5BT1C

Histone chaperone hif1 playing with histone h2a-h2b dimer
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
85
structure length
85
Chain Sequence
QSRSAKAGLTFPVGRVHRLLRRGNYAQRIGSGAPVYLTAVLEYLAAEILELAGNAARDNKKTRIIPRHLQLAIRNDDELNKLLGN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Insights into the Association of Hif1 with Histones H2A-H2B Dimer and H3-H4 Tetramer
pubmed doi rcsb
source organism Saccharomyces cerevisiae (strain atcc 204508 / s288c)
molecule tags Chaperone
molecule keywords HAT1-interacting factor 1
total genus 29
structure length 85
sequence length 85
ec nomenclature
pdb deposition date 2015-06-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5bt1C00
3UTAB 5B31B 5DNMD 4ZUXB 3O62C 3MGSA 1P3ID 1HQ3C 1P3FC 5B24B 1BH8A 3LZ0D 5AV9C 3REKA 3UTBD 1HQ3A 1P3FA 4YM6A 1P3AC 2BYMB 2IO5C 1H3OA 3RELD 1P3PD 5AY8B 5AVBC 5AVCD 4H9SC 3AZJA 1P3LD 3X1SD 5AVCB 3AZFA 1M18A 3VH6W 4E44A 3AV1C 4ZBJB 2F8NG 5B32B 3RELB 1P3PB 4AWLC 4Z2MG 3AYWB 1WWIA 3W98D 1HTAA 4G92C 3AZED 3KXBA 1S32D 4CSRB 4NE6A 5B32D 5AV9B 1M19A 3W98B 3LZ0C 2IO5B 1M1AD 3O62D 3AZNB 4KGCC 3C1CB 3LZ0A 3AZMA 4EO5C 5B33A 3B6GD 1ULYA 3KUYA 5B33B 3AZLC 5CPJC 5B2IB 3AZKB 5BT1D 3B0DB 4J8WD 2NZDA 1AOID 3AZJD 3WA9A 3LJAA 5AV6B 4E45A 1P3GB 1ID3A 5B1LC 1P3GD 5CPIB 4X23C 1P3OD 3KXBD 1S32A 4YS3B 5BS7C 5B32A 1P3BB 5B31G 1P3BA 3X1UD 5KDMA 3W99C 3WKJA 5JA4A 3VH6A 3AZLB 4WNNA 3MGPC 3X1UB 2CV5B 1P3KB 4Z5TB 3KXBB 3AZLD 5B0YA 3B0DC 4H9RB 3AZMD 5CP6A 5B0YB 3X1TA 3B6GC 3KWQB 1BH9B 3NQUA 4XZQD 3TU4D 4XZQB 3TU4B 3AFAB 3W97A 1P3LB 1N1JB 4YS3C 3W97B 5E5AB 4H9PA 5E5AD 1KX4B 2PYOB 3A6NC 3AFAD 4JJNB 3REHD 4R8PB 3AN2A 4H9SA 3B0CT 3MGRC 3REIB 3AZIC 1P3MD 2HIOC 3LZ1B 3AV1B 3WAAC 3WKJD 5GSUC 3RELC 1P3PC 1S32C 4KUDC 1TAFA 3UTBC 4WU8C 5B40C 4H9NA 4WU9C 3C1CA 5KDMB 3MGSC 3AV1D 3MGRD 2RVQC 4WV4B 4ZUXA 5CP6C 5B2IA 3AZKA 5CPJB 5GT3B 4J8UC 4QLCB 4XUJB 4R8PC 5DNMA 1P3IA 3MGSD 5B31C 1F66A 3REKD 5B32G 3NQJA 5DNMC 4R8PA 3AN2B 1P3IC 1HQ3D 1P3FD 4ZUXC 3AN2D 4CAYA 3UTBB 5C3IB 5JRGC 5JRGD 1H3OB 4NE5A 3LELA 3X1VD 3AYWD 1P3AB 5B1MC 3X1VB 4Z5TD 3W98A 3MNNC 5AV8A 5B2JD 1ZLAD 5B1LD 1P3KA 3UT9D 5B2JB 4Z66B 3AZHB 1F66D 3WA9C 5B40D 4Z66D 2AROA 4H9QB 3C1BB 5FUGA 1ZLAB 5DNNB 1BH9A 3WKJC 4LD9B 1AOIB 5GT0B 4J8VC 4KGCB 2BYMA 1U35B 4JJNC 2NQBD 5GT0A 2NZDD 4KGCA 3WA9D 3LELD 3REHC 2NQBB 4X23D 3LZ1A 3MNNB 5GXQB 5BNVB 5E5AC 4NFTA 3W96A 4LD9D 3MGQC 5AV6C 3W99A 3MVDD 5AV8C 3AZIB 3VH5W 5CPIC 5B24C 3VH5T 3AZIA 5BT1C 4J8WC 4H9OB 5B31D 3MGQD 5B1LA 5CPJA 1P3KD 3UT9A 2YFWB 2HUEB 1BH8B 5GT3D 1M1AA 4H9QA 3NQUB 3C1BA 5CP6D 5GXQC 5CP6B 1WWSA 4ZBJC 3KUYB 4J8XA 3LZ0B 4CAYB 3UTBA 1P3OC 2BYKB 5C3IC 5JRGB 4X23A 3AZNC 2HIOD 3MVDA 4WZSB 1M18D 1KX3A 5CPKA 5E5AA 3A6NA 3B0BA 3REID 5G49B 3C1CC 5B1MD 1R4VA 1M1AB 2L5AA 3UTAA 5B1LB 1EQZA 1S32B 1M18C 1TAFB 5B40B 3WAAB 5BO0A 4WU9D 4XZQA 3TU4A 5B2ID 3LJAB 3AZKD 1P34C 4G91B 3MGSB 2NZDB 2HIOA 4XUJA 3KWQC 3LJAD 5CPKD 3A6ND 3MGPB 2CV5C 3AFAA 1P3KC 3AZFC 1Q9CA 1P3GA 1KX3C 1P3MA 1EQZC 4YS3A 3MGPD 2PYOA 5GSUA 1P3MC 5B0ZD 4Z5TA 2PYOC 3AV1A 3AZMB 3AZLA 4WNNB 2CV5A 2AROC 3LELC 3VH6T 5AV5D 3AV2B 5AVBA 5F99C 1F1EA 3AV2A 4QLCA 3AZHC 5B0ZC 1U35A 1KU5A 4R8PD 5F99D 4KUDB 5DNNC 1KX4D 1P3MB 3WA9B 4LD9C 2BYKA 5JRGA 4X23B 4KGCD 3MGPA 3LZ1D 2PYOD 4UUZA 3LELB 4JJND 3REHB 2NQBC 3W96D 4UUZB 5B0ZA 4WU8D 1U35C 5BS7A 5B32C 3KXBC 4J8VA 2LY8A 1A7WA 3WAAD 4G92B 2F8ND 3AZID 3B6FC 2F8NH 4CSRA 4ZUXD 5DNMB 3AN2C 1P3IB 5CPKC 3LJAC 3AZGD 5GT3A 3B6FA 2HUEC 3REKB 1M19C 5DNNA 3AZNA 5B24A 5BNXB 1KX5B 1KX4A 3AZHA 4J8XD 1P34A 1KX5D 3X1SB 3AZGC 2NQBA 4J8XB 3V9RA 1P3LA 3REIC 3V9RB 2HIOB 1HQ3B 3LZ1C 1P3FB 4LD9A 5GSUB 5AV6A 4HGAC 3UTAC 5GT0C 4J8VB 5AY8C 5AV9D 3AZEA 5CPIA 3R45A 2FJ7D 5G49A 3MGQA 3C1BD 1TZYC 1ZLAA 5DNND 2FJ7B 1ID3C 3AZND 3B6GB 3UT9B 4Z66A 3KWQA 3AZHD 4KUDD 1AOIA 5GXQD 4M6BA 1P34B 3RELA 1P3PA 3KSYA 5AV6D 4KHAA 1ID3D 4J8WB 3NQJB 3MVDC 1KX3D 3AZJB 5AV5C 3MNNA 3W99D 1P3OA 3A6NB 5CPID 3REJA 1ID3B 1P3OB 5B1MA 1KX3B 2F8NK 1P3BD 3X1UA 1B6WA 1EQZB 3KUYC 3UTAD 1EQZD 5B31A 1F66C 4Z66C 3O62A 2CV5D 3KWQD 3AZMC 1TZYA 1ZLAC 4YM6B 4WU9A 3WTPE 5AVCC 3KUYD 5AVBD 5AV5B 3AV2D 4YM6D 3X1UC 5AVBB 4Z5TC 4J8WA 1B67A 5AVCA 2AROB 1M18B 4QLCC 5BNVA 5AY8D 4H9PB 1JFIA 5F99B 3VH5A 1M1AC 3AYWC 3REHA 3WTPA 5JA4B 3AZEB 5B0YC 3REIA 3B0CW 4JJNA 3W98C 3REJC 2YFWA 4HGAB 1P3AA 4G91C 5B1MB 3X1VC 3C1CD 3W96C 1TZYB 4H9RA 1P3LC 3R45B 4J8UD 1TZYD 3MGRB 3O62B 5B33D 3X1TC 3X1TD 3WTPC 5B33C 3B6GA 2RVQD 2JSSA 5FUGB 1KX4C 2YFVA 2FJ7C 3AZGA 5BO0B 3B6FD 4WU9B 4QLCD 5AY8A 3AZEC 3B6FB 1N1JA 5B24D 1P3BC 5CPKB 1JFIB 5F99A 4XUJD 3AV2C 4DRBA 3WTPD 3W99B 5BNXA 5GT3C 1KX5A 3X1SC 3X1VA 4H9NB 1KX5C 5B0ZB 4NE3A 3WTPB 4YS3D 1P3AD 5GSUD 4J8VD 5AV8B 5B0YD 4J8UA 4XZQC 5AV8D 3TU4C 2F8NA 2FJ7A 3AFAC 4EO5B 5B2JA 1F66B 5AV5A 4H9OA 2NZDC 5B40A 2AROD 3W97D 3W97C 4YM6C 2YFVB 1U35D 4KHAB 5B2IC 3AZKC 1P34D 3AZFB 4KUDA 5GT0D 5GXQA 5B2JC 5CHLB 3UT9C 3C1BC 1P3GC 3X1SA 3AZFD 3AYWA 4DRAA 3MVDB 3WKJB 4WU8B 3AZJC 3MNND 1AOIC 2F8NB 1BFMA 4WU8A 3W96B 5AV9A 3REKC 1M19B 4J8XC 3REJD 4J8UB 3MGRA 3X1TB 3REJB 3WAAA 5CPJD 3MGQB 4Z2MH 4AWLB 1M19D 3AZGB 4XUJC 2CWEA
