5BT1C

Histone chaperone hif1 playing with histone h2a-h2b dimer
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
85
structure length
85
Chain Sequence
b'QSRSAKAGLTFPVGRVHRLLRRGNYAQRIGSGAPVYLTAVLEYLAAEILELAGNAARDNKKTRIIPRHLQLAIRNDDELNKLLGN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HAT1-interacting factor 1
publication title Structural Insights into the Association of Hif1 with Histones H2A-H2B Dimer and H3-H4 Tetramer
pubmed doi rcsb
source organism Saccharomyces cerevisiae (strain atcc 204508 / s288c)
molecule tags Chaperone
total genus 29
structure length 85
sequence length 85
ec nomenclature
pdb deposition date 2015-06-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5bt1C00
4Z5TA 3B0CW 3AN2A 5B32B 4XZQB 2JSSA 2BYMA 3REHB 2RVQD 5B31D 3AZLC 3AFAB 4H9RA 1P3AA 5B24A 5B2JD 3O62A 3W96D 5CP6B 5CPIA 1M18C 5B32G 4CAYB 3REJD 3AZJA 3AZFC 4HGAC 4NE3A 4YM6C 4J8VB 3X1SD 2HIOC 4E45A 5B1LC 5B0YB 1TZYC 3WA9B 1BFMA 2CV5A 2FJ7D 1WWIA 1JFIA 4J8WA 2NQBD 3AZMC 5DNNC 5AV9C 4KGCC 5GSUC 3AZIA 3MGPC 4R8PB 4YM6B 4NE6A 5JRGA 4EO5C 1M1AC 1KX5D 1AOID 3AZGC 4CSRB 4XUJA 3LJAB 5DNNB 5AVCD 1P3KA 3AZEA 5GSUB 3B0BA 3REKB 3TU4C 5BO0A 3LELA 4ZUXD 3AZNA 4EO5B 1M1AB 5B0ZD 4WNNA 3A6NC 1F66C 4Z5TD 4KUDA 3AN2D 1P3GC 2BYKA 3VH6A 5AV6C 1P3AD 5B24D 4LD9B 5JA4B 3O62D 4XZQA 2LY8A 1P3PC 5CPID 1F66B 3AFAA 2HUEC 5B31G 3AZJD 3W97B 1P3GB 5CP6A 3B0DB 3VH5T 2CV5D 1P34C 2NQBB 4J8WD 3LZ0C 3WA9A 3AZID 2F8NB 1R4VA 1KX5B 5JRGD 3B6FC 3UT9C 4WU8C 3RELC 1P34B 3AZHC 4YM6A 4XUJD 2HIOA 5B1LA 5FUGA 1TZYA 1P3KD 3KSYA 4CSRA 4DRBA 3LELD 3AZND 3W99B 4UUZB 5DNNA 5AV9A 4WU9B 3B6FB 4KGCA 5GSUA 3MGPA 4Z5TB 5E5AC 3MGQD 3REKA 3RELB 3AZHB 5BT1D 4KUDD 1P3IC 4WZSB 3C1CC 1M1AA 3AZGA 4X23C 5B24B 1ULYA 1B6WA 4KHAB 5CPKC 3KWQC 4XZQD 3AFAD 3AV2C 4LD9A 5JA4A 3MVDC 3C1CB 5CP6D 1H3OB 3A6NA 3MGSC 1F66A 5CPKB 5B33C 1P3LC 3NQUB 5AV8B 3W97A 4J8VD 1P3GA 4DRAA 4J8UC 3WA9D 5AV6A 5JRGB 3B0CT 2F8NA 5GT0C 5B33B 3B6GC 1P3LB 4YM6D 4AWLB 3AZKC 2HIOD 4J8UB 5B1LD 1B67A 3AZEB 1TZYD 1P3KB 1P34A 4J8XC 3X1UC 5DNND 5AV9D 3LZ0A 1P3OC 5GSUD 5GT0B 3X1TC 3MGPD 3REKD 3W99A 1M1AD 2BYKB 4WU9A 3B6FA 4WU8A 3RELA 3AZGD 2AROB 5AVBC 5F99C 3AZHA 3X1UB 1WWSA 1P3OB 3WTPE 2F8NK 2YFVB 1P3BC 5B40C 4KHAA 1F1EA 4LD9D 1ID3C 3VH6T 4E44A 5E5AA 3A6ND 1F66D 5AVBB 1HTAA 3C1CA 3W97D 1P3GD 1H3OA 3AZLB 5AV6D 3WTPC 5CPKA 1KX3C 3NQUA 5AV8A 1ID3B 1M18B 2F8ND 3AZFB 3AV2A 4HGAB 3MVDA 2HIOB 5CHLB 5B1LB 5FUGB 1TZYB 5AY8C 3AYWC 3MGSA 5B33A 1KX3B 1P3LA 3AV1C 1P34D 3AZMB 4KGCB 5AV9B 4J8UA 3LZ0D 3MGPB 1KX4C 3KXBC 4QLCC 3W99D 3X1VC 4WU9D 3B6FD 3AZGB 3B6GA 5GT0A 3RELD 4Z66C 3AZHD 4G91C 3TU4B 3KXBB 1KX4B 1EQZC 2AROA 3X1VB 4J8XA 3X1UA 1P3OA 3A6NB 2YFVA 3X1TA 4Z66B 2RVQC 4G91B 5B31C 3C1CD 3KUYC 5AV6B 3W96C 5F99A 1Q9CA 5AVBA 5CPKD 5GXQC 4JJNC 5AV8D 1HQ3C 5BS7C 1P3PB 2CWEA 3AZLA 2HUEB 4M6BA 5B40A 3AV2D 3MVDD 1ID3A 1M18A 2NZDC 3MGSD 3AZFA 5B33D 5GT3C 5GXQB 1P3LD 1P3FC 1HQ3B 2PYOC 3LZ0B 2F8NG 3UTBC 4J8UD 3AZED 3WTPA 4H9QA 1KX3A 1S32C 3AZMA 4NFTA 2NZDB 5DNMC 4WU8B 3UT9B 5GT0D 3WKJC 4H9NA 4Z2MG 3AYWA 5AV5C 3WAAC 4YS3C 5B0ZC 2AROD 1S32B 1TAFB 4J8XD 2L5AA 3X1UD 4H9SC 3UTAC 1P3OD 5DNMB 5B1MC 3TU4A 5E5AB 3KXBA 1KX4A 3X1TD 1P3IB 3X1VA 1A7WA 3LZ1C 3WAAB 4X23B 3VH5W 4Z66A 5AVBD 3KWQB 5B1MB 3AZLD 3AV2B 1M19C 3MVDB 1ZLAC 3C1BC 3LZ1B 3R45A 1P3PA 1ID3D 3MGSB 1M18D 2CV5C 1U35C 2IO5C 3REIC 3AZFD 5CPJC 1P3MC 3KUYA 1M19B 3WTPD 3MGRC 1ZLAB 3C1BB 5GXQA 4JJNA 1KX3D 1HQ3A 5BS7A 3AZMD 4KGCD 1U35B 3B6GB 3AZKB 5CPJB 3LELC 3W98C 3AYWD 2NZDA 3UT9A 3MGRB 5BNVB 5G49A 5GT3A 4J8XB 1P3FA 3V9RB 2PYOA 3MNNC 3MGQC 3UTBA 3X1TB 3TU4D 3KXBD 1KX4D 4NE5A 3X1VD 1S32A 1TAFA 5DNMA 5B32C 5BNXB 4XZQC 5F99B 3REHC 4Z66D 3WKJA 1P3IA 3MNNB 5AV5A 3AFAC 4YS3A 3WAAA 1P3BB 2YFWB 4X23A 5B40B 5CP6C 3KWQA 3UTAA 5B1MA 1P3PD 4J8VC 5B2IC 5B0YC 3WA9C 3LZ1A 1N1JB 3KUYD 3WTPB 4H9QB 5GXQD 4JJND 1HQ3D 4H9PB 4R8PC 1M19A 4H9NB 5B2IB 1ZLAA 3C1BA 5AY8B 3AYWB 4H9OB 5KDMA 2NZDD 1U35A 3UT9D 4WU8D 3LJAC 3REIA 3AV1B 5GT3D 3AZKA 5CPJA 1P3FD 1P3MA 3REKC 2PYOD 3NQJB 3UTBD 4QLCB 3MGRA 5BNVA 1S32D 3V9RA 3VH6W 5DNMD 5E5AD 3WKJD 1P3ID 1BH8B 3W98A 5AV5D 5B2JC 4YS3D 3WAAD 4LD9C 4X23D 1EQZB 5BNXA 3KWQD 3R45B 3MNNA 3MGQA 1BH9B 3REJC 3UTAD 5B1MD 1P3BA 2YFWA 3X1SC 5B31B 3W97C 3B0DC 1KU5A 3LZ1D 3KUYB 5B2JB 3W96B 5B32A 2FJ7C 3REHA 2NQBC 4JJNB 3REJB 1N1JA 3X1SB 1M19D 1KX5C 1AOIC 1ZLAD 3C1BD 4CAYA 4H9PA 2FJ7B 5C3IC 1U35D 5G49B 4J8VA 3B6GD 5GT3B 3REID 5B2IA 5AVCC 5B0YA 1P3FB 5CPJD 3AZKD 2PYOB 5AY8A 4ZUXC 3UTBB 1P3MD 4H9OA 3W99C 3MGRD 3AV1A 1AOIB 4WU9C 4Z5TC 3NQJA 5C3IB 3AN2C 4R8PA 3WKJB 4QLCA 5AVCB 4ZUXB 5AV5B 1P3AC 4YS3B 5B24C 3W98D 5B0ZB 3O62C 3LJAA 5F99D 5CPIC 3UTAB 3MNND 1BH8A 3AN2B 3AZJC 1P3BD 2BYMB 1EQZA 5B40D 4H9RB 1P3AB 1BH9A 3O62B 5B32D 4G92C 5AV8C 4WV4B 5B31A 4J8WC 3REHD 5CPIB 3AZIC 3AZJB 3VH5A 5B2JA 3W96A 5JRGC 3REJA 5KDMB 2CV5B 2IO5B 4G92B 4XUJC 3X1SA 1JFIB 4J8WB 3REIB 4AWLC 5B2ID 1P3KC 5B0YD 3AZEC 3AZIB 1P3MB 5AY8D 3AZNC 2FJ7A 4ZBJC 2F8NH 2NQBA 3AV1D 5BT1C 4XUJB 4KUDC 4R8PD 4QLCD 1KX5A 1AOIA 5BO0B 3LELB 3W98B 3AZNB 4Z2MH 2AROC 4ZBJB 3LJAD 5AVCA 4WNNB 3MGQB 4ZUXA 4KUDB 5B0ZA 1EQZD 4UUZA 4H9SA
