5BT1C

Histone chaperone hif1 playing with histone h2a-h2b dimer
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
85
structure length
85
Chain Sequence
QSRSAKAGLTFPVGRVHRLLRRGNYAQRIGSGAPVYLTAVLEYLAAEILELAGNAARDNKKTRIIPRHLQLAIRNDDELNKLLGN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Chaperone
molecule keywords HAT1-interacting factor 1
publication title Structural Insights into the Association of Hif1 with Histones H2A-H2B Dimer and H3-H4 Tetramer
pubmed doi rcsb
source organism Saccharomyces cerevisiae (strain atcc 204508 / s288c)
total genus 29
structure length 85
sequence length 85
ec nomenclature
pdb deposition date 2015-06-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5bt1C00
3W97C 2CV5D 4KGCC 1P3LB 5CPKB 4YS3B 1M18B 3LZ1C 3AZIC 2CV5B 3LZ0D 4KUDA 3AV1A 5G49B 4H9QA 3AZJD 5FUGA 3AV2B 5B33C 2BYKA 4LD9D 3KXBC 5AV9C 3AYWA 1KX5C 4KHAA 3WTPE 3LZ0B 1P3PC 3AZGA 5AV5C 5B24A 5GT0D 1EQZC 1B67A 5B31C 4LD9B 3RELC 3X1TC 1BH8B 5C3IB 3AZMC 3B6GD 5B1LC 5B0ZD 3AFAC 3W97A 5GT0B 3W98B 4KGCA 2YFWA 4H9NA 3MGRB 2AROA 3LZ1A 3B6GB 3AZIA 5B0ZB 5CPJD 4WNNA 4Z5TC 2NQBD 3MNNC 4R8PC 2RVQD 3WA9D 4H9OA 3UTAD 5B33A 4H9PB 4WU8D 4EO5B 4Z66D 3TU4C 2NQBB 3UT9D 1KX5A 3NQJB 2F8ND 3AZFC 3WA9B 1P3PA 3C1CC 4WV4B 3UTAB 5AV5A 3B6FD 5BO0B 3A6NC 4WU8B 1EQZA 5B31A 3NQUB 3UT9B 2F8NB 5GT3D 3AZMA 3AZNA 4X23C 3AFAA 3VH6W 1AOIC 3B6FB 5B2IC 1P3OB 5AVBA 3WTPA 1M1AC 3AZLC 4CAYA 3WAAD 4J8UC 5GT3B 3REKC 1P3LA 2HUEC 4Z5TA 5B2JD 3MNNA 4R8PA 1P3FC 4YM6D 1Q9CA 1N1JA 5B1MC 4J8WD 4J8XC 3WAAB 2HIOA 4XZQD 2PYOA 4ZBJC 5CP6D 1U35C 4Z2MH 5B2JB 4E44A 5B0YD 3X1VA 1HQ3C 1HTAA 3REHD 1P3GC 4DRAA 4YM6B 5GXQD 4J8WB 4XZQB 1P34C 5CPIC 5DNND 3LELA 4XUJA 1P3KD 3KUYA 5B40C 3UTBD 3REHB 4X23A 3C1BA 4J8VC 4H9SC 5GXQB 1AOIA 2IO5B 5B2IA 1S32D 1F66D 1M19C 3MGSD 5DNNB 3MVDB 1M1AA 5B32C 4QLCD 3MGQC 2NZDD 1JFIB 4J8UA 4G92C 3W98A 3REKA 3W97D 3UTBB 5BNVB 3AZEC 4KGCD 3MGRA 1S32B 1F66B 4KUDC 3MGSB 1P3AA 5B1MA 4QLCB 2NZDB 3MGPC 4J8XA 1U35A 1KX4D 3KXBD 3WKJA 5AV9D 4CSRB 1KX4B 5KDMA 5B40A 5BNXB 3V9RA 4H9SA 3B0CW 3RELD 5JRGD 3X1TD 3KXBB 5AV9B 3AZKC 1M19A 5AY8A 5B32A 3MGQA 5B1LD 2AROC 4H9RA 3B0CT 1WWSA 3REID 3X1SA 3O62D 3AZEA 3RELB 5JRGB 3AN2A 5B1LB 3MGPA 3AZHD 4R8PD 3REIB 5DNMA 3O62B 5AV6D 4HGAC 4DRBA 1ID3D 5BS7C 5F99D 3AZJB 3REJC 3TU4D 3AZHB 1KX3C 3AZFD 5AV6B 3C1CD 1ID3B 1TZYC 5F99B 1P3IC 3AZNC 3LJAA 3B0DC 3A6ND 5GSUD 3TU4B 3AZKA 5AVBC 3WTPC 3VH6A 2JSSA 4WU9C 3AZFB 5JA4A 1R4VA 3C1CB 1BH9A 1P3LC 5AV8D 3A6NB 5GSUB 4YS3C 1P3MD 3AZLD 1TAFB 5AVCA 1M18C 4J8UD 5E5AA 1H3OB 2F8NK 2HIOC 2PYOC 5CPJB 1P3FD 4JJNA 5AV8B 1P3MB 5BS7A 3X1UD 3X1VC 3AZLB 3R45A 3AV2C 4ZUXD 4UUZA 3W99D 3REJA 1ZLAD 1U35D 3KWQA 1P3BA 1HQ3D 3LELC 4Z66B 4XUJC 2BYMB 