D 1S32D 4E44A 1M19A 4QLCD 3KWQC 1KX3C 4J8WD 3AZGB 5B31B 5B1LA 1P3LD 3H0RC 1P3BC 4KGCB 4EO5B 4KHAA 5E5AD 3AZEB 1ZLAA 5B33D 1BH9A 3X1UB 2AROD 1P3MB 1P3GA 5DNMD 5AVCC 3VH5A 5B31G 3MGRA 3B6GA 3X1VB 5AV9A 5JRGB 4ZBJC 1BH8B 3RELA 5AY8D 5CPKA 3UTAD 4Z5TC 3O62B 2Y2MA 5CPKC 2CV5D 5F99A 3C1BC 3UTBB 2F8ND 2JSSA 3WAAB 2LY8A 3REKB 3UT9D 3AN2B 3WTPB 5B0YD 3KWQD 4ZUXC 1KX3D 3B0CT 2Y2HA 3VH6A 5GT3C 3AZLB 4NE6A 5GXQA 5B1LD 5B2IB 3KUYB 4JJNC 1ZLAD 1S32B 4QLCB 1P3GD 2ZY2A 1R4VA 3B6GD 3A6NA 5B32C 2BYKA 1P3LB 1P3FA 2L5AA 2IO5C 5E5AB 4J8VA 3REHA 3RELD 3REHC 2AROB 5DNMB 5CPKD 1P3PC 5GT0A 3W98A 2FFFB 5F99D 3AZNA 3W98C 1P3KA 2YFVA 1P3KC 2PYOA 4KGCC 5AY8B 4EO5C 3AZEC 3UTAB 1P3OA 4ZUXD 4H9SA 1P3OC 4H9RB 1P3MC 5GT3D 2F8NB 3B0CW 2FJ7A 1M1AA 3X1VC 3WKJA 3EPLA 3UT9B 3WKJC 1PZRA 5AV5A 4YM6A 2BYMB 5B0YB 1U35A 1HQ3A 1KX3B 1U35C 3EPJA 1HQ3C 1M19B 3O62C 5B32D 4WV4B 3A6ND 3UTBC 5B1LB 1P3FD 4KHAB 5AVBA 2Y2GA 4J8VD 3REHD 1ZLAB 3H0MC 1P3GB 1P3PD 3WTPC 2NQBA 3MGRB 3NQJA 5GT0D 3B6GB 3IP4C 3W98D 3AZND 4XZQC 5CPJA 3KXBA 3AZLC 3AV2A 1P3KD 4KGCD 3RELB 5B2IC 3KUYC 5CPKB 1ULYA 1P3OD 2J8PA 1P3MD 1S32C 5F99B 4AWLB 4H9OB 3AZHA 4YS3A 3X1VD 3AZHC 1P3LC 1M1AD 3WKJD 2HIOC 4YM6D 4ZUXB 1U35D 1HQ3D 3LJAA 5BS7A 5DNMC 1N1JA 4J8UA 5GXQB 2G5IC 3NQUA 2UWXA 4E45A 3WTPD 2Y2OA 2RIQA 5B24A 2NQBD 5B32B 3MGQA 4XZQD 3A6NB 3MGQC 2BYKB 5CPJD 5DNNA 1P3FB 2IO5B 5BNXA 3MGSA 5DNNC 3AZLD 4H9QA 3AV2D 4J8VB 3REHB 5GSUA 3UT9C 5JA4B 1P3AA 5GSUC 5B32G 5B0YC 5GT0B 3MVDA 3W98B 3A1KA 1H3OB 1M19C 3FDDA 3MVDC 3AZNB 3X1TA 3AZHD 3X1TC 1P3KB 5B1LC 2HIOD 2YFVB 1A7WA 5C3IC 3C1CA 1ZLAC 1B6WA 1P3OB 4HGAB 1P3GC 4KUDA 3MGRC 3AZKA 2ZY4A 4KUDC 3B6GC 3EG5B 3AZKC 5CP6A 4J8UD 1M1AB 2FJ7B 4R8PA 3WKJB 3KFUG 5BT1C 5AV9C 4YM6B 3RELC 1U35B 1HQ3B 2RVQD 3AZMA 3R45A 3MGQD 4LD9A 5F99C 4Z66A 3KSYA 5DNND 4AWLC 2Y2LA 4Z66C 3MGSD 3B6FA 2Y2KA 1BFMA 5GSUD 1KX5A 1P3AD 2NQBB 3AZIA 1M19D 4WNNA 3MVDD 4XZQB 2Y2NA 3AZFA 5CPJB 3X1TD 3AV2B 5GXQC 3C1CD 1Z2CB 3MGRD 4KUDD 3AZKD 3AZHB 3A6NC 5B0ZA 1P3FC 2HIOB 3LZ0A 5BT1D 5AV9D 5B0ZC 4R8PD 3LZ0C 3WA9A 4J8VC 1F1EA 1W2EA 1M18A 3AZMD 1M18C 5GT0C 1N1JB 3AZNC 2DF4C 4J8UB 4Z66D 5B1MA 2YFWA 4G91B 3MNNA 1TAFA 2PYOC 1KX5D 3P5JB 5B24B 5B40A 5AV6A 3AZID 4H9SC 4CAYA 2XD1A 5AV6C 4HGAC 3MGQB 5DNNB 3AL0C 5BNVA 3LELA 5BNXB 3MGSB 4H9QB 5GXQD 3LELC 4G92C 4Z2MG 1F66A 3W97A 1M1AC 3WTPE 2Y2IA 5GSUB 1F66C 2FJ7C 3W97C 5BO0A 1P3AB 3W99A 2NZDC 5AV5C 4YM6C 5CPIA 2F8NG 4XUJA 5CPIC 3MVDB 3AZGA 4H9PA 3X1TB 3AYWA 5B31A 2F2AC 1TZYA 3TU4A 4CSRA 5C3IB 5B0ZD 1TZYC 3LZ0D 3TU4C 2F8NH 4DRBA 3C1CB 2XD5A 5AVBC 1P34A 3AV1A 1BH9B 5FUGA 3A1IA 2NQBC 1M18D 4KUDB 3MGPA 3AZKB 1P3IA 3VH6T 3AZJA 4X23A 5CPJC 4R8PB 5AV9B 3KXBC 3AV2C 1BH8A 4M6BA 4UPKA 2PYOD 5AV8A 2DQNC 4J8XA 3AZMB 3R45B 5B40D 5AV6D 4WU9A 3REIA 1B67A 2ZY3A 1WWSA 4Z66B 3LELD 4YS3C 2HUEB 3F6TA 3VH5W 1F66D 2FJ7D 3B6FB 3W97D 2NZDD 2JE5A 5AV5D 1KX5B 3W99D 5CPID 3AZIB 1KX4A 4XUJD 3LJAC 5BS7C 1KX4C 1EQZA 1EQZC 3AYWD 3B0DC 1TZYD 3AFAA 4J8UC 3TU4D 5AVBD 4WU8A 4G91C 1P34D 1ID3A 1JFIA 2RVQC 4J8WA 5B24C 3MGPD 4UUZA 3V9RA 3AZJD 4X23D 3KXBD 1Q9CA 5B0ZB 3LZ0B 3MGSC 3WA9B 3VH6W 5B33A 2AROA 5AV8D 1P3AC 1M18B 4J8XD 3REJA 4WU9D 5G49A 3REID 4YS3D 1AOIA 2PYOB 2YFWB 1AOIC 1TAFB 3C1CC 5B40B 5AV6B 2CV5A 3LJAD 1KX4D 4CAYB 1EQZD 3LELB 4DQYB 4G92B 1F66B 5CP6C 5CHLB 3W97B 2NZDB 4R8PC 5AV5B 5BO0B 3W99B 3KWQA 5CPIB 1KX3A 1ID3D 3W96A 4XUJB 2BG1A 4NFTA 5B24D 3W96C 3AZMC 4H9PB 3B0BA 4LD9C 3AYWB 5B2JA 1P3BA 5KDMA 1TZYB 5B2JC 3TU4B 4CSRB 5AVBB 2HUEC 3B6FC 2NZDA 1P34B 3AV1B 4NE5A 5FUGB 5AVCA 2ZM5A 1KX5C 3NQJB 4WZSB 3REJD 3MGPB 3AZIC 1P3IB 3AZJB 4X23B 3KXBB 3AZFC 1AOID 5AV8B 4Z5TA 4J8XB 4WU9B 3C1BA 3REIB 2Y2QA 4H9OA 4YS3B 4H9NA 3EPHA 5CP6D 2Y2JA 3WA9C 3X1SA 4ZUXA 3X1SC 3LJAB 1KX4B 3W96D 5GT3A 1EQZB 4LD9D 3B0DB 5B2JD 1HTAA 2ZY5A 1P3BD 3NQUB 3AFAB 4JJNA 3B6FD 5B1MC 4WU8B 3MNNC