chains in the Genus database with same CATH superfamily
4Z5TA 3B0CW 3AN2A 5B32B 4XZQB 2JSSA 2BYMA 3REHB 2RVQD 5B31D 3AZLC 3AFAB 4H9RA 1P3AA 5B24A 5B2JD 3O62A 3W96D 5CP6B 5CPIA 1M18C 5B32G 4CAYB 3REJD 3AZJA 3AZFC 4HGAC 4NE3A 4YM6C 4J8VB 3X1SD 4E45A 2HIOC 5B1LC 5B0YB 1TZYC 3WA9B 1BFMA 2CV5A 2FJ7D 1WWIA 1JFIA 4J8WA 2NQBD 3AZMC 5DNNC 5AV9C 4KGCC 5GSUC 3AZIA 2ZY2A 3MGPC 4R8PB 4YM6B 4NE6A 5JRGA 4EO5C 1M1AC 1KX5D 1AOID 3AZGC 4CSRB 4XUJA 2JCHA 3LJAB 5DNNB 5AVCD 1P3KA 3AZEA 5GSUB 3B0BA 2DQNC 3REKB 3TU4C 5BO0A 3LELA 4ZUXD 3AZNA 4EO5B 1M1AB 5B0ZD 4WNNA 3A6NC 1F66C 4Z5TD 4KUDA 3AN2D 1P3GC 2BYKA 3VH6A 5AV6C 1P3AD 5B24D 4LD9B 5JA4B 3O62D 4XZQA 4UPKA 2LY8A 1P3PC 5CPID 1F66B 2Y2OA 3AFAA 2HUEC 5B31G 3AZJD 3W97B 1P3GB 5CP6A 3B0DB 3VH5T 2CV5D 3EPLA 1P34C 2NQBB 4J8WD 3P5JB 3LZ0C 3WA9A 3AZID 2F8NB 2ZY4A 1R4VA 1KX5B 5JRGD 3B6FC 3UT9C 4WU8C 3RELC 1P34B 3AZHC 4YM6A 4XUJD 1W2EA 2HIOA 5B1LA 5FUGA 1TZYA 1P3KD 4WJ3C 3KSYA 4CSRA 4DRBA 3LELD 3AZND 3W99B 4UUZB 5DNNA 5AV9A 4WU9B 3B6FB 4KGCA 5GSUA 3MGPA 4Z5TB 5E5AC 3MGQD 3REKA 3RELB 3AZHB 5BT1D 2Y2MA 4KUDD 1P3IC 4WZSB 3C1CC 1M1AA 3AZGA 4X23C 5B24B 2G5IC 1ULYA 1B6WA 1T3UA 4KHAB 5CPKC 3KWQC 4XZQD 3AFAD 3AV2C 4LD9A 5JA4A 3MVDC 3C1CB 5CP6D 1H3OB 2ZY5A 3A6NA 3MGSC 1F66A 5CPKB 5B33C 2ZY3A 1P3LC 3NQUB 5AV8B 3W97A 4J8VD 1P3GA 4DRAA 4J8UC 3WA9D 5AV6A 5JRGB 3B0CT 2G5HC 2F8NA 5GT0C 5B33B 3B6GC 1P3LB 2Y2NA 4YM6D 4AWLB 3AZKC 2HIOD 4J8UB 5B1LD 1B67A 3AZEB 1TZYD 1P3KB 2FFFB 1P34A 4J8XC 3X1UC 5DNND 5AV9D 3LZ0A 3EPKA 1P3OC 5GSUD 5GT0B 3X1TC 3MGPD 3REKD 2F2AC 3W99A 1M1AD 2BYKB 4WU9A 3B6FA 4WU8A 3RELA 3AZGD 2AROB 5AVBC 5F99C 3AZHA 3X1UB 1WWSA 1P3OB 3WTPE 2F8NK 2YFVB 1P3BC 5B40C 4KHAA 1F1EA 4LD9D 1ID3C 3A1IA 3VH6T 4E44A 5E5AA 3A6ND 1F66D 5AVBB 1HTAA 2Y2JA 3C1CA 3W97D 1P3GD 1Z2CB 1H3OA 3AZLB 5AV6D 3WTPC 5CPKA 3H0MC 1KX3C 3NQUA 5AV8A 1ID3B 1M18B 2F8ND 3AZFB 3AV2A 4HGAB 3KFUG 3MVDA 2HIOB 5CHLB 5B1LB 5FUGB 1TZYB 5AY8C 3AYWC 3MGSA 5B33A 2Y2GA 1KX3B 1P3LA 3AV1C 1P34D 2Y2HA 3AZMB 3H0LC 5AV9B 4KGCB 4J8UA 3LZ0D 3IP4C 3MGPB 3KXBC 1KX4C 4QLCC 3W99D 3X1VC 4WU9D 2Y2QA 3B6FD 3AZGB 3B6GA 5GT0A 3RELD 4Z66C 2XD5A 3AZHD 4G91C 2Y2LA 3TU4B 3KXBB 1KX4B 1EQZC 2AROA 3X1VB 4J8XA 3X1UA 1P3OA 3A6NB 2YFVA 3X1TA 4Z66B 2RVQC 4G91B 5B31C 3C1CD 3KUYC 3EG5B 5AV6B 3W96C 5F99A 1Q9CA 5AVBA 5CPKD 5GXQC 4JJNC 5AV8D 1HQ3C 5BS7C 1P3PB 2CWEA 3AZLA 2HUEB 4M6BA 5B40A 3AV2D 3MVDD 1ID3A 1M18A 2NZDC 3MGSD 3AZFA 5B33D 5GT3C 5GXQB 1P3LD 1P3FC 2ZM5A 1HQ3B 2PYOC 3AL0C 3LZ0B 2F8NG 3UTBC 4J8UD 3AZED 3WTPA 4H9QA 1KX3A 1S32C 3AZMA 4NFTA 2NZDB 5DNMC 4WU8B 3UT9B 5GT0D 3WKJC 4H9NA 4Z2MG 3AYWA 5AV5C 3WAAC 4YS3C 5B0ZC 2BG1A 2Y2IA 2AROD 1S32B 1TAFB 4J8XD 2L5AA 3X1UD 4H9SC 3UTAC 1P3OD 5DNMB 5B1MC 3TU4A 5E5AB 3KXBA 1KX4A 3X1TD 1P3IB 3X1VA 1A7WA 3LZ1C 3FDDA 3WAAB 4X23B 3VH5W 4Z66A 5AVBD 3KWQB 5B1MB 3AZLD 3AV2B 1M19C 3MVDB 1ZLAC 3C1BC 3LZ1B 3R45A 1P3PA 1ID3D 3MGSB 1M18D 2CV5C 1U35C 2IO5C 3REIC 3AZFD 5CPJC 1P3MC 3KUYA 1M19B 3WTPD 3MGRC 1ZLAB 3C1BB 5GXQA 4JJNA 1KX3D 1HQ3A 5BS7A 3AZMD 4KGCD 1U35B 3B6GB 3AZKB 5CPJB 3EPHA 3LELC 3A1KA 3AYWD 3W98C 2NZDA 3UT9A 3MGRB 3F6TA 5G49A 5BNVB 5GT3A 4J8XB 1P3FA 3V9RB 2PYOA 3MNNC 3MGQC 3UTBA 2DF4C 3X1TB 3TU4D 3KXBD 1KX4D 4NE5A 3X1VD 1S32A 1TAFA 5DNMA 5B32C 5BNXB 4XZQC 5F99B 3REHC 4Z66D 3WKJA 1P3IA 3MNNB 5AV5A 3AFAC 4YS3A 3WAAA 1P3BB 2YFWB 4X23A 5B40B 5CP6C 3KWQA 3UTAA 5B1MA 1P3PD 4J8VC 5B2IC 5B0YC 3WA9C 3LZ1A 1N1JB 3KUYD 3WTPB 4H9QB 4DQYB 5GXQD 4JJND 1HQ3D 4H9PB 4R8PC 1M19A 4H9NB 5B2IB 1ZLAA 3C1BA 5AY8B 3AYWB 4H9OB 5KDMA 2NZDD 1U35A 3UT9D 4WU8D 3LJAC 3REIA 3AV1B 5GT3D 3AZKA 5CPJA 1P3FD 1P3MA 3REKC 2PYOD 3NQJB 3UTBD 2Y2PA 4QLCB 3MGRA 5BNVA 1PZRA 1S32D 2W8SA 3V9RA 3VH6W 5DNMD 2UWXA 5E5AD 3WKJD 1P3ID 1BH8B 3W98A 5AV5D 5B2JC 4YS3D 3WAAD 4LD9C 4X23D 1EQZB 5BNXA 3EPJA 3KWQD 3R45B 3MNNA 