1P3FB 1KX3A 3KUYC 1P3GD 1TZYA 3X1UB 1P3IA 1P34D 4ZUXB 3C1BC 4LD9C 5BT1C 5CPID 3W99B 1ZLAB 5C3IC 1HQ3B 2YFVA 2FJ7D 4WU9A 1P3GB 5GT0C 4J8VD 3W96D 3W98C 3VH6T 4AWLC 4NFTA 1P34B 5CPKA 4YS3A 3MGRC 1M18A 4NE5A 1P3AC 2FJ7B 5B0ZC 3W96B 4J8VB 1A7WA 2CV5A 1WWIA 5G49A 4KUDD 3AV1D 2F8NG 3AV2A 4G91C 4G92B 4EO5C 3B0BA 3WKJC 3AYWD 3LZ0A 5CP6B 3AZJA 3AV1B 5B0YB 4H9QB 3AZGD 5B24D 5FUGB 1ULYA 4WU8C 4LD9A 2BYKB 1BH8A 3UT9C 4M6BA 4NE3A 3AYWB 4KHAB 5AY8C 1P3KB 5GT0A 3B6FC 3AZGB 1P3OC 5B24B 3X1SC 3AN2C 2AROD 5GT3C 3B6GA 5B0ZA 3LZ1D 3AZID 3W97B 1TAFA 5DNMC 4KGCB 1H3OA 2YFWB 3WAAC 4H9PA 5B33D 5CPJA 3LZ1B 3AZIB 2NQBA 5B2JC 4WNNB 3NQJA 1KX5D 3WA9A 3UTAA 4YM6C 1P3PD 4H9OB 5BO0A 5AV5D 4XZQC 5B33B 4WU8A 3LJAC 4Z66A 1EQZD 3NQUA 5B31D 3UT9A 2F8NA 1KX5B 3AZMD 1P3ID 3AZND 5GXQC 1P3PB 2IO5C 3AFAD 1P3OA 5AV5B 3B6FA 5AVBD 3WTPD 3MVDC 1EQZB 5B31B 3X1TB 5AVCC 5GT3A 3UTBC 3AZMB 5E5AC 3AZNB 1P3LD 4Z5TD 3AFAB 3MNND 1S32C 1F66C 3MGSC 4JJNC 3WTPB 1M18D 2NZDC 3WAAA 4CAYB 2HIOD 2PYOD 5B2JA 4Z5TB 3KWQC 3MNNB 3X1VD 4R8PB 1P3BC 3KSYA 3AV2D 4YM6A 4WZSB 4J8WA 1N1JB 4XZQA 2HIOB 5CP6A 3LELD 4XUJD 1KX4C 5B31G 5B0YA 2PYOB 3KUYD 3X1VB 3REHA 5GXQA 4X23D 3C1BD 5BT1D 1AOID 5B2ID 5DNNA 3MVDA 5CPKC 1P3KA 3LELB 4XUJB 1M1AD 1JFIA 3KUYB 3UTBA 5BNVA 3W98D 2CWEA 3REKD 4X23B 3C1BB 2CV5C 1AOIB 5JRGC 5B2IB 3MGRD 1S32A 1F66A 3MGSA 3VH5A 4QLCA 1P3AD 2NZDA 1M1AB 5B1MD 4J8XD 4J8UB 3REIC 3REKB 3O62C 4AWLB 2HUEB 3LZ0C 3AZJC 1KU5A 1P3AB 5B1MB 4J8XB 3AZHC 3WKJD 4CSRA 4E45A 1KX4A 5AV6C 4ZBJB 1ID3C 1U35B 5BNXA 5B40D 5F99C 4Z2MG 4G91B 1F1EA 3KXBA 5AV9A 1BFMA 3WKJB 5CPIB 1M19D 5AY8D 5B32D 3MGQD 5KDMB 3B6GC 5B40B 1P3OD 5GSUC 3X1SD 3V9RB 3VH5W 3AZED 3RELA 5JRGA 3X1TA 3AN2D 4NE6A 1M19B 5B1LA 5AY8B 5B32B 3MGQB 3MGPD 3VH5T 4H9RB 3REIA 5CPJC 3O62A 5AV8C 2NQBC 5DNMD 3X1SB 1P3MC 3AZEB 1B6WA 2RVQC 3AN2B 3WA9C 3UTAC 4KUDB 3MGPB 3AZHA 4Z66C 5AV6A 5DNMB 1ID3A 3X1UC 5F99A 4ZUXC 3LJAD 3W99C 1ZLAC 3TU4A 5CHLB 3AZKD 3AZFA 3C1CA 5B32G 3A6NA 5GSUA 3LJAB 3MVDD 3AZKB 5AVCD 2FJ7C 3W96C 4H9NB 5E5AD 2AROB 5JA4B 4WU9B 1BH9B 5AV8A 2F8NH 2L5AA 1P3MA 4JJND 3AZLA 5AVCB 4J8WC 5E5AB 3REJD 3KWQD 1P3FA 5CP6C 2BYMA 1P3BD 1KX3D 3AV1C 5B0YC 4JJNB 3X1UA 4HGAB 1TZYD 3REHC 3R45B 4ZUXA 3W99A 1ZLAA 4UUZB 3REJB 3AYWC 1HQ3A 5DNNC 3KWQB 1P3BB 1P3KC 1KX3B 4WU9D 1P3GA 3AZGC 5B24C 1TZYB 1P34A 1P3IB 5CPIA 3B0DB 5CPKD 4YS3D 2LY8A 5AVBB 2FJ7A 4QLCC 2YFVB 3W96A 4J8VA
chains in the Genus database with same CATH superfamily
