5BT1C

Histone chaperone hif1 playing with histone h2a-h2b dimer
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
85
structure length
85
Chain Sequence
QSRSAKAGLTFPVGRVHRLLRRGNYAQRIGSGAPVYLTAVLEYLAAEILELAGNAARDNKKTRIIPRHLQLAIRNDDELNKLLGN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HAT1-interacting factor 1
publication title Structural Insights into the Association of Hif1 with Histones H2A-H2B Dimer and H3-H4 Tetramer
pubmed doi rcsb
source organism Saccharomyces cerevisiae (strain atcc 204508 / s288c)
molecule tags Chaperone
total genus 29
structure length 85
sequence length 85
ec nomenclature
pdb deposition date 2015-06-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5bt1C00
5BO0A 2HIOD 3W97B 3AZKC 3MGQB 1P3IA 5BNXB 4XUJC 1P3PB 3AV2A 1P3KC 1EQZA 1M1AB 3B6GB 5AV6A 3AN2C 3AZLB 3LJAD 3AZFB 1TAFA 3VH5W 4XZQC 2BYKB 3WAAC 3O62C 1TZYD 2IO5B 5AVCC 1P3IB 3WA9D 3AV2B 1EQZB 3RELC 1P3BD 2BYMA 3W98B 5AV6B 4H9NA 4Z66C 5DNMD 1TAFB 4Z5TA 3LZ1D 4H9QA 3RELA 3AZID 1KX5D 3KWQA 2CV5A 3A6NA 3WTPC 3UTAC 3AFAD 2BYMB 1P3LB 1BH8A 3UT9D 2F8NK 3B6FC 4H9NB 3AZHC 1S32C 5AV5C 3AV1B 5KDMA 3X1VD 2FJ7A 4Z5TB 4J8WB 4H9QB 4YS3D 3KWQB 2CV5B 1ID3D 3MVDD 3A6NB 3UTBA 2HIOC 1BH8B 4QLCD 3VH6T 1P3OA 3REID 3LELD 3AZMD 1M18D 1AOIA 3WKJD 5KDMB 3C1BD 5B2IA 2FJ7B 5F99A 5B40A 3LJAC 1ULYA 3UTBB 1KX4D 1HQ3D 4H9RA 1TZYC 5B24A 1P3OB 3WA9C 3LZ0A 1AOIB 4ZUXD 1P3BC 5B2IB 5CPKB 5GT0D 1ZLAD 5F99B 5B40B 1B6WA 5DNMC 4R8PA 3WTPE 3LZ1C 4H9RB 3AZIC 1KX5C 5B24B 3LZ0B 5C3IB 3AFAC 3UT9C 4R8PB 1P3GA 3X1VC 3W97D 4YS3C 3AFAA 3MGQD 1P3PD 4G92C 1ID3C 3MVDC 5CPIA 3B0DC 3W96A 1M1AD 3B6GD 4QLCC 5B31G 3AZLD 3AZFD 3REIC 3LELC 3AZMC 1M18C 1P3GB 3WKJC 3C1BC 2HUEB 5JRGA 3AZEA 1P3ID 4UUZA 3AV2D 3KXBA 5CPIB 1KX4C 1EQZD 3W96B 3W98D 1HQ3C 5AV6D 3C1BA 2AROA 4ZUXC 1F1EA 4DRBA 5GT0C 5JRGB 3AZEB 1ZLAC 4UUZB 3KXBB 3AYWA 5GXQA 1F66A 4Z5TD 3MGPA 5B32G 3KSYA 2JSSA 4KHAA 3KWQD 5CPJA 2CV5D 4KGCB 3A6ND 3VH5T 3AYWB 5GXQB 3W97C 1F66B 3MGQC 1P3PC 3B6GC 1M1AC 2FJ7D 3MGPB 4WU9B 4KHAB 3AZFC 5CPJB 3UTBD 5BS7A 1P3OD 2IO5C 2RVQD 1P3IC 4J8UA 1AOID 3AV2C 3AZLA 1EQZC 5B2ID 5CPKD 3W98C 5AV6C 5F99D 5B40D 2BYKA 5B31A 3TU4A 5B24D 4EO5B 3W98A 4J8UB 3LZ0D 4JJNA 4X23B 5B31B 4R8PD 3TU4B 4Z5TC 1Q9CA 5B0ZA 1P3LA 3KWQC 5B2JA 2CV5C 4M6BA 4JJNB 4H9OA 3A6NC 4WU8A 3AV1A 4J8WA 3B0BA 5G49A 1P3GD 4J8VA 2FJ7C 5B0ZB 5B2JB 4H9OB 3UTBC 5B32A 5CPID 3W96D 5AVBA 4WU8B 3X1TB 2RVQC 1P3OC 5G49B 1AOIC 1P3MA 4J8VB 1BFMA 5B2IC 5CPKC 5JRGD 3AZED 5F99C 5B40C 3KXBD 5B32B 1N1JA 5AVBB 3REHA 5B0YA 5B24C 5CPKA 2AROD 3REKA 3LZ0C 1P3MB 3MNNA 5C3IC 3AN2B 1N1JB 3REHB 4R8PC 3AYWD 5GXQD 5E5AB 5B0YB 1F66D 3REKB 2CWEA 3MNNB 3MGPD 1KX3A 2LY8A 5CPJD 1H3OA 1P3GC 3AZGA 2HUEC 3X1UA 3MGRA 4YM6B 1BH9A 3WTPB 5AV9A 5CPIC 3W96C 4J8XA 3V9RA 1KX3B 4AWLB 3X1SA 1H3OB 5CHLB 1M19A 3AZGB 4NE3A 3X1UB 5B1MA 3MGRB 5JRGC 3AZEC 5BT1D 4NFTA 1BH9B 5GT3A 4J8UD 5AV9B 5B1LA 3KXBC 4J8XB 1HTAA 3V9RB 4X23D 2F8NH 4E45A 1WWIA 4HGAB 4WV4B 5B33A 3X1SB 3R45B 2AROC 5B31D 1M19B 2NZDA 3TU4D 5B1MB 2PYOA 5GT3B 4JJND 5B1LB 4Z2MH 5CP6A 3AYWC 3AZJA 5GXQC 5B33B 1F66C 2NZDB 4H9SA 4KGCA 3MGPC 2PYOB 5B0ZD 3REJA 2YFWA 5CPJC 1P3LD 5B2JD 5CP6B 3AZJB 4WU8D 3AV1D 2YFVA 1P3AA 4J8WD 4J8VD 4WU9A 3REJB 2YFWB 5B32D 5AVBD 5BS7C 2YFVB 5BT1C 1P3AB 4EO5C 4J8UC 1P3MD 3AZLC 1P3FA 4X23C 4KUDA 4E44A 1U35A 5B31C 5AY8A 3REHD 3TU4C 5E5AD 1A7WA 5AV8A 5B0YD 4X23A 3REKD 4JJNC 3MNND 1KU5A 1P3FB 2NQBA 4KUDB 4CSRA 1U35B 2F8NG 5AY8B 5AV8B 5DNNB 3AZNA 1P34A 5B0ZC 4YM6D 1P3LC 3W99A 5B2JC 2NQBB 3MGSA 1KX3D 4LD9A 4WU8C 3KUYA 3AV1C 4G91B 4CSRB 4Z2MG 4J8WC 3AZGD 5JA4B 4J8VC 3VH6A 3X1UD 3MGRD 3AZNB 1P34B 3W99B 4ZBJB 5AV9D 3C1CB 4J8XD 5B32C 3MGSB 5AVBC 4LD9B 3X1TA 3KUYB 5GSUA 3X1SD 1M19D 1P3MC 5B1MD 5BO0B 5GT3D 3AZKA 5B1LD 4XUJA 3REHC 1P3KA 3B0CW 5E5AC 5B0YC 5GSUB 5B33D 3AN2A 3REKC 3MNNC 2NZDD 2PYOD 4XZQA 3WAAA 3O62A 5E5AA 3AZKB 5CP6D 5AVCA 4NE5A 4XUJB 3AZJD 1P3KB 4YM6C 4Z66A 4KGCD 1KX3C 4AWLC 3REJD 4XZQB 3WAAB 3O62B 2L5AA 5AVCB 4YM6A 3AZGC 3WTPA 3X1UC 3MGRC 3RELB 3UTAA 2F8NA 1P3AD 3B6FA 1B67A 1R4VA 5AV9C 4WU9D 4Z66B 4J8XC 3AZHA 1S32A 5AV5A 4WZSB 4WNNA 4HGAC 3X1SC 1M19C 3UTAB 2HIOA 5B1MC 2F8NB 5GT3C 3B6FB 5B1LC 3AZHB 1S32B 1P3FD 5AV5B 4KUDD 3R45A 4WNNB 1U35D 5B33C 3LJAA 5AY8D 2NZDC 2HIOB 5DNND 5AV8D 2PYOC 1TZYA 5CP6C 2NQBD 3WA9A 3AZJC 1P3BA 3VH5A 3LJAB 4H9SC 4KGCC 5DNMA 3AZND 1P34D 3REJC 3W99D 3LZ1A 3AZIA 1TZYB 3C1CD 1KX5A 3NQUA 3MGSD 3WA9B 3VH6W 4LD9D 3KUYD 4NE6A 1P3BB 1P3AC 3UT9A 4WU9C 5DNMB 3X1VA 5FUGA 3LZ1B 3AZIB 1KX5B 4YS3A 4DRAA 3NQUB 1ID3A 3X1TD 3MVDA 3AFAB 4QLCA 5GSUD 3UT9B 4H9PA 3REIA 3LELA 3NQJA 3AZMA 1P3FC 1M18A 4KUDC 3WKJA 4CAYA 3X1VB 5FUGB 1U35C 3AZKD 4YS3B 5AY8C 4XUJD 4G92B 3MVDB 1P3KD 1KX4A 3B0DB 1ID3B 5DNNC 5AV8C 1WWSA 4QLCB 1HQ3A 4H9PB 3AN2D 1JFIA 3REIB 3LELB 3NQJB 3AZMB 1M18B 2NQBC 3WKJB 4CAYB 3C1BB 4ZUXA 4XZQD 4G91C 2AROB 5GT0A 3O62D 3WAAD 1ZLAA 5DNNA 5AVCD 1KX4B 3RELD 3AZNC 1P34C 1HQ3B 3W99C 4ZBJC 5BNVA 3C1CC 3B0CT 4Z66D 1JFIB 3MGSC 4LD9C 4ZUXB 3KUYC 5GT0B 5JA4A 1ZLAB 3WTPD 3UTAD 2F8ND 3C1CA 3B6FD 3W97A 5BNVB 3AZHD 3MGQA 1S32D 5BNXA 5AV5D 1P3PA 3X1TC 3B6GA 1M1AA 5GSUC 3AZFA