chains in the Genus database with same CATH superfamily
3UTAB 5B31B 2ZY4A 5DNMD 4ZUXB 3O62C 3MGSA 1P3ID 1HQ3C 1P3FC 5B24B 1BH8A 3LZ0D 5AV9C 2Y2QA 3REKA 3P5JB 3UTBD 1HQ3A 1P3FA 4YM6A 1P3AC 2BYMB 2IO5C 1H3OA 3RELD 1P3PD 5AY8B 5AVBC 5AVCD 4H9SC 3AZJA 1P3LD 3X1SD 5AVCB 3AZFA 1M18A 3VH6W 4E44A 3EPLA 3AV1C 4ZBJB 2F8NG 5B32B 3RELB 1P3PB 4AWLC 4Z2MG 3AYWB 1WWIA 3W98D 2Y2JA 1HTAA 4G92C 3AZED 3KXBA 1S32D 4CSRB 4NE6A 5B32D 5AV9B 1M19A 3W98B 3LZ0C 2ZY5A 2IO5B 1M1AD 3O62D 3AZNB 4KGCC 3C1CB 3LZ0A 3AZMA 4EO5C 5B33A 3B6GD 1ULYA 3KUYA 5B33B 3AZLC 5CPJC 5B2IB 3AZKB 2Y2KA 3F6TA 3IP4C 5BT1D 3B0DB 4J8WD 2NZDA 1AOID 3AZJD 3WA9A 3LJAA 5AV6B 4E45A 1P3GB 1ID3A 5B1LC 1P3GD 5CPIB 4X23C 1P3OD 3KXBD 1S32A 4YS3B 5BS7C 5B32A 1P3BB 5B31G 1P3BA 3X1UD 5KDMA 3W99C 3WKJA 5JA4A 3VH6A 3AZLB 4WNNA 3MGPC 3X1UB 2CV5B 1P3KB 4Z5TB 3KXBB 3AZLD 5B0YA 3B0DC 4H9RB 3AZMD 5CP6A 5B0YB 3X1TA 3B6GC 3KWQB 3EPHA 1BH9B 3NQUA 4XZQD 3TU4D 4XZQB 3TU4B 3AFAB 3W97A 1P3LB 1N1JB 4YS3C 3W97B 5E5AB 4H9PA 5E5AD 1KX4B 2PYOB 3A6NC 3AFAD 4JJNB 3REHD 4R8PB 3AN2A 4H9SA 3B0CT 3MGRC 3REIB 3AZIC 1P3MD 1T3UA 2HIOC 3LZ1B 3AV1B 3A1KA 3WAAC 3WKJD 5GSUC 3RELC 1P3PC 1S32C 4KUDC 1TAFA 3UTBC 4WU8C 5B40C 4H9NA 4WU9C 3C1CA 5KDMB 3MGSC 3AV1D 2FFFB 3MGRD 2RVQC 4WV4B 4ZUXA 5CP6C 5B2IA 3AZKA 5CPJB 5GT3B 4J8UC 2Y2MA 4QLCB 4XUJB 4R8PC 5DNMA 1P3IA 3MGSD 5B31C 1F66A 3REKD 5B32G 3NQJA 5DNMC 4R8PA 3AN2B 1P3IC 1HQ3D 1P3FD 4ZUXC 3AN2D 4CAYA 3UTBB 5C3IB 5JRGC 5JRGD 3FDDA 1H3OB 4NE5A 3LELA 3X1VD 3AYWD 1P3AB 5B1MC 3X1VB 4Z5TD 3W98A 3MNNC 2Y2OA 2ZY2A 5AV8A 5B2JD 1ZLAD 5B1LD 1P3KA 3UT9D 2Y2HA 5B2JB 4Z66B 3AZHB 1F66D 3WA9C 5B40D 4Z66D 2AROA 2XD5A 4H9QB 3C1BB 5FUGA 2XD1A 1ZLAB 5DNNB 1BH9A 2F2AC 3WKJC 4LD9B 1AOIB 5GT0B 4J8VC 4KGCB 2BYMA 1U35B 4JJNC 2NQBD 5GT0A 2NZDD 4KGCA 3WA9D 3LELD 3REHC 2NQBB 4X23D 3LZ1A 3MNNB 5GXQB 5BNVB 5E5AC 4NFTA 3W96A 4LD9D 3MGQC 5AV6C 3W99A 3MVDD 5AV8C 3AZIB 3VH5W 5CPIC 5B24C 3VH5T 3EPJA 3AZIA 5BT1C 4J8WC 4H9OB 5B31D 3MGQD 3AL0C 5B1LA 5CPJA 1P3KD 3UT9A 2YFWB 2HUEB 1BH8B 5GT3D 1M1AA 4H9QA 3NQUB 3C1BA 5CP6D 5GXQC 5CP6B 1WWSA 4ZBJC 3KUYB 4J8XA 3LZ0B 4CAYB 3UTBA 1P3OC 2BYKB 5C3IC 5JRGB 4X23A 3AZNC 2HIOD 3MVDA 4WZSB 1M18D 2RIQA 1KX3A 5CPKA 5E5AA 3A6NA 3B0BA 3REID 3A1IA 5G49B 3C1CC 5B1MD 1R4VA 1M1AB 2L5AA 3UTAA 5B1LB 1EQZA 1S32B 2ZM5A 1M18C 2JCHA 3H0LC 1TAFB 5B40B 3WAAB 5BO0A 4WU9D 4XZQA 3TU4A 5B2ID 3LJAB 3AZKD 1P34C 4G91B 3MGSB 2NZDB 2HIOA 4XUJA 3KWQC 3LJAD 5CPKD 2G5IC 3A6ND 3MGPB 2CV5C 3AFAA 1P3KC 3AZFC 1Q9CA 1P3GA 1KX3C 1P3MA 1EQZC 4YS3A 3MGPD 2PYOA 5GSUA 1P3MC 2Y2LA 5B0ZD 4Z5TA 2PYOC 2Y2PA 3AZMB 3AV1A 3AZLA 4WNNB 2CV5A 2AROC 3LELC 3VH6T 5AV5D 3AV2B 5AVBA 5F99C 1F1EA 3AV2A 2Y2IA 4QLCA 3AZHC 5B0ZC 1U35A 2G5HC 1KU5A 4R8PD 5F99D 4KUDB 5DNNC 1KX4D 1P3MB 3WA9B 4LD9C 2BYKA 5JRGA 4X23B 4KGCD 3MGPA 3LZ1D 2PYOD 4UUZA 3LELB 4JJND 3REHB 2NQBC 3W96D 4UUZB 3EG5B 5B0ZA 4WU8D 1U35C 5BS7A 5B32C 3KXBC 4J8VA 2LY8A 1A7WA 3WAAD 4G92B 2F8ND 3AZID 3B6FC 2F8NH 4CSRA 4ZUXD 5DNMB 3AN2C 1P3IB 5CPKC 3LJAC 3AZGD 5GT3A 3B6FA 2HUEC 3REKB 1M19C 5DNNA 3AZNA 5B24A 5BNXB 1KX5B 1KX4A 3AZHA 4J8XD 1P34A 1KX5D 3X1SB 3AZGC 2NQBA 4J8XB 3V9RA 1P3LA 3REIC 3V9RB 2HIOB 1HQ3B 3LZ1C 1P3FB 4LD9A 5GSUB 5AV6A 4HGAC 3UTAC 5GT0C 4J8VB 5AY8C 5AV9D 3AZEA 5CPIA 3R45A 2FJ7D 5G49A 4DQYB 3EPKA 3MGQA 2BG1A 3C1BD 1TZYC 1ZLAA 5DNND 2FJ7B 1ID3C 3AZND 3B6GB 2JE5A 3UT9B 4Z66A 3KWQA 3AZHD 4KUDD 1AOIA 5GXQD 4M6BA 1P34B 3RELA 1P3PA 3KSYA 2UWXA 5AV6D 4KHAA 1ID3D 4J8WB 3NQJB 3MVDC 1KX3D 3AZJB 5AV5C 3MNNA 3W99D 1P3OA 3A6NB 5CPID 3REJA 1ID3B 1P3OB 3H0MC 5B1MA 1KX3B 2F8NK 1P3BD 3X1UA 1B6WA 1EQZB 3KUYC 3UTAD 1EQZD 5B31A 1F66C 4Z66C 2VQRA 3O62A 2CV5D 2DQNC 3KWQD 3AZMC 1TZYA 1ZLAC 4YM6B 4WU9A 3WTPE 5AVCC 3KUYD 5AVBD 5AV5B 3AV2D 4YM6D 1Z2CB 2DF4C 3X1UC 5AVBB 4Z5TC 2J8PA 4J8WA 1B67A 5AVCA 2AROB 1M18B 4QLCC 