3W97C 2CV5D 3P5JB 4KGCC 1P3LB 5CPKB 4YS3B 3IP4C 1M18B 3LZ1C 3AZIC 1W2EA 2CV5B 3LZ0D 4KUDA 3AV1A 5G49B 4H9QA 3AZJD 5FUGA 3AV2B 5B33C 1T3UA 2BYKA 4LD9D 3KXBC 5AV9C 3AYWA 1KX5C 4KHAA 3WTPE 3LZ0B 1P3PC 3AZGA 5AV5C 5B24A 5GT0D 3EPLA 1EQZC 1B67A 5B31C 4LD9B 3RELC 3X1TC 1BH8B 5C3IB 3AZMC 3B6GD 5B1LC 5B0ZD 3AFAC 3W97A 5GT0B 3W98B 4KGCA 2YFWA 4H9NA 3MGRB 2AROA 3LZ1A 3B6GB 3AZIA 5B0ZB 5CPJD 4WNNA 4Z5TC 2NQBD 3MNNC 4R8PC 2RVQD 3WA9D 4H9OA 3UTAD 5B33A 4H9PB 4WU8D 2Y2IA 4EO5B 4Z66D 3TU4C 2NQBB 3UT9D 1KX5A 3NQJB 2F8ND 3AZFC 3WA9B 1P3PA 3C1CC 4WV4B 3UTAB 5AV5A 3B6FD 5BO0B 3A6NC 4WU8B 1EQZA 5B31A 3NQUB 3UT9B 2F8NB 5GT3D 3AZMA 3AZNA 4X23C 3AFAA 3VH6W 1AOIC 3B6FB 5B2IC 1P3OB 5AVBA 3WTPA 1M1AC 3AZLC 4CAYA 3WAAD 4J8UC 3EPKA 5GT3B 3REKC 1P3LA 2HUEC 4Z5TA 5B2JD 3MNNA 4R8PA 1P3FC 4UPKA 2Y2LA 2Y2QA 1Q9CA 1N1JA 5B1MC 4YM6D 4J8WD 4J8XC 3WAAB 2HIOA 4XZQD 2PYOA 2ZY2A 4ZBJC 5CP6D 3KFUG 1U35C 4Z2MH 5B2JB 4E44A 5B0YD 3X1VA 1HQ3C 1HTAA 2XD5A 3F6TA 3REHD 1P3GC 4DRAA 4YM6B 5GXQD 4J8WB 4XZQB 1P34C 5CPIC 5DNND 3LELA 4XUJA 1P3KD 3KUYA 5B40C 3UTBD 3REHB 4X23A 3C1BA 4J8VC 4H9SC 5GXQB 1AOIA 2IO5B 5B2IA 2ZM5A 1S32D 1F66D 1M19C 3MGSD 5DNNB 3MVDB 2XD1A 5B32C 4QLCD 3MGQC 1M1AA 2NZDD 1JFIB 4J8UA 4G92C 3W98A 3REKA 3W97D 2J8PA 3UTBB 5BNVB 3EPHA 3AZEC 4KGCD 2ZY5A 3MGRA 1S32B 1F66B 4KUDC 3MGSB 1P3AA 5B1MA 4QLCB 2NZDB 3MGPC 4J8XA 1U35A 1KX4D 3KXBD 3WKJA 5AV9D 2G5HC 4CSRB 1KX4B 5KDMA 5B40A 5BNXB 3H0MC 3V9RA 4H9SA 3B0CW 3RELD 5JRGD 3X1TD 3KXBB 5AV9B 3AZKC 1M19A 5AY8A 5B32A 3MGQA 5B1LD 2AROC 4H9RA 3B0CT 1WWSA 3REID 3X1SA 3O62D 3AZEA 3RELB 5JRGB 3AN2A 5B1LB 3MGPA 3AZHD 4R8PD 3REIB 5DNMA 3O62B 5AV6D 4HGAC 4DRBA 1ID3D 5BS7C 5F99D 3AZJB 3REJC 3TU4D 2JE5A 3AZHB 1KX3C 3AZFD 5AV6B 3C1CD 1ID3B 1TZYC 3EG5B 2G5IC 5F99B 1P3IC 3AZNC 3LJAA 3B0DC 3A6ND 5GSUD 3TU4B 3AZKA 5AVBC 3WTPC 3VH6A 2JSSA 4WU9C 3AZFB 5JA4A 1R4VA 3C1CB 1BH9A 1P3LC 5AV8D 3A6NB 5GSUB 3A1IA 4YS3C 1P3MD 3AZLD 1TAFB 5AVCA 1M18C 2RIQA 4J8UD 5E5AA 1H3OB 2F8NK 2HIOC 2PYOC 5CPJB 1P3FD 4JJNA 5AV8B 1P3MB 5BS7A 3X1UD 3X1VC 3AZLB 3R45A 3AV2C 4ZUXD 4UUZA 3W99D 2F2AC 3REJA 1ZLAD 1U35D 3KWQA 1P3BA 1HQ3D 2ZY4A 4Z66B 4XUJC 2BYMB 3LELC 1P3FB 3KUYC 1KX3A 1P3GD 1TZYA 3X1UB 1P3IA 1P34D 4ZUXB 3C1BC 4LD9C 5BT1C 5CPID 3W99B 1ZLAB 5C3IC 1HQ3B 2YFVA 2FJ7D 4WU9A 1P3GB 5GT0C 4J8VD 3W96D 3W98C 3VH6T 4AWLC 4NFTA 1P34B 5CPKA 4YS3A 3MGRC 1M18A 4NE5A 1P3AC 2FJ7B 5B0ZC 3W96B 3A1KA 1A7WA 4J8VB 2CV5A 1WWIA 5G49A 4KUDD 3AV1D 2VQRA 2F8NG 3AV2A 4G91C 4G92B 3FDDA 4EO5C 3B0BA 3WKJC 3AYWD 3LZ0A 5CP6B 3AZJA 3AV1B 5B0YB 4H9QB 3AZGD 5B24D 5FUGB 1ULYA 4WU8C 1Z2CB 4LD9A 2BYKB 1BH8A 2Y2MA 3UT9C 4M6BA 4NE3A 3AYWB 4KHAB 5AY8C 1P3KB 5GT0A 3B6FC 3AZGB 1P3OC 5B24B 3X1SC 3AN2C 2AROD 5GT3C 3B6GA 5B0ZA 3LZ1D 3AZID 3W97B 1TAFA 5DNMC 4KGCB 1H3OA 2YFWB 3WAAC 4H9PA 5B33D 5CPJA 3LZ1B 3AZIB 2NQBA 5B2JC 4WNNB 3NQJA 1KX5D 3WA9A 3UTAA 4YM6C 1P3PD 4H9OB 5BO0A 5AV5D 4XZQC 5B33B 4WU8A 3LJAC 4Z66A 1EQZD 3NQUA 5B31D 3UT9A 2F8NA 1KX5B 3AZMD 1P3ID 3AZND 5GXQC 1P3PB 