3MGQA 1BH9B 3REJC 3UTAD 5B1MD 1P3BA 2YFWA 3X1SC 5B31B 3W97C 3B0DC 1KU5A 3LZ1D 3KUYB 2RIQA 5B2JB 3W96B 5B32A 2FJ7C 3REHA 2NQBC 4JJNB 3REJB 1N1JA 3X1SB 2Y2KA 1M19D 1KX5C 1AOIC 1ZLAD 3C1BD 4CAYA 4H9PA 2FJ7B 5C3IC 2JE5A 1U35D 5G49B 4J8VA 3B6GD 5GT3B 3REID 5B2IA 5AVCC 5B0YA 1P3FB 5CPJD 3AZKD 2PYOB 5AY8A 4ZUXC 3UTBB 1P3MD 4H9OA 3W99C 3MGRD 3AV1A 1AOIB 4WU9C 4Z5TC 3NQJA 5C3IB 3AN2C 4R8PA 3WKJB 4QLCA 5AVCB 4ZUXB 5AV5B 1P3AC 4YS3B 5B24C 3W98D 5B0ZB 3O62C 3LJAA 5F99D 5CPIC 3UTAB 3MNND 1BH8A 3AN2B 3AZJC 2XD1A 1P3BD 2BYMB 1EQZA 5B40D 2VQRA 4H9RB 1P3AB 1BH9A 3O62B 5B32D 4G92C 5AV8C 4WV4B 5B31A 4J8WC 3REHD 5CPIB 3AZIC 3AZJB 3VH5A 5B2JA 3W96A 5JRGC 3REJA 5KDMB 2CV5B 2IO5B 4G92B 4XUJC 3X1SA 1JFIB 4J8WB 3REIB 4AWLC 5B2ID 1P3KC 5B0YD 3AZEC 3AZIB 1P3MB 5AY8D 3AZNC 2FJ7A 4ZBJC 2F8NH 2NQBA 3AV1D 5BT1C 4XUJB 4KUDC 4R8PD 4QLCD 1KX5A 1AOIA 5BO0B 3LELB 3W98B 3AZNB 4Z2MH 2J8PA 2AROC 4ZBJB 3LJAD 5AVCA 4WNNB 3MGQB 4ZUXA 4KUDB 5B0ZA 3H0RC 1EQZD 4UUZA 4H9SA
chains in the Genus database with same CATH topology
4Z5TA 3B0CW 3AN2A 5B32B 4XZQB 2JSSA 2BYMA 3REHB 2RVQD 5B31D 3AZLC 3AFAB 4H9RA 1P3AA 5B24A 5B2JD 3O62A 3W96D 5CP6B 5CPIA 1M18C 5B32G 4CAYB 3REJD 3AZJA 3AZFC 4HGAC 4NE3A 4YM6C 4J8VB 3X1SD 4E45A 2HIOC 5B1LC 5B0YB 1TZYC 3WA9B 1BFMA 2CV5A 2FJ7D 1WWIA 1JFIA 4J8WA 2NQBD 3AZMC 5DNNC 5AV9C 4KGCC 5GSUC 3AZIA 2ZY2A 3MGPC 4R8PB 4YM6B 4NE6A 5JRGA 4EO5C 1M1AC 1KX5D 1AOID 3AZGC 4CSRB 4XUJA 2JCHA 3LJAB 5DNNB 5AVCD 1P3KA 3AZEA 5GSUB 3B0BA 2DQNC 3REKB 3TU4C 5BO0A 3LELA 4ZUXD 3AZNA 4EO5B 1M1AB 5B0ZD 4WNNA 3A6NC 1F66C 4Z5TD 4KUDA 3AN2D 1P3GC 2BYKA 3VH6A 5AV6C 1P3AD 5B24D 4LD9B 5JA4B 3O62D 4XZQA 4UPKA 2LY8A 1P3PC 5CPID 1F66B 2Y2OA 3AFAA 2HUEC 5B31G 3AZJD 3W97B 1P3GB 5CP6A 3B0DB 3VH5T 2CV5D 3EPLA 1P34C 2NQBB 4J8WD 3P5JB 3LZ0C 3WA9A 3AZID 2F8NB 2ZY4A 1R4VA 1KX5B 5JRGD 3B6FC 3UT9C 4WU8C 3RELC 1P34B 3AZHC 4YM6A 4XUJD 1W2EA 2HIOA 5B1LA 5FUGA 1TZYA 1P3KD 4WJ3C 3KSYA 4CSRA 4DRBA 3LELD 3AZND 3W99B 4UUZB 5DNNA 5AV9A 4WU9B 3B6FB 4KGCA 5GSUA 3MGPA 4Z5TB 5E5AC 3MGQD 3REKA 3RELB 3AZHB 5BT1D 2Y2MA 4KUDD 1P3IC 4WZSB 3C1CC 1M1AA 3AZGA 4X23C 5B24B 2G5IC 1ULYA 1B6WA 1T3UA 4KHAB 5CPKC 3KWQC 4XZQD 3AFAD 3AV2C 4LD9A 5JA4A 3MVDC 3C1CB 5CP6D 1H3OB 2ZY5A 3A6NA 3MGSC 1F66A 5CPKB 5B33C 2ZY3A 1P3LC 3NQUB 5AV8B 3W97A 4J8VD 1P3GA 4DRAA 4J8UC 3WA9D 5AV6A 5JRGB 3B0CT 2G5HC 2F8NA 5GT0C 5B33B 3B6GC 1P3LB 2Y2NA 4YM6D 4AWLB 3AZKC 2HIOD 4J8UB 5B1LD 1B67A 3AZEB 1TZYD 1P3KB 2FFFB 1P34A 4J8XC 3X1UC 5DNND 5AV9D 3LZ0A 3EPKA 1P3OC 5GSUD 5GT0B 3X1TC 3MGPD 3REKD 2F2AC 3W99A 1M1AD 2BYKB 4WU9A 3B6FA 4WU8A 3RELA 3AZGD 2AROB 5AVBC 5F99C 3AZHA 3X1UB 1WWSA 1P3OB 3WTPE 2F8NK 2YFVB 1P3BC 5B40C 4KHAA 1F1EA 4LD9D 1ID3C 3A1IA 3VH6T 4E44A 5E5AA 3A6ND 1F66D 5AVBB 1HTAA 2Y2JA 3C1CA 3W97D 1P3GD 1Z2CB 1H3OA 3AZLB 5AV6D 3WTPC 5CPKA 3H0MC 1KX3C 3NQUA 5AV8A 1ID3B 1M18B 2F8ND 3AZFB 3AV2A 4HGAB 3KFUG 3MVDA 2HIOB 5CHLB 5B1LB 5FUGB 1TZYB 5AY8C 3AYWC 3MGSA 5B33A 2Y2GA 1KX3B 1P3LA 3AV1C 1P34D 2Y2HA 3AZMB 3H0LC 5AV9B 4KGCB 4J8UA 3LZ0D 3IP4C 3MGPB 3KXBC 1KX4C 4QLCC 3W99D 3X1VC 4WU9D 2Y2QA 3B6FD 3AZGB 3B6GA 5GT0A 3RELD 4Z66C 2XD5A 3AZHD 4G91C 2Y2LA 3TU4B 3KXBB 1KX4B 1EQZC 2AROA 3X1VB 4J8XA 3X1UA 1P3OA 3A6NB 2YFVA 3X1TA 4Z66B 2RVQC 4G91B 5B31C 3C1CD 3KUYC 3EG5B 5AV6B 3W96C 5F99A 1Q9CA 5AVBA 5CPKD 5GXQC 4JJNC 5AV8D 1HQ3C 5BS7C 1P3PB 2CWEA 3AZLA 2HUEB 4M6BA 5B40A 3AV2D 3MVDD 1ID3A 1M18A 2NZDC 3MGSD 3AZFA 5B33D 5GT3C 5GXQB 1P3LD 1P3FC 2ZM5A 1HQ3B 2PYOC 3AL0C 3LZ0B 2F8NG 3UTBC 4J8UD 3AZED 3WTPA 4H9QA 1KX3A 1S32C 3AZMA 4NFTA 2NZDB 5DNMC 4WU8B 3UT9B 5GT0D 3WKJC 4H9NA 4Z2MG 3AYWA 5AV5C 3WAAC 4YS3C 5B0ZC 2BG1A 2Y2IA 2AROD 1S32B 1TAFB 4J8XD 2L5AA 3X1UD 4H9SC 3UTAC 1P3OD 5DNMB 5B1MC 3TU4A 5E5AB 3KXBA 1KX4A 3X1TD 1P3IB 3X1VA 1A7WA 3LZ1C 3FDDA 3WAAB 4X23B 3VH5W 4Z66A 5AVBD 3KWQB 5B1MB 3AZLD 3AV2B 1M19C 3MVDB 1ZLAC 3C1BC 3LZ1B 3R45A 1P3PA 1ID3D 3MGSB 1M18D 2CV5C 1U35C 2IO5C 3REIC 3AZFD 5CPJC 1P3MC 3KUYA 1M19B 3WTPD 3MGRC 1ZLAB 3C1BB 5GXQA 4JJNA 1KX3D 1HQ3A 5BS7A 3AZMD 4KGCD 1U35B 3B6GB 3AZKB 5CPJB 3EPHA 3LELC 3A1KA 3AYWD 3W98C 2NZDA 3UT9A 3MGRB 3F6TA 5G49A 5BNVB 5GT3A 4J8XB 1P3FA 3V9RB 2PYOA 3MNNC 3MGQC 3UTBA 2DF4C 3X1TB 3TU4D 3KXBD 1KX4D 4NE5A 3X1VD 1S32A 1TAFA 5DNMA 5B32C 5BNXB 4XZQC 5F99B 3REHC 4Z66D 3WKJA 1P3IA 3MNNB 5AV5A 3AFAC 4YS3A 3WAAA 1P3BB 2YFWB 4X23A 5B40B 5CP6C 3KWQA 3UTAA 5B1MA 1P3PD 4J8VC 5B2IC 5B0YC 3WA9C 3LZ1A 1N1JB 3KUYD 3WTPB 4H9QB 4DQYB 5GXQD 4JJND 1HQ3D 4H9PB 4R8PC 1M19A 