chains in the Genus database with same CATH topology
1ID3B 5AVCD 3EPKA 1JFIB 4NE3A 2VQRA 4J8WB 5B32A 5B40C 3VH5T 3LZ1A 4UUZB 2CWEA 3LZ1C 3V9RB 3AZFD 2W8SA 5B33B 5JA4A 1P3PA 4Z5TD 3W99C 3REJB 1H3OA 4XUJC 3C1BD 5G49B 4Z2MH 3AZGC 3AYWC 5B31C 1WWIA 4WJ3C 3H0LC 1AOIB 4KGCA 3AZEA 3WA9D 3X1SD 3X1UA 1P3MA 1P34C 3AV1C 2CV5B 3X1UC 3MGPC 3X1VA 1T3UA 1P3IC 5CP6B 3AZJC 4X23C 5JRGA 1KU5A 5B1MD 4JJND 5JRGC 3MNND 3KWQB 5AV8C 2JCHA 3O62A 3W96B 4J8XC 4LD9B 4WU9C 3LZ1D 3REIC 3UTBA 2G5HC 5B2JB 1P3BB 5KDMB 3WAAA 3WAAC 3REKA 3AN2A 3WTPA 3REKC 5AVCB 3AN2C 4WNNB 4XZQA 2F8NK 3AZGD 3AZFB 3AZLA 5B31D 4ZBJB 5B2IA 3AFAC 3KUYA 3AZED 4Z5TB 1S32A 3AV1D 4WU8C 4QLCA 3X1UD 1ID3C 3C1BB 4QLCC 4J8WC 1P3ID 1P3LA 4H9NB 2HIOA 5E5AA 5JRGD 5E5AC 3X1SB 5B33C 5DNMA 2AROC 3O62D 5GT3B 3REJC 3UTBD 4DRAA 3WAAD 5B1MB 4JJNB 3MNNB 3REKD 5AY8A 2Y2PA 3UTAA 3AN2D 5AY8C 3UTAC 4H9RA 2CV5C 3LZ1B 2F8NA 5BNVB 3AFAD 3UT9A 5B2ID 2BYMA 5B0YA 3KUYD 1P3PB 4WU8D 1S32D 4E44A 1M19A 4QLCD 3KWQC 1KX3C 4J8WD 3AZGB 5B31B 5B1LA 1P3LD 3H0RC 1P3BC 4KGCB 4EO5B 4KHAA 5E5AD 3AZEB 1ZLAA 5B33D 1BH9A 3X1UB 2AROD 1P3MB 1P3GA 5DNMD 5AVCC 3VH5A 5B31G 3MGRA 3B6GA 3X1VB 5AV9A 5JRGB 4ZBJC 1BH8B 3RELA 5AY8D 5CPKA 3UTAD 4Z5TC 3O62B 2Y2MA 5CPKC 2CV5D 5F99A 3C1BC 3UTBB 2F8ND 2JSSA 3WAAB 2LY8A 3REKB 3UT9D 3AN2B 3WTPB 5B0YD 3KWQD 4ZUXC 1KX3D 3B0CT 2Y2HA 3VH6A 5GT3C 3AZLB 4NE6A 5GXQA 5B1LD 5B2IB 3KUYB 4JJNC 1ZLAD 1S32B 4QLCB 1P3GD 2ZY2A 1R4VA 3B6GD 3A6NA 5B32C 2BYKA 1P3LB 1P3FA 2L5AA 2IO5C 5E5AB 4J8VA 3REHA 3RELD 3REHC 2AROB 5DNMB 5CPKD 1P3PC 5GT0A 3W98A 2FFFB 5F99D 3AZNA 3W98C 1P3KA 2YFVA 1P3KC 2PYOA 4KGCC 5AY8B 4EO5C 3AZEC 3UTAB 1P3OA 4ZUXD 4H9SA 1P3OC 4H9RB 1P3MC 5GT3D 2F8NB 3B0CW 2FJ7A 1M1AA 3X1VC 3WKJA 3EPLA 3UT9B 3WKJC 1PZRA 5AV5A 4YM6A 2BYMB 5B0YB 1U35A 1HQ3A 1KX3B 1U35C 3EPJA 1HQ3C 1M19B 3O62C 5B32D 4WV4B 3A6ND 3UTBC 5B1LB 1P3FD 4KHAB 5AVBA 2Y2GA 4J8VD 3REHD 1ZLAB 3H0MC 1P3GB 1P3PD 3WTPC 2NQBA 3MGRB 3NQJA 5GT0D 3B6GB 3IP4C 3W98D 3AZND 4XZQC 5CPJA 3KXBA 3AZLC 3AV2A 1P3KD 4KGCD 3RELB 5B2IC 3KUYC 5CPKB 1ULYA 1P3OD 2J8PA 1P3MD 1S32C 5F99B 4AWLB 4H9OB 3AZHA 4YS3A 3X1VD 3AZHC 1P3LC 1M1AD 3WKJD 2HIOC 4YM6D 4ZUXB 1U35D 1HQ3D 3LJAA 5BS7A 5DNMC 1N1JA 4J8UA 5GXQB 2G5IC 3NQUA 2UWXA 4E45A 3WTPD 2Y2OA 2RIQA 5B24A 2NQBD 5B32B 3MGQA 4XZQD 3A6NB 3MGQC 2BYKB 5CPJD 5DNNA 1P3FB 2IO5B 5BNXA 3MGSA 5DNNC 3AZLD 4H9QA 3AV2D 4J8VB 3REHB 5GSUA 3UT9C 5JA4B 1P3AA 5GSUC 5B32G 5B0YC 5GT0B 3MVDA 3W98B 3A1KA 1H3OB 1M19C 3FDDA 3MVDC 3AZNB 3X1TA 3AZHD 3X1TC 1P3KB 5B1LC 2HIOD 2YFVB 1A7WA 5C3IC 3C1CA 1ZLAC 1B6WA 1P3OB 4HGAB 1P3GC 4KUDA 3MGRC 3AZKA 2ZY4A 4KUDC 3B6GC 3EG5B 3AZKC 5CP6A 4J8UD 1M1AB 2FJ7B 4R8PA 3WKJB 3KFUG 5BT1C 5AV9C 4YM6B 3RELC 1U35B 1HQ3B 2RVQD 3AZMA 3R45A 3MGQD 4LD9A 5F99C 4Z66A 3KSYA 5DNND 4AWLC 2Y2LA 4Z66C 3MGSD 3B6FA 2Y2KA 1BFMA 5GSUD 1KX5A 1P3AD 2NQBB 3AZIA 1M19D 4WNNA 3MVDD 4XZQB 2Y2NA 3AZFA 5CPJB 3X1TD 3AV2B 5GXQC 3C1CD 1Z2CB 3MGRD 4KUDD 3AZKD 3AZHB 3A6NC 5B0ZA 1P3FC 2HIOB 3LZ0A 5BT1D 5AV9D 5B0ZC 4R8PD 3LZ0C 3WA9A 4J8VC 1F1EA 1W2EA 1M18A 3AZMD 1M18C 5GT0C 1N1JB 3AZNC 2DF4C 4J8UB 4Z66D 5B1MA 2YFWA 4G91B 3MNNA 1TAFA 2PYOC 1KX5D 3P5JB 5B24B 5B40A 5AV6A 3AZID 4H9SC 4CAYA 2XD1A 5AV6C 4HGAC 3MGQB 5DNNB 3AL0C 5BNVA 3LELA 5BNXB 3MGSB 4H9QB 5GXQD 3LELC 4G92C 4Z2MG 1F66A 3W97A 1M1AC 3WTPE 2Y2IA 5GSUB 1F66C 2FJ7C 3W97C 5BO0A 1P3AB 3W99A 2NZDC 5AV5C 4YM6C 5CPIA 2F8NG 4XUJA 5CPIC 3MVDB 3AZGA 4H9PA 3X1TB 3AYWA 5B31A 2F2AC 1TZYA 3TU4A 4CSRA 5C3IB 5B0ZD 1TZYC 3LZ0D 3TU4C 2F8NH 4DRBA 3C1CB 2XD5A 5AVBC 1P34A 3AV1A 1BH9B 5FUGA 3A1IA 2NQBC 1M18D 4KUDB 