2IO5C 3AFAD 1P3OA 5AV5B 3B6FA 3AL0C 5AVBD 3WTPD 3MVDC 1EQZB 5B31B 3X1TB 5AVCC 5GT3A 3UTBC 3AZMB 5E5AC 3AZNB 1P3LD 4Z5TD 3AFAB 3MNND 1S32C 1F66C 3MGSC 4JJNC 3WTPB 1M18D 3H0LC 2NZDC 2BG1A 3WAAA 4CAYB 2HIOD 2PYOD 5B2JA 4Z5TB 3KWQC 3MNNB 3X1VD 4R8PB 1P3BC 3KSYA 3AV2D 4YM6A 4WZSB 2JCHA 4J8WA 1N1JB 4XZQA 2HIOB 5CP6A 3LELD 4XUJD 1KX4C 5B31G 5B0YA 2PYOB 3KUYD 3X1VB 3REHA 5GXQA 4X23D 3C1BD 5BT1D 1AOID 5B2ID 4WJ3C 2FFFB 5DNNA 3MVDA 5CPKC 2DQNC 1P3KA 3LELB 4XUJB 1M1AD 1JFIA 3KUYB 3UTBA 5BNVA 3W98D 2CWEA 3REKD 4X23B 3C1BB 2CV5C 1AOIB 5JRGC 5B2IB 3MGRD 1S32A 1F66A 3MGSA 2Y2KA 3VH5A 4QLCA 1P3AD 2NZDA 1M1AB 5B1MD 4J8XD 4J8UB 3REIC 3REKB 3O62C 4AWLB 2HUEB 3LZ0C 3AZJC 1KU5A 1P3AB 5B1MB 4J8XB 3AZHC 3WKJD 4CSRA 4E45A 1KX4A 5AV6C 4ZBJB 1ID3C 1U35B 5BNXA 5B40D 5F99C 4Z2MG 4G91B 1F1EA 3KXBA 5AV9A 1PZRA 1BFMA 3WKJB 5CPIB 1M19D 3H0RC 5AY8D 5B32D 3MGQD 3EPJA 2Y2GA 2ZY3A 5KDMB 5B40B 2Y2NA 1P3OD 3B6GC 5GSUC 3X1SD 3V9RB 3VH5W 3AZED 3RELA 5JRGA 2W8SA 3X1TA 3AN2D 4NE6A 4DQYB 2Y2HA 1M19B 5B1LA 5AY8B 5B32B 3MGQB 3MGPD 3VH5T 4H9RB 3REIA 5CPJC 3O62A 5AV8C 2NQBC 5DNMD 3X1SB 1P3MC 3AZEB 1B6WA 2RVQC 3AN2B 3WA9C 3UTAC 4KUDB 3MGPB 2DF4C 3AZHA 4Z66C 5AV6A 5DNMB 1ID3A 3X1UC 2Y2OA 5F99A 4ZUXC 3LJAD 3W99C 1ZLAC 3TU4A 5CHLB 3AZKD 3AZFA 3C1CA 5B32G 3A6NA 5GSUA 3LJAB 3MVDD 3AZKB 5AVCD 2FJ7C 3W96C 4H9NB 5E5AD 2AROB 5JA4B 4WU9B 1BH9B 5AV8A 2F8NH 2L5AA 1P3MA 4JJND 3AZLA 5AVCB 4J8WC 5E5AB 3REJD 3KWQD 1P3FA 5CP6C 2BYMA 1P3BD 1KX3D 3AV1C 5B0YC 4JJNB 3X1UA 4HGAB 1TZYD 3REHC 3R45B 4ZUXA 3W99A 1ZLAA 4UUZB 3REJB 3AYWC 1HQ3A 5DNNC 3KWQB 2UWXA 1P3BB 1P3KC 1KX3B 4WU9D 1P3GA 2Y2JA 3AZGC 5B24C 1TZYB 1P34A 1P3IB 5CPIA 3B0DB 5CPKD 4YS3D 2LY8A 5AVBB 2FJ7A 4QLCC 2Y2PA 2YFVB 3W96A 4J8VA
chains in the Genus database with same CATH topology
3W97C 2CV5D 3P5JB 4KGCC 1P3LB 5CPKB 4YS3B 3IP4C 1M18B 3LZ1C 3AZIC 1W2EA 2CV5B 3LZ0D 4KUDA 3AV1A 5G49B 4H9QA 3AZJD 5FUGA 3AV2B 5B33C 1T3UA 2BYKA 4LD9D 3KXBC 5AV9C 3AYWA 1KX5C 4KHAA 3WTPE 3LZ0B 1P3PC 3AZGA 5AV5C 5B24A 5GT0D 3EPLA 1EQZC 1B67A 5B31C 4LD9B 3RELC 3X1TC 1BH8B 5C3IB 3AZMC 3B6GD 5B1LC 5B0ZD 3AFAC 3W97A 5GT0B 3W98B 4KGCA 2YFWA 4H9NA 3MGRB 2AROA 3LZ1A 3B6GB 3AZIA 5B0ZB 5CPJD 4WNNA 4Z5TC 2NQBD 3MNNC 4R8PC 2RVQD 3WA9D 4H9OA 3UTAD 5B33A 4H9PB 4WU8D 2Y2IA 4EO5B 4Z66D 3TU4C 2NQBB 3UT9D 1KX5A 3NQJB 2F8ND 3AZFC 3WA9B 1P3PA 3C1CC 4WV4B 3UTAB 5AV5A 3B6FD 5BO0B 3A6NC 4WU8B 1EQZA 5B31A 3NQUB 3UT9B 2F8NB 5GT3D 3AZMA 3AZNA 4X23C 3AFAA 3VH6W 1AOIC 3B6FB 5B2IC 1P3OB 5AVBA 3WTPA 1M1AC 3AZLC 4CAYA 3WAAD 4J8UC 3EPKA 5GT3B 3REKC 1P3LA 2HUEC 4Z5TA 5B2JD 3MNNA 4R8PA 1P3FC 4UPKA 2Y2LA 2Y2QA 1Q9CA 1N1JA 5B1MC 4YM6D 4J8WD 4J8XC 3WAAB 2HIOA 4XZQD 2PYOA 2ZY2A 4ZBJC 5CP6D 3KFUG 1U35C 4Z2MH 5B2JB 4E44A 