chains in the Genus database with same CATH superfamily
5BO0A 2HIOD 2ZY5A 3W97B 3AZKC 3MGQB 1P3IA 5BNXB 4XUJC 1P3PB 3AV2A 1P3KC 1EQZA 1M1AB 3B6GB 3EG5B 5AV6A 3AN2C 3EPHA 3AZLB 3LJAD 3AZFB 2ZM5A 2RIQA 1TAFA 3VH5W 4XZQC 2BYKB 3WAAC 3O62C 1TZYD 2IO5B 5AVCC 1P3IB 3WA9D 3AV2B 1EQZB 3RELC 1P3BD 2BYMA 3W98B 5AV6B 4H9NA 2ZY3A 4Z66C 5DNMD 1TAFB 4Z5TA 3LZ1D 4H9QA 3RELA 3AZID 1KX5D 3KWQA 1PZRA 2CV5A 3A6NA 3WTPC 3UTAC 3AFAD 2BYMB 1P3LB 1BH8A 2F2AC 3UT9D 2F8NK 4H9NB 3B6FC 3AZHC 1S32C 5AV5C 3AV1B 3A1KA 5KDMA 3X1VD 2FJ7A 4Z5TB 4J8WB 4H9QB 4YS3D 3KWQB 2CV5B 1ID3D 3MVDD 3A6NB 3UTBA 2HIOC 1BH8B 4QLCD 4UPKA 3VH6T 1P3OA 3REID 3LELD 3AZMD 1M18D 1AOIA 3WKJD 5KDMB 3C1BD 5B2IA 2FJ7B 5F99A 5B40A 3LJAC 1ULYA 3UTBB 1KX4D 1HQ3D 4H9RA 1TZYC 5B24A 1P3OB 3WA9C 3LZ0A 1AOIB 4ZUXD 1P3BC 5B2IB 5CPKB 5GT0D 1ZLAD 5F99B 5B40B 1B6WA 5DNMC 4R8PA 3WTPE 3LZ1C 4H9RB 3AZIC 1KX5C 5B24B 3H0LC 3LZ0B 5C3IB 3AFAC 3UT9C 4R8PB 1P3GA 3X1VC 3W97D 2VQRA 4YS3C 3AFAA 3MGQD 1P3PD 4G92C 1ID3C 3MVDC 5CPIA 3B0DC 3W96A 1M1AD 3B6GD 4QLCC 5B31G 3AZLD 3AZFD 2XD5A 3REIC 3LELC 3AZMC 1M18C 1P3GB 3WKJC 3C1BC 2HUEB 5JRGA 3AZEA 1P3ID 4UUZA 3AV2D 3KXBA 5CPIB 1KX4C 1EQZD 3W96B 3W98D 1HQ3C 5AV6D 3C1BA 2AROA 4ZUXC 5JRGB 1F1EA 4DRBA 5GT0C 3AZEB 1ZLAC 4UUZB 3KXBB 3AYWA 5GXQA 1F66A 4Z5TD 3MGPA 5B32G 3KSYA 2JSSA 4KHAA 3KWQD 5CPJA 2CV5D 4KGCB 3A6ND 3VH5T 3AYWB 5GXQB 3W97C 1F66B 3MGQC 1P3PC 2Y2HA 3B6GC 1M1AC 2FJ7D 3MGPB 4WU9B 4KHAB 3AZFC 5CPJB 3UTBD 5BS7A 1P3OD 2IO5C 2RVQD 1P3IC 4J8UA 1AOID 3H0MC 3AV2C 3AZLA 1EQZC 5B2ID 5CPKD 3W98C 5AV6C 5F99D 5B40D 2XD1A 2BYKA 5B31A 3TU4A 5B24D 4EO5B 2Y2LA 3W98A 4J8UB 3LZ0D 4JJNA 3EPKA 4X23B 5B31B 4R8PD 3TU4B 4Z5TC 1Q9CA 5B0ZA 1P3LA 3KWQC 5B2JA 2CV5C 4M6BA 4JJNB 4H9OA 3A6NC 2Y2JA 4WU8A 3AV1A 4J8WA 3B0BA 5G49A 1P3GD 4J8VA 2Y2NA 2FJ7C 2DQNC 5B0ZB 5B2JB 2Y2IA 4H9OB 5B32A 3UTBC 5CPID 3W96D 5AVBA 4WU8B 3X1TB 2RVQC 1P3OC 3H0RC 5G49B 1AOIC 1P3MA 4J8VB 1BFMA 5B2IC 5CPKC 5JRGD 3AZED 5F99C 5B40C 3KXBD 5B32B 1N1JA 5AVBB 3REHA 5B0YA 5B24C 5CPKA 2AROD 3REKA 3LZ0C 1P3MB 3MNNA 5C3IC 3AN2B 1N1JB 2Y2KA 3REHB 4R8PC 3AYWD 5GXQD 5E5AB 5B0YB 1F66D 1T3UA 3REKB 2CWEA 3MNNB 3MGPD 1KX3A 2LY8A 2DF4C 5CPJD 1H3OA 1P3GC 3AZGA 2HUEC 3X1UA 3MGRA 4YM6B 1BH9A 3WTPB 2BG1A 5AV9A 5CPIC 3W96C 4J8XA 3V9RA 1KX3B 4AWLB 3X1SA 1H3OB 5CHLB 1M19A 3AZGB 4NE3A 3X1UB 5B1MA 3MGRB 5JRGC 3AZEC 5BT1D 1W2EA 1BH9B 4NFTA 5GT3A 4J8UD 5AV9B 5B1LA 3KXBC 4J8XB 1HTAA 3V9RB 4X23D 2F8NH 4E45A 1WWIA 4HGAB 3AL0C 4WV4B 5B33A 3X1SB 3R45B 2AROC 5B31D 1M19B 2NZDA 3TU4D 5B1MB 2PYOA 3F6TA 5GT3B 4JJND 5B1LB 4Z2MH 5CP6A 3FDDA 2UWXA 3AYWC 3AZJA 5GXQC 5B33B 1F66C 2Y2OA 2NZDB 4H9SA 4KGCA 3MGPC 2PYOB 5B0ZD 3REJA 2YFWA 2ZY2A 5CPJC 5B2JD 1P3LD 5CP6B 3AZJB 4WU8D 3AV1D 2YFVA 1P3AA 4J8WD 3IP4C 4J8VD 4WU9A 2ZY4A 3REJB 2YFWB 5B32D 5AVBD 5BS7C 2YFVB 5BT1C 2Y2PA 1P3AB 4EO5C 4J8UC 1P3MD 3AZLC 1P3FA 4X23C 4KUDA 4E44A 1U35A 2Y2QA 3EPJA 5B31C 5AY8A 3REHD 3TU4C 5E5AD 1A7WA 5AV8A 5B0YD 4X23A 3REKD 4JJNC 3MNND 1KU5A 1P3FB 2NQBA 4KUDB 4CSRA 1U35B 4WJ3C 2F8NG 5AY8B 5AV8B 5DNNB 3AZNA 1P34A 5B0ZC 4YM6D 1P3LC 3W99A 5B2JC 2Y2MA 2NQBB 3MGSA 1KX3D 4LD9A 3EPLA 4WU8C 3KUYA 3AV1C 1Z2CB 4G91B 4CSRB 4Z2MG 4J8WC 3AZGD 5JA4B 4J8VC 3VH6A 3X1UD 3MGRD 4DQYB 3AZNB 1P34B 3W99B 4ZBJB 5AV9D 3C1CB 4J8XD 5B32C 3MGSB 5AVBC 4LD9B 3X1TA 3KUYB 5GSUA 3X1SD 1M19D 1P3MC 5B1MD 5BO0B 5GT3D 3AZKA 5B1LD 4XUJA 3REHC 1P3KA 3B0CW 5E5AC 5B0YC 5GSUB 5B33D 3AN2A 3REKC 3MNNC 2NZDD 2PYOD 4XZQA 3WAAA 3O62A 5E5AA 3AZKB 5CP6D 5AVCA 4NE5A 4XUJB 3AZJD 1P3KB 4YM6C 4Z66A 4KGCD 1KX3C 4AWLC 3REJD 4XZQB 3WAAB 3O62B 2L5AA 5AVCB 4YM6A 3AZGC 3WTPA 3X1UC 3MGRC 3RELB 3UTAA 2F8NA 1P3AD 3B6FA 1B67A 1R4VA 5AV9C 4WU9D 4Z66B 4J8XC 3AZHA 1S32A 5AV5A 4WZSB 4WNNA 4HGAC 3X1SC 2Y2GA 1M19C 3UTAB 2HIOA 5B1MC 2F8NB 2W8SA 5GT3C 3B6FB 5B1LC 3AZHB 1S32B 