3MGPA 3AZKB 1P3IA 3VH6T 3AZJA 4X23A 5CPJC 4R8PB 5AV9B 3KXBC 3AV2C 1BH8A 4M6BA 4UPKA 2PYOD 5AV8A 2DQNC 4J8XA 3AZMB 3R45B 5B40D 5AV6D 4WU9A 3REIA 1B67A 2ZY3A 1WWSA 4Z66B 3LELD 4YS3C 2HUEB 3F6TA 3VH5W 1F66D 2FJ7D 3B6FB 3W97D 2NZDD 2JE5A 5AV5D 1KX5B 3W99D 5CPID 3AZIB 1KX4A 4XUJD 3LJAC 5BS7C 1KX4C 1EQZA 1EQZC 3AYWD 3B0DC 1TZYD 3AFAA 4J8UC 3TU4D 5AVBD 4WU8A 4G91C 1P34D 1ID3A 1JFIA 2RVQC 4J8WA 5B24C 3MGPD 4UUZA 3V9RA 3AZJD 4X23D 3KXBD 1Q9CA 5B0ZB 3LZ0B 3MGSC 3WA9B 3VH6W 5B33A 2AROA 5AV8D 1P3AC 1M18B 4J8XD 3REJA 4WU9D 5G49A 3REID 4YS3D 1AOIA 2PYOB 2YFWB 1AOIC 1TAFB 3C1CC 5B40B 5AV6B 2CV5A 3LJAD 1KX4D 4CAYB 1EQZD 3LELB 4DQYB 4G92B 1F66B 5CP6C 5CHLB 3W97B 2NZDB 4R8PC 5AV5B 5BO0B 3W99B 3KWQA 5CPIB 1KX3A 1ID3D 3W96A 4XUJB 2BG1A 4NFTA 5B24D 3W96C 3AZMC 4H9PB 3B0BA 4LD9C 3AYWB 5B2JA 1P3BA 5KDMA 1TZYB 5B2JC 3TU4B 4CSRB 5AVBB 2HUEC 3B6FC 2NZDA 1P34B 3AV1B 4NE5A 5FUGB 5AVCA 2ZM5A 1KX5C 3NQJB 4WZSB 3REJD 3MGPB 3AZIC 1P3IB 3AZJB 4X23B 3KXBB 3AZFC 1AOID 5AV8B 4Z5TA 4J8XB 4WU9B 3C1BA 3REIB 2Y2QA 4H9OA 4YS3B 4H9NA 3EPHA 5CP6D 2Y2JA 3WA9C 3X1SA 4ZUXA 3X1SC 3LJAB 1KX4B 3W96D 5GT3A 1EQZB 4LD9D 3B0DB 5B2JD 1HTAA 2ZY5A 1P3BD 3NQUB 3AFAB 4JJNA 3B6FD 5B1MC 4WU8B 3MNNC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ID3 B;  5AVC D;  1JFI B;  4NE3 A;  4J8W B;  5B32 A;  5B40 C;  3VH5 T;  3LZ1 A;  4UUZ B;  2CWE A;  3LZ1 C;  3V9R B;  3AZF D;  5B33 B;  5JA4 A;  1P3P A;  4Z5T D;  3W99 C;  3REJ B;  1H3O A;  4XUJ C;  3C1B D;  5G49 B;  4Z2M H;  3AZG C;  3AYW C;  5B31 C;  1WWI A;  1AOI B;  4KGC A;  3AZE A;  3WA9 D;  3X1S D;  3X1U A;  1P3M A;  1P34 C;  3AV1 C;  2CV5 B;  3X1U C;  3MGP C;  3X1V A;  1P3I C;  5CP6 B;  3AZJ C;  4X23 C;  5JRG A;  1KU5 A;  5B1M D;  4JJN D;  5JRG C;  3MNN D;  3KWQ B;  5AV8 C;  3O62 A;  3W96 B;  4J8X C;  4LD9 B;  4WU9 C;  3LZ1 D;  3REI C;  3UTB A;  5B2J B;  1P3B B;  5KDM B;  3WAA A;  3WAA C;  3REK A;  3AN2 A;  3WTP A;  3REK C;  5AVC B;  3AN2 C;  4WNN B;  4XZQ A;  2F8N K;  3AZG D;  3AZF B;  3AZL A;  5B31 D;  4ZBJ B;  5B2I A;  3AFA C;  3KUY A;  3AZE D;  4Z5T B;  1S32 A;  3AV1 D;  4WU8 C;  4QLC A;  3X1U D;  1ID3 C;  3C1B B;  4QLC C;  4J8W C;  1P3I D;  1P3L A;  4H9N B;  2HIO A;  5E5A A;  5JRG D;  5E5A C;  3X1S B;  5B33 C;  5DNM A;  2ARO C;  3O62 D;  5GT3 B;  3REJ C;  3UTB D;  4DRA A;  3WAA D;  5B1M B;  4JJN B;  3MNN B;  3REK D;  5AY8 A;  3AN2 D;  3UTA A;  5AY8 C;  3UTA C;  4H9R A;  2CV5 C;  3LZ1 B;  2F8N A;  5BNV B;  3AFA D;  3UT9 A;  5B2I D;  2BYM A;  5B0Y A;  3KUY D;  1P3P B;  4WU8 D;  1S32 D;  4E44 A;  1M19 A;  4QLC D;  3KWQ C;  1KX3 C;  4J8W D;  3AZG B;  5B31 B;  5B1L A;  1P3L D;  1P3B C;  4KGC B;  4EO5 B;  4KHA A;  5E5A D;  3AZE B;  1ZLA A;  5B33 D;  1BH9 A;  3X1U B;  2ARO D;  1P3M B;  1P3G A;  5DNM D;  5AVC C;  3VH5 A;  5B31 G;  3MGR A;  3B6G A;  3X1V B;  5AV9 A;  5JRG B;  4ZBJ C;  1BH8 B;  3REL A;  5AY8 D;  5CPK A;  3UTA D;  4Z5T C;  3O62 B;  5CPK C;  2CV5 D;  5F99 A;  3C1B C;  3UTB B;  2F8N D;  2JSS A;  3WAA B;  2LY8 A;  3REK B;  3UT9 D;  3AN2 B;  3WTP B;  5B0Y D;  3KWQ D;  4ZUX C;  1KX3 D;  3B0C T;  3VH6 A;  5GT3 C;  3AZL B;  4NE6 A;  5GXQ A;  5B1L D;  5B2I B;  3KUY B;  4JJN C;  1ZLA D;  1S32 B;  4QLC B;  1P3G D;  1R4V A;  3B6G D;  3A6N A;  5B32 C;  2BYK A;  1P3L B;  1P3F A;  2L5A A;  2IO5 C;  5E5A B;  4J8V A;  3REH A;  3REL D;  3REH C;  2ARO B;  5DNM B;  5CPK D;  1P3P C;  5GT0 A;  3W98 A;  5F99 D;  3AZN A;  3W98 C;  1P3K A;  2YFV A;  1P3K C;  2PYO A;  4KGC C;  5AY8 B;  4EO5 C;  3AZE C;  3UTA B;  1P3O A;  4ZUX D;  4H9S A;  1P3O C;  4H9R B;  1P3M C;  5GT3 D;  2F8N B;  3B0C W;  2FJ7 A;  1M1A A;  3X1V C;  3WKJ A;  3UT9 B;  3WKJ C;  5AV5 A;  4YM6 A;  2BYM B;  5B0Y B;  