5B0YD 3X1VA 1HQ3C 1HTAA 2XD5A 3F6TA 3REHD 1P3GC 4DRAA 4YM6B 5GXQD 4J8WB 4XZQB 1P34C 5CPIC 5DNND 3LELA 4XUJA 1P3KD 3KUYA 5B40C 3UTBD 3REHB 4X23A 3C1BA 4J8VC 4H9SC 5GXQB 1AOIA 2IO5B 5B2IA 2ZM5A 1S32D 1F66D 1M19C 3MGSD 5DNNB 3MVDB 2XD1A 5B32C 4QLCD 3MGQC 1M1AA 2NZDD 1JFIB 4J8UA 4G92C 3W98A 3REKA 3W97D 2J8PA 3UTBB 5BNVB 3EPHA 3AZEC 4KGCD 2ZY5A 3MGRA 1S32B 1F66B 4KUDC 3MGSB 1P3AA 5B1MA 4QLCB 2NZDB 3MGPC 4J8XA 1U35A 1KX4D 3KXBD 3WKJA 5AV9D 2G5HC 4CSRB 1KX4B 5KDMA 5B40A 5BNXB 3H0MC 3V9RA 4H9SA 3B0CW 3RELD 5JRGD 3X1TD 3KXBB 5AV9B 3AZKC 1M19A 5AY8A 5B32A 3MGQA 5B1LD 2AROC 4H9RA 3B0CT 1WWSA 3REID 3X1SA 3O62D 3AZEA 3RELB 5JRGB 3AN2A 5B1LB 3MGPA 3AZHD 4R8PD 3REIB 5DNMA 3O62B 5AV6D 4HGAC 4DRBA 1ID3D 5BS7C 5F99D 3AZJB 3REJC 3TU4D 2JE5A 3AZHB 1KX3C 3AZFD 5AV6B 3C1CD 1ID3B 1TZYC 3EG5B 2G5IC 5F99B 1P3IC 3AZNC 3LJAA 3B0DC 3A6ND 5GSUD 3TU4B 3AZKA 5AVBC 3WTPC 3VH6A 2JSSA 4WU9C 3AZFB 5JA4A 1R4VA 3C1CB 1BH9A 1P3LC 5AV8D 3A6NB 5GSUB 3A1IA 4YS3C 1P3MD 3AZLD 1TAFB 5AVCA 1M18C 2RIQA 4J8UD 5E5AA 1H3OB 2F8NK 2HIOC 2PYOC 5CPJB 1P3FD 4JJNA 5AV8B 1P3MB 5BS7A 3X1UD 3X1VC 3AZLB 3R45A 3AV2C 4ZUXD 4UUZA 3W99D 2F2AC 3REJA 1ZLAD 1U35D 3KWQA 1P3BA 1HQ3D 2ZY4A 4Z66B 4XUJC 2BYMB 3LELC 1P3FB 3KUYC 1KX3A 1P3GD 1TZYA 3X1UB 1P3IA 1P34D 4ZUXB 3C1BC 4LD9C 5BT1C 5CPID 3W99B 1ZLAB 5C3IC 1HQ3B 2YFVA 2FJ7D 4WU9A 1P3GB 5GT0C 4J8VD 3W96D 3W98C 3VH6T 4AWLC 4NFTA 1P34B 5CPKA 4YS3A 3MGRC 1M18A 4NE5A 1P3AC 2FJ7B 5B0ZC 3W96B 3A1KA 1A7WA 4J8VB 2CV5A 1WWIA 5G49A 4KUDD 3AV1D 2VQRA 2F8NG 3AV2A 4G91C 4G92B 3FDDA 4EO5C 3B0BA 3WKJC 3AYWD 3LZ0A 5CP6B 3AZJA 3AV1B 5B0YB 4H9QB 3AZGD 5B24D 5FUGB 1ULYA 4WU8C 1Z2CB 4LD9A 2BYKB 1BH8A 2Y2MA 3UT9C 4M6BA 4NE3A 3AYWB 4KHAB 5AY8C 1P3KB 5GT0A 3B6FC 3AZGB 1P3OC 5B24B 3X1SC 3AN2C 2AROD 5GT3C 3B6GA 5B0ZA 3LZ1D 3AZID 3W97B 1TAFA 5DNMC 4KGCB 1H3OA 2YFWB 3WAAC 4H9PA 5B33D 5CPJA 3LZ1B 3AZIB 2NQBA 5B2JC 4WNNB 3NQJA 1KX5D 3WA9A 3UTAA 4YM6C 1P3PD 4H9OB 5BO0A 5AV5D 4XZQC 5B33B 4WU8A 3LJAC 4Z66A 1EQZD 3NQUA 5B31D 3UT9A 2F8NA 1KX5B 3AZMD 1P3ID 3AZND 5GXQC 1P3PB 2IO5C 3AFAD 1P3OA 5AV5B 3B6FA 3AL0C 5AVBD 3WTPD 3MVDC 1EQZB 5B31B 3X1TB 5AVCC 5GT3A 3UTBC 3AZMB 5E5AC 3AZNB 1P3LD 4Z5TD 3AFAB 3MNND 1S32C 1F66C 3MGSC 4JJNC 3WTPB 1M18D 3H0LC 2NZDC 2BG1A 3WAAA 4CAYB 2HIOD 2PYOD 5B2JA 4Z5TB 3KWQC 3MNNB 3X1VD 4R8PB 1P3BC 3KSYA 3AV2D 4YM6A 4WZSB 2JCHA 4J8WA 1N1JB 4XZQA 2HIOB 5CP6A 3LELD 4XUJD 1KX4C 5B31G 5B0YA 2PYOB 3KUYD 3X1VB 3REHA 5GXQA 4X23D 3C1BD 5BT1D 1AOID 5B2ID 4WJ3C 2FFFB 5DNNA 3MVDA 5CPKC 2DQNC 1P3KA 3LELB 4XUJB 1M1AD 1JFIA 3KUYB 3UTBA 5BNVA 3W98D 2CWEA 3REKD 4X23B 3C1BB 2CV5C 1AOIB 5JRGC 5B2IB 3MGRD 1S32A 1F66A 3MGSA 2Y2KA 3VH5A 4QLCA 1P3AD 2NZDA 1M1AB 5B1MD 4J8XD 4J8UB 3REIC 3REKB 3O62C 4AWLB 