4H9NB 5B2IB 1ZLAA 3C1BA 5AY8B 3AYWB 4H9OB 5KDMA 2NZDD 1U35A 3UT9D 4WU8D 3LJAC 3REIA 3AV1B 5GT3D 3AZKA 5CPJA 1P3FD 1P3MA 3REKC 2PYOD 3NQJB 3UTBD 2Y2PA 4QLCB 3MGRA 5BNVA 1PZRA 1S32D 2W8SA 3V9RA 3VH6W 5DNMD 2UWXA 5E5AD 3WKJD 1P3ID 1BH8B 3W98A 5AV5D 5B2JC 4YS3D 3WAAD 4LD9C 4X23D 1EQZB 5BNXA 3EPJA 3KWQD 3R45B 3MNNA 3MGQA 1BH9B 3REJC 3UTAD 5B1MD 1P3BA 2YFWA 3X1SC 5B31B 3W97C 3B0DC 1KU5A 3LZ1D 3KUYB 2RIQA 5B2JB 3W96B 5B32A 2FJ7C 3REHA 2NQBC 4JJNB 3REJB 1N1JA 3X1SB 2Y2KA 1M19D 1KX5C 1AOIC 1ZLAD 3C1BD 4CAYA 4H9PA 2FJ7B 5C3IC 2JE5A 1U35D 5G49B 4J8VA 3B6GD 5GT3B 3REID 5B2IA 5AVCC 5B0YA 1P3FB 5CPJD 3AZKD 2PYOB 5AY8A 4ZUXC 3UTBB 1P3MD 4H9OA 3W99C 3MGRD 3AV1A 1AOIB 4WU9C 4Z5TC 3NQJA 5C3IB 3AN2C 4R8PA 3WKJB 4QLCA 5AVCB 4ZUXB 5AV5B 1P3AC 4YS3B 5B24C 3W98D 5B0ZB 3O62C 3LJAA 5F99D 5CPIC 3UTAB 3MNND 1BH8A 3AN2B 3AZJC 2XD1A 1P3BD 2BYMB 1EQZA 5B40D 2VQRA 4H9RB 1P3AB 1BH9A 3O62B 5B32D 4G92C 5AV8C 4WV4B 5B31A 4J8WC 3REHD 5CPIB 3AZIC 3AZJB 3VH5A 5B2JA 3W96A 5JRGC 3REJA 5KDMB 2CV5B 2IO5B 4G92B 4XUJC 3X1SA 1JFIB 4J8WB 3REIB 4AWLC 5B2ID 1P3KC 5B0YD 3AZEC 3AZIB 1P3MB 5AY8D 3AZNC 2FJ7A 4ZBJC 2F8NH 2NQBA 3AV1D 5BT1C 4XUJB 4KUDC 4R8PD 4QLCD 1KX5A 1AOIA 5BO0B 3LELB 3W98B 3AZNB 4Z2MH 2J8PA 2AROC 4ZBJB 3LJAD 5AVCA 4WNNB 3MGQB 4ZUXA 4KUDB 5B0ZA 3H0RC 1EQZD 4UUZA 4H9SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Z5T A;  3B0C W;  3AN2 A;  5B32 B;  4XZQ B;  2JSS A;  2BYM A;  3REH B;  2RVQ D;  5B31 D;  3AZL C;  3AFA B;  4H9R A;  1P3A A;  5B24 A;  5B2J D;  3O62 A;  3W96 D;  5CP6 B;  5CPI A;  1M18 C;  5B32 G;  4CAY B;  3REJ D;  3AZJ A;  3AZF C;  4HGA C;  4NE3 A;  4YM6 C;  4J8V B;  3X1S D;  2HIO C;  4E45 A;  5B1L C;  5B0Y B;  1TZY C;  3WA9 B;  1BFM A;  2CV5 A;  2FJ7 D;  1WWI A;  1JFI A;  4J8W A;  2NQB D;  3AZM C;  5DNN C;  5AV9 C;  4KGC C;  5GSU C;  3AZI A;  3MGP C;  4R8P B;  4YM6 B;  4NE6 A;  5JRG A;  4EO5 C;  1M1A C;  1KX5 D;  1AOI D;  3AZG C;  4CSR B;  4XUJ A;  3LJA B;  5DNN B;  5AVC D;  1P3K A;  3AZE A;  5GSU B;  3B0B A;  3REK B;  3TU4 C;  5BO0 A;  3LEL A;  4ZUX D;  3AZN A;  4EO5 B;  1M1A B;  5B0Z D;  4WNN A;  3A6N C;  1F66 C;  4Z5T D;  4KUD A;  3AN2 D;  1P3G C;  2BYK A;  3VH6 A;  5AV6 C;  1P3A D;  5B24 D;  4LD9 B;  5JA4 B;  3O62 D;  4XZQ A;  2LY8 A;  1P3P C;  5CPI D;  1F66 B;  3AFA A;  2HUE C;  5B31 G;  3AZJ D;  3W97 B;  1P3G B;  5CP6 A;  3B0D B;  3VH5 T;  2CV5 D;  1P34 C;  2NQB B;  4J8W D;  3LZ0 C;  3WA9 A;  3AZI D;  2F8N B;  1R4V A;  1KX5 B;  5JRG D;  3B6F C;  3UT9 C;  4WU8 C;  3REL C;  1P34 B;  3AZH C;  4YM6 A;  4XUJ D;  2HIO A;  5B1L A;  5FUG A;  1TZY A;  1P3K D;  3KSY A;  4CSR A;  4DRB A;  3LEL D;  3AZN D;  3W99 B;  4UUZ B;  5DNN A;  5AV9 A;  4WU9 B;  3B6F B;  4KGC A;  5GSU A;  3MGP A;  4Z5T B;  5E5A C;  3MGQ D;  3REK A;  3REL B;  3AZH B;  5BT1 D;  4KUD D;  1P3I C;  4WZS B;  3C1C C;  1M1A A;  3AZG A;  4X23 C;  5B24 B;  1ULY A;  1B6W A;  4KHA B;  5CPK C;  3KWQ C;  4XZQ D;  3AFA D;  3AV2 C;  4LD9 A;  5JA4 A;  3MVD C;  3C1C B;  5CP6 D;  1H3O B;  3A6N A;  3MGS C;  1F66 A;  5CPK B;  5B33 C;  1P3L C;  3NQU B;  5AV8 B;  3W97 A;  4J8V D;  1P3G A;  4DRA A;  4J8U C;  3WA9 D;  5AV6 A;  5JRG B;  3B0C T;  2F8N A;  5GT0 C;  5B33 B;  3B6G C;  1P3L B;  4YM6 D;  4AWL B;  3AZK C;  2HIO D;  4J8U B;  5B1L D;  1B67 A;  3AZE B;  1TZY D;  1P3K B;  1P34 A;  4J8X C;  3X1U C;  5DNN D;  5AV9 D;  3LZ0 A;  1P3O C;  5GSU D;  5GT0 B;  3X1T C;  3MGP D;  3REK D;  3W99 A;  1M1A D;  2BYK B;  4WU9 A;  3B6F A;  4WU8 A;  3REL A;  3AZG D;  2ARO B;  5AVB C;  5F99 C;  3AZH A;  3X1U B;  1WWS A;  1P3O B;  3WTP E;  2F8N K;  2YFV B;  1P3B C;  5B40 C;  4KHA A;  1F1E A;  4LD9 D;  1ID3 C;  3VH6 T;  4E44 A;  5E5A A;  3A6N D;  1F66 D;  5AVB B;  1HTA A;  3C1C A;  3W97 D;  1P3G D;  1H3O A;  3AZL B;  5AV6 D;  3WTP C;  5CPK A;  1KX3 C;  3NQU A;  5AV8 A;  1ID3 B;  1M18 B;  2F8N D;  3AZF B;  3AV2 A;  4HGA B;  3MVD A;  2HIO B;  5CHL B;  5B1L B;  5FUG B;  1TZY B;  5AY8 C;  3AYW C;  3MGS A;  5B33 A;  1KX3 B;  1P3L A;  3AV1 C;  1P34 D;  3AZM B;  4KGC B;  5AV9 B;  4J8U A;  3LZ0 D;  3MGP B;  1KX4 C;  3KXB C;  4QLC C;  3W99 D;  3X1V C;  4WU9 D;  3B6F D;  3AZG B;  3B6G A;  5GT0 A;  3REL D;  4Z66 C;  3AZH D;  4G91 C;  3TU4 B;  3KXB B;  1KX4 B;  1EQZ C;  2ARO A;  3X1V B;  4J8X A;  3X1U A;  1P3O A;  3A6N B;  2YFV A;  3X1T A;  4Z66 B;  2RVQ C;  4G91 B;  5B31 C;  3C1C D;  3KUY C;  5AV6 B;  3W96 C;  5F99 A;  1Q9C A;  5AVB A;  5CPK D;  5GXQ C;  4JJN C;  5AV8 