1U35 A;  1HQ3 A;  1KX3 B;  1U35 C;  1M19 B;  1HQ3 C;  3O62 C;  5B32 D;  4WV4 B;  3A6N D;  3UTB C;  5B1L B;  1P3F D;  4KHA B;  5AVB A;  1ZLA B;  4J8V D;  3REH D;  1P3G B;  1P3P D;  2NQB A;  3WTP C;  3MGR B;  3NQJ A;  5GT0 D;  3B6G B;  3W98 D;  3AZN D;  4XZQ C;  5CPJ A;  3KXB A;  3AZL C;  3AV2 A;  1P3K D;  4KGC D;  3REL B;  5B2I C;  3KUY C;  5CPK B;  1ULY A;  1P3O D;  1P3M D;  1S32 C;  5F99 B;  4AWL B;  4H9O B;  3AZH A;  4YS3 A;  3X1V D;  3AZH C;  1P3L C;  1M1A D;  3WKJ D;  2HIO C;  4YM6 D;  4ZUX B;  1U35 D;  1HQ3 D;  3LJA A;  5BS7 A;  5DNM C;  1N1J A;  4J8U A;  5GXQ B;  3NQU A;  4E45 A;  3WTP D;  5B24 A;  2NQB D;  5B32 B;  3MGQ A;  4XZQ D;  3A6N B;  3MGQ C;  2BYK B;  5CPJ D;  5DNN A;  1P3F B;  2IO5 B;  5BNX A;  3MGS A;  5DNN C;  3AZL D;  4H9Q A;  3AV2 D;  4J8V B;  3REH B;  5GSU A;  3UT9 C;  5JA4 B;  1P3A A;  5GSU C;  5B32 G;  5B0Y C;  5GT0 B;  3MVD A;  3W98 B;  1H3O B;  1M19 C;  3MVD C;  3AZN B;  3X1T A;  3AZH D;  3X1T C;  1P3K B;  5B1L C;  2HIO D;  2YFV B;  1A7W A;  5C3I C;  3C1C A;  1ZLA C;  1B6W A;  1P3O B;  4HGA B;  1P3G C;  4KUD A;  3MGR C;  3AZK A;  4KUD C;  3B6G C;  3AZK C;  5CP6 A;  4J8U D;  1M1A B;  2FJ7 B;  4R8P A;  3WKJ B;  5BT1 C;  5AV9 C;  4YM6 B;  3REL C;  1U35 B;  1HQ3 B;  2RVQ D;  3AZM A;  3R45 A;  3MGQ D;  4LD9 A;  5F99 C;  4Z66 A;  3KSY A;  5DNN D;  4AWL C;  4Z66 C;  3MGS D;  3B6F A;  1BFM A;  5GSU D;  1KX5 A;  1P3A D;  2NQB B;  3AZI A;  1M19 D;  4WNN A;  3MVD D;  4XZQ B;  5CPJ B;  3AZF A;  3X1T D;  3AV2 B;  5GXQ C;  3C1C D;  3MGR D;  4KUD D;  3AZK D;  3AZH B;  3A6N C;  5B0Z A;  1P3F C;  2HIO B;  3LZ0 A;  5BT1 D;  5AV9 D;  5B0Z C;  4R8P D;  3LZ0 C;  3WA9 A;  4J8V C;  1F1E A;  1M18 A;  3AZM D;  1M18 C;  5GT0 C;  1N1J B;  3AZN C;  4J8U B;  4Z66 D;  5B1M A;  2YFW A;  4G91 B;  3MNN A;  1TAF A;  2PYO C;  1KX5 D;  5B24 B;  5B40 A;  5AV6 A;  3AZI D;  4H9S C;  4CAY A;  3MGQ B;  5AV6 C;  4HGA C;  5DNN B;  5BNV A;  3LEL A;  5BNX B;  3MGS B;  4H9Q B;  5GXQ D;  3LEL C;  4G92 C;  4Z2M G;  1F66 A;  3W97 A;  1M1A C;  3WTP E;  1F66 C;  5GSU B;  2FJ7 C;  2NZD A;  3W97 C;  5BO0 A;  1P3A B;  3W99 A;  2NZD C;  5AV5 C;  4YM6 C;  5CPI A;  2F8N G;  4XUJ A;  5CPI C;  3MVD B;  3AZG A;  4H9P A;  3X1T B;  3AYW A;  5B31 A;  1TZY A;  3TU4 A;  5B0Z D;  4CSR A;  5C3I B;  1TZY C;  3LZ0 D;  3TU4 C;  2F8N H;  4DRB A;  3C1C B;  5AVB C;  1P34 A;  3AV1 A;  1BH9 B;  5FUG A;  2NQB C;  1M18 D;  4KUD B;  3MGP A;  3AZK B;  1P3I A;  3VH6 T;  3AZJ A;  4X23 A;  5CPJ C;  4R8P B;  5AV9 B;  3KXB C;  3AV2 C;  1BH8 A;  4M6B A;  2PYO D;  5AV8 A;  4J8X A;  3AZM B;  3R45 B;  5B40 D;  5AV6 D;  4WU9 A;  3REI A;  1B67 A;  1WWS A;  4Z66 B;  3LEL D;  4YS3 C;  2HUE B;  3VH5 W;  2FJ7 D;  1F66 D;  3B6F B;  3W97 D;  2NZD D;  5AV5 D;  1KX5 B;  3W99 D;  5CPI D;  3AZI B;  1KX4 A;  4XUJ D;  3LJA C;  5BS7 C;  1KX4 C;  1EQZ A;  1EQZ C;  3AYW D;  3B0D C;  1TZY D;  3AFA A;  4J8U C;  3TU4 D;  5AVB D;  4WU8 A;  4G91 C;  1P34 D;  1ID3 A;  1JFI A;  2RVQ C;  4J8W A;  5B24 C;  3MGP D;  4UUZ A;  3V9R A;  3AZJ D;  4X23 D;  3KXB D;  1Q9C A;  5B0Z B;  3LZ0 B;  3MGS C;  3WA9 B;  3VH6 W;  5B33 A;  2ARO A;  5AV8 D;  1P3A C;  1M18 B;  4J8X D;  3REJ A;  4WU9 D;  5G49 A;  3REI D;  4YS3 D;  1AOI A;  2PYO B;  2YFW B;  1AOI C;  1TAF B;  3C1C C;  5B40 B;  5AV6 B;  2CV5 A;  3LJA D;  1KX4 D;  4CAY B;  1EQZ D;  3LEL B;  4G92 B;  1F66 B;  5CP6 C;  5CHL B;  3W97 B;  2NZD B;  4R8P C;  5AV5 B;  5BO0 B;  3W99 B;  3KWQ A;  5CPI B;  1KX3 A;  1ID3 D;  3W96 A;  4XUJ B;  5B24 D;  4NFT A;  3W96 C;  3AZM C;  4H9P B;  3B0B A;  4LD9 C;  3AYW B;  5B2J A;  1P3B A;  5KDM A;  1TZY B;  5B2J C;  3TU4 B;  4CSR B;  5AVB B;  2HUE C;  3B6F C;  1P34 B;  3AV1 B;  4NE5 A;  5FUG B;  5AVC A;  1KX5 C;  3NQJ B;  4WZS B;  3REJ D;  3MGP B;  3AZI C;  1P3I B;  3AZJ B;  4X23 B;  3KXB B;  3AZF C;  1AOI D;  5AV8 B;  4Z5T A;  4J8X B;  4WU9 B;  3C1B A;  3REI B;  4H9O A;  4YS3 B;  4H9N A;  5CP6 D;  3WA9 C;  3X1S A;  4ZUX A;  3X1S C;  3LJA B;  1KX4 B;  3W96 D;  5GT3 A;  1EQZ B;  4LD9 D;  3B0D B;  5B2J D;  1HTA A;  1P3B D;  3NQU B;  3AFA B;  4JJN A;  3B6F D;  5B1M C;  4WU8 B;  3MNN C; 