1P3FD 5AV5B 4KUDD 3KFUG 3R45A 4WNNB 1U35D 5B33C 3LJAA 5AY8D 2NZDC 2HIOB 5DNND 5AV8D 2PYOC 1TZYA 5CP6C 2FFFB 2NQBD 3WA9A 3AZJC 2J8PA 1P3BA 3VH5A 3LJAB 4H9SC 4KGCC 5DNMA 3AZND 1P34D 3REJC 3W99D 3LZ1A 3AZIA 1TZYB 3C1CD 1KX5A 3NQUA 3MGSD 3WA9B 3VH6W 4LD9D 3KUYD 4NE6A 1P3BB 1P3AC 3UT9A 4WU9C 5DNMB 3X1VA 5FUGA 3LZ1B 3AZIB 1KX5B 4YS3A 4DRAA 3NQUB 1ID3A 3X1TD 3MVDA 3AFAB 4QLCA 5GSUD 3UT9B 4H9PA 2G5IC 2JCHA 3REIA 3LELA 3NQJA 2G5HC 3AZMA 1P3FC 1M18A 3WKJA 4CAYA 4KUDC 3X1VB 5FUGB 1U35C 3AZKD 4YS3B 5AY8C 4XUJD 4G92B 3MVDB 1P3KD 1KX4A 3B0DB 1ID3B 5DNNC 5AV8C 1WWSA 4QLCB 1HQ3A 4H9PB 3AN2D 1JFIA 2JE5A 3LELB 3NQJB 3REIB 3AZMB 1M18B 2NQBC 3WKJB 4CAYB 3A1IA 4ZUXA 3C1BB 4XZQD 4G91C 2AROB 5GT0A 3O62D 3WAAD 1ZLAA 5DNNA 5AVCD 1KX4B 3RELD 3AZNC 1P34C 1HQ3B 3W99C 4ZBJC 5BNVA 3C1CC 3B0CT 4Z66D 1JFIB 3MGSC 4LD9C 4ZUXB 3KUYC 5GT0B 5JA4A 1ZLAB 3WTPD 3UTAD 2F8ND 3C1CA 3B6FD 3W97A 5BNVB 3AZHD 3P5JB 3MGQA 5BNXA 5AV5D 1S32D 3X1TC 1P3PA 3B6GA 1M1AA 5GSUC 3AZFA
chains in the Genus database with same CATH topology
5BO0A 2HIOD 2ZY5A 3W97B 3AZKC 3MGQB 1P3IA 5BNXB 4XUJC 1P3PB 3AV2A 1P3KC 1EQZA 1M1AB 3B6GB 3EG5B 5AV6A 3AN2C 3EPHA 3AZLB 3LJAD 3AZFB 2ZM5A 2RIQA 1TAFA 3VH5W 4XZQC 2BYKB 3WAAC 3O62C 1TZYD 2IO5B 5AVCC 1P3IB 3WA9D 3AV2B 1EQZB 3RELC 1P3BD 2BYMA 3W98B 5AV6B 4H9NA 2ZY3A 4Z66C 5DNMD 1TAFB 4Z5TA 3LZ1D 4H9QA 3RELA 3AZID 1KX5D 3KWQA 1PZRA 2CV5A 3A6NA 3WTPC 3UTAC 3AFAD 2BYMB 1P3LB 1BH8A 2F2AC 3UT9D 2F8NK 4H9NB 3B6FC 3AZHC 1S32C 5AV5C 3AV1B 3A1KA 5KDMA 3X1VD 2FJ7A 4Z5TB 4J8WB 4H9QB 4YS3D 3KWQB 2CV5B 1ID3D 3MVDD 3A6NB 3UTBA 2HIOC 1BH8B 4QLCD 4UPKA 3VH6T 1P3OA 3REID 3LELD 3AZMD 1M18D 1AOIA 3WKJD 5KDMB 3C1BD 5B2IA 2FJ7B 5F99A 5B40A 3LJAC 1ULYA 3UTBB 1KX4D 1HQ3D 4H9RA 1TZYC 5B24A 1P3OB 3WA9C 3LZ0A 1AOIB 4ZUXD 1P3BC 5B2IB 5CPKB 5GT0D 1ZLAD 5F99B 5B40B 1B6WA 5DNMC 4R8PA 3WTPE 3LZ1C 4H9RB 3AZIC 1KX5C 5B24B 3H0LC 3LZ0B 5C3IB 3AFAC 3UT9C 4R8PB 1P3GA 3X1VC 3W97D 2VQRA 4YS3C 3AFAA 3MGQD 1P3PD 4G92C 1ID3C 3MVDC 5CPIA 3B0DC 3W96A 1M1AD 3B6GD 4QLCC 5B31G 3AZLD 3AZFD 2XD5A 3REIC 3LELC 3AZMC 1M18C 1P3GB 3WKJC 3C1BC 2HUEB 5JRGA 3AZEA 1P3ID 4UUZA 3AV2D 3KXBA 5CPIB 1KX4C 1EQZD 3W96B 3W98D 1HQ3C 5AV6D 3C1BA 2AROA 4ZUXC 5JRGB 1F1EA 4DRBA 5GT0C 3AZEB 1ZLAC 4UUZB 3KXBB 3AYWA 5GXQA 1F66A 4Z5TD 3MGPA 5B32G 3KSYA 2JSSA 4KHAA 3KWQD 5CPJA 2CV5D 4KGCB 3A6ND 3VH5T 3AYWB 5GXQB 3W97C 1F66B 3MGQC 1P3PC 2Y2HA 3B6GC 1M1AC 2FJ7D 3MGPB 4WU9B 4KHAB 3AZFC 5CPJB 3UTBD 5BS7A 1P3OD 2IO5C 2RVQD 1P3IC 4J8UA 1AOID 3H0MC 3AV2C 3AZLA 1EQZC 5B2ID 5CPKD 3W98C 5AV6C 5F99D 5B40D 2XD1A 2BYKA 5B31A 3TU4A 5B24D 4EO5B 2Y2LA 3W98A 4J8UB 3LZ0D 4JJNA 3EPKA 4X23B 5B31B 4R8PD 3TU4B 4Z5TC 1Q9CA 5B0ZA 1P3LA 3KWQC 5B2JA 2CV5C 4M6BA 4JJNB 4H9OA 3A6NC 2Y2JA 4WU8A 3AV1A 4J8WA 3B0BA 5G49A 1P3GD 4J8VA 2Y2NA 2FJ7C 2DQNC 5B0ZB 5B2JB 2Y2IA 4H9OB 5B32A 3UTBC 5CPID 3W96D 5AVBA 4WU8B 3X1TB 2RVQC 1P3OC 3H0RC 5G49B 1AOIC 1P3MA 4J8VB 1BFMA 5B2IC 5CPKC 5JRGD 3AZED 5F99C 5B40C 3KXBD 5B32B 1N1JA 5AVBB 3REHA 5B0YA 5B24C 5CPKA 2AROD 3REKA 3LZ0C 1P3MB 3MNNA 5C3IC 3AN2B 1N1JB 2Y2KA 3REHB 4R8PC 3AYWD 5GXQD 5E5AB 5B0YB 1F66D 1T3UA 3REKB 2CWEA 3MNNB 3MGPD 1KX3A 2LY8A 2DF4C 5CPJD 1H3OA 1P3GC 3AZGA 2HUEC 3X1UA 3MGRA 4YM6B 1BH9A 3WTPB 2BG1A 5AV9A 5CPIC 3W96C 4J8XA 3V9RA 1KX3B 4AWLB 3X1SA 1H3OB 5CHLB 1M19A 3AZGB 4NE3A 3X1UB 5B1MA 3MGRB 5JRGC 3AZEC 5BT1D 1W2EA 1BH9B 4NFTA 5GT3A 4J8UD 5AV9B 5B1LA 3KXBC 4J8XB 1HTAA 3V9RB 4X23D 2F8NH 4E45A 1WWIA 4HGAB 3AL0C 4WV4B 5B33A 3X1SB 3R45B 2AROC 5B31D 1M19B 2NZDA 3TU4D 5B1MB 2PYOA 3F6TA 5GT3B 4JJND 5B1LB 4Z2MH 5CP6A 3FDDA 2UWXA 3AYWC 3AZJA 5GXQC 5B33B 1F66C 2Y2OA 2NZDB 4H9SA 4KGCA 3MGPC 2PYOB 5B0ZD 3REJA 2YFWA 2ZY2A 5CPJC 5B2JD 1P3LD 5CP6B 3AZJB 4WU8D 3AV1D 2YFVA 1P3AA 4J8WD 3IP4C 4J8VD 4WU9A 2ZY4A 3REJB 2YFWB 5B32D 5AVBD 5BS7C 2YFVB 5BT1C 2Y2PA 1P3AB 4EO5C 4J8UC 1P3MD 3AZLC 1P3FA 4X23C 4KUDA 4E44A 1U35A 2Y2QA 3EPJA 5B31C 5AY8A 3REHD 3TU4C 5E5AD 1A7WA 5AV8A 5B0YD 4X23A 3REKD 4JJNC 3MNND 1KU5A 1P3FB 2NQBA 4KUDB 4CSRA 1U35B 4WJ3C 2F8NG 5AY8B 5AV8B 5DNNB 3AZNA 1P34A 5B0ZC 4YM6D 1P3LC 3W99A 5B2JC 2Y2MA 2NQBB 3MGSA 1KX3D 4LD9A 3EPLA 4WU8C 3KUYA 3AV1C 1Z2CB 4G91B 4CSRB 4Z2MG 4J8WC 3AZGD 5JA4B 4J8VC 3VH6A 3X1UD 3MGRD 4DQYB 3AZNB 1P34B 3W99B 4ZBJB 5AV9D 3C1CB 4J8XD 5B32C 3MGSB 5AVBC 4LD9B 3X1TA 3KUYB 5GSUA 3X1SD 1M19D 1P3MC 5B1MD 5BO0B 5GT3D 3AZKA 5B1LD 4XUJA 3REHC 1P3KA 3B0CW 5E5AC 5B0YC 5GSUB 5B33D 3AN2A 3REKC 3MNNC 2NZDD 2PYOD 4XZQA 3WAAA 3O62A 5E5AA 3AZKB 