2HUEB 3LZ0C 3AZJC 1KU5A 1P3AB 5B1MB 4J8XB 3AZHC 3WKJD 4CSRA 4E45A 1KX4A 5AV6C 4ZBJB 1ID3C 1U35B 5BNXA 5B40D 5F99C 4Z2MG 4G91B 1F1EA 3KXBA 5AV9A 1PZRA 1BFMA 3WKJB 5CPIB 1M19D 3H0RC 5AY8D 5B32D 3MGQD 3EPJA 2Y2GA 2ZY3A 5KDMB 5B40B 2Y2NA 1P3OD 3B6GC 5GSUC 3X1SD 3V9RB 3VH5W 3AZED 3RELA 5JRGA 2W8SA 3X1TA 3AN2D 4NE6A 4DQYB 2Y2HA 1M19B 5B1LA 5AY8B 5B32B 3MGQB 3MGPD 3VH5T 4H9RB 3REIA 5CPJC 3O62A 5AV8C 2NQBC 5DNMD 3X1SB 1P3MC 3AZEB 1B6WA 2RVQC 3AN2B 3WA9C 3UTAC 4KUDB 3MGPB 2DF4C 3AZHA 4Z66C 5AV6A 5DNMB 1ID3A 3X1UC 2Y2OA 5F99A 4ZUXC 3LJAD 3W99C 1ZLAC 3TU4A 5CHLB 3AZKD 3AZFA 3C1CA 5B32G 3A6NA 5GSUA 3LJAB 3MVDD 3AZKB 5AVCD 2FJ7C 3W96C 4H9NB 5E5AD 2AROB 5JA4B 4WU9B 1BH9B 5AV8A 2F8NH 2L5AA 1P3MA 4JJND 3AZLA 5AVCB 4J8WC 5E5AB 3REJD 3KWQD 1P3FA 5CP6C 2BYMA 1P3BD 1KX3D 3AV1C 5B0YC 4JJNB 3X1UA 4HGAB 1TZYD 3REHC 3R45B 4ZUXA 3W99A 1ZLAA 4UUZB 3REJB 3AYWC 1HQ3A 5DNNC 3KWQB 2UWXA 1P3BB 1P3KC 1KX3B 4WU9D 1P3GA 2Y2JA 3AZGC 5B24C 1TZYB 1P34A 1P3IB 5CPIA 3B0DB 5CPKD 4YS3D 2LY8A 5AVBB 2FJ7A 4QLCC 2Y2PA 2YFVB 3W96A 4J8VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3W97 C;  2CV5 D;  4KGC C;  1P3L B;  5CPK B;  4YS3 B;  1M18 B;  3LZ1 C;  3AZI C;  2CV5 B;  3LZ0 D;  4KUD A;  3AV1 A;  5G49 B;  4H9Q A;  3AZJ D;  5FUG A;  3AV2 B;  5B33 C;  2BYK A;  4LD9 D;  3KXB C;  5AV9 C;  3AYW A;  1KX5 C;  4KHA A;  3WTP E;  3LZ0 B;  1P3P C;  3AZG A;  5AV5 C;  5B24 A;  5GT0 D;  1EQZ C;  1B67 A;  5B31 C;  4LD9 B;  3REL C;  3X1T C;  1BH8 B;  5C3I B;  3AZM C;  3B6G D;  5B1L C;  5B0Z D;  3AFA C;  3W97 A;  5GT0 B;  3W98 B;  4KGC A;  2YFW A;  4H9N A;  3MGR B;  2ARO A;  3LZ1 A;  3B6G B;  3AZI A;  5B0Z B;  5CPJ D;  4WNN A;  4Z5T C;  2NQB D;  3MNN C;  4R8P C;  2RVQ D;  3WA9 D;  4H9O A;  3UTA D;  5B33 A;  4H9P B;  4WU8 D;  4EO5 B;  4Z66 D;  3TU4 C;  2NQB B;  3UT9 D;  1KX5 A;  3NQJ B;  2F8N D;  3AZF C;  3WA9 B;  1P3P A;  3C1C C;  4WV4 B;  3UTA B;  5AV5 A;  3B6F D;  5BO0 B;  3A6N C;  4WU8 B;  1EQZ A;  5B31 A;  3NQU B;  3UT9 B;  2F8N B;  5GT3 D;  3AZM A;  3AZN A;  4X23 C;  3AFA A;  3VH6 W;  1AOI C;  3B6F B;  5B2I C;  1P3O B;  5AVB A;  3WTP A;  1M1A C;  3AZL C;  4CAY A;  3WAA D;  4J8U C;  5GT3 B;  3REK C;  1P3L A;  2HUE C;  4Z5T A;  5B2J D;  3MNN A;  4R8P A;  1P3F C;  4YM6 D;  1Q9C A;  1N1J A;  5B1M C;  4J8W D;  4J8X C;  3WAA B;  2HIO A;  4XZQ D;  2PYO A;  4ZBJ C;  5CP6 D;  1U35 C;  4Z2M H;  5B2J B;  4E44 A;  5B0Y D;  3X1V A;  1HQ3 C;  1HTA A;  3REH D;  1P3G C;  4DRA A;  4YM6 B;  5GXQ D;  4J8W B;  4XZQ B;  1P34 C;  5CPI C;  5DNN D;  3LEL A;  4XUJ A;  1P3K D;  3KUY A;  5B40 C;  3UTB D;  3REH B;  4X23 A;  3C1B A;  4J8V C;  4H9S C;  5GXQ B;  1AOI A;  2IO5 B;  5B2I A;  1S32 D;  1F66 D;  1M19 C;  3MGS D;  5DNN