#chains in the Genus database with same CATH topology
 1ID3 B;  5AVC D;  3EPK A;  1JFI B;  4NE3 A;  2VQR A;  4J8W B;  5B32 A;  5B40 C;  3VH5 T;  3LZ1 A;  4UUZ B;  2CWE A;  3LZ1 C;  3V9R B;  3AZF D;  2W8S A;  5B33 B;  5JA4 A;  1P3P A;  4Z5T D;  3W99 C;  3REJ B;  1H3O A;  4XUJ C;  3C1B D;  5G49 B;  4Z2M H;  3AZG C;  3AYW C;  5B31 C;  1WWI A;  4WJ3 C;  3H0L C;  1AOI B;  4KGC A;  3AZE A;  3WA9 D;  3X1S D;  3X1U A;  1P3M A;  1P34 C;  3AV1 C;  2CV5 B;  3X1U C;  3MGP C;  3X1V A;  1T3U A;  1P3I C;  5CP6 B;  3AZJ C;  4X23 C;  5JRG A;  1KU5 A;  5B1M D;  4JJN D;  5JRG C;  3MNN D;  3KWQ B;  5AV8 C;  2JCH A;  3O62 A;  3W96 B;  4J8X C;  4LD9 B;  4WU9 C;  3LZ1 D;  3REI C;  3UTB A;  2G5H C;  5B2J B;  1P3B B;  5KDM B;  3WAA A;  3WAA C;  3REK A;  3AN2 A;  3WTP A;  3REK C;  5AVC B;  3AN2 C;  4WNN B;  4XZQ A;  2F8N K;  3AZG D;  3AZF B;  3AZL A;  5B31 D;  4ZBJ B;  5B2I A;  3AFA C;  3KUY A;  3AZE D;  4Z5T B;  1S32 A;  3AV1 D;  4WU8 C;  4QLC A;  3X1U D;  1ID3 C;  3C1B B;  4QLC C;  4J8W C;  1P3I D;  1P3L A;  4H9N B;  2HIO A;  5E5A A;  5JRG D;  5E5A C;  3X1S B;  5B33 C;  5DNM A;  2ARO C;  3O62 D;  5GT3 B;  3REJ C;  3UTB D;  4DRA A;  3WAA D;  5B1M B;  4JJN B;  3MNN B;  3REK D;  5AY8 A;  2Y2P A;  3UTA A;  3AN2 D;  5AY8 C;  3UTA C;  4H9R A;  2CV5 C;  3LZ1 B;  2F8N A;  5BNV B;  3AFA D;  3UT9 A;  5B2I D;  2BYM A;  5B0Y A;  3KUY D;  1P3P B;  4WU8 D;  1S32 D;  4E44 A;  1M19 A;  4QLC D;  3KWQ C;  1KX3 C;  4J8W D;  3AZG B;  5B31 B;  5B1L A;  1P3L D;  3H0R C;  1P3B C;  4KGC B;  4EO5 B;  4KHA A;  5E5A D;  3AZE B;  1ZLA A;  5B33 D;  1BH9 A;  3X1U B;  2ARO D;  1P3M B;  1P3G A;  5DNM D;  5AVC C;  3VH5 A;  5B31 G;  3MGR A;  3B6G A;  3X1V B;  5AV9 A;  5JRG B;  4ZBJ C;  1BH8 B;  3REL A;  5AY8 D;  5CPK A;  3UTA D;  4Z5T C;  3O62 B;  2Y2M A;  5CPK C;  2CV5 D;  5F99 A;  3C1B C;  3UTB B;  2F8N D;  2JSS A;  3WAA B;  2LY8 A;  3REK B;  3UT9 D;  3AN2 B;  3WTP B;  5B0Y D;  3KWQ D;  4ZUX C;  1KX3 D;  3B0C T;  2Y2H A;  3VH6 A;  5GT3 C;  3AZL B;  4NE6 A;  5GXQ A;  5B1L D;  5B2I B;  3KUY B;  4JJN C;  1ZLA D;  1S32 B;  4QLC B;  1P3G D;  2ZY2 A;  1R4V A;  3B6G D;  3A6N A;  5B32 C;  2BYK A;  1P3L B;  1P3F A;  2L5A A;  2IO5 C;  5E5A B;  4J8V A;  3REH A;  3REL D;  3REH C;  2ARO B;  5DNM B;  5CPK D;  1P3P C;  5GT0 A;  3W98 A;  2FFF B;  5F99 D;  3AZN A;  3W98 C;  1P3K A;  2YFV A;  1P3K C;  2PYO A;  4KGC C;  5AY8 B;  4EO5 C;  3AZE C;  3UTA B;  1P3O A;  4ZUX D;  4H9S A;  1P3O C;  4H9R B;  1P3M C;  5GT3 D;  2F8N B;  3B0C W;  2FJ7 A;  1M1A A;  3X1V C;  3WKJ A;  3EPL A;  3UT9 B;  3WKJ C;  1PZR A;  5AV5 A;  4YM6 A;  2BYM B;  5B0Y B;  1U35 A;  1HQ3 A;  1KX3 B;  1U35 C;  3EPJ A;  1HQ3 C;  1M19 B;  3O62 C;  5B32 D;  4WV4 B;  3A6N D;  3UTB C;  5B1L B;  1P3F D;  4KHA B;  5AVB A;  2Y2G A;  4J8V D;  3REH D;  1ZLA B;  3H0M C;  1P3G B;  1P3P D;  3WTP C;  2NQB A;  3MGR B;  3NQJ A;  5GT0 D;  3B6G B;  3IP4 C;  3W98 D;  3AZN D;  4XZQ C;  5CPJ A;  3KXB A;  3AZL C;  3AV2 A;  1P3K D;  4KGC D;  3REL B;  5B2I C;  3KUY C;  5CPK B;  1ULY A;  1P3O D;  2J8P A;  1P3M D;  1S32 C;  5F99 B;  4AWL B;  4H9O B;  3AZH A;  4YS3 A;  3X1V D;  3AZH C;  1P3L C;  1M1A D;  3WKJ D;  2HIO C;  4YM6 D;  4ZUX B;  1U35 D;  1HQ3 D;  3LJA A;  5BS7 A;  5DNM