5BNVA 5AY8D 4H9PB 1JFIA 5F99B 3VH5A 1M1AC 3AYWC 3REHA 3WTPA 5JA4B 3AZEB 5B0YC 3REIA 2ZY3A 4UPKA 3B0CW 4JJNA 3W98C 3REJC 2YFWA 4HGAB 1P3AA 4G91C 5B1MB 3X1VC 3C1CD 3W96C 1TZYB 4H9RA 1P3LC 3R45B 4J8UD 1TZYD 3MGRB 3O62B 5B33D 3X1TC 3X1TD 3WTPC 2Y2GA 5B33C 3B6GA 2RVQD 2JSSA 5FUGB 1KX4C 2YFVA 2FJ7C 3AZGA 5BO0B 3B6FD 4WU9B 4QLCD 5AY8A 3AZEC 3B6FB 1N1JA 5B24D 1P3BC 5CPKB 1JFIB 5F99A 4XUJD 3AV2C 4DRBA 3WTPD 3H0RC 2Y2NA 3W99B 5BNXA 5GT3C 1KX5A 3X1SC 3X1VA 4H9NB 1KX5C 5B0ZB 4NE3A 3WTPB 4YS3D 1W2EA 1P3AD 5GSUD 4J8VD 5AV8B 5B0YD 4J8UA 4XZQC 5AV8D 3TU4C 2F8NA 2FJ7A 3AFAC 4EO5B 5B2JA 1F66B 5AV5A 4H9OA 2W8SA 2NZDC 5B40A 2AROD 3W97D 4WJ3C 3W97C 1PZRA 4YM6C 2YFVB 1U35D 4KHAB 5B2IC 3AZKC 1P34D 3AZFB 4KUDA 3KFUG 5GT0D 5GXQA 5B2JC 5CHLB 3UT9C 3C1BC 1P3GC 3X1SA 3AZFD 3AYWA 4DRAA 3MVDB 3WKJB 4WU8B 3AZJC 3MNND 1AOIC 2F8NB 1BFMA 4WU8A 3W96B 5AV9A 3REKC 1M19B 4J8XC 3REJD 4J8UB 3MGRA 3X1TB 3REJB 3WAAA 5CPJD 3MGQB 4Z2MH 4AWLB 1M19D 3AZGB 4XUJC 2CWEA
chains in the Genus database with same CATH topology
3UTAB 5B31B 2ZY4A 5DNMD 4ZUXB 3O62C 3MGSA 1P3ID 1HQ3C 1P3FC 5B24B 1BH8A 3LZ0D 5AV9C 2Y2QA 3REKA 3P5JB 3UTBD 1HQ3A 1P3FA 4YM6A 1P3AC 2BYMB 2IO5C 1H3OA 3RELD 1P3PD 5AY8B 5AVBC 5AVCD 4H9SC 3AZJA 1P3LD 3X1SD 5AVCB 3AZFA 1M18A 3VH6W 4E44A 3EPLA 3AV1C 4ZBJB 2F8NG 5B32B 3RELB 1P3PB 4AWLC 4Z2MG 3AYWB 1WWIA 3W98D 2Y2JA 1HTAA 4G92C 3AZED 3KXBA 1S32D 4CSRB 4NE6A 5B32D 5AV9B 1M19A 3W98B 3LZ0C 2ZY5A 2IO5B 1M1AD 3O62D 3AZNB 4KGCC 3C1CB 3LZ0A 3AZMA 4EO5C 5B33A 3B6GD 1ULYA 3KUYA 5B33B 3AZLC 5CPJC 5B2IB 3AZKB 2Y2KA 3F6TA 3IP4C 5BT1D 3B0DB 4J8WD 2NZDA 1AOID 3AZJD 3WA9A 3LJAA 5AV6B 4E45A 1P3GB 1ID3A 5B1LC 1P3GD 5CPIB 4X23C 1P3OD 3KXBD 1S32A 4YS3B 5BS7C 5B32A 1P3BB 5B31G 1P3BA 3X1UD 5KDMA 3W99C 3WKJA 5JA4A 3VH6A 3AZLB 4WNNA 3MGPC 3X1UB 2CV5B 1P3KB 4Z5TB 3KXBB 3AZLD 5B0YA 3B0DC 4H9RB 3AZMD 5CP6A 5B0YB 3X1TA 3B6GC 3KWQB 3EPHA 1BH9B 3NQUA 4XZQD 3TU4D 4XZQB 3TU4B 3AFAB 3W97A 1P3LB 1N1JB 4YS3C 3W97B 5E5AB 4H9PA 5E5AD 1KX4B 2PYOB 3A6NC 3AFAD 4JJNB 3REHD 4R8PB 3AN2A 4H9SA 3B0CT 3MGRC 3REIB 3AZIC 1P3MD 1T3UA 2HIOC 3LZ1B 3AV1B 3A1KA 3WAAC 3WKJD 5GSUC 3RELC 1P3PC 1S32C 4KUDC 1TAFA 3UTBC 4WU8C 5B40C 4H9NA 4WU9C 3C1CA 5KDMB 3MGSC 3AV1D 2FFFB 3MGRD 2RVQC 4WV4B 4ZUXA 5CP6C 5B2IA 3AZKA 5CPJB 5GT3B 4J8UC 2Y2MA 4QLCB 4XUJB 4R8PC 5DNMA 1P3IA 3MGSD 5B31C 1F66A 3REKD 5B32G 3NQJA 5DNMC 4R8PA 3AN2B 1P3IC 1HQ3D 1P3FD 4ZUXC 3AN2D 4CAYA 3UTBB 5C3IB 5JRGC 5JRGD 3FDDA 1H3OB 4NE5A 3LELA 3X1VD 3AYWD 1P3AB 5B1MC 3X1VB 4Z5TD 3W98A 3MNNC 2Y2OA 2ZY2A 5AV8A 5B2JD 1ZLAD 5B1LD 1P3KA 3UT9D 2Y2HA 5B2JB 4Z66B 3AZHB 1F66D 3WA9C 5B40D 4Z66D 2AROA 2XD5A 4H9QB 3C1BB 5FUGA 2XD1A 1ZLAB 5DNNB 1BH9A 2F2AC 3WKJC 4LD9B 1AOIB 5GT0B 4J8VC 4KGCB 2BYMA 1U35B 4JJNC 2NQBD 5GT0A 2NZDD 4KGCA 3WA9D 3LELD 3REHC 2NQBB 4X23D 3LZ1A 3MNNB 5GXQB 5BNVB 5E5AC 4NFTA 3W96A 4LD9D 3MGQC 5AV6C 3W99A 3MVDD 5AV8C 3AZIB 3VH5W 5CPIC 5B24C 3VH5T 3EPJA 3AZIA 5BT1C 4J8WC 4H9OB 5B31D 3MGQD 3AL0C 5B1LA 5CPJA 1P3KD 3UT9A 2YFWB 2HUEB 1BH8B 5GT3D 1M1AA 4H9QA 3NQUB 3C1BA 5CP6D 5GXQC 5CP6B 1WWSA 4ZBJC 3KUYB 4J8XA 3LZ0B 4CAYB 3UTBA 1P3OC 2BYKB 5C3IC 5JRGB 4X23A 3AZNC 2HIOD 3MVDA 4WZSB 1M18D 2RIQA 1KX3A 5CPKA 5E5AA 3A6NA 3B0BA 3REID 3A1IA 5G49B 3C1CC 5B1MD 1R4VA 1M1AB 2L5AA 3UTAA 5B1LB 1EQZA 1S32B 2ZM5A 1M18C 2JCHA 3H0LC 1TAFB 5B40B 3WAAB 5BO0A 4WU9D 4XZQA 3TU4A 5B2ID 3LJAB 3AZKD 1P34C 4G91B 3MGSB 2NZDB 2HIOA 4XUJA 3KWQC 3LJAD 5CPKD 2G5IC 3A6ND 3MGPB 2CV5C 3AFAA 1P3KC 3AZFC 1Q9CA 1P3GA 1KX3C 1P3MA 1EQZC 4YS3A 3MGPD 2PYOA 5GSUA 1P3MC 2Y2LA 5B0ZD 4Z5TA 2PYOC 2Y2PA 3AZMB 3AV1A 3AZLA 4WNNB 2CV5A 2AROC 3LELC 3VH6T 5AV5D 3AV2B 5AVBA 5F99C 1F1EA 3AV2A 2Y2IA 4QLCA 3AZHC 5B0ZC 1U35A 2G5HC 1KU5A 4R8PD 5F99D 4KUDB 5DNNC 1KX4D 1P3MB 3WA9B 4LD9C 2BYKA 5JRGA 4X23B 4KGCD 3MGPA 3LZ1D 2PYOD 4UUZA 3LELB 4JJND 3REHB 2NQBC 3W96D 4UUZB 3EG5B 5B0ZA 4WU8D 1U35C 5BS7A 5B32C 3KXBC 4J8VA 2LY8A 1A7WA 3WAAD 4G92B 2F8ND 3AZID 3B6FC 2F8NH 4CSRA 4ZUXD 5DNMB 3AN2C 1P3IB 5CPKC 3LJAC 3AZGD 5GT3A 3B6FA 2HUEC 3REKB 1M19C 5DNNA 3AZNA 5B24A 5BNXB 1KX5B 1KX4A 3AZHA 4J8XD 1P34A 1KX5D 3X1SB 3AZGC 2NQBA 4J8XB 3V9RA 1P3LA 3REIC 3V9RB 2HIOB 1HQ3B 3LZ1C 1P3FB 4LD9A 5GSUB 5AV6A 4HGAC 3UTAC 5GT0C 4J8VB 5AY8C 5AV9D 3AZEA 5CPIA 3R45A 2FJ7D 5G49A 4DQYB 3EPKA 3MGQA 2BG1A 3C1BD 1TZYC 1ZLAA 5DNND 2FJ7B 1ID3C 3AZND 3B6GB 2JE5A 3UT9B 4Z66A 3KWQA 3AZHD 4KUDD 1AOIA 5GXQD 4M6BA 1P34B 3RELA 1P3PA 3KSYA 2UWXA 5AV6D 4KHAA 1ID3D 4J8WB 3NQJB 3MVDC 1KX3D 3AZJB 