5CP6D 5AVCA 4NE5A 4XUJB 3AZJD 1P3KB 4YM6C 4Z66A 4KGCD 1KX3C 4AWLC 3REJD 4XZQB 3WAAB 3O62B 2L5AA 5AVCB 4YM6A 3AZGC 3WTPA 3X1UC 3MGRC 3RELB 3UTAA 2F8NA 1P3AD 3B6FA 1B67A 1R4VA 5AV9C 4WU9D 4Z66B 4J8XC 3AZHA 1S32A 5AV5A 4WZSB 4WNNA 4HGAC 3X1SC 2Y2GA 1M19C 3UTAB 2HIOA 5B1MC 2F8NB 2W8SA 5GT3C 3B6FB 5B1LC 3AZHB 1S32B 1P3FD 5AV5B 4KUDD 3KFUG 3R45A 4WNNB 1U35D 5B33C 3LJAA 5AY8D 2NZDC 2HIOB 5DNND 5AV8D 2PYOC 1TZYA 5CP6C 2FFFB 2NQBD 3WA9A 3AZJC 2J8PA 1P3BA 3VH5A 3LJAB 4H9SC 4KGCC 5DNMA 3AZND 1P34D 3REJC 3W99D 3LZ1A 3AZIA 1TZYB 3C1CD 1KX5A 3NQUA 3MGSD 3WA9B 3VH6W 4LD9D 3KUYD 4NE6A 1P3BB 1P3AC 3UT9A 4WU9C 5DNMB 3X1VA 5FUGA 3LZ1B 3AZIB 1KX5B 4YS3A 4DRAA 3NQUB 1ID3A 3X1TD 3MVDA 3AFAB 4QLCA 5GSUD 3UT9B 4H9PA 2G5IC 2JCHA 3REIA 3LELA 3NQJA 2G5HC 3AZMA 1P3FC 1M18A 3WKJA 4CAYA 4KUDC 3X1VB 5FUGB 1U35C 3AZKD 4YS3B 5AY8C 4XUJD 4G92B 3MVDB 1P3KD 1KX4A 3B0DB 1ID3B 5DNNC 5AV8C 1WWSA 4QLCB 1HQ3A 4H9PB 3AN2D 1JFIA 2JE5A 3LELB 3NQJB 3REIB 3AZMB 1M18B 2NQBC 3WKJB 4CAYB 3A1IA 4ZUXA 3C1BB 4XZQD 4G91C 2AROB 5GT0A 3O62D 3WAAD 1ZLAA 5DNNA 5AVCD 1KX4B 3RELD 3AZNC 1P34C 1HQ3B 3W99C 4ZBJC 5BNVA 3C1CC 3B0CT 4Z66D 1JFIB 3MGSC 4LD9C 4ZUXB 3KUYC 5GT0B 5JA4A 1ZLAB 3WTPD 3UTAD 2F8ND 3C1CA 3B6FD 3W97A 5BNVB 3AZHD 3P5JB 3MGQA 5BNXA 5AV5D 1S32D 3X1TC 1P3PA 3B6GA 1M1AA 5GSUC 3AZFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5BO0 A;  2HIO D;  3W97 B;  3AZK C;  3MGQ B;  1P3I A;  5BNX B;  4XUJ C;  1P3P B;  3AV2 A;  1P3K C;  1EQZ A;  1M1A B;  3B6G B;  5AV6 A;  3AN2 C;  3AZL B;  3LJA D;  3AZF B;  1TAF A;  3VH5 W;  4XZQ C;  2BYK B;  3WAA C;  3O62 C;  1TZY D;  2IO5 B;  5AVC C;  1P3I B;  3WA9 D;  3AV2 B;  1EQZ B;  3REL C;  1P3B D;  2BYM A;  3W98 B;  5AV6 B;  4H9N A;  4Z66 C;  5DNM D;  1TAF B;  4Z5T A;  3LZ1 D;  4H9Q A;  3REL A;  3AZI D;  1KX5 D;  3KWQ A;  2CV5 A;  3A6N A;  3WTP C;  3UTA C;  3AFA D;  2BYM B;  1P3L B;  1BH8 A;  3UT9 D;  2F8N K;  3B6F C;  4H9N B;  3AZH C;  1S32 C;  5AV5 C;  3AV1 B;  5KDM A;  3X1V D;  2FJ7 A;  4Z5T B;  4J8W B;  4H9Q B;  4YS3 D;  3KWQ B;  2CV5 B;  1ID3 D;  3MVD D;  3A6N B;  3UTB A;  2HIO C;  1BH8 B;  4QLC D;  3VH6 T;  1P3O A;  3REI D;  3LEL D;  3AZM D;  1M18 D;  1AOI A;  3WKJ D;  5KDM B;  3C1B D;  5B2I A;  2FJ7 B;  5F99 A;  5B40 A;  3LJA C;  1ULY A;  3UTB B;  1KX4 D;  1HQ3 D;  4H9R A;  1TZY C;  5B24 A;  1P3O B;  3WA9 C;  3LZ0 A;  1AOI B;  4ZUX D;  1P3B C;  5B2I B;  5CPK B;  5GT0 D;  1ZLA D;  5F99 B;  5B40 B;  1B6W A;  5DNM C;  4R8P A;  3WTP E;  3LZ1 C;  4H9R B;  3AZI C;  1KX5 C;  5B24 B;  3LZ0 B;  5C3I B;  3AFA C;  3UT9 C;  4R8P B;  1P3G A;  3X1V C;  3W97 D;  4YS3 C;  3AFA A;  3MGQ D;  1P3P D;  4G92 C;  1ID3 C;  3MVD C;  5CPI A;  3B0D C;  3W96 A;  1M1A D;  3B6G D;  4QLC C;  5B31 G;  3AZL D;  3AZF D;  3REI C;  3LEL C;  3AZM C;  1M18 C;  1P3G B;  3WKJ C;  3C1B C;  2HUE B;  5JRG A;  3AZE A;  1P3I D;  4UUZ A;  3AV2 D;  3KXB A;  5CPI B;  1KX4 C;  1EQZ D;  3W96 B;  3W98 D;  1HQ3 C;  5AV6 D;  3C1B A;  2ARO A;  4ZUX C;  1F1E A;  4DRB A;  5GT0 C;  5JRG B;  3AZE B;  1ZLA C;  4UUZ B;  3KXB B;  3AYW A;  5GXQ A;  1F66 A;  4Z5T D;  3MGP A;  5B32 G;  3KSY A;  2JSS A;  4KHA A;  3KWQ D;  5CPJ A;  2CV5 D;  4KGC B;  3A6N D;  3VH5 T;  3AYW B;  5GXQ B;  3W97 C;  1F66 B;  3MGQ C;  1P3P C;  3B6G C;  1M1A C;  2FJ7 D;  3MGP B;  4WU9 B;  4KHA B;  3AZF C;  5CPJ B;  3UTB D;  5BS7 A;  1P3O D;  2IO5 C;  2RVQ D;  1P3I C;  4J8U A;  1AOI D;  3AV2 C;  3AZL A;  1EQZ C;  5B2I D;  5CPK D;  3W98 C;  5AV6 C;  5F99 D;  5B40 D;  2BYK A;  5B31 A;  3TU4 A;  5B24 D;  4EO5 B;  3W98 A;  4J8U B;  3LZ0 D;  4JJN A;  4X23 B;  5B31 B;  4R8P D;  3TU4 B;  4Z5T C;  1Q9C A;  5B0Z A;  1P3L A;  3KWQ C;  5B2J A;  2CV5 C;  4M6B A;  4JJN B;  4H9O A;  3A6N C;  4WU8 A;  3AV1 A;  4J8W A;  3B0B A;  5G49 A;  1P3G D;  4J8V A;  2FJ7 C;  5B0Z B;  5B2J B;  4H9O B;  3UTB C;  5B32 A;  5CPI D;  3W96 D;  5AVB A;  4WU8 B;  3X1T B;  2RVQ C;  1P3O C;  5G49 B;  1AOI C;  1P3M A;  4J8V B;  1BFM A;  5B2I C;  5CPK C;  5JRG D;  3AZE D;  5F99 C;  5B40 C;  3KXB D;  5B32 B;  1N1J A;  5AVB B;  3REH A;  5B0Y A;  5B24 C;  5CPK A;  2ARO D;  3REK A;  3LZ0 C;  1P3M B;  3MNN A;  5C3I C;  3AN2 B;  1N1J B;  3REH B;  4R8P C;  3AYW D;  5GXQ D;  5E5A B;  5B0Y B;  1F66 D;  3REK B;  2CWE A;  3MNN B;  3MGP D;  1KX3 A;  2LY8 A;  5CPJ D;  1H3O A;  1P3G C;  3AZG A;  2HUE C;  3X1U A;  3MGR A;  4YM6 B;  1BH9 A;  3WTP B;  5AV9 A;  5CPI C;  3W96 C;  4J8X A;  3V9R A;  1KX3 B;  4AWL B;  3X1S