C;  1N1J A;  4J8U A;  5GXQ B;  2G5I C;  3NQU A;  2UWX A;  4E45 A;  3WTP D;  2Y2O A;  2RIQ A;  5B24 A;  2NQB D;  5B32 B;  3MGQ A;  4XZQ D;  3A6N B;  3MGQ C;  2BYK B;  5CPJ D;  5DNN A;  1P3F B;  2IO5 B;  5BNX A;  3MGS A;  5DNN C;  3AZL D;  4H9Q A;  3AV2 D;  4J8V B;  3REH B;  5GSU A;  3UT9 C;  5JA4 B;  1P3A A;  5GSU C;  5B32 G;  5B0Y C;  5GT0 B;  3MVD A;  3W98 B;  3A1K A;  1H3O B;  1M19 C;  3FDD A;  3MVD C;  3AZN B;  3X1T A;  3AZH D;  3X1T C;  1P3K B;  5B1L C;  2HIO D;  2YFV B;  1A7W A;  5C3I C;  3C1C A;  1ZLA C;  1B6W A;  1P3O B;  4HGA B;  1P3G C;  4KUD A;  3MGR C;  3AZK A;  2ZY4 A;  4KUD C;  3B6G C;  3EG5 B;  3AZK C;  5CP6 A;  4J8U D;  1M1A B;  2FJ7 B;  4R8P A;  3WKJ B;  3KFU G;  5BT1 C;  5AV9 C;  4YM6 B;  3REL C;  1U35 B;  1HQ3 B;  2RVQ D;  3AZM A;  3R45 A;  3MGQ D;  4LD9 A;  5F99 C;  4Z66 A;  3KSY A;  5DNN D;  4AWL C;  2Y2L A;  4Z66 C;  3MGS D;  3B6F A;  2Y2K A;  1BFM A;  5GSU D;  1KX5 A;  1P3A D;  2NQB B;  3AZI A;  1M19 D;  4WNN A;  3MVD D;  4XZQ B;  2Y2N A;  3AZF A;  5CPJ B;  3X1T D;  3AV2 B;  5GXQ C;  3C1C D;  1Z2C B;  3MGR D;  4KUD D;  3AZK D;  3AZH B;  3A6N C;  5B0Z A;  1P3F C;  2HIO B;  3LZ0 A;  5BT1 D;  5AV9 D;  5B0Z C;  4R8P D;  3LZ0 C;  3WA9 A;  4J8V C;  1F1E A;  1W2E A;  1M18 A;  3AZM D;  1M18 C;  5GT0 C;  1N1J B;  3AZN C;  2DF4 C;  4J8U B;  4Z66 D;  5B1M A;  2YFW A;  4G91 B;  3MNN A;  1TAF A;  2PYO C;  1KX5 D;  3P5J B;  5B24 B;  5B40 A;  5AV6 A;  3AZI D;  4H9S C;  4CAY A;  2XD1 A;  5AV6 C;  4HGA C;  3MGQ B;  5DNN B;  3AL0 C;  5BNV A;  3LEL A;  5BNX B;  3MGS B;  4H9Q B;  5GXQ D;  3LEL C;  4G92 C;  4Z2M G;  1F66 A;  3W97 A;  1M1A C;  3WTP E;  2Y2I A;  5GSU B;  1F66 C;  2FJ7 C;  3W97 C;  5BO0 A;  1P3A B;  3W99 A;  2NZD C;  5AV5 C;  4YM6 C;  5CPI A;  2F8N G;  4XUJ A;  5CPI C;  3MVD B;  3AZG A;  4H9P A;  3X1T B;  3AYW A;  5B31 A;  2F2A C;  1TZY A;  3TU4 A;  4CSR A;  5C3I B;  5B0Z D;  1TZY C;  3LZ0 D;  3TU4 C;  2F8N H;  4DRB A;  3C1C B;  2XD5 A;  5AVB C;  1P34 A;  3AV1 A;  1BH9 B;  5FUG A;  3A1I A;  2NQB C;  1M18 D;  4KUD B;  3MGP A;  3AZK B;  1P3I A;  3VH6 T;  3AZJ A;  4X23 A;  5CPJ C;  4R8P B;  5AV9 B;  3KXB C;  3AV2 C;  1BH8 A;  4M6B A;  4UPK A;  2PYO D;  5AV8 A;  2DQN C;  4J8X A;  3AZM B;  3R45 B;  5B40 D;  5AV6 D;  4WU9 A;  3REI A;  1B67 A;  2ZY3 A;  1WWS A;  4Z66 B;  3LEL D;  4YS3 C;  2HUE B;  3F6T A;  3VH5 W;  1F66 D;  2FJ7 D;  3B6F B;  3W97 D;  2NZD D;  2JE5 A;  5AV5 D;  1KX5 B;  3W99 D;  5CPI D;  3AZI B;  1KX4 A;  4XUJ D;  3LJA C;  5BS7 C;  1KX4 C;  1EQZ A;  1EQZ C;  3AYW D;  3B0D C;  1TZY D;  3AFA A;  4J8U C;  3TU4 D;  5AVB D;  4WU8 A;  4G91 C;  1P34 D;  1ID3 A;  1JFI A;  2RVQ C;  4J8W A;  5B24 C;  3MGP D;  4UUZ A;  3V9R A;  3AZJ D;  4X23 D;  3KXB D;  1Q9C A;  5B0Z B;  3LZ0 B;  3MGS C;  3WA9 B;  3VH6 W;  5B33 A;  2ARO A;  5AV8 D;  1P3A C;  1M18 B;  4J8X D;  3REJ A;  4WU9 D;  5G49 A;  3REI D;  4YS3 D;  1AOI A;  2PYO B;  2YFW B;  1AOI C;  1TAF B;  3C1C C;  5B40 B;  5AV6 B;  2CV5 A;  3LJA D;  1KX4 D;  4CAY B;  1EQZ D;  3LEL B;  4DQY B;  4G92 B;  1F66 B;  5CP6 C;  5CHL B;  3W97 B;  2NZD B;  4R8P C;  5AV5 B;  5BO0 B;  3W99 B;  3KWQ A;  5CPI B;  1KX3 A;  1ID3 D;  3W96 A;  4XUJ B;  2BG1 A;  4NFT A;  5B24 D;  3W96 C;  3AZM C;  4H9P B;  3B0B A;  4LD9 C;  3AYW B;  5B2J A;  1P3B A;  5KDM A;  1TZY B;  5B2J C;  3TU4 B;  4CSR B;  5AVB B;  2HUE C;  3B6F C;  2NZD A;  1P34 B;  3AV1 B;  4NE5 A;  5FUG B;  5AVC A;  2ZM5 A;  1KX5 C;  3NQJ B;  4WZS B;  3REJ D;  3MGP B;  3AZI C;  1P3I B;  3AZJ B;  4X23 B;  3KXB B;  3AZF C;  1AOI D;  5AV8 B;  4Z5T A;  4J8X B;  4WU9 B;  3C1B A;  3REI B;  2Y2Q A;  4H9O A;  4YS3 B;  4H9N A;  3EPH A;  5CP6 D;  2Y2J A;  3WA9 C;  3X1S A;  4ZUX A;  3X1S C;  3LJA B;  1KX4 B;  3W96 D;  5GT3 A;  1EQZ B;  4LD9 D;  3B0D B;  5B2J D;  1HTA A;  2ZY5 A;  1P3B D;  3NQU B;  3AFA B;  4JJN A;  3B6F D;  5B1M C;  4WU8 B;  3MNN C; 