5AV5C 3MNNA 3W99D 1P3OA 3A6NB 5CPID 3REJA 1ID3B 1P3OB 3H0MC 5B1MA 1KX3B 2F8NK 1P3BD 3X1UA 1B6WA 1EQZB 3KUYC 3UTAD 1EQZD 5B31A 1F66C 4Z66C 2VQRA 3O62A 2CV5D 2DQNC 3KWQD 3AZMC 1TZYA 1ZLAC 4YM6B 4WU9A 3WTPE 5AVCC 3KUYD 5AVBD 5AV5B 3AV2D 4YM6D 1Z2CB 2DF4C 3X1UC 5AVBB 4Z5TC 2J8PA 4J8WA 1B67A 5AVCA 2AROB 1M18B 4QLCC 5BNVA 5AY8D 4H9PB 1JFIA 5F99B 3VH5A 1M1AC 3AYWC 3REHA 3WTPA 5JA4B 3AZEB 5B0YC 3REIA 2ZY3A 4UPKA 3B0CW 4JJNA 3W98C 3REJC 2YFWA 4HGAB 1P3AA 4G91C 5B1MB 3X1VC 3C1CD 3W96C 1TZYB 4H9RA 1P3LC 3R45B 4J8UD 1TZYD 3MGRB 3O62B 5B33D 3X1TC 3X1TD 3WTPC 2Y2GA 5B33C 3B6GA 2RVQD 2JSSA 5FUGB 1KX4C 2YFVA 2FJ7C 3AZGA 5BO0B 3B6FD 4WU9B 4QLCD 5AY8A 3AZEC 3B6FB 1N1JA 5B24D 1P3BC 5CPKB 1JFIB 5F99A 4XUJD 3AV2C 4DRBA 3WTPD 3H0RC 2Y2NA 3W99B 5BNXA 5GT3C 1KX5A 3X1SC 3X1VA 4H9NB 1KX5C 5B0ZB 4NE3A 3WTPB 4YS3D 1W2EA 1P3AD 5GSUD 4J8VD 5AV8B 5B0YD 4J8UA 4XZQC 5AV8D 3TU4C 2F8NA 2FJ7A 3AFAC 4EO5B 5B2JA 1F66B 5AV5A 4H9OA 2W8SA 2NZDC 5B40A 2AROD 3W97D 4WJ3C 3W97C 1PZRA 4YM6C 2YFVB 1U35D 4KHAB 5B2IC 3AZKC 1P34D 3AZFB 4KUDA 3KFUG 5GT0D 5GXQA 5B2JC 5CHLB 3UT9C 3C1BC 1P3GC 3X1SA 3AZFD 3AYWA 4DRAA 3MVDB 3WKJB 4WU8B 3AZJC 3MNND 1AOIC 2F8NB 1BFMA 4WU8A 3W96B 5AV9A 3REKC 1M19B 4J8XC 3REJD 4J8UB 3MGRA 3X1TB 3REJB 3WAAA 5CPJD 3MGQB 4Z2MH 4AWLB 1M19D 3AZGB 4XUJC 2CWEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UTA B;  5B31 B;  5DNM D;  4ZUX B;  3O62 C;  3MGS A;  1P3I D;  1HQ3 C;  1P3F C;  5B24 B;  1BH8 A;  3LZ0 D;  5AV9 C;  3REK A;  3UTB D;  1HQ3 A;  1P3F A;  4YM6 A;  1P3A C;  2BYM B;  2IO5 C;  1H3O A;  3REL D;  1P3P D;  5AY8 B;  5AVB C;  5AVC D;  4H9S C;  3AZJ A;  1P3L D;  3X1S D;  5AVC B;  3AZF A;  1M18 A;  3VH6 W;  4E44 A;  3AV1 C;  4ZBJ B;  2F8N G;  5B32 B;  3REL B;  1P3P B;  4AWL C;  4Z2M G;  3AYW B;  1WWI A;  3W98 D;  1HTA A;  4G92 C;  3AZE D;  3KXB A;  1S32 D;  4CSR B;  4NE6 A;  5B32 D;  5AV9 B;  1M19 A;  3W98 B;  3LZ0 C;  2IO5 B;  1M1A D;  3O62 D;  3AZN B;  4KGC C;  3C1C B;  3LZ0 A;  3AZM A;  4EO5 C;  5B33 A;  3B6G D;  1ULY A;  3KUY A;  5B33 B;  3AZL C;  5CPJ C;  5B2I B;  3AZK B;  5BT1 D;  3B0D B;  4J8W D;  2NZD A;  1AOI D;  3AZJ D;  3WA9 A;  3LJA A;  5AV6 B;  4E45 A;  1P3G B;  1ID3 A;  5B1L C;  1P3G D;  5CPI B;  4X23 C;  1P3O D;  3KXB D;  1S32 A;  4YS3 B;  5BS7 C;  5B32 A;  1P3B B;  5B31 G;  1P3B A;  3X1U D;  5KDM A;  3W99 C;  3WKJ A;  5JA4 A;  3VH6 A;  3AZL B;  4WNN A;  3MGP C;  3X1U B;  2CV5 B;  1P3K B;  4Z5T B;  3KXB B;  3AZL D;  5B0Y A;  3B0D C;  4H9R B;  3AZM D;  5CP6 A;  5B0Y B;  3X1T A;  3B6G C;  3KWQ B;  1BH9 B;  3NQU A;  4XZQ D;  3TU4 D;  4XZQ B;  3TU4 B;  3AFA B;  3W97 A;  1P3L B;  1N1J B;  4YS3 C;  3W97 B;  5E5A B;  4H9P A;  5E5A D;  1KX4 B;  2PYO B;  3A6N C;  3AFA D;  4JJN B;  3REH D;  4R8P B;  3AN2 A;  4H9S A;  3B0C T;  3MGR C;  3REI B;  3AZI C;  1P3M D;  2HIO C;  3LZ1 B;  3AV1 B;  3WAA C;  3WKJ D;  5GSU C;  3REL C;  1P3P C;  1S32 C;  4KUD C;  1TAF A;  3UTB C;  4WU8 C;  5B40 C;  4H9N A;  4WU9 C;  3C1C A;  5KDM B;  3MGS C;  3AV1 D;  3MGR D;  2RVQ C;  4WV4 B;  4ZUX A;  5CP6 C;  5B2I A;  3AZK A;  5CPJ B;  5GT3 B;  4J8U C;  4QLC B;  4XUJ B;  4R8P C;  5DNM A;  1P3I A;  3MGS D;  5B31 C;  1F66 A;  3REK D;  5B32 G;  3NQJ A;  5DNM C;  4R8P A;  3AN2 B;  1P3I C;  1HQ3 D;  1P3F D;  4ZUX C;  3AN2 D;  4CAY A;  3UTB B;  5C3I B;  5JRG C;  5JRG D;  1H3O B;  4NE5 A;  3LEL A;  3X1V D;  3AYW D;  1P3A B;  5B1M C;  3X1V B;  4Z5T D;  3W98 A;  3MNN C;  5AV8 A;  5B2J D;  1ZLA D;  5B1L D;  1P3K A;  3UT9 D;  5B2J B;  4Z66 B;  3AZH B;  1F66 D;  3WA9 C;  5B40 D;  4Z66 D;  2ARO A;  4H9Q B;  3C1B B;  5FUG A;  1ZLA B;  5DNN B;  1BH9 A;  3WKJ C;  4LD9 B;  1AOI B;  5GT0 B;  4J8V C;  4KGC B;  2BYM A;  1U35 B;  4JJN C;  2NQB D;  5GT0 A;  2NZD D;  4KGC A;  3WA9 D;  3LEL D;  3REH C;  2NQB B;  4X23 D;  3LZ1 A;  3MNN B;  5GXQ B;  5BNV B;  5E5A C;  4NFT A;  3W96 A;  4LD9 D;  3MGQ C;  5AV6 C;  3W99 A;  3MVD D;  5AV8 C;  3AZI B;  3VH5 W;  5CPI C;  5B24 C;  3VH5 T;  3AZI A;  5BT1 C;  4J8W C;  4H9O B;  5B31 D;  3MGQ D;  5B1L A;  5CPJ A;  1P3K D;  3UT9 A;  2YFW B;  2HUE B;  1BH8 B;  5GT3 D;  1M1A A;  4H9Q A;  3NQU B;  3C1B A;  5CP6 D;  5GXQ C;  5CP6 B;  1WWS A;  4ZBJ C;  3KUY B;  4J8X A;  3LZ0 B;  4CAY B;  3UTB A;  1P3O C;  2BYK B;  5C3I C;  5JRG B;  4X23 A;  3AZN C;  2HIO D;  3MVD A;  4WZS B;  1M18 D;  1KX3 A;  5CPK A;  5E5A A;  3A6N A;  3B0B A;  3REI D;  5G49 B;  3C1C C;  5B1M D;  1R4V A;  1M1A B;  2L5A A;  3UTA A;  5B1L