D;  1HQ3 C;  5BS7 C;  1P3P B;  2CWE A;  3AZL A;  2HUE B;  4M6B A;  5B40 A;  3AV2 D;  3MVD D;  1ID3 A;  1M18 A;  2NZD C;  3MGS D;  3AZF A;  5B33 D;  5GT3 C;  5GXQ B;  1P3L D;  1P3F C;  1HQ3 B;  2PYO C;  3LZ0 B;  2F8N G;  3UTB C;  4J8U D;  3AZE D;  3WTP A;  4H9Q A;  1KX3 A;  1S32 C;  3AZM A;  4NFT A;  2NZD B;  5DNM C;  4WU8 B;  3UT9 B;  5GT0 D;  3WKJ C;  4H9N A;  4Z2M G;  3AYW A;  5AV5 C;  3WAA C;  4YS3 C;  5B0Z C;  2ARO D;  1S32 B;  1TAF B;  4J8X D;  2L5A A;  3X1U D;  4H9S C;  3UTA C;  1P3O D;  5DNM B;  5B1M C;  3TU4 A;  5E5A B;  3KXB A;  1KX4 A;  3X1T D;  1P3I B;  3X1V A;  1A7W A;  3LZ1 C;  3WAA B;  4X23 B;  3VH5 W;  4Z66 A;  5AVB D;  3KWQ B;  5B1M B;  3AZL D;  3AV2 B;  1M19 C;  3MVD B;  1ZLA C;  3C1B C;  3LZ1 B;  3R45 A;  1P3P A;  1ID3 D;  3MGS B;  1M18 D;  2CV5 C;  1U35 C;  2IO5 C;  3REI C;  3AZF D;  5CPJ C;  1P3M C;  3KUY A;  1M19 B;  3WTP D;  3MGR C;  1ZLA B;  3C1B B;  5GXQ A;  4JJN A;  1KX3 D;  1HQ3 A;  5BS7 A;  3AZM D;  4KGC D;  1U35 B;  3B6G B;  3AZK B;  5CPJ B;  3LEL C;  3W98 C;  3AYW D;  2NZD A;  3UT9 A;  3MGR B;  5BNV B;  5G49 A;  5GT3 A;  4J8X B;  1P3F A;  3V9R B;  2PYO A;  3MNN C;  3MGQ C;  3UTB A;  3X1T B;  3TU4 D;  3KXB D;  1KX4 D;  4NE5 A;  3X1V D;  1S32 A;  1TAF A;  5DNM A;  5B32 C;  5BNX B;  4XZQ C;  5F99 B;  3REH C;  4Z66 D;  3WKJ A;  1P3I A;  3MNN B;  5AV5 A;  3AFA C;  4YS3 A;  3WAA A;  1P3B B;  2YFW B;  4X23 A;  5B40 B;  5CP6 C;  3KWQ A;  3UTA A;  5B1M A;  1P3P D;  4J8V C;  5B2I C;  5B0Y C;  3WA9 C;  3LZ1 A;  1N1J B;  3KUY D;  3WTP B;  4H9Q B;  5GXQ D;  4JJN D;  1HQ3 D;  4H9P B;  4R8P C;  1M19 A;  4H9N B;  5B2I B;  1ZLA A;  3C1B A;  5AY8 B;  3AYW B;  4H9O B;  5KDM A;  2NZD D;  1U35 A;  3UT9 D;  4WU8 D;  3LJA C;  3REI A;  3AV1 B;  5GT3 D;  3AZK A;  5CPJ A;  1P3F D;  1P3M A;  3REK C;  2PYO D;  3NQJ B;  3UTB D;  4QLC B;  3MGR A;  5BNV A;  1S32 D;  3V9R A;  3VH6 W;  5DNM D;  5E5A D;  3WKJ D;  1P3I D;  1BH8 B;  3W98 A;  5AV5 D;  5B2J C;  4YS3 D;  3WAA D;  4LD9 C;  4X23 D;  1EQZ B;  5BNX A;  3KWQ D;  3R45 B;  3MNN A;  3MGQ A;  1BH9 B;  3REJ C;  3UTA D;  5B1M D;  1P3B A;  2YFW A;  3X1S C;  5B31 B;  3W97 C;  3B0D C;  1KU5 A;  3LZ1 D;  3KUY B;  5B2J B;  3W96 B;  5B32 A;  2FJ7 C;  3REH A;  2NQB C;  4JJN B;  3REJ B;  1N1J A;  3X1S B;  1M19 D;  1KX5 C;  1AOI C;  1ZLA D;  3C1B D;  4CAY A;  4H9P A;  2FJ7 B;  5C3I C;  1U35 D;  5G49 B;  4J8V A;  3B6G D;  5GT3 B;  3REI D;  5B2I A;  5AVC C;  5B0Y A;  1P3F B;  5CPJ D;  3AZK D;  2PYO B;  5AY8 A;  4ZUX C;  3UTB B;  1P3M D;  4H9O A;  3W99 C;  3MGR D;  3AV1 A;  1AOI B;  4WU9 C;  4Z5T C;  3NQJ A;  5C3I B;  3AN2 C;  4R8P A;  3WKJ B;  4QLC A;  5AVC B;  4ZUX B;  5AV5 B;  1P3A C;  4YS3 B;  5B24 C;  3W98 D;  5B0Z B;  3O62 C;  3LJA A;  5F99 D;  5CPI C;  3UTA B;  3MNN D;  1BH8 A;  3AN2 B;  3AZJ C;  1P3B D;  2BYM B;  1EQZ A;  5B40 D;  4H9R B;  1P3A B;  1BH9 A;  3O62 B;  5B32 D;  4G92 C;  5AV8 C;  4WV4 B;  5B31 A;  4J8W C;  3REH D;  5CPI B;  3AZI C;  3AZJ B;  3VH5 A;  5B2J A;  3W96 A;  5JRG C;  3REJ A;  5KDM B;  2CV5 B;  2IO5 B;  4G92 B;  4XUJ C;  3X1S A;  1JFI B;  4J8W B;  3REI B;  4AWL C;  5B2I D;  1P3K C;  5B0Y D;  3AZE C;  3AZI B;  1P3M B;  5AY8 D;  3AZN C;  2FJ7 A;  4ZBJ C;  2F8N H;  2NQB A;  3AV1 D;  5BT1 C;  4XUJ B;  4KUD C;  4R8P D;  4QLC D;  1KX5 A;  1AOI A;  5BO0 B;  3LEL B;  3W98 B;  3AZN B;  4Z2M H;  2ARO C;  4ZBJ B;  3LJA D;  5AVC A;  4WNN B;  3MGQ B;  4ZUX A;  4KUD B;  5B0Z A;  1EQZ D;  4UUZ A;  4H9S A; 
#chains in the Genus database with same CATH topology
 4Z5T A;  3B0C W;  3AN2 A;  5B32 B;  4XZQ B;  2JSS A;  2BYM A;  3REH B;  2RVQ D;  5B31 D;  3AZL C;  3AFA B;  4H9R A;  1P3A A;  5B24 A;  5B2J D;  3O62 A;  3W96 D;  5CP6 B;  5CPI A;  1M18 C;  5B32 G;  4CAY B;  3REJ D;  3AZJ A;  3AZF C;  4HGA C;  4NE3 A;  4YM6 C;  4J8V B;  3X1S D;  4E45 A;  2HIO C;  5B1L C;  5B0Y B;  1TZY C;  3WA9 B;  1BFM A;  2CV5 A;  2FJ7 D;  1WWI A;  1JFI A;  4J8W A;  2NQB D;  3AZM C;  5DNN C;  5AV9 C;  4KGC C;  5GSU C;  3AZI A;  2ZY2 A;  3MGP C;  4R8P B;  4YM6 B;  4NE6 A;  5JRG A;  4EO5 C;  1M1A C;  1KX5 D;  1AOI D;  3AZG C;  4CSR B;  4XUJ A;  2JCH A;  3LJA B;  5DNN B;  5AVC D;  1P3K A;  3AZE A;  5GSU B;  3B0B A;  2DQN C;  3REK B;  3TU4 C;  5BO0 A;  3LEL A;  4ZUX D;  3AZN A;  4EO5 B;  1M1A B;  5B0Z D;  4WNN A;  3A6N C;  1F66 C;  4Z5T D;  4KUD A;  3AN2 D;  1P3G C;  2BYK A;  3VH6 A;  5AV6 C;  1P3A D;  5B24 D;  4LD9 B;  5JA4 B;  3O62 D;  4XZQ A;  