#chains in the Genus database with same CATH homology
 1ID3 B;  5AVC D;  3EPK A;  1JFI B;  4NE3 A;  2VQR A;  4J8W B;  5B32 A;  5B40 C;  3VH5 T;  3LZ1 A;  4UUZ B;  2CWE A;  3LZ1 C;  3V9R B;  3AZF D;  2W8S A;  5B33 B;  5JA4 A;  1P3P A;  4Z5T D;  3W99 C;  3REJ B;  1H3O A;  4XUJ C;  3C1B D;  5G49 B;  4Z2M H;  3AZG C;  3AYW C;  5B31 C;  1WWI A;  4WJ3 C;  3H0L C;  1AOI B;  4KGC A;  3AZE A;  3WA9 D;  3X1S D;  3X1U A;  1P3M A;  1P34 C;  3AV1 C;  2CV5 B;  3X1U C;  3MGP C;  3X1V A;  1T3U A;  1P3I C;  5CP6 B;  3AZJ C;  4X23 C;  5JRG A;  1KU5 A;  5B1M D;  4JJN D;  5JRG C;  3MNN D;  3KWQ B;  5AV8 C;  2JCH A;  3O62 A;  3W96 B;  4J8X C;  4LD9 B;  4WU9 C;  3LZ1 D;  3REI C;  3UTB A;  2G5H C;  5B2J B;  1P3B B;  5KDM B;  3WAA A;  3WAA C;  3REK A;  3AN2 A;  3WTP A;  3REK C;  5AVC B;  3AN2 C;  4WNN B;  4XZQ A;  2F8N K;  3AZG D;  3AZF B;  3AZL A;  5B31 D;  4ZBJ B;  5B2I A;  3AFA C;  3KUY A;  3AZE D;  4Z5T B;  1S32 A;  3AV1 D;  4WU8 C;  4QLC A;  3X1U D;  1ID3 C;  3C1B B;  4QLC C;  4J8W C;  1P3I D;  1P3L A;  4H9N B;  2HIO A;  5E5A A;  5JRG D;  5E5A C;  3X1S B;  5B33 C;  5DNM A;  2ARO C;  3O62 D;  5GT3 B;  3REJ C;  3UTB D;  4DRA A;  3WAA D;  5B1M B;  4JJN B;  3MNN B;  3REK D;  5AY8 A;  2Y2P A;  3UTA A;  3AN2 D;  5AY8 C;  3UTA C;  4H9R A;  2CV5 C;  3LZ1 B;  2F8N A;  5BNV B;  3AFA D;  3UT9 A;  5B2I D;  2BYM A;  5B0Y A;  3KUY D;  1P3P B;  4WU8 D;  1S32 D;  4E44 A;  1M19 A;  4QLC D;  3KWQ C;  1KX3 C;  4J8W D;  3AZG B;  5B31 B;  5B1L A;  1P3L D;  3H0R C;  1P3B C;  4KGC B;  4EO5 B;  4KHA A;  5E5A D;  3AZE B;  1ZLA A;  5B33 D;  1BH9 A;  3X1U B;  2ARO D;  1P3M B;  1P3G A;  5DNM D;  5AVC C;  3VH5 A;  5B31 G;  3MGR A;  3B6G A;  3X1V B;  5AV9 A;  5JRG B;  4ZBJ C;  1BH8 B;  3REL A;  5AY8 D;  5CPK A;  3UTA D;  4Z5T C;  3O62 B;  2Y2M A;  5CPK C;  2CV5 D;  5F99 A;  3C1B C;  3UTB B;  2F8N D;  2JSS A;  3WAA B;  2LY8 A;  3REK B;  3UT9 D;  3AN2 B;  3WTP B;  5B0Y D;  3KWQ D;  4ZUX C;  1KX3 D;  3B0C T;  2Y2H A;  3VH6 A;  5GT3 C;  3AZL B;  4NE6 A;  5GXQ A;  5B1L D;  5B2I B;  3KUY B;  4JJN C;  1ZLA D;  1S32 B;  4QLC B;  1P3G D;  2ZY2 A;  1R4V A;  3B6G D;  3A6N A;  5B32 C;  2BYK A;  1P3L B;  1P3F A;  2L5A A;  2IO5 C;  5E5A B;  4J8V A;  3REH A;  3REL D;  3REH C;  2ARO B;  5DNM B;  5CPK D;  1P3P C;  5GT0 A;  3W98 A;  2FFF B;  5F99 D;  3AZN A;  3W98 C;  1P3K A;  2YFV A;  1P3K C;  2PYO A;  4KGC C;  5AY8 B;  4EO5 C;  3AZE C;  3UTA B;  1P3O A;  4ZUX D;  4H9S A;  1P3O C;  4H9R B;  1P3M C;  5GT3 D;  2F8N B;  3B0C W;  2FJ7 A;  1M1A A;  3X1V C;  3WKJ A;  3EPL A;  3UT9 B;  3WKJ C;  1PZR A;  5AV5 A;  4YM6 A;  2BYM B;  5B0Y B;  1U35 A;  1HQ3 A;  1KX3 B;  1U35 C;  3EPJ A;  1HQ3 C;  1M19 B;  3O62 C;  5B32 D;  4WV4 B;  3A6N D;  3UTB C;  5B1L B;  1P3F D;  4KHA B;  5AVB A;  2Y2G A;  4J8V D;  3REH D;  1ZLA B;  3H0M C;  1P3G B;  1P3P D;  3WTP C;  2NQB A;  3MGR B;  3NQJ A;  5GT0 D;  3B6G B;  3IP4 C;  3W98 D;  3AZN D;  4XZQ C;  5CPJ A;  3KXB A;  3AZL C;  3AV2 A;  1P3K D;  4KGC D;  3REL B;  5B2I C;  3KUY C;  5CPK B;  1ULY A;  1P3O D;  2J8P A;  1P3M D;  1S32 C;  5F99 B;  4AWL B;  4H9O B;  3AZH A;  4YS3 A;  3X1V D;  3AZH C;  1P3L C;  1M1A D;  3WKJ D;  2HIO C;  4YM6 D;  4ZUX B;  1U35 D;  1HQ3 D;  3LJA A;  5BS7 A;  5DNM C;  1N1J A;  4J8U A;  5GXQ B;  2G5I C;  3NQU A;  2UWX A;  4E45 A;  3WTP D;  2Y2O A;  2RIQ A;  5B24 A;  2NQB D;  5B32 B;  3MGQ A;  4XZQ D;  3A6N B;  3MGQ C;  2BYK B;  5CPJ D;  5DNN A;  1P3F B;  2IO5 B;  5BNX A;  3MGS A;  5DNN C;  3AZL