A;  1H3O B;  5CHL B;  1M19 A;  3AZG B;  4NE3 A;  3X1U B;  5B1M A;  3MGR B;  5JRG C;  3AZE C;  5BT1 D;  4NFT A;  1BH9 B;  5GT3 A;  4J8U D;  5AV9 B;  5B1L A;  3KXB C;  4J8X B;  1HTA A;  3V9R B;  4X23 D;  2F8N H;  4E45 A;  1WWI A;  4HGA B;  4WV4 B;  5B33 A;  3X1S B;  3R45 B;  2ARO C;  5B31 D;  1M19 B;  2NZD A;  3TU4 D;  5B1M B;  2PYO A;  5GT3 B;  4JJN D;  5B1L B;  4Z2M H;  5CP6 A;  3AYW C;  3AZJ A;  5GXQ C;  5B33 B;  1F66 C;  2NZD B;  4H9S A;  4KGC A;  3MGP C;  2PYO B;  5B0Z D;  3REJ A;  2YFW A;  5CPJ C;  1P3L D;  5B2J D;  5CP6 B;  3AZJ B;  4WU8 D;  3AV1 D;  2YFV A;  1P3A A;  4J8W D;  4J8V D;  4WU9 A;  3REJ B;  2YFW B;  5B32 D;  5AVB D;  5BS7 C;  2YFV B;  5BT1 C;  1P3A B;  4EO5 C;  4J8U C;  1P3M D;  3AZL C;  1P3F A;  4X23 C;  4KUD A;  4E44 A;  1U35 A;  5B31 C;  5AY8 A;  3REH D;  3TU4 C;  5E5A D;  1A7W A;  5AV8 A;  5B0Y D;  4X23 A;  3REK D;  4JJN C;  3MNN D;  1KU5 A;  1P3F B;  2NQB A;  4KUD B;  4CSR A;  1U35 B;  2F8N G;  5AY8 B;  5AV8 B;  5DNN B;  3AZN A;  1P34 A;  5B0Z C;  4YM6 D;  1P3L C;  3W99 A;  5B2J C;  2NQB B;  3MGS A;  1KX3 D;  4LD9 A;  4WU8 C;  3KUY A;  3AV1 C;  4G91 B;  4CSR B;  4Z2M G;  4J8W C;  3AZG D;  5JA4 B;  4J8V C;  3VH6 A;  3X1U D;  3MGR D;  3AZN B;  1P34 B;  3W99 B;  4ZBJ B;  5AV9 D;  3C1C B;  4J8X D;  5B32 C;  3MGS B;  5AVB C;  4LD9 B;  3X1T A;  3KUY B;  5GSU A;  3X1S D;  1M19 D;  1P3M C;  5B1M D;  5BO0 B;  5GT3 D;  3AZK A;  5B1L D;  4XUJ A;  3REH C;  1P3K A;  3B0C W;  5E5A C;  5B0Y C;  5GSU B;  5B33 D;  3AN2 A;  3REK C;  3MNN C;  2NZD D;  2PYO D;  4XZQ A;  3WAA A;  3O62 A;  5E5A A;  3AZK B;  5CP6 D;  5AVC A;  4NE5 A;  4XUJ B;  3AZJ D;  1P3K B;  4YM6 C;  4Z66 A;  4KGC D;  1KX3 C;  4AWL C;  3REJ D;  4XZQ B;  3WAA B;  3O62 B;  2L5A A;  5AVC B;  4YM6 A;  3AZG C;  3WTP A;  3X1U C;  3MGR C;  3REL B;  3UTA A;  2F8N A;  1P3A D;  3B6F A;  1B67 A;  1R4V A;  5AV9 C;  4WU9 D;  4Z66 B;  4J8X C;  3AZH A;  1S32 A;  5AV5 A;  4WZS B;  4WNN A;  4HGA C;  3X1S C;  1M19 C;  3UTA B;  2HIO A;  5B1M C;  2F8N B;  5GT3 C;  3B6F B;  5B1L C;  3AZH B;  1S32 B;  1P3F D;  5AV5 B;  4KUD D;  3R45 A;  4WNN B;  1U35 D;  5B33 C;  3LJA A;  5AY8 D;  2NZD C;  2HIO B;  5DNN D;  5AV8 D;  2PYO C;  1TZY A;  5CP6 C;  2NQB D;  3WA9 A;  3AZJ C;  1P3B A;  3VH5 A;  3LJA B;  4H9S C;  4KGC C;  5DNM A;  3AZN D;  1P34 D;  3REJ C;  3W99 D;  3LZ1 A;  3AZI A;  1TZY B;  3C1C D;  1KX5 A;  3NQU A;  3MGS D;  3WA9 B;  3VH6 W;  4LD9 D;  3KUY D;  4NE6 A;  1P3B B;  1P3A C;  3UT9 A;  4WU9 C;  5DNM B;  3X1V A;  5FUG A;  3LZ1 B;  3AZI B;  1KX5 B;  4YS3 A;  4DRA A;  3NQU B;  1ID3 A;  3X1T D;  3MVD A;  3AFA B;  4QLC A;  5GSU D;  3UT9 B;  4H9P A;  3REI A;  3LEL A;  3NQJ A;  3AZM A;  1P3F C;  1M18 A;  4KUD C;  3WKJ A;  4CAY A;  3X1V B;  5FUG B;  1U35 C;  3AZK D;  4YS3 B;  5AY8 C;  4XUJ D;  4G92 B;  3MVD B;  1P3K D;  1KX4 A;  3B0D B;  1ID3 B;  5DNN C;  5AV8 C;  1WWS A;  4QLC B;  1HQ3 A;  4H9P B;  3AN2 D;  1JFI A;  3REI B;  3LEL B;  3NQJ B;  3AZM B;  1M18 B;  2NQB C;  3WKJ B;  4CAY B;  3C1B B;  4ZUX A;  4XZQ D;  4G91 C;  2ARO B;  5GT0 A;  3O62 D;  3WAA D;  1ZLA A;  5DNN A;  5AVC D;  1KX4 B;  3REL D;  3AZN C;  1P34 C;  1HQ3 B;  3W99 C;  4ZBJ C;  5BNV A;  3C1C C;  3B0C T;  4Z66 D;  1JFI B;  3MGS C;  4LD9 C;  4ZUX B;  3KUY C;  5GT0 B;  5JA4 A;  1ZLA B;  3WTP D;  3UTA D;  2F8N D;  3C1C A;  3B6F D;  3W97 A;  5BNV B;  3AZH D;  3MGQ A;  1S32 D;  5BNX A;  5AV5 D;  1P3P A;  3X1T C;  3B6G A;  1M1A A;  5GSU C;  3AZF A; 
#chains in the Genus database with same CATH topology
 5BO0 A;  2HIO D;  2ZY5 A;  3W97 B;  3AZK C;  3MGQ B;  1P3I A;  5BNX B;  4XUJ C;  1P3P B;  3AV2 A;  1P3K C;  1EQZ A;  1M1A B;  3B6G B;  3EG5 B;  5AV6 A;  3AN2 C;  3EPH A;  3AZL B;  3LJA D;  3AZF B;  2ZM5 A;  2RIQ A;  1TAF A;  3VH5 W;  4XZQ C;  2BYK B;  3WAA C;  3O62 C;  1TZY D;  2IO5 B;  5AVC C;  1P3I B;  3WA9 D;  3AV2 B;  1EQZ B;  3REL C;  1P3B D;  2BYM A;  3W98 B;  5AV6 B;  4H9N A;  2ZY3 A;  4Z66 C;  5DNM D;  1TAF B;  4Z5T A;  3LZ1 D;  4H9Q A;  3REL A;  3AZI D;  1KX5 D;  3KWQ A;  1PZR A;  2CV5 A;  3A6N A;  3WTP C;  3UTA C;  3AFA D;  2BYM B;  1P3L B;  1BH8 A;  2F2A C;  3UT9 D;  2F8N K;  4H9N B;  3B6F C;  3AZH C;  1S32 C;  5AV5 C;  3AV1 B;  3A1K A;  5KDM A;  3X1V D;  2FJ7 A;  4Z5T B;  4J8W B;  4H9Q B;  4YS3 D;  3KWQ B;  2CV5 B;  1ID3 D;  3MVD D;  3A6N B;  3UTB A;  2HIO C;  1BH8 B;  4QLC D;  4UPK A;  3VH6 T;  1P3O A;  3REI D;  3LEL D;  3AZM D;  1M18 D;  1AOI A;  