4UPK A;  2LY8 A;  1P3P C;  5CPI D;  1F66 B;  2Y2O A;  3AFA A;  2HUE C;  5B31 G;  3AZJ D;  3W97 B;  1P3G B;  5CP6 A;  3B0D B;  3VH5 T;  2CV5 D;  3EPL A;  1P34 C;  2NQB B;  4J8W D;  3P5J B;  3LZ0 C;  3WA9 A;  3AZI D;  2F8N B;  2ZY4 A;  1R4V A;  1KX5 B;  5JRG D;  3B6F C;  3UT9 C;  4WU8 C;  3REL C;  1P34 B;  3AZH C;  4YM6 A;  4XUJ D;  1W2E A;  2HIO A;  5B1L A;  5FUG A;  1TZY A;  1P3K D;  4WJ3 C;  3KSY A;  4CSR A;  4DRB A;  3LEL D;  3AZN D;  3W99 B;  4UUZ B;  5DNN A;  5AV9 A;  4WU9 B;  3B6F B;  4KGC A;  5GSU A;  3MGP A;  4Z5T B;  5E5A C;  3MGQ D;  3REK A;  3REL B;  3AZH B;  5BT1 D;  2Y2M A;  4KUD D;  1P3I C;  4WZS B;  3C1C C;  1M1A A;  3AZG A;  4X23 C;  5B24 B;  2G5I C;  1ULY A;  1B6W A;  1T3U A;  4KHA B;  5CPK C;  3KWQ C;  4XZQ D;  3AFA D;  3AV2 C;  4LD9 A;  5JA4 A;  3MVD C;  3C1C B;  5CP6 D;  1H3O B;  2ZY5 A;  3A6N A;  3MGS C;  1F66 A;  5CPK B;  5B33 C;  2ZY3 A;  1P3L C;  3NQU B;  5AV8 B;  3W97 A;  4J8V D;  1P3G A;  4DRA A;  4J8U C;  3WA9 D;  5AV6 A;  5JRG B;  3B0C T;  2G5H C;  2F8N A;  5GT0 C;  5B33 B;  3B6G C;  1P3L B;  2Y2N A;  4YM6 D;  4AWL B;  3AZK C;  2HIO D;  4J8U B;  5B1L D;  1B67 A;  3AZE B;  1TZY D;  1P3K B;  2FFF B;  1P34 A;  4J8X C;  3X1U C;  5DNN D;  5AV9 D;  3LZ0 A;  3EPK A;  1P3O C;  5GSU D;  5GT0 B;  3X1T C;  3MGP D;  3REK D;  2F2A C;  3W99 A;  1M1A D;  2BYK B;  4WU9 A;  3B6F A;  4WU8 A;  3REL A;  3AZG D;  2ARO B;  5AVB C;  5F99 C;  3AZH A;  3X1U B;  1WWS A;  1P3O B;  3WTP E;  2F8N K;  2YFV B;  1P3B C;  5B40 C;  4KHA A;  1F1E A;  4LD9 D;  1ID3 C;  3A1I A;  3VH6 T;  4E44 A;  5E5A A;  3A6N D;  1F66 D;  5AVB B;  1HTA A;  2Y2J A;  3C1C A;  3W97 D;  1P3G D;  1Z2C B;  1H3O A;  3AZL B;  5AV6 D;  3WTP C;  5CPK A;  3H0M C;  1KX3 C;  3NQU A;  5AV8 A;  1ID3 B;  1M18 B;  2F8N D;  3AZF B;  3AV2 A;  4HGA B;  3KFU G;  3MVD A;  2HIO B;  5CHL B;  5B1L B;  5FUG B;  1TZY B;  5AY8 C;  3AYW C;  3MGS A;  5B33 A;  2Y2G A;  1KX3 B;  1P3L A;  3AV1 C;  1P34 D;  2Y2H A;  3AZM B;  3H0L C;  5AV9 B;  4KGC B;  4J8U A;  3LZ0 D;  3IP4 C;  3MGP B;  3KXB C;  1KX4 C;  4QLC C;  3W99 D;  3X1V C;  4WU9 D;  2Y2Q A;  3B6F D;  3AZG B;  3B6G A;  5GT0 A;  3REL D;  4Z66 C;  2XD5 A;  3AZH D;  4G91 C;  2Y2L A;  3TU4 B;  3KXB B;  1KX4 B;  1EQZ C;  2ARO A;  3X1V B;  4J8X A;  3X1U A;  1P3O A;  3A6N B;  2YFV A;  3X1T A;  4Z66 B;  2RVQ C;  4G91 B;  5B31 C;  3C1C D;  3KUY C;  3EG5 B;  5AV6 B;  3W96 C;  5F99 A;  1Q9C A;  5AVB A;  5CPK D;  5GXQ C;  4JJN C;  5AV8 D;  1HQ3 C;  5BS7 C;  1P3P B;  2CWE A;  3AZL A;  2HUE B;  4M6B A;  5B40 A;  3AV2 D;  3MVD D;  1ID3 A;  1M18 A;  2NZD C;  3MGS D;  3AZF A;  5B33 D;  5GT3 C;  5GXQ B;  1P3L D;  1P3F C;  2ZM5 A;  1HQ3 B;  2PYO C;  3AL0 C;  3LZ0 B;  2F8N G;  3UTB C;  4J8U D;  3AZE D;  3WTP A;  4H9Q A;  1KX3 A;  1S32 C;  3AZM A;  4NFT A;  2NZD B;  5DNM C;  4WU8 B;  3UT9 B;  5GT0 D;  3WKJ C;  4H9N A;  4Z2M G;  3AYW A;  5AV5 C;  3WAA C;  4YS3 C;  5B0Z C;  2BG1 A;  2Y2I A;  2ARO D;  1S32 B;  1TAF B;  4J8X D;  2L5A A;  3X1U D;  4H9S C;  3UTA C;  1P3O D;  5DNM B;  5B1M C;  3TU4 A;  5E5A B;  3KXB A;  1KX4 A;  3X1T D;  1P3I B;  3X1V A;  1A7W A;  3LZ1 C;  3FDD A;  3WAA B;  4X23 B;  3VH5 W;  4Z66 A;  5AVB D;  3KWQ B;  5B1M B;  3AZL D;  3AV2 B;  1M19 C;  3MVD B;  1ZLA C;  3C1B C;  3LZ1 B;  3R45 A;  1P3P A;  1ID3 D;  3MGS B;  1M18 D;  2CV5 C;  1U35 C;  2IO5 C;  3REI C;  3AZF D;  5CPJ C;  1P3M C;  3KUY A;  1M19 B;  3WTP D;  3MGR C;  1ZLA B;  3C1B B;  5GXQ A;  4JJN A;  1KX3 D;  1HQ3 A;  5BS7 A;  3AZM D;  4KGC D;  1U35 B;  3B6G B;  3AZK B;  5CPJ B;  3EPH A;  3LEL C;  3A1K A;  3AYW D;  3W98 C;  2NZD A;  3UT9 A;  3MGR B;  3F6T A;  5G49 A;  5BNV B;  5GT3 A;  4J8X B;  1P3F A;  3V9R B;  2PYO A;  3MNN C;  3MGQ C;  3UTB A;  2DF4 C;  3X1T B;  3TU4 D;  3KXB D;  1KX4 D;  4NE5 A;  3X1V D;  1S32 A;  1TAF A;  5DNM A;  5B32 C;  5BNX B;  4XZQ C;  5F99 B;  3REH C;  4Z66 D;  3WKJ A;  1P3I A;  3MNN B;  5AV5 A;  3AFA C;  4YS3 A;  3WAA A;  1P3B B;  2YFW B;  4X23 A;  5B40 B;  5CP6 C;  3KWQ A;  3UTA A;  5B1M A;  1P3P D;  4J8V C;  5B2I C;  5B0Y C;  3WA9 C;  3LZ1 A;  1N1J B;  3KUY D;  3WTP B;  4H9Q B;  4DQY B;  5GXQ D;  4JJN D;  1HQ3 D;  4H9P B;  4R8P C;  1M19 A;  4H9N B;  5B2I B;  1ZLA A;  3C1B A;  5AY8 B;  3AYW B;  4H9O B;  5KDM A;  2NZD D;  1U35 A;  3UT9 D;  4WU8 D;  3LJA C;  3REI A;  3AV1 B;  5GT3 D;  3AZK A;  5CPJ A;  1P3F D;  1P3M A;  3REK C;  2PYO D;  3NQJ B;  3UTB D;  2Y2P A;  4QLC B;  3MGR A;  5BNV