B;  1EQZ A;  1S32 B;  1M18 C;  1TAF B;  5B40 B;  3WAA B;  5BO0 A;  4WU9 D;  4XZQ A;  3TU4 A;  5B2I D;  3LJA B;  3AZK D;  1P34 C;  4G91 B;  3MGS B;  2NZD B;  2HIO A;  4XUJ A;  3KWQ C;  3LJA D;  5CPK D;  3A6N D;  3MGP B;  2CV5 C;  3AFA A;  1P3K C;  3AZF C;  1Q9C A;  1P3G A;  1KX3 C;  1P3M A;  1EQZ C;  4YS3 A;  3MGP D;  2PYO A;  5GSU A;  1P3M C;  5B0Z D;  4Z5T A;  2PYO C;  3AV1 A;  3AZM B;  3AZL A;  4WNN B;  2CV5 A;  2ARO C;  3LEL C;  3VH6 T;  5AV5 D;  3AV2 B;  5AVB A;  5F99 C;  1F1E A;  3AV2 A;  4QLC A;  3AZH C;  5B0Z C;  1U35 A;  1KU5 A;  4R8P D;  5F99 D;  4KUD B;  5DNN C;  1KX4 D;  1P3M B;  3WA9 B;  4LD9 C;  2BYK A;  5JRG A;  4X23 B;  4KGC D;  3MGP A;  3LZ1 D;  2PYO D;  4UUZ A;  3LEL B;  4JJN D;  3REH B;  2NQB C;  3W96 D;  4UUZ B;  5B0Z A;  4WU8 D;  1U35 C;  5BS7 A;  5B32 C;  3KXB C;  4J8V A;  2LY8 A;  1A7W A;  3WAA D;  4G92 B;  2F8N D;  3AZI D;  3B6F C;  2F8N H;  4CSR A;  4ZUX D;  5DNM B;  3AN2 C;  1P3I B;  5CPK C;  3LJA C;  3AZG D;  5GT3 A;  3B6F A;  2HUE C;  3REK B;  1M19 C;  5DNN A;  3AZN A;  5B24 A;  5BNX B;  1KX5 B;  1KX4 A;  3AZH A;  4J8X D;  1P34 A;  1KX5 D;  3X1S B;  3AZG C;  2NQB A;  4J8X B;  3V9R A;  1P3L A;  3REI C;  3V9R B;  2HIO B;  1HQ3 B;  3LZ1 C;  1P3F B;  4LD9 A;  5GSU B;  5AV6 A;  4HGA C;  3UTA C;  5GT0 C;  4J8V B;  5AY8 C;  5AV9 D;  3AZE A;  5CPI A;  3R45 A;  2FJ7 D;  5G49 A;  3MGQ A;  3C1B D;  1TZY C;  1ZLA A;  5DNN D;  2FJ7 B;  1ID3 C;  3AZN D;  3B6G B;  3UT9 B;  4Z66 A;  3KWQ A;  3AZH D;  4KUD D;  1AOI A;  5GXQ D;  4M6B A;  1P34 B;  3REL A;  1P3P A;  3KSY A;  5AV6 D;  4KHA A;  1ID3 D;  4J8W B;  3NQJ B;  3MVD C;  1KX3 D;  3AZJ B;  5AV5 C;  3MNN A;  3W99 D;  1P3O A;  3A6N B;  5CPI D;  3REJ A;  1ID3 B;  1P3O B;  5B1M A;  1KX3 B;  2F8N K;  1P3B D;  3X1U A;  1B6W A;  1EQZ B;  3KUY C;  3UTA D;  1EQZ D;  5B31 A;  1F66 C;  4Z66 C;  3O62 A;  2CV5 D;  3KWQ D;  3AZM C;  1TZY A;  1ZLA C;  4YM6 B;  4WU9 A;  3WTP E;  5AVC C;  3KUY D;  5AVB D;  5AV5 B;  3AV2 D;  4YM6 D;  3X1U C;  5AVB B;  4Z5T C;  4J8W A;  1B67 A;  5AVC A;  2ARO B;  1M18 B;  4QLC C;  5BNV A;  5AY8 D;  4H9P B;  1JFI A;  5F99 B;  3VH5 A;  1M1A C;  3AYW C;  3REH A;  3WTP A;  5JA4 B;  3AZE B;  5B0Y C;  3REI A;  3B0C W;  4JJN A;  3W98 C;  3REJ C;  2YFW A;  4HGA B;  1P3A A;  4G91 C;  5B1M B;  3X1V C;  3C1C D;  3W96 C;  1TZY B;  4H9R A;  1P3L C;  3R45 B;  4J8U D;  1TZY D;  3MGR B;  3O62 B;  5B33 D;  3X1T C;  3X1T D;  3WTP C;  5B33 C;  3B6G A;  2RVQ D;  2JSS A;  5FUG B;  1KX4 C;  2YFV A;  2FJ7 C;  3AZG A;  5BO0 B;  3B6F D;  4WU9 B;  4QLC D;  5AY8 A;  3AZE C;  3B6F B;  1N1J A;  5B24 D;  1P3B C;  5CPK B;  1JFI B;  5F99 A;  4XUJ D;  3AV2 C;  4DRB A;  3WTP D;  3W99 B;  5BNX A;  5GT3 C;  1KX5 A;  3X1S C;  3X1V A;  4H9N B;  1KX5 C;  5B0Z B;  4NE3 A;  3WTP B;  4YS3 D;  1P3A D;  5GSU D;  4J8V D;  5AV8 B;  5B0Y D;  4J8U A;  4XZQ C;  5AV8 D;  3TU4 C;  2F8N A;  2FJ7 A;  3AFA C;  4EO5 B;  5B2J A;  1F66 B;  5AV5 A;  4H9O A;  2NZD C;  5B40 A;  2ARO D;  3W97 D;  3W97 C;  4YM6 C;  2YFV B;  1U35 D;  4KHA B;  5B2I C;  3AZK C;  1P34 D;  3AZF B;  4KUD A;  5GT0 D;  5GXQ A;  5B2J C;  5CHL B;  3UT9 C;  3C1B C;  1P3G C;  3X1S A;  3AZF D;  3AYW A;  4DRA A;  3MVD B;  3WKJ B;  4WU8 B;  3AZJ C;  3MNN D;  1AOI C;  2F8N B;  1BFM A;  4WU8 A;  3W96 B;  5AV9 A;  3REK C;  1M19 B;  4J8X C;  3REJ D;  4J8U B;  3MGR A;  3X1T B;  3REJ B;  3WAA A;  5CPJ D;  3MGQ B;  4Z2M H;  4AWL B;  1M19 D;  3AZG B;  4XUJ C;  2CWE A; 
#chains in the Genus database with same CATH topology
 3UTA B;  5B31 B;  2ZY4 A;  5DNM D;  4ZUX B;  3O62 C;  3MGS A;  1P3I D;  1HQ3 C;  1P3F C;  5B24 B;  1BH8 A;  3LZ0 D;  5AV9 C;  2Y2Q A;  3REK A;  3P5J B;  3UTB D;  1HQ3 A;  1P3F A;  4YM6 A;  1P3A C;  2BYM B;  2IO5 C;  1H3O A;  3REL D;  1P3P D;  5AY8 B;  5AVB C;  5AVC D;  4H9S C;  3AZJ A;  1P3L D;  3X1S D;  5AVC B;  3AZF A;  1M18 A;  3VH6 W;  4E44 A;  3EPL A;  3AV1 C;  4ZBJ B;  2F8N G;  5B32 B;  3REL B;  1P3P B;  4AWL C;  4Z2M G;  3AYW B;  1WWI A;  3W98 D;  2Y2J A;  1HTA A;  4G92 C;  3AZE D;  3KXB A;  1S32 D;  4CSR B;  4NE6 A;  5B32 D;  5AV9 B;  1M19 A;  3W98 B;  3LZ0 C;  2ZY5 A;  2IO5 B;  1M1A D;  3O62 D;  3AZN B;  4KGC C;  3C1C B;  3LZ0 A;  3AZM A;  4EO5 C;  5B33 A;  3B6G D;  1ULY A;  3KUY A;  5B33 B;  3AZL C;  5CPJ C;  5B2I B;  3AZK B;  2Y2K A;  3F6T A;  3IP4 C;  5BT1 D;  3B0D B;  4J8W D;  2NZD A;  1AOI D;  3AZJ D;  3WA9 A;  3LJA A;  5AV6 B;  4E45 A;  1P3G B;  1ID3 