B;  3MVD B;  1M1A A;  5B32 C;  4QLC D;  3MGQ C;  2NZD D;  1JFI B;  4J8U A;  4G92 C;  3W98 A;  3REK A;  3W97 D;  3UTB B;  5BNV B;  3AZE C;  4KGC D;  3MGR A;  1S32 B;  1F66 B;  4KUD C;  3MGS B;  1P3A A;  5B1M A;  4QLC B;  2NZD B;  3MGP C;  4J8X A;  1U35 A;  1KX4 D;  3KXB D;  3WKJ A;  5AV9 D;  4CSR B;  1KX4 B;  5KDM A;  5B40 A;  5BNX B;  3V9R A;  4H9S A;  3B0C W;  3REL D;  5JRG D;  3X1T D;  3KXB B;  5AV9 B;  3AZK C;  1M19 A;  5AY8 A;  5B32 A;  3MGQ A;  5B1L D;  2ARO C;  4H9R A;  3B0C T;  1WWS A;  3REI D;  3X1S A;  3O62 D;  3AZE A;  3REL B;  5JRG B;  3AN2 A;  5B1L B;  3MGP A;  3AZH D;  4R8P D;  3REI B;  5DNM A;  3O62 B;  5AV6 D;  4HGA C;  4DRB A;  1ID3 D;  5BS7 C;  5F99 D;  3AZJ B;  3REJ C;  3TU4 D;  3AZH B;  1KX3 C;  3AZF D;  5AV6 B;  3C1C D;  1ID3 B;  1TZY C;  5F99 B;  1P3I C;  3AZN C;  3LJA A;  3B0D C;  3A6N D;  5GSU D;  3TU4 B;  3AZK A;  5AVB C;  3WTP C;  3VH6 A;  2JSS A;  4WU9 C;  3AZF B;  5JA4 A;  1R4V A;  3C1C B;  1BH9 A;  1P3L C;  5AV8 D;  3A6N B;  5GSU B;  4YS3 C;  1P3M D;  3AZL D;  1TAF B;  5AVC A;  1M18 C;  4J8U D;  5E5A A;  1H3O B;  2F8N K;  2HIO C;  2PYO C;  5CPJ B;  1P3F D;  4JJN A;  5AV8 B;  1P3M B;  5BS7 A;  3X1U D;  3X1V C;  3AZL B;  3R45 A;  3AV2 C;  4ZUX D;  4UUZ A;  3W99 D;  3REJ A;  1ZLA D;  1U35 D;  3KWQ A;  1P3B A;  1HQ3 D;  3LEL C;  4Z66 B;  4XUJ C;  2BYM B;  1P3F B;  1KX3 A;  3KUY C;  1P3G D;  1TZY A;  3X1U B;  1P3I A;  1P34 D;  4ZUX B;  3C1B C;  4LD9 C;  5BT1 C;  5CPI D;  3W99 B;  1ZLA B;  5C3I C;  1HQ3 B;  2YFV A;  2FJ7 D;  4WU9 A;  1P3G B;  5GT0 C;  4J8V D;  3W96 D;  3W98 C;  3VH6 T;  4AWL C;  4NFT A;  1P34 B;  5CPK A;  4YS3 A;  3MGR C;  1M18 A;  4NE5 A;  1P3A C;  2FJ7 B;  5B0Z C;  3W96 B;  4J8V B;  1A7W A;  2CV5 A;  1WWI A;  5G49 A;  4KUD D;  3AV1 D;  2F8N G;  3AV2 A;  4G91 C;  4G92 B;  4EO5 C;  3B0B A;  3WKJ C;  3AYW D;  3LZ0 A;  5CP6 B;  3AZJ A;  3AV1 B;  5B0Y B;  4H9Q B;  3AZG D;  5B24 D;  5FUG B;  1ULY A;  4WU8 C;  4LD9 A;  2BYK B;  1BH8 A;  3UT9 C;  4M6B A;  4NE3 A;  3AYW B;  4KHA B;  5AY8 C;  1P3K B;  5GT0 A;  3B6F C;  3AZG B;  1P3O C;  5B24 B;  3X1S C;  3AN2 C;  2ARO D;  5GT3 C;  3B6G A;  5B0Z A;  3LZ1 D;  3AZI D;  3W97 B;  1TAF A;  5DNM C;  4KGC B;  1H3O A;  2YFW B;  3WAA C;  4H9P A;  5B33 D;  5CPJ A;  3LZ1 B;  3AZI B;  2NQB A;  5B2J C;  4WNN B;  3NQJ A;  1KX5 D;  3WA9 A;  3UTA A;  4YM6 C;  1P3P D;  4H9O B;  5BO0 A;  5AV5 D;  4XZQ C;  5B33 B;  4WU8 A;  3LJA C;  4Z66 A;  1EQZ D;  3NQU A;  5B31 D;  3UT9 A;  2F8N A;  1KX5 B;  3AZM D;  1P3I D;  3AZN D;  5GXQ C;  1P3P B;  2IO5 C;  3AFA D;  1P3O A;  5AV5 B;  3B6F A;  5AVB D;  3WTP D;  3MVD C;  1EQZ B;  5B31 B;  3X1T B;  5AVC C;  5GT3 A;  3UTB C;  3AZM B;  5E5A C;  3AZN B;  