A;  1PZR A;  1S32 D;  2W8S A;  3V9R A;  3VH6 W;  5DNM D;  2UWX A;  5E5A D;  3WKJ D;  1P3I D;  1BH8 B;  3W98 A;  5AV5 D;  5B2J C;  4YS3 D;  3WAA D;  4LD9 C;  4X23 D;  1EQZ B;  5BNX A;  3EPJ A;  3KWQ D;  3R45 B;  3MNN A;  3MGQ A;  1BH9 B;  3REJ C;  3UTA D;  5B1M D;  1P3B A;  2YFW A;  3X1S C;  5B31 B;  3W97 C;  3B0D C;  1KU5 A;  3LZ1 D;  3KUY B;  2RIQ A;  5B2J B;  3W96 B;  5B32 A;  2FJ7 C;  3REH A;  2NQB C;  4JJN B;  3REJ B;  1N1J A;  3X1S B;  2Y2K A;  1M19 D;  1KX5 C;  1AOI C;  1ZLA D;  3C1B D;  4CAY A;  4H9P A;  2FJ7 B;  5C3I C;  2JE5 A;  1U35 D;  5G49 B;  4J8V A;  3B6G D;  5GT3 B;  3REI D;  5B2I A;  5AVC C;  5B0Y A;  1P3F B;  5CPJ D;  3AZK D;  2PYO B;  5AY8 A;  4ZUX C;  3UTB B;  1P3M D;  4H9O A;  3W99 C;  3MGR D;  3AV1 A;  1AOI B;  4WU9 C;  4Z5T C;  3NQJ A;  5C3I B;  3AN2 C;  4R8P A;  3WKJ B;  4QLC A;  5AVC B;  4ZUX B;  5AV5 B;  1P3A C;  4YS3 B;  5B24 C;  3W98 D;  5B0Z B;  3O62 C;  3LJA A;  5F99 D;  5CPI C;  3UTA B;  3MNN D;  1BH8 A;  3AN2 B;  3AZJ C;  2XD1 A;  1P3B D;  2BYM B;  1EQZ A;  5B40 D;  2VQR A;  4H9R B;  1P3A B;  1BH9 A;  3O62 B;  5B32 D;  4G92 C;  5AV8 C;  4WV4 B;  5B31 A;  4J8W C;  3REH D;  5CPI B;  3AZI C;  3AZJ B;  3VH5 A;  5B2J A;  3W96 A;  5JRG C;  3REJ A;  5KDM B;  2CV5 B;  2IO5 B;  4G92 B;  4XUJ C;  3X1S A;  1JFI B;  4J8W B;  3REI B;  4AWL C;  5B2I D;  1P3K C;  5B0Y D;  3AZE C;  3AZI B;  1P3M B;  5AY8 D;  3AZN C;  2FJ7 A;  4ZBJ C;  2F8N H;  2NQB A;  3AV1 D;  5BT1 C;  4XUJ B;  4KUD C;  4R8P D;  4QLC D;  1KX5 A;  1AOI A;  5BO0 B;  3LEL B;  3W98 B;  3AZN B;  4Z2M H;  2J8P A;  2ARO C;  4ZBJ B;  3LJA D;  5AVC A;  4WNN B;  3MGQ B;  4ZUX A;  4KUD B;  5B0Z A;  3H0R C;  1EQZ D;  4UUZ A;  4H9S A; 
#chains in the Genus database with same CATH homology
 4Z5T A;  3B0C W;  3AN2 A;  5B32 B;  4XZQ B;  2JSS A;  2BYM A;  3REH B;  2RVQ D;  5B31 D;  3AZL C;  3AFA B;  4H9R A;  1P3A A;  5B24 A;  5B2J D;  3O62 A;  3W96 D;  5CP6 B;  5CPI A;  1M18 C;  5B32 G;  4CAY B;  3REJ D;  3AZJ A;  3AZF C;  4HGA C;  4NE3 A;  4YM6 C;  4J8V B;  3X1S D;  4E45 A;  2HIO C;  5B1L C;  5B0Y B;  1TZY C;  3WA9 B;  1BFM A;  2CV5 A;  2FJ7 D;  1WWI A;  1JFI A;  4J8W A;  2NQB D;  3AZM C;  5DNN C;  5AV9 C;  4KGC C;  5GSU C;  3AZI A;  2ZY2 A;  3MGP C;  4R8P B;  4YM6 B;  4NE6 A;  5JRG A;  4EO5 C;  1M1A C;  1KX5 D;  1AOI D;  3AZG C;  4CSR B;  4XUJ A;  2JCH A;  3LJA B;  5DNN B;  5AVC D;  1P3K A;  3AZE A;  5GSU B;  3B0B A;  2DQN C;  3REK B;  3TU4 C;  5BO0 A;  3LEL A;  4ZUX D;  3AZN A;  4EO5 B;  1M1A B;  5B0Z D;  4WNN A;  3A6N C;  1F66 C;  4Z5T D;  4KUD A;  3AN2 D;  1P3G C;  2BYK A;  3VH6 A;  5AV6 C;  1P3A D;  5B24 D;  4LD9 B;  5JA4 B;  3O62 D;  4XZQ A;  4UPK A;  2LY8 A;  1P3P C;  5CPI D;  1F66 B;  2Y2O A;  3AFA A;  2HUE C;  5B31 G;  3AZJ D;  3W97 B;  1P3G B;  5CP6 A;  3B0D B;  3VH5 T;  2CV5 D;  3EPL A;  1P34 C;  2NQB B;  4J8W D;  3P5J B;  3LZ0 C;  3WA9 A;  3AZI D;  2F8N B;  2ZY4 A;  1R4V A;  1KX5 B;  5JRG D;  3B6F C;  3UT9 C;  4WU8 C;  3REL C;  1P34 B;  3AZH C;  4YM6 A;  4XUJ D;  1W2E A;  2HIO A;  5B1L A;  5FUG A;  1TZY A;  1P3K D;  4WJ3 C;  3KSY A;  4CSR A;  4DRB A;  3LEL D;  3AZN D;  3W99 B;  4UUZ B;  5DNN A;  5AV9 A;  4WU9 B;  3B6F B;  4KGC A;  5GSU A;  3MGP A;  4Z5T B;  5E5A C;  3MGQ D;  3REK A;  3REL B;  3AZH B;  5BT1 D;  2Y2M A;  4KUD D;  1P3I C;  4WZS B;  3C1C C;  1M1A A;  3AZG A;  4X23 C;  5B24 B;  2G5I C;  1ULY A;  1B6W A;  1T3U A;  4KHA B;  5CPK C;  3KWQ C;  4XZQ D;  3AFA D;  3AV2 C;  4LD9 A;  5JA4 A;  3MVD C;  3C1C B;  5CP6 D;  1H3O B;  2ZY5 A;  3A6N A;  3MGS C;  1F66 A;  5CPK B;  5B33 C;  2ZY3 A;  1P3L C;  3NQU B;  5AV8 B;  3W97 A;  4J8V D;  1P3G A;  4DRA A;  4J8U C;  3WA9 D;  5AV6 A;  5JRG B;  3B0C T;  2G5H C;  2F8N A;  5GT0 C;  5B33 B;  3B6G C;  1P3L B;  2Y2N A;  4YM6 D;  4AWL B;  3AZK C;  2HIO D;  4J8U B;  5B1L D;  1B67 A;  3AZE B;  1TZY D;  1P3K B;  2FFF B;  1P34 A;  4J8X C;  3X1U C;  5DNN D;  5AV9 D;  3LZ0 A;  3EPK A;  1P3O C;  5GSU D;  5GT0 B;  3X1T C;  3MGP D;  3REK D;  2F2A C;  3W99 A;  1M1A D;  2BYK B;  4WU9 A;  3B6F A;  4WU8 A;  3REL A;  3AZG D;  2ARO B;  5AVB C;  5F99 C;  3AZH A;  3X1U B;  1WWS A;  1P3O B;  3WTP E;  2F8N K;  2YFV B;  1P3B C;  5B40 C;  4KHA A;  1F1E A;  4LD9 D;  1ID3 C;  3A1I A;  3VH6 T;  4E44 A;  5E5A A;  3A6N D;  1F66 D;  5AVB B;  1HTA A;  2Y2J A;  3C1C A;  3W97 D;  1P3G D;  1Z2C B;  1H3O A;  3AZL B;  5AV6 D;  3WTP C;  5CPK A;  3H0M C;  1KX3 C;  3NQU A;  5AV8 A;  