A;  5B1L C;  1P3G D;  5CPI B;  4X23 C;  1P3O D;  3KXB D;  1S32 A;  4YS3 B;  5BS7 C;  5B32 A;  1P3B B;  5B31 G;  1P3B A;  3X1U D;  5KDM A;  3W99 C;  3WKJ A;  5JA4 A;  3VH6 A;  3AZL B;  4WNN A;  3MGP C;  3X1U B;  2CV5 B;  1P3K B;  4Z5T B;  3KXB B;  3AZL D;  5B0Y A;  3B0D C;  4H9R B;  3AZM D;  5CP6 A;  5B0Y B;  3X1T A;  3B6G C;  3KWQ B;  3EPH A;  1BH9 B;  3NQU A;  4XZQ D;  3TU4 D;  4XZQ B;  3TU4 B;  3AFA B;  3W97 A;  1P3L B;  1N1J B;  4YS3 C;  3W97 B;  5E5A B;  4H9P A;  5E5A D;  1KX4 B;  2PYO B;  3A6N C;  3AFA D;  4JJN B;  3REH D;  4R8P B;  3AN2 A;  4H9S A;  3B0C T;  3MGR C;  3REI B;  3AZI C;  1P3M D;  1T3U A;  2HIO C;  3LZ1 B;  3AV1 B;  3A1K A;  3WAA C;  3WKJ D;  5GSU C;  3REL C;  1P3P C;  1S32 C;  4KUD C;  1TAF A;  3UTB C;  4WU8 C;  5B40 C;  4H9N A;  4WU9 C;  3C1C A;  5KDM B;  3MGS C;  3AV1 D;  2FFF B;  3MGR D;  2RVQ C;  4WV4 B;  4ZUX A;  5CP6 C;  5B2I A;  3AZK A;  5CPJ B;  5GT3 B;  4J8U C;  2Y2M A;  4QLC B;  4XUJ B;  4R8P C;  5DNM A;  1P3I A;  3MGS D;  5B31 C;  1F66 A;  3REK D;  5B32 G;  3NQJ A;  5DNM C;  4R8P A;  3AN2 B;  1P3I C;  1HQ3 D;  1P3F D;  4ZUX C;  3AN2 D;  4CAY A;  3UTB B;  5C3I B;  5JRG C;  5JRG D;  3FDD A;  1H3O B;  4NE5 A;  3LEL A;  3X1V D;  3AYW D;  1P3A B;  5B1M C;  3X1V B;  4Z5T D;  3W98 A;  3MNN C;  2Y2O A;  2ZY2 A;  5AV8 A;  5B2J D;  1ZLA D;  5B1L D;  1P3K A;  3UT9 D;  2Y2H A;  5B2J B;  4Z66 B;  3AZH B;  1F66 D;  3WA9 C;  5B40 D;  4Z66 D;  2ARO A;  2XD5 A;  4H9Q B;  3C1B B;  5FUG A;  2XD1 A;  1ZLA B;  5DNN B;  1BH9 A;  2F2A C;  3WKJ C;  4LD9 B;  1AOI B;  5GT0 B;  4J8V C;  4KGC B;  2BYM A;  1U35 B;  4JJN C;  2NQB D;  5GT0 A;  2NZD D;  4KGC A;  3WA9 D;  3LEL D;  3REH C;  2NQB B;  4X23 D;  3LZ1 A;  3MNN B;  5GXQ B;  5BNV B;  5E5A C;  4NFT A;  3W96 A;  4LD9 D;  3MGQ C;  5AV6 C;  3W99 A;  3MVD D;  5AV8 C;  3AZI B;  3VH5 W;  5CPI C;  5B24 C;  3VH5 T;  3EPJ A;  3AZI A;  5BT1 C;  4J8W C;  4H9O B;  5B31 D;  3MGQ D;  3AL0 C;  5B1L A;  5CPJ A;  1P3K D;  3UT9 A;  2YFW B;  2HUE B;  1BH8 B;  5GT3 D;  1M1A A;  4H9Q A;  3NQU B;  3C1B A;  5CP6 D;  5GXQ C;  5CP6 B;  1WWS A;  4ZBJ C;  3KUY B;  4J8X A;  3LZ0 B;  4CAY B;  3UTB A;  1P3O C;  2BYK B;  5C3I C;  5JRG B;  4X23 A;  3AZN C;  2HIO D;  3MVD A;  4WZS B;  1M18 D;  2RIQ A;  1KX3 A;  5CPK A;  5E5A A;  3A6N A;  3B0B A;  3REI D;  3A1I A;  5G49 B;  3C1C C;  5B1M D;  1R4V A;  1M1A B;  2L5A A;  3UTA A;  5B1L B;  1EQZ A;  1S32 B;  2ZM5 A;  1M18 C;  2JCH A;  3H0L C;  1TAF B;  5B40 B;  3WAA B;  5BO0 A;  4WU9 D;  4XZQ A;  3TU4 A;  5B2I D;  3LJA B;  3AZK D;  1P34 C;  4G91 B;  3MGS B;  2NZD B;  2HIO A;  4XUJ A;  3KWQ C;  3LJA D;  5CPK D;  2G5I C;  3A6N D;  3MGP B;  2CV5 C;  3AFA A;  1P3K C;  3AZF C;  1Q9C A;  1P3G A;  1KX3 C;  1P3M A;  1EQZ C;  4YS3 A;  3MGP D;  2PYO A;  5GSU A;  1P3M C;  2Y2L A;  5B0Z D;  4Z5T A;  2PYO C;  2Y2P A;  3AZM B;  3AV1 A;  3AZL A;  4WNN B;  2CV5 A;  2ARO C;  3LEL C;  3VH6 T;  5AV5 D;  3AV2 B;  5AVB A;  5F99 C;  1F1E A;  3AV2 A;  2Y2I A;  4QLC A;  3AZH C;  5B0Z C;  1U35 A;  2G5H C;  1KU5 A;  4R8P D;  5F99 D;  4KUD B;  5DNN C;  1KX4 D;  1P3M B;  3WA9 B;  4LD9 C;  2BYK A;  5JRG A;  4X23 B;  4KGC D;  3MGP A;  3LZ1 D;  2PYO D;  4UUZ A;  3LEL B;  4JJN D;  3REH B;  2NQB C;  3W96 D;  4UUZ B;  3EG5 B;  5B0Z A;  4WU8 D;  1U35 C;  5BS7 A;  5B32 C;  3KXB C;  4J8V A;  2LY8 A;  1A7W A;  3WAA D;  4G92 B;  2F8N D;  3AZI D;  3B6F C;  2F8N H;  4CSR A;  4ZUX D;  5DNM B;  3AN2 C;  1P3I B;  5CPK C;  3LJA C;  3AZG D;  5GT3 A;  3B6F A;  2HUE C;  3REK B;  1M19 C;  5DNN A;  3AZN A;  5B24 A;  5BNX B;  1KX5 B;  1KX4 A;  3AZH A;  4J8X D;  1P34 A;  1KX5 D;  3X1S B;  3AZG C;  2NQB A;  4J8X B;  3V9R A;  1P3L A;  3REI C;  3V9R B;  2HIO B;  1HQ3 B;  3LZ1 C;  1P3F B;  4LD9 A;  5GSU B;  5AV6 A;  4HGA C;  3UTA C;  5GT0 C;  4J8V B;  5AY8 C;  5AV9 D;  3AZE A;  5CPI A;  3R45 A;  2FJ7 D;  5G49 A;  4DQY B;  3EPK A;  3MGQ A;  2BG1 A;  3C1B D;  1TZY C;  1ZLA A;  5DNN D;  2FJ7 B;  1ID3 C;  3AZN D;  3B6G B;  2JE5 A;  3UT9 B;  4Z66 A;  3KWQ A;  3AZH D;  4KUD D;  1AOI A;  5GXQ D;  4M6B A;  1P34 B;  3REL A;  1P3P A;  3KSY A;  2UWX A;  5AV6 D;  4KHA A;  1ID3 D;  4J8W B;  3NQJ B;  3MVD C;  1KX3 D;  3AZJ B;  5AV5 C;  3MNN A;  3W99 D;  1P3O A;  3A6N B;  5CPI D;  3REJ A;  1ID3 B;  1P3O B;  3H0M C;  5B1M A;  1KX3 B;  2F8N K;  1P3B D;  3X1U A;  1B6W A;  1EQZ B;  3KUY C;  3UTA D;  1EQZ D;  5B31 A;  1F66 C;  4Z66 C;  2VQR A;  3O62 A;  2CV5 D;  2DQN C;  