3WKJ D;  5KDM B;  3C1B D;  5B2I A;  2FJ7 B;  5F99 A;  5B40 A;  3LJA C;  1ULY A;  3UTB B;  1KX4 D;  1HQ3 D;  4H9R A;  1TZY C;  5B24 A;  1P3O B;  3WA9 C;  3LZ0 A;  1AOI B;  4ZUX D;  1P3B C;  5B2I B;  5CPK B;  5GT0 D;  1ZLA D;  5F99 B;  5B40 B;  1B6W A;  5DNM C;  4R8P A;  3WTP E;  3LZ1 C;  4H9R B;  3AZI C;  1KX5 C;  5B24 B;  3H0L C;  3LZ0 B;  5C3I B;  3AFA C;  3UT9 C;  4R8P B;  1P3G A;  3X1V C;  3W97 D;  2VQR A;  4YS3 C;  3AFA A;  3MGQ D;  1P3P D;  4G92 C;  1ID3 C;  3MVD C;  5CPI A;  3B0D C;  3W96 A;  1M1A D;  3B6G D;  4QLC C;  5B31 G;  3AZL D;  3AZF D;  2XD5 A;  3REI C;  3LEL C;  3AZM C;  1M18 C;  1P3G B;  3WKJ C;  3C1B C;  2HUE B;  5JRG A;  3AZE A;  1P3I D;  4UUZ A;  3AV2 D;  3KXB A;  5CPI B;  1KX4 C;  1EQZ D;  3W96 B;  3W98 D;  1HQ3 C;  5AV6 D;  3C1B A;  2ARO A;  4ZUX C;  5JRG B;  1F1E A;  4DRB A;  5GT0 C;  3AZE B;  1ZLA C;  4UUZ B;  3KXB B;  3AYW A;  5GXQ A;  1F66 A;  4Z5T D;  3MGP A;  5B32 G;  3KSY A;  2JSS A;  4KHA A;  3KWQ D;  5CPJ A;  2CV5 D;  4KGC B;  3A6N D;  3VH5 T;  3AYW B;  5GXQ B;  3W97 C;  1F66 B;  3MGQ C;  1P3P C;  2Y2H A;  3B6G C;  1M1A C;  2FJ7 D;  3MGP B;  4WU9 B;  4KHA B;  3AZF C;  5CPJ B;  3UTB D;  5BS7 A;  1P3O D;  2IO5 C;  2RVQ D;  1P3I C;  4J8U A;  1AOI D;  3H0M C;  3AV2 C;  3AZL A;  1EQZ C;  5B2I D;  5CPK D;  3W98 C;  5AV6 C;  5F99 D;  5B40 D;  2XD1 A;  2BYK A;  5B31 A;  3TU4 A;  5B24 D;  4EO5 B;  2Y2L A;  3W98 A;  4J8U B;  3LZ0 D;  4JJN A;  3EPK A;  4X23 B;  5B31 B;  4R8P D;  3TU4 B;  4Z5T C;  1Q9C A;  5B0Z A;  1P3L A;  3KWQ C;  5B2J A;  2CV5 C;  4M6B A;  4JJN B;  4H9O A;  3A6N C;  2Y2J A;  4WU8 A;  3AV1 A;  4J8W A;  3B0B A;  5G49 A;  1P3G D;  4J8V A;  2Y2N A;  2FJ7 C;  2DQN C;  5B0Z B;  5B2J B;  2Y2I A;  4H9O B;  5B32 A;  3UTB C;  5CPI D;  3W96 D;  5AVB A;  4WU8 B;  3X1T B;  2RVQ C;  1P3O C;  3H0R C;  5G49 B;  1AOI C;  1P3M A;  4J8V B;  1BFM A;  5B2I C;  5CPK C;  5JRG D;  3AZE D;  5F99 C;  5B40 C;  3KXB D;  5B32 B;  1N1J A;  5AVB B;  3REH A;  5B0Y A;  5B24 C;  5CPK A;  2ARO D;  3REK A;  3LZ0 C;  1P3M B;  3MNN A;  5C3I C;  3AN2 B;  1N1J B;  2Y2K A;  3REH B;  4R8P C;  3AYW D;  5GXQ D;  5E5A B;  5B0Y B;  1F66 D;  1T3U A;  3REK B;  2CWE A;  3MNN B;  3MGP D;  1KX3 A;  2LY8 A;  2DF4 C;  5CPJ D;  1H3O A;  1P3G C;  3AZG A;  2HUE C;  3X1U A;  3MGR A;  4YM6 B;  1BH9 A;  3WTP B;  2BG1 A;  5AV9 A;  5CPI C;  3W96 C;  4J8X A;  3V9R A;  1KX3 B;  4AWL B;  3X1S A;  1H3O B;  5CHL B;  1M19 A;  3AZG B;  4NE3 A;  3X1U B;  5B1M A;  3MGR B;  5JRG C;  3AZE C;  5BT1 D;  1W2E A;  1BH9 B;  4NFT A;  5GT3 A;  4J8U D;  5AV9 B;  5B1L A;  3KXB C;  4J8X B;  1HTA A;  3V9R B;  4X23 D;  2F8N H;  4E45 A;  1WWI A;  4HGA B;  3AL0 C;  4WV4 B;  5B33 A;  3X1S B;  3R45 B;  2ARO C;  5B31 D;  1M19 B;  2NZD A;  3TU4 D;  5B1M B;  2PYO A;  3F6T A;  5GT3 B;  4JJN D;  5B1L B;  4Z2M H;  5CP6 A;  3FDD A;  2UWX A;  3AYW C;  3AZJ A;  5GXQ C;  5B33 B;  1F66 C;  2Y2O A;  2NZD B;  4H9S A;  4KGC A;  3MGP C;  2PYO B;  5B0Z D;  3REJ A;  2YFW A;  2ZY2 A;  5CPJ C;  5B2J D;  1P3L D;  5CP6 B;  3AZJ B;  4WU8 D;  3AV1 D;  2YFV A;  1P3A A;  4J8W D;  3IP4 C;  4J8V D;  4WU9 A;  2ZY4 A;  3REJ B;  2YFW B;  5B32 D;  5AVB D;  5BS7 C;  2YFV B;  5BT1 C;  2Y2P A;  1P3A B;  4EO5 C;  4J8U C;  1P3M D;  3AZL C;  1P3F A;  4X23 C;  4KUD A;  4E44 A;  1U35 A;  2Y2Q A;  3EPJ A;  5B31 C;  5AY8 A;  3REH D;  3TU4 C;  5E5A D;  1A7W A;  5AV8 A;  5B0Y D;  4X23 A;  3REK D;  4JJN C;  3MNN D;  1KU5 A;  1P3F B;  2NQB A;  4KUD B;  4CSR A;  1U35 B;  4WJ3 C;  2F8N G;  5AY8 B;  5AV8 B;  5DNN B;  3AZN A;  1P34 A;  5B0Z C;  4YM6 D;  1P3L C;  3W99 A;  5B2J C;  2Y2M A;  2NQB B;  3MGS A;  1KX3 D;  4LD9 A;  3EPL A;  4WU8 C;  3KUY A;  3AV1 C;  1Z2C B;  4G91 B;  4CSR B;  4Z2M G;  4J8W C;  3AZG D;  5JA4 B;  4J8V C;  3VH6 A;  3X1U D;  3MGR D;  4DQY B;  3AZN B;  1P34 B;  3W99 B;  4ZBJ B;  5AV9 D;  3C1C B;  4J8X D;  5B32 C;  3MGS B;  5AVB C;  4LD9 B;  3X1T A;  3KUY B;  5GSU A;  3X1S D;  1M19 D;  1P3M C;  5B1M D;  5BO0 B;  5GT3 D;  3AZK A;  5B1L D;  4XUJ A;  3REH C;  1P3K A;  3B0C W;  5E5A C;  5B0Y C;  5GSU B;  5B33 D;  3AN2 A;  3REK C;  3MNN C;  2NZD D;  2PYO D;  4XZQ A;  3WAA A;  3O62 A;  5E5A A;  3AZK B;  5CP6 D;  5AVC A;  4NE5 A;  4XUJ B;  3AZJ D;  1P3K B;  4YM6 C;  4Z66 A;  4KGC D;  1KX3 C;  4AWL C;  3REJ D;  4XZQ B;  3WAA B;  3O62 B;  2L5A A;  5AVC B;  4YM6 A;  3AZG C;  3WTP A;  3X1U C;  3MGR C;  3REL B;  3UTA A;  2F8N A;  1P3A D;  3B6F A;  1B67 