1ID3 B;  1M18 B;  2F8N D;  3AZF B;  3AV2 A;  4HGA B;  3KFU G;  3MVD A;  2HIO B;  5CHL B;  5B1L B;  5FUG B;  1TZY B;  5AY8 C;  3AYW C;  3MGS A;  5B33 A;  2Y2G A;  1KX3 B;  1P3L A;  3AV1 C;  1P34 D;  2Y2H A;  3AZM B;  3H0L C;  5AV9 B;  4KGC B;  4J8U A;  3LZ0 D;  3IP4 C;  3MGP B;  3KXB C;  1KX4 C;  4QLC C;  3W99 D;  3X1V C;  4WU9 D;  2Y2Q A;  3B6F D;  3AZG B;  3B6G A;  5GT0 A;  3REL D;  4Z66 C;  2XD5 A;  3AZH D;  4G91 C;  2Y2L A;  3TU4 B;  3KXB B;  1KX4 B;  1EQZ C;  2ARO A;  3X1V B;  4J8X A;  3X1U A;  1P3O A;  3A6N B;  2YFV A;  3X1T A;  4Z66 B;  2RVQ C;  4G91 B;  5B31 C;  3C1C D;  3KUY C;  3EG5 B;  5AV6 B;  3W96 C;  5F99 A;  1Q9C A;  5AVB A;  5CPK D;  5GXQ C;  4JJN C;  5AV8 D;  1HQ3 C;  5BS7 C;  1P3P B;  2CWE A;  3AZL A;  2HUE B;  4M6B A;  5B40 A;  3AV2 D;  3MVD D;  1ID3 A;  1M18 A;  2NZD C;  3MGS D;  3AZF A;  5B33 D;  5GT3 C;  5GXQ B;  1P3L D;  1P3F C;  2ZM5 A;  1HQ3 B;  2PYO C;  3AL0 C;  3LZ0 B;  2F8N G;  3UTB C;  4J8U D;  3AZE D;  3WTP A;  4H9Q A;  1KX3 A;  1S32 C;  3AZM A;  4NFT A;  2NZD B;  5DNM C;  4WU8 B;  3UT9 B;  5GT0 D;  3WKJ C;  4H9N A;  4Z2M G;  3AYW A;  5AV5 C;  3WAA C;  4YS3 C;  5B0Z C;  2BG1 A;  2Y2I A;  2ARO D;  1S32 B;  1TAF B;  4J8X D;  2L5A A;  3X1U D;  4H9S C;  3UTA C;  1P3O D;  5DNM B;  5B1M C;  3TU4 A;  5E5A B;  3KXB A;  1KX4 A;  3X1T D;  1P3I B;  3X1V A;  1A7W A;  3LZ1 C;  3FDD A;  3WAA B;  4X23 B;  3VH5 W;  4Z66 A;  5AVB D;  3KWQ B;  5B1M B;  3AZL D;  3AV2 B;  1M19 C;  3MVD B;  1ZLA C;  3C1B C;  3LZ1 B;  3R45 A;  1P3P A;  1ID3 D;  3MGS B;  1M18 D;  2CV5 C;  1U35 C;  2IO5 C;  3REI C;  3AZF D;  5CPJ C;  1P3M C;  3KUY A;  1M19 B;  3WTP D;  3MGR C;  1ZLA B;  3C1B B;  5GXQ A;  4JJN A;  1KX3 D;  1HQ3 A;  5BS7 A;  3AZM D;  4KGC D;  1U35 B;  3B6G B;  3AZK B;  5CPJ B;  3EPH A;  3LEL C;  3A1K A;  3AYW D;  3W98 C;  2NZD A;  3UT9 A;  3MGR B;  3F6T A;  5G49 A;  5BNV B;  5GT3 A;  4J8X B;  1P3F A;  3V9R B;  2PYO A;  3MNN C;  3MGQ C;  3UTB A;  2DF4 C;  3X1T B;  3TU4 D;  3KXB D;  1KX4 D;  4NE5 A;  3X1V D;  1S32 A;  1TAF A;  5DNM A;  5B32 C;  5BNX B;  4XZQ C;  5F99 B;  3REH C;  4Z66 D;  3WKJ A;  1P3I A;  3MNN B;  5AV5 A;  3AFA C;  4YS3 A;  3WAA A;  1P3B B;  2YFW B;  4X23 A;  5B40 B;  5CP6 C;  3KWQ A;  3UTA A;  5B1M A;  1P3P D;  4J8V C;  5B2I C;  5B0Y C;  3WA9 C;  3LZ1 A;  1N1J B;  3KUY D;  3WTP B;  4H9Q B;  4DQY B;  5GXQ D;  4JJN D;  1HQ3 D;  4H9P B;  4R8P C;  1M19 A;  4H9N B;  5B2I B;  1ZLA A;  3C1B A;  5AY8 B;  3AYW B;  4H9O B;  5KDM A;  2NZD D;  1U35 A;  3UT9 D;  4WU8 D;  3LJA C;  3REI A;  3AV1 B;  5GT3 D;  3AZK A;  5CPJ A;  1P3F D;  1P3M A;  3REK C;  2PYO D;  3NQJ B;  3UTB D;  2Y2P A;  4QLC B;  3MGR A;  5BNV A;  1PZR A;  1S32 D;  2W8S A;  3V9R A;  3VH6 W;  5DNM D;  2UWX A;  5E5A D;  3WKJ D;  1P3I D;  1BH8 B;  3W98 A;  5AV5 D;  5B2J C;  4YS3 D;  3WAA D;  4LD9 C;  4X23 D;  1EQZ B;  5BNX A;  3EPJ A;  3KWQ D;  3R45 B;  3MNN A;  3MGQ A;  1BH9 B;  3REJ C;  3UTA D;  5B1M D;  1P3B A;  2YFW A;  3X1S C;  5B31 B;  3W97 C;  3B0D C;  1KU5 A;  3LZ1 D;  3KUY B;  2RIQ A;  5B2J B;  3W96 B;  5B32 A;  2FJ7 C;  3REH A;  2NQB C;  4JJN B;  3REJ B;  1N1J A;  3X1S B;  2Y2K A;  1M19 D;  1KX5 C;  1AOI C;  1ZLA D;  3C1B D;  4CAY A;  4H9P A;  2FJ7 B;  5C3I C;  2JE5 A;  1U35 D;  5G49 B;  4J8V A;  3B6G D;  5GT3 B;  3REI D;  5B2I A;  5AVC C;  5B0Y A;  1P3F B;  5CPJ D;  3AZK D;  2PYO B;  5AY8 A;  4ZUX C;  3UTB B;  1P3M D;  4H9O A;  3W99 C;  3MGR D;  3AV1 A;  1AOI B;  4WU9 C;  4Z5T C;  3NQJ A;  5C3I B;  3AN2 C;  4R8P A;  3WKJ B;  4QLC A;  5AVC B;  4ZUX B;  5AV5 B;  1P3A C;  4YS3 B;  5B24 C;  3W98 D;  5B0Z B;  3O62 C;  3LJA A;  5F99 D;  5CPI C;  3UTA B;  3MNN D;  1BH8 A;  3AN2 B;  3AZJ C;  2XD1 A;  1P3B D;  2BYM B;  1EQZ A;  5B40 D;  2VQR A;  4H9R B;  1P3A B;  1BH9 A;  3O62 B;  5B32 D;  4G92 C;  5AV8 C;  4WV4 B;  5B31 A;  4J8W C;  3REH D;  5CPI B;  3AZI C;  3AZJ B;  3VH5 A;  5B2J A;  3W96 A;  5JRG C;  3REJ A;  5KDM B;  2CV5 B;  2IO5 B;  4G92 B;  4XUJ C;  3X1S A;  1JFI B;  4J8W B;  3REI B;  4AWL C;  5B2I D;  1P3K C;  5B0Y D;  3AZE C;  3AZI B;  1P3M B;  5AY8 D;  3AZN C;  2FJ7 A;  4ZBJ C;  2F8N H;  2NQB A;  3AV1 D;  5BT1 C;  4XUJ B;  4KUD C;  4R8P D;  4QLC D;  1KX5 A;  1AOI A;  5BO0 B;  3LEL B;  3W98 B;  3AZN B;  4Z2M H;  2J8P A;  2ARO C;  4ZBJ B;  3LJA D;  5AVC A;  4WNN B;  3MGQ B;  4ZUX A;  4KUD B;  5B0Z A;  3H0R C;  1EQZ D;  4UUZ A;  4H9S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...