D;  4H9Q A;  3AV2 D;  4J8V B;  3REH B;  5GSU A;  3UT9 C;  5JA4 B;  1P3A A;  5GSU C;  5B32 G;  5B0Y C;  5GT0 B;  3MVD A;  3W98 B;  3A1K A;  1H3O B;  1M19 C;  3FDD A;  3MVD C;  3AZN B;  3X1T A;  3AZH D;  3X1T C;  1P3K B;  5B1L C;  2HIO D;  2YFV B;  1A7W A;  5C3I C;  3C1C A;  1ZLA C;  1B6W A;  1P3O B;  4HGA B;  1P3G C;  4KUD A;  3MGR C;  3AZK A;  2ZY4 A;  4KUD C;  3B6G C;  3EG5 B;  3AZK C;  5CP6 A;  4J8U D;  1M1A B;  2FJ7 B;  4R8P A;  3WKJ B;  3KFU G;  5BT1 C;  5AV9 C;  4YM6 B;  3REL C;  1U35 B;  1HQ3 B;  2RVQ D;  3AZM A;  3R45 A;  3MGQ D;  4LD9 A;  5F99 C;  4Z66 A;  3KSY A;  5DNN D;  4AWL C;  2Y2L A;  4Z66 C;  3MGS D;  3B6F A;  2Y2K A;  1BFM A;  5GSU D;  1KX5 A;  1P3A D;  2NQB B;  3AZI A;  1M19 D;  4WNN A;  3MVD D;  4XZQ B;  2Y2N A;  3AZF A;  5CPJ B;  3X1T D;  3AV2 B;  5GXQ C;  3C1C D;  1Z2C B;  3MGR D;  4KUD D;  3AZK D;  3AZH B;  3A6N C;  5B0Z A;  1P3F C;  2HIO B;  3LZ0 A;  5BT1 D;  5AV9 D;  5B0Z C;  4R8P D;  3LZ0 C;  3WA9 A;  4J8V C;  1F1E A;  1W2E A;  1M18 A;  3AZM D;  1M18 C;  5GT0 C;  1N1J B;  3AZN C;  2DF4 C;  4J8U B;  4Z66 D;  5B1M A;  2YFW A;  4G91 B;  3MNN A;  1TAF A;  2PYO C;  1KX5 D;  3P5J B;  5B24 B;  5B40 A;  5AV6 A;  3AZI D;  4H9S C;  4CAY A;  2XD1 A;  5AV6 C;  4HGA C;  3MGQ B;  5DNN B;  3AL0 C;  5BNV A;  3LEL A;  5BNX B;  3MGS B;  4H9Q B;  5GXQ D;  3LEL C;  4G92 C;  4Z2M G;  1F66 A;  3W97 A;  1M1A C;  3WTP E;  2Y2I A;  5GSU B;  1F66 C;  2FJ7 C;  3W97 C;  5BO0 A;  1P3A B;  3W99 A;  2NZD C;  5AV5 C;  4YM6 C;  5CPI A;  2F8N G;  4XUJ A;  5CPI C;  3MVD B;  3AZG A;  4H9P A;  3X1T B;  3AYW A;  5B31 A;  2F2A C;  1TZY A;  3TU4 A;  4CSR A;  5C3I B;  5B0Z D;  1TZY C;  3LZ0 D;  3TU4 C;  2F8N H;  4DRB A;  3C1C B;  2XD5 A;  5AVB C;  1P34 A;  3AV1 A;  1BH9 B;  5FUG A;  3A1I A;  2NQB C;  1M18 D;  4KUD B;  3MGP A;  3AZK B;  1P3I A;  3VH6 T;  3AZJ A;  4X23 A;  5CPJ C;  4R8P B;  5AV9 B;  3KXB C;  3AV2 C;  1BH8 A;  4M6B A;  4UPK A;  2PYO D;  5AV8 A;  2DQN C;  4J8X A;  3AZM B;  3R45 B;  5B40 D;  5AV6 D;  4WU9 A;  3REI A;  1B67 A;  2ZY3 A;  1WWS A;  4Z66 B;  3LEL D;  4YS3 C;  2HUE B;  3F6T A;  3VH5 W;  1F66 D;  2FJ7 D;  3B6F B;  3W97 D;  2NZD D;  2JE5 A;  5AV5 D;  1KX5 B;  3W99 D;  5CPI D;  3AZI B;  1KX4 A;  4XUJ D;  3LJA C;  5BS7 C;  1KX4 C;  1EQZ A;  1EQZ C;  3AYW D;  3B0D C;  1TZY D;  3AFA A;  4J8U C;  3TU4 D;  5AVB D;  4WU8 A;  4G91 C;  1P34 D;  1ID3 A;  1JFI A;  2RVQ C;  4J8W A;  5B24 C;  3MGP D;  4UUZ A;  3V9R A;  3AZJ D;  4X23 D;  3KXB D;  1Q9C A;  5B0Z B;  3LZ0 B;  3MGS C;  3WA9 B;  3VH6 W;  5B33 A;  2ARO A;  5AV8 D;  1P3A C;  1M18 B;  4J8X D;  3REJ A;  4WU9 D;  5G49 A;  3REI D;  4YS3 D;  1AOI A;  2PYO B;  2YFW B;  1AOI C;  1TAF B;  3C1C C;  5B40 B;  5AV6 B;  2CV5 A;  3LJA D;  1KX4 D;  4CAY B;  1EQZ D;  3LEL B;  4DQY B;  4G92 B;  1F66 B;  5CP6 C;  5CHL B;  3W97 B;  2NZD B;  4R8P C;  5AV5 B;  5BO0 B;  3W99 B;  3KWQ A;  5CPI B;  1KX3 A;  1ID3 D;  3W96 A;  4XUJ B;  2BG1 A;  4NFT A;  5B24 D;  3W96 C;  3AZM C;  4H9P B;  3B0B A;  4LD9 C;  3AYW B;  5B2J A;  1P3B A;  5KDM A;  1TZY B;  5B2J C;  3TU4 B;  4CSR B;  5AVB B;  2HUE C;  3B6F C;  2NZD A;  1P34 B;  3AV1 B;  4NE5 A;  5FUG B;  5AVC A;  2ZM5 A;  1KX5 C;  3NQJ B;  4WZS B;  3REJ D;  3MGP B;  3AZI C;  1P3I B;  3AZJ B;  4X23 B;  3KXB B;  3AZF C;  1AOI D;  5AV8 B;  4Z5T A;  4J8X B;  4WU9 B;  3C1B A;  3REI B;  2Y2Q A;  4H9O A;  4YS3 B;  4H9N A;  3EPH A;  5CP6 D;  2Y2J A;  3WA9 C;  3X1S A;  4ZUX A;  3X1S C;  3LJA B;  1KX4 B;  3W96 D;  5GT3 A;  1EQZ B;  4LD9 D;  3B0D B;  5B2J D;  1HTA A;  2ZY5 A;  1P3B D;  3NQU B;  3AFA B;  4JJN A;  3B6F D;  5B1M C;  4WU8 B;  3MNN C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...