A;  1R4V A;  5AV9 C;  4WU9 D;  4Z66 B;  4J8X C;  3AZH A;  1S32 A;  5AV5 A;  4WZS B;  4WNN A;  4HGA C;  3X1S C;  2Y2G A;  1M19 C;  3UTA B;  2HIO A;  5B1M C;  2F8N B;  2W8S A;  5GT3 C;  3B6F B;  5B1L C;  3AZH B;  1S32 B;  1P3F D;  5AV5 B;  4KUD D;  3KFU G;  3R45 A;  4WNN B;  1U35 D;  5B33 C;  3LJA A;  5AY8 D;  2NZD C;  2HIO B;  5DNN D;  5AV8 D;  2PYO C;  1TZY A;  5CP6 C;  2FFF B;  2NQB D;  3WA9 A;  3AZJ C;  2J8P A;  1P3B A;  3VH5 A;  3LJA B;  4H9S C;  4KGC C;  5DNM A;  3AZN D;  1P34 D;  3REJ C;  3W99 D;  3LZ1 A;  3AZI A;  1TZY B;  3C1C D;  1KX5 A;  3NQU A;  3MGS D;  3WA9 B;  3VH6 W;  4LD9 D;  3KUY D;  4NE6 A;  1P3B B;  1P3A C;  3UT9 A;  4WU9 C;  5DNM B;  3X1V A;  5FUG A;  3LZ1 B;  3AZI B;  1KX5 B;  4YS3 A;  4DRA A;  3NQU B;  1ID3 A;  3X1T D;  3MVD A;  3AFA B;  4QLC A;  5GSU D;  3UT9 B;  4H9P A;  2G5I C;  2JCH A;  3REI A;  3LEL A;  3NQJ A;  2G5H C;  3AZM A;  1P3F C;  1M18 A;  3WKJ A;  4CAY A;  4KUD C;  3X1V B;  5FUG B;  1U35 C;  3AZK D;  4YS3 B;  5AY8 C;  4XUJ D;  4G92 B;  3MVD B;  1P3K D;  1KX4 A;  3B0D B;  1ID3 B;  5DNN C;  5AV8 C;  1WWS A;  4QLC B;  1HQ3 A;  4H9P B;  3AN2 D;  1JFI A;  2JE5 A;  3LEL B;  3NQJ B;  3REI B;  3AZM B;  1M18 B;  2NQB C;  3WKJ B;  4CAY B;  3A1I A;  4ZUX A;  3C1B B;  4XZQ D;  4G91 C;  2ARO B;  5GT0 A;  3O62 D;  3WAA D;  1ZLA A;  5DNN A;  5AVC D;  1KX4 B;  3REL D;  3AZN C;  1P34 C;  1HQ3 B;  3W99 C;  4ZBJ C;  5BNV A;  3C1C C;  3B0C T;  4Z66 D;  1JFI B;  3MGS C;  4LD9 C;  4ZUX B;  3KUY C;  5GT0 B;  5JA4 A;  1ZLA B;  3WTP D;  3UTA D;  2F8N D;  3C1C A;  3B6F D;  3W97 A;  5BNV B;  3AZH D;  3P5J B;  3MGQ A;  5BNX A;  5AV5 D;  1S32 D;  3X1T C;  1P3P A;  3B6G A;  1M1A A;  5GSU C;  3AZF A; 
#chains in the Genus database with same CATH homology
 5BO0 A;  2HIO D;  2ZY5 A;  3W97 B;  3AZK C;  3MGQ B;  1P3I A;  5BNX B;  4XUJ C;  1P3P B;  3AV2 A;  1P3K C;  1EQZ A;  1M1A B;  3B6G B;  3EG5 B;  5AV6 A;  3AN2 C;  3EPH A;  3AZL B;  3LJA D;  3AZF B;  2ZM5 A;  2RIQ A;  1TAF A;  3VH5 W;  4XZQ C;  2BYK B;  3WAA C;  3O62 C;  1TZY D;  2IO5 B;  5AVC C;  1P3I B;  3WA9 D;  3AV2 B;  1EQZ B;  3REL C;  1P3B D;  2BYM A;  3W98 B;  5AV6 B;  4H9N A;  2ZY3 A;  4Z66 C;  5DNM D;  1TAF B;  4Z5T A;  3LZ1 D;  4H9Q A;  3REL A;  3AZI D;  1KX5 D;  3KWQ A;  1PZR A;  2CV5 A;  3A6N A;  3WTP C;  3UTA C;  3AFA D;  2BYM B;  1P3L B;  1BH8 A;  2F2A C;  3UT9 D;  2F8N K;  4H9N B;  3B6F C;  3AZH C;  1S32 C;  5AV5 C;  3AV1 B;  3A1K A;  5KDM A;  3X1V D;  2FJ7 A;  4Z5T B;  4J8W B;  4H9Q B;  4YS3 D;  3KWQ B;  2CV5 B;  1ID3 D;  3MVD D;  3A6N B;  3UTB A;  2HIO C;  1BH8 B;  4QLC D;  4UPK A;  3VH6 T;  1P3O A;  3REI D;  3LEL D;  3AZM D;  1M18 D;  1AOI A;  3WKJ D;  5KDM B;  3C1B D;  5B2I A;  2FJ7 B;  5F99 A;  5B40 A;  3LJA C;  1ULY A;  3UTB B;  1KX4 D;  1HQ3 D;  4H9R A;  1TZY C;  5B24 A;  1P3O B;  3WA9 C;  3LZ0 A;  1AOI B;  4ZUX D;  1P3B C;  5B2I B;  5CPK B;  5GT0 D;  1ZLA D;  5F99 B;  5B40 B;  1B6W A;  5DNM C;  4R8P A;  3WTP E;  3LZ1 C;  4H9R B;  3AZI C;  1KX5 C;  5B24 B;  3H0L C;  3LZ0 B;  5C3I B;  3AFA C;  3UT9 C;  4R8P B;  1P3G A;  3X1V C;  3W97 D;  2VQR A;  4YS3 C;  3AFA A;  3MGQ D;  1P3P D;  4G92 C;  1ID3 C;  3MVD C;  5CPI A;  3B0D C;  3W96 A;  1M1A D;  3B6G D;  4QLC C;  5B31 G;  3AZL D;  3AZF D;  2XD5 A;  3REI C;  3LEL C;  3AZM C;  1M18 C;  1P3G B;  3WKJ C;  3C1B C;  2HUE B;  5JRG A;  3AZE A;  1P3I D;  4UUZ A;  3AV2 D;  3KXB A;  5CPI B;  1KX4 C;  1EQZ D;  3W96 B;  3W98 D;  1HQ3 C;  5AV6 D;  3C1B A;  2ARO A;  4ZUX C;  5JRG B;  1F1E A;  4DRB A;  5GT0 C;  3AZE B;  1ZLA C;  4UUZ B;  3KXB B;  3AYW A;  5GXQ A;  1F66 A;  4Z5T D;  3MGP A;  5B32 G;  3KSY A;  2JSS A;  4KHA A;  3KWQ D;  5CPJ A;  2CV5 D;  4KGC B;  3A6N D;  3VH5 T;  3AYW B;  5GXQ B;  3W97 C;  1F66 B;  3MGQ C;  1P3P C;  2Y2H A;  3B6G C;  1M1A C;  2FJ7 D;  3MGP B;  4WU9 B;  4KHA B;  3AZF C;  5CPJ B;  3UTB D;  5BS7 A;  1P3O D;  2IO5 C;  2RVQ D;  1P3I C;  4J8U A;  1AOI D;  3H0M C;  3AV2 C;  3AZL A;  1EQZ C;  5B2I D;  5CPK D;  3W98 C;  5AV6 C;  5F99 D;  5B40 D;  2XD1 A;  2BYK A;  5B31 A;  3TU4 A;  5B24 D;  4EO5 B;  2Y2L A;  3W98 A;  4J8U B;  3LZ0 D;  4JJN A;  3EPK A;  4X23 B;  5B31 B;  4R8P D;  3TU4 B;  4Z5T C;  1Q9C A;  5B0Z A;  1P3L A;  3KWQ C;  5B2J A;  2CV5 C;  4M6B A;  4JJN B;  4H9O A;  3A6N C;  2Y2J A;  4WU8 A;  3AV1 A;  4J8W A;  3B0B A;  5G49 A;  1P3G D;  4J8V A;  2Y2N A;  2FJ7 C;  2DQN C;  5B0Z B;  5B2J B;  2Y2I A;  4H9O B;  5B32 A;  3UTB C;  