3KWQ D;  3AZM C;  1TZY A;  1ZLA C;  4YM6 B;  4WU9 A;  3WTP E;  5AVC C;  3KUY D;  5AVB D;  5AV5 B;  3AV2 D;  4YM6 D;  1Z2C B;  2DF4 C;  3X1U C;  5AVB B;  4Z5T C;  2J8P A;  4J8W A;  1B67 A;  5AVC A;  2ARO B;  1M18 B;  4QLC C;  5BNV A;  5AY8 D;  4H9P B;  1JFI A;  5F99 B;  3VH5 A;  1M1A C;  3AYW C;  3REH A;  3WTP A;  5JA4 B;  3AZE B;  5B0Y C;  3REI A;  2ZY3 A;  4UPK A;  3B0C W;  4JJN A;  3W98 C;  3REJ C;  2YFW A;  4HGA B;  1P3A A;  4G91 C;  5B1M B;  3X1V C;  3C1C D;  3W96 C;  1TZY B;  4H9R A;  1P3L C;  3R45 B;  4J8U D;  1TZY D;  3MGR B;  3O62 B;  5B33 D;  3X1T C;  3X1T D;  3WTP C;  2Y2G A;  5B33 C;  3B6G A;  2RVQ D;  2JSS A;  5FUG B;  1KX4 C;  2YFV A;  2FJ7 C;  3AZG A;  5BO0 B;  3B6F D;  4WU9 B;  4QLC D;  5AY8 A;  3AZE C;  3B6F B;  1N1J A;  5B24 D;  1P3B C;  5CPK B;  1JFI B;  5F99 A;  4XUJ D;  3AV2 C;  4DRB A;  3WTP D;  3H0R C;  2Y2N A;  3W99 B;  5BNX A;  5GT3 C;  1KX5 A;  3X1S C;  3X1V A;  4H9N B;  1KX5 C;  5B0Z B;  4NE3 A;  3WTP B;  4YS3 D;  1W2E A;  1P3A D;  5GSU D;  4J8V D;  5AV8 B;  5B0Y D;  4J8U A;  4XZQ C;  5AV8 D;  3TU4 C;  2F8N A;  2FJ7 A;  3AFA C;  4EO5 B;  5B2J A;  1F66 B;  5AV5 A;  4H9O A;  2W8S A;  2NZD C;  5B40 A;  2ARO D;  3W97 D;  4WJ3 C;  3W97 C;  1PZR A;  4YM6 C;  2YFV B;  1U35 D;  4KHA B;  5B2I C;  3AZK C;  1P34 D;  3AZF B;  4KUD A;  3KFU G;  5GT0 D;  5GXQ A;  5B2J C;  5CHL B;  3UT9 C;  3C1B C;  1P3G C;  3X1S A;  3AZF D;  3AYW A;  4DRA A;  3MVD B;  3WKJ B;  4WU8 B;  3AZJ C;  3MNN D;  1AOI C;  2F8N B;  1BFM A;  4WU8 A;  3W96 B;  5AV9 A;  3REK C;  1M19 B;  4J8X C;  3REJ D;  4J8U B;  3MGR A;  3X1T B;  3REJ B;  3WAA A;  5CPJ D;  3MGQ B;  4Z2M H;  4AWL B;  1M19 D;  3AZG B;  4XUJ C;  2CWE A; 
#chains in the Genus database with same CATH homology
 3UTA B;  5B31 B;  2ZY4 A;  5DNM D;  4ZUX B;  3O62 C;  3MGS A;  1P3I D;  1HQ3 C;  1P3F C;  5B24 B;  1BH8 A;  3LZ0 D;  5AV9 C;  2Y2Q A;  3REK A;  3P5J B;  3UTB D;  1HQ3 A;  1P3F A;  4YM6 A;  1P3A C;  2BYM B;  2IO5 C;  1H3O A;  3REL D;  1P3P D;  5AY8 B;  5AVB C;  5AVC D;  4H9S C;  3AZJ A;  1P3L D;  3X1S D;  5AVC B;  3AZF A;  1M18 A;  3VH6 W;  4E44 A;  3EPL A;  3AV1 C;  4ZBJ B;  2F8N G;  5B32 B;  3REL B;  1P3P B;  4AWL C;  4Z2M G;  3AYW B;  1WWI A;  3W98 D;  2Y2J A;  1HTA A;  4G92 C;  3AZE D;  3KXB A;  1S32 D;  4CSR B;  4NE6 A;  5B32 D;  5AV9 B;  1M19 A;  3W98 B;  3LZ0 C;  2ZY5 A;  2IO5 B;  1M1A D;  3O62 D;  3AZN B;  4KGC C;  3C1C B;  3LZ0 A;  3AZM A;  4EO5 C;  5B33 A;  3B6G D;  1ULY A;  3KUY A;  5B33 B;  3AZL C;  5CPJ C;  5B2I B;  3AZK B;  2Y2K A;  3F6T A;  3IP4 C;  5BT1 D;  3B0D B;  4J8W D;  2NZD A;  1AOI D;  3AZJ D;  3WA9 A;  3LJA A;  5AV6 B;  4E45 A;  1P3G B;  1ID3 A;  5B1L C;  1P3G D;  5CPI B;  4X23 C;  1P3O D;  3KXB D;  1S32 A;  4YS3 B;  5BS7 C;  5B32 A;  1P3B B;  5B31 G;  1P3B A;  3X1U D;  5KDM A;  3W99 C;  3WKJ A;  5JA4 A;  3VH6 A;  3AZL B;  4WNN A;  3MGP C;  3X1U B;  2CV5 B;  1P3K B;  4Z5T B;  3KXB B;  3AZL D;  5B0Y A;  3B0D C;  4H9R B;  3AZM D;  5CP6 A;  5B0Y B;  3X1T A;  3B6G C;  3KWQ B;  3EPH A;  1BH9 B;  3NQU A;  4XZQ D;  3TU4 D;  4XZQ B;  3TU4 B;  3AFA B;  3W97 A;  1P3L B;  1N1J B;  4YS3 C;  3W97 B;  5E5A B;  4H9P A;  5E5A D;  1KX4 B;  2PYO B;  3A6N C;  3AFA D;  4JJN B;  3REH D;  4R8P B;  3AN2 A;  4H9S A;  3B0C T;  3MGR C;  3REI B;  3AZI C;  1P3M D;  1T3U A;  2HIO C;  3LZ1 B;  3AV1 B;  3A1K A;  3WAA C;  3WKJ D;  5GSU C;  3REL C;  1P3P C;  1S32 C;  4KUD C;  1TAF A;  3UTB C;  4WU8 C;  5B40 C;  4H9N A;  4WU9 C;  3C1C A;  5KDM B;  3MGS C;  3AV1 D;  2FFF B;  3MGR D;  2RVQ C;  4WV4 B;  4ZUX A;  5CP6 C;  5B2I A;  3AZK A;  5CPJ B;  5GT3 B;  4J8U C;  2Y2M A;  4QLC B;  4XUJ B;  4R8P C;  5DNM A;  1P3I A;  3MGS D;  5B31 C;  1F66 A;  3REK D;  5B32 G;  3NQJ A;  5DNM C;  4R8P A;  3AN2 B;  1P3I C;  1HQ3 D;  1P3F D;  4ZUX C;  3AN2 D;  4CAY A;  3UTB B;  5C3I B;  5JRG C;  5JRG D;  3FDD A;  1H3O B;  4NE5 A;  3LEL A;  3X1V D;  3AYW D;  1P3A B;  5B1M C;  3X1V B;  4Z5T D;  3W98 A;  3MNN C;  2Y2O A;  2ZY2 A;  5AV8 A;  5B2J D;  1ZLA D;  5B1L D;  1P3K A;  3UT9 D;  2Y2H A;  5B2J B;  4Z66 B;  3AZH B;  1F66 D;  3WA9 C;  5B40 D;  4Z66 D;  2ARO A;  2XD5 A;  4H9Q B;  3C1B B;  5FUG A;  2XD1 A;  1ZLA B;  5DNN B;  1BH9 A;  2F2A C;  3WKJ C;  4LD9 B;  1AOI B;  5GT0 B;  4J8V C;  4KGC B;  2BYM A;  1U35 B;  4JJN C;  2NQB D;  5GT0 A;  2NZD D;  4KGC A;  3WA9 D;  3LEL D;  3REH C;  2NQB B;  4X23 D;  3LZ1 A;  3MNN B;  5GXQ B;  5BNV B;  5E5A C;  4NFT A;  3W96 A;  4LD9 D;  3MGQ C;  5AV6 C;  3W99 A;  3MVD D;  5AV8 C;  3AZI B;  3VH5 W;  5CPI C;  5B24 C;  3VH5 T;  3EPJ A;  3AZI A;  5BT1 C;  4J8W C;  4H9O B;  5B31 D;  3MGQ D;  3AL0 C;  5B1L A;  5CPJ A;  1P3K D;  3UT9 A;  2YFW B;  2HUE B;  1BH8 B;  5GT3 D;  1M1A A;  4H9Q A;  3NQU B;  3C1B A;  5CP6 D;  5GXQ C;  5CP6 B;  1WWS A;  4ZBJ C;  3KUY B;  4J8X A;  3LZ0 B;  4CAY B;  3UTB A;  1P3O C;  2BYK B;  5C3I C;  5JRG B;  4X23 A;  3AZN C;  2HIO D;  3MVD A;  4WZS B;  1M18 D;  2RIQ A;  1KX3 A;  5CPK A;  5E5A A;  3A6N A;  3B0B A;  3REI D;  3A1I A;  5G49 B;  3C1C C;  5B1M D;  1R4V A;  1M1A B;  2L5A A;  3UTA A;  5B1L B;  1EQZ A;  1S32 B;  2ZM5 A;  1M18 C;  2JCH A;  3H0L C;  1TAF B;  5B40 B;  3WAA B;  5BO0 A;  4WU9 D;  4XZQ A;  3TU4 A;  5B2I D;  3LJA B;  3AZK D;  1P34 C;  4G91 B;  3MGS B;  2NZD B;  2HIO A;  4XUJ A;  3KWQ C;  3LJA D;  5CPK D;  2G5I C;  3A6N D;  3MGP B;  2CV5 C;  3AFA A;  1P3K C;  3AZF C;  1Q9C A;  1P3G A;  1KX3 C;  1P3M A;  1EQZ C;  4YS3 A;  3MGP D;  2PYO A;  5GSU A;  1P3M C;  2Y2L A;  5B0Z D;  4Z5T A;  2PYO C;  2Y2P A;  3AZM B;  3AV1 A;  3AZL A;  4WNN B;  2CV5 A;  2ARO C;  3LEL C;  3VH6 T;  5AV5 D;  3AV2 B;  5AVB A;  5F99 C;  1F1E A;  3AV2 A;  2Y2I A;  4QLC A;  3AZH C;  5B0Z C;  1U35 A;  2G5H C;  1KU5 A;  4R8P D;  5F99 D;  4KUD B;  5DNN C;  1KX4 D;  1P3M B;  3WA9 B;  4LD9 C;  2BYK A;  5JRG A;  4X23 B;  4KGC D;  3MGP A;  3LZ1 D;  2PYO D;  4UUZ A;  3LEL B;  4JJN D;  3REH B;  2NQB C;  3W96 D;  4UUZ B;  3EG5 B;  5B0Z A;  4WU8 D;  1U35 C;  5BS7 A;  5B32 C;  3KXB C;  4J8V A;  2LY8 A;  1A7W A;  3WAA D;  4G92 B;  2F8N D;  3AZI D;  3B6F C;  2F8N H;  4CSR A;  4ZUX D;  5DNM B;  3AN2 C;  1P3I B;  5CPK C;  3LJA C;  3AZG D;  5GT3 A;  3B6F A;  2HUE C;  3REK B;  1M19 C;  5DNN A;  3AZN A;  5B24 A;  5BNX B;  1KX5 B;  1KX4 A;  3AZH A;  4J8X D;  1P34 A;  1KX5 D;  3X1S B;  3AZG C;  2NQB A;  4J8X B;  3V9R A;  1P3L A;  3REI C;  3V9R B;  2HIO B;  1HQ3 B;  3LZ1 C;  1P3F B;  4LD9 A;  5GSU B;  5AV6 A;  4HGA C;  3UTA C;  5GT0 C;  4J8V B;  5AY8 C;  5AV9 D;  3AZE A;  5CPI A;  3R45 A;  2FJ7 D;  5G49 A;  4DQY B;  3EPK A;  3MGQ A;  2BG1 A;  3C1B D;  1TZY C;  1ZLA A;  5DNN D;  2FJ7 B;  1ID3 C;  3AZN D;  3B6G B;  2JE5 A;  3UT9 B;  4Z66 A;  3KWQ A;  3AZH D;  4KUD D;  1AOI A;  5GXQ D;  4M6B A;  1P34 B;  3REL A;  1P3P A;  3KSY A;  2UWX A;  5AV6 D;  4KHA A;  1ID3 D;  4J8W B;  3NQJ B;  3MVD C;  1KX3 D;  3AZJ B;  5AV5 C;  3MNN A;  3W99 D;  1P3O A;  3A6N B;  5CPI D;  3REJ A;  1ID3 B;  1P3O B;  3H0M C;  5B1M A;  1KX3 B;  2F8N K;  1P3B D;  3X1U A;  1B6W A;  1EQZ B;  3KUY C;  3UTA D;  1EQZ D;  5B31 A;  1F66 C;  4Z66 C;  2VQR A;  3O62 A;  2CV5 D;  2DQN C;  3KWQ D;  3AZM C;  1TZY A;  1ZLA C;  4YM6 B;  4WU9 A;  3WTP E;  5AVC C;  3KUY D;  5AVB D;  5AV5 B;  3AV2 D;  4YM6 D;  1Z2C B;  2DF4 C;  3X1U C;  5AVB B;  4Z5T C;  2J8P A;  4J8W A;  1B67 A;  5AVC A;  2ARO B;  1M18 B;  4QLC C;  5BNV A;  5AY8 D;  4H9P B;  1JFI A;  5F99 B;  3VH5 A;  1M1A C;  3AYW C;  3REH A;  3WTP A;  5JA4 B;  3AZE B;  5B0Y C;  3REI A;  2ZY3 A;  4UPK A;  3B0C W;  4JJN A;  3W98 C;  3REJ C;  2YFW A;  4HGA B;  1P3A A;  4G91 C;  5B1M B;  3X1V C;  3C1C D;  3W96 C;  1TZY B;  4H9R A;  1P3L C;  3R45 B;  4J8U D;  1TZY D;  3MGR B;  3O62 B;  5B33 D;  3X1T C;  3X1T D;  3WTP C;  2Y2G A;  5B33 C;  3B6G A;  2RVQ D;  2JSS A;  5FUG B;  1KX4 C;  2YFV A;  2FJ7 C;  3AZG A;  5BO0 B;  3B6F D;  4WU9 B;  4QLC D;  5AY8 A;  3AZE C;  3B6F B;  1N1J A;  5B24 D;  1P3B C;  5CPK B;  1JFI B;  5F99 A;  4XUJ D;  3AV2 C;  4DRB A;  3WTP D;  3H0R C;  2Y2N A;  3W99 B;  5BNX A;  5GT3 C;  1KX5 A;  3X1S C;  3X1V A;  4H9N B;  1KX5 C;  5B0Z B;  4NE3 A;  3WTP B;  4YS3 D;  1W2E A;  1P3A D;  5GSU D;  4J8V D;  5AV8 B;  5B0Y D;  4J8U A;  4XZQ C;  5AV8 D;  3TU4 C;  2F8N A;  2FJ7 A;  3AFA C;  4EO5 B;  5B2J A;  1F66 B;  5AV5 A;  4H9O A;  2W8S A;  2NZD C;  5B40 A;  2ARO D;  3W97 D;  4WJ3 C;  3W97 C;  1PZR A;  4YM6 C;  2YFV B;  1U35 D;  4KHA B;  5B2I C;  3AZK C;  1P34 D;  3AZF B;  4KUD A;  3KFU G;  5GT0 D;  5GXQ A;  5B2J C;  5CHL B;  3UT9 C;  3C1B C;  1P3G C;  3X1S A;  3AZF D;  3AYW A;  4DRA A;  3MVD B;  3WKJ B;  4WU8 B;  3AZJ C;  3MNN D;  1AOI C;  2F8N B;  1BFM A;  4WU8 A;  3W96 B;  5AV9 A;  3REK C;  1M19 B;  4J8X C;  3REJ D;  4J8U B;  3MGR A;  3X1T B;  3REJ B;  3WAA A;  5CPJ D;  3MGQ B;  4Z2M H;  4AWL B;  1M19 D;  3AZG B;  4XUJ C;  2CWE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...