5CPI D;  3W96 D;  5AVB A;  4WU8 B;  3X1T B;  2RVQ C;  1P3O C;  3H0R C;  5G49 B;  1AOI C;  1P3M A;  4J8V B;  1BFM A;  5B2I C;  5CPK C;  5JRG D;  3AZE D;  5F99 C;  5B40 C;  3KXB D;  5B32 B;  1N1J A;  5AVB B;  3REH A;  5B0Y A;  5B24 C;  5CPK A;  2ARO D;  3REK A;  3LZ0 C;  1P3M B;  3MNN A;  5C3I C;  3AN2 B;  1N1J B;  2Y2K A;  3REH B;  4R8P C;  3AYW D;  5GXQ D;  5E5A B;  5B0Y B;  1F66 D;  1T3U A;  3REK B;  2CWE A;  3MNN B;  3MGP D;  1KX3 A;  2LY8 A;  2DF4 C;  5CPJ D;  1H3O A;  1P3G C;  3AZG A;  2HUE C;  3X1U A;  3MGR A;  4YM6 B;  1BH9 A;  3WTP B;  2BG1 A;  5AV9 A;  5CPI C;  3W96 C;  4J8X A;  3V9R A;  1KX3 B;  4AWL B;  3X1S A;  1H3O B;  5CHL B;  1M19 A;  3AZG B;  4NE3 A;  3X1U B;  5B1M A;  3MGR B;  5JRG C;  3AZE C;  5BT1 D;  1W2E A;  1BH9 B;  4NFT A;  5GT3 A;  4J8U D;  5AV9 B;  5B1L A;  3KXB C;  4J8X B;  1HTA A;  3V9R B;  4X23 D;  2F8N H;  4E45 A;  1WWI A;  4HGA B;  3AL0 C;  4WV4 B;  5B33 A;  3X1S B;  3R45 B;  2ARO C;  5B31 D;  1M19 B;  2NZD A;  3TU4 D;  5B1M B;  2PYO A;  3F6T A;  5GT3 B;  4JJN D;  5B1L B;  4Z2M H;  5CP6 A;  3FDD A;  2UWX A;  3AYW C;  3AZJ A;  5GXQ C;  5B33 B;  1F66 C;  2Y2O A;  2NZD B;  4H9S A;  4KGC A;  3MGP C;  2PYO B;  5B0Z D;  3REJ A;  2YFW A;  2ZY2 A;  5CPJ C;  5B2J D;  1P3L D;  5CP6 B;  3AZJ B;  4WU8 D;  3AV1 D;  2YFV A;  1P3A A;  4J8W D;  3IP4 C;  4J8V D;  4WU9 A;  2ZY4 A;  3REJ B;  2YFW B;  5B32 D;  5AVB D;  5BS7 C;  2YFV B;  5BT1 C;  2Y2P A;  1P3A B;  4EO5 C;  4J8U C;  1P3M D;  3AZL C;  1P3F A;  4X23 C;  4KUD A;  4E44 A;  1U35 A;  2Y2Q A;  3EPJ A;  5B31 C;  5AY8 A;  3REH D;  3TU4 C;  5E5A D;  1A7W A;  5AV8 A;  5B0Y D;  4X23 A;  3REK D;  4JJN C;  3MNN D;  1KU5 A;  1P3F B;  2NQB A;  4KUD B;  4CSR A;  1U35 B;  4WJ3 C;  2F8N G;  5AY8 B;  5AV8 B;  5DNN B;  3AZN A;  1P34 A;  5B0Z C;  4YM6 D;  1P3L C;  3W99 A;  5B2J C;  2Y2M A;  2NQB B;  3MGS A;  1KX3 D;  4LD9 A;  3EPL A;  4WU8 C;  3KUY A;  3AV1 C;  1Z2C B;  4G91 B;  4CSR B;  4Z2M G;  4J8W C;  3AZG D;  5JA4 B;  4J8V C;  3VH6 A;  3X1U D;  3MGR D;  4DQY B;  3AZN B;  1P34 B;  3W99 B;  4ZBJ B;  5AV9 D;  3C1C B;  4J8X D;  5B32 C;  3MGS B;  5AVB C;  4LD9 B;  3X1T A;  3KUY B;  5GSU A;  3X1S D;  1M19 D;  1P3M C;  5B1M D;  5BO0 B;  5GT3 D;  3AZK A;  5B1L D;  4XUJ A;  3REH C;  1P3K A;  3B0C W;  5E5A C;  5B0Y C;  5GSU B;  5B33 D;  3AN2 A;  3REK C;  3MNN C;  2NZD D;  2PYO D;  4XZQ A;  3WAA A;  3O62 A;  5E5A A;  3AZK B;  5CP6 D;  5AVC A;  4NE5 A;  4XUJ B;  3AZJ D;  1P3K B;  4YM6 C;  4Z66 A;  4KGC D;  1KX3 C;  4AWL C;  3REJ D;  4XZQ B;  3WAA B;  3O62 B;  2L5A A;  5AVC B;  4YM6 A;  3AZG C;  3WTP A;  3X1U C;  3MGR C;  3REL B;  3UTA A;  2F8N A;  1P3A D;  3B6F A;  1B67 A;  1R4V A;  5AV9 C;  4WU9 D;  4Z66 B;  4J8X C;  3AZH A;  1S32 A;  5AV5 A;  4WZS B;  4WNN A;  4HGA C;  3X1S C;  2Y2G A;  1M19 C;  3UTA B;  2HIO A;  5B1M C;  2F8N B;  2W8S A;  5GT3 C;  3B6F B;  5B1L C;  3AZH B;  1S32 B;  1P3F D;  5AV5 B;  4KUD D;  3KFU G;  3R45 A;  4WNN B;  1U35 D;  5B33 C;  3LJA A;  5AY8 D;  2NZD C;  2HIO B;  5DNN D;  5AV8 D;  2PYO C;  1TZY A;  5CP6 C;  2FFF B;  2NQB D;  3WA9 A;  3AZJ C;  2J8P A;  1P3B A;  3VH5 A;  3LJA B;  4H9S C;  4KGC C;  5DNM A;  3AZN D;  1P34 D;  3REJ C;  3W99 D;  3LZ1 A;  3AZI A;  1TZY B;  3C1C D;  1KX5 A;  3NQU A;  3MGS D;  3WA9 B;  3VH6 W;  4LD9 D;  3KUY D;  4NE6 A;  1P3B B;  1P3A C;  3UT9 A;  4WU9 C;  5DNM B;  3X1V A;  5FUG A;  3LZ1 B;  3AZI B;  1KX5 B;  4YS3 A;  4DRA A;  3NQU B;  1ID3 A;  3X1T D;  3MVD A;  3AFA B;  4QLC A;  5GSU D;  3UT9 B;  4H9P A;  2G5I C;  2JCH A;  3REI A;  3LEL A;  3NQJ A;  2G5H C;  3AZM A;  1P3F C;  1M18 A;  3WKJ A;  4CAY A;  4KUD C;  3X1V B;  5FUG B;  1U35 C;  3AZK D;  4YS3 B;  5AY8 C;  4XUJ D;  4G92 B;  3MVD B;  1P3K D;  1KX4 A;  3B0D B;  1ID3 B;  5DNN C;  5AV8 C;  1WWS A;  4QLC B;  1HQ3 A;  4H9P B;  3AN2 D;  1JFI A;  2JE5 A;  3LEL B;  3NQJ B;  3REI B;  3AZM B;  1M18 B;  2NQB C;  3WKJ B;  4CAY B;  3A1I A;  4ZUX A;  3C1B B;  4XZQ D;  4G91 C;  2ARO B;  5GT0 A;  3O62 D;  3WAA D;  1ZLA A;  5DNN A;  5AVC D;  1KX4 B;  3REL D;  3AZN C;  1P34 C;  1HQ3 B;  3W99 C;  4ZBJ C;  5BNV A;  3C1C C;  3B0C T;  4Z66 D;  1JFI B;  3MGS C;  4LD9 C;  4ZUX B;  3KUY C;  5GT0 B;  5JA4 A;  1ZLA B;  3WTP D;  3UTA D;  2F8N D;  3C1C A;  3B6F D;  3W97 A;  5BNV B;  3AZH D;  3P5J B;  3MGQ A;  5BNX A;  5AV5 D;  1S32 D;  3X1T C;  1P3P A;  3B6G A;  1M1A A;  5GSU C;  3AZF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...