1P3L D;  4Z5T D;  3AFA B;  3MNN D;  1S32 C;  1F66 C;  3MGS C;  4JJN C;  3WTP B;  1M18 D;  2NZD C;  3WAA A;  4CAY B;  2HIO D;  2PYO D;  5B2J A;  4Z5T B;  3KWQ C;  3MNN B;  3X1V D;  4R8P B;  1P3B C;  3KSY A;  3AV2 D;  4YM6 A;  4WZS B;  4J8W A;  1N1J B;  4XZQ A;  2HIO B;  5CP6 A;  3LEL D;  4XUJ D;  1KX4 C;  5B31 G;  5B0Y A;  2PYO B;  3KUY D;  3X1V B;  3REH A;  5GXQ A;  4X23 D;  3C1B D;  5BT1 D;  1AOI D;  5B2I D;  5DNN A;  3MVD A;  5CPK C;  1P3K A;  3LEL B;  4XUJ B;  1M1A D;  1JFI A;  3KUY B;  3UTB A;  5BNV A;  3W98 D;  2CWE A;  3REK D;  4X23 B;  3C1B B;  2CV5 C;  1AOI B;  5JRG C;  5B2I B;  3MGR D;  1S32 A;  1F66 A;  3MGS A;  3VH5 A;  4QLC A;  1P3A D;  2NZD A;  1M1A B;  5B1M D;  4J8X D;  4J8U B;  3REI C;  3REK B;  3O62 C;  4AWL B;  2HUE B;  3LZ0 C;  3AZJ C;  1KU5 A;  1P3A B;  5B1M B;  4J8X B;  3AZH C;  3WKJ D;  4CSR A;  4E45 A;  1KX4 A;  5AV6 C;  4ZBJ B;  1ID3 C;  1U35 B;  5BNX A;  5B40 D;  5F99 C;  4Z2M G;  4G91 B;  1F1E A;  3KXB A;  5AV9 A;  1BFM A;  3WKJ B;  5CPI B;  1M19 D;  5AY8 D;  5B32 D;  3MGQ D;  5KDM B;  3B6G C;  5B40 B;  1P3O D;  5GSU C;  3X1S D;  3V9R B;  3VH5 W;  3AZE D;  3REL A;  5JRG A;  3X1T A;  3AN2 D;  4NE6 A;  1M19 B;  5B1L A;  5AY8 B;  5B32 B;  3MGQ B;  3MGP D;  3VH5 T;  4H9R B;  3REI A;  5CPJ C;  3O62 A;  5AV8 C;  2NQB C;  5DNM D;  3X1S B;  1P3M C;  3AZE B;  1B6W A;  2RVQ C;  3AN2 B;  3WA9 C;  3UTA C;  4KUD B;  3MGP B;  3AZH A;  4Z66 C;  5AV6 A;  5DNM B;  1ID3 A;  3X1U C;  5F99 A;  4ZUX C;  3LJA D;  3W99 C;  1ZLA C;  3TU4 A;  5CHL B;  3AZK D;  3AZF A;  3C1C A;  5B32 G;  3A6N A;  5GSU A;  3LJA B;  3MVD D;  3AZK B;  5AVC D;  2FJ7 C;  3W96 C;  4H9N B;  5E5A D;  2ARO B;  5JA4 B;  4WU9 B;  1BH9 B;  5AV8 A;  2F8N H;  2L5A A;  1P3M A;  4JJN D;  3AZL A;  5AVC B;  4J8W C;  5E5A B;  3REJ D;  3KWQ D;  1P3F A;  5CP6 C;  2BYM A;  1P3B D;  1KX3 D;  3AV1 C;  5B0Y C;  4JJN B;  3X1U A;  4HGA B;  1TZY D;  3REH C;  3R45 B;  4ZUX A;  3W99 A;  1ZLA A;  4UUZ B;  3REJ B;  3AYW C;  1HQ3 A;  5DNN C;  3KWQ B;  1P3B B;  1P3K C;  1KX3 B;  4WU9 D;  1P3G A;  3AZG C;  5B24 C;  1TZY B;  1P34 A;  1P3I B;  5CPI A;  3B0D B;  5CPK D;  4YS3 D;  2LY8 A;  5AVB B;  2FJ7 A;  4QLC C;  2YFV B;  3W96 A;  4J8V A; 
#chains in the Genus database with same CATH topology
 3W97 C;  2CV5 D;  3P5J B;  4KGC C;  1P3L B;  5CPK B;  4YS3 B;  3IP4 C;  1M18 B;  3LZ1 C;  3AZI C;  1W2E A;  2CV5 B;  3LZ0 D;  4KUD A;  3AV1 A;  5G49 B;  4H9Q A;  3AZJ D;  5FUG A;  3AV2 B;  5B33 C;  1T3U A;  2BYK A;  4LD9 D;  3KXB C;  5AV9 C;  3AYW A;  1KX5 C;  4KHA A;  3WTP E;  3LZ0 B;  1P3P C;  3AZG A;  5AV5 C;  5B24 A;  5GT0 D;  3EPL A;  1EQZ C;  1B67 A;  5B31 C;  4LD9 B;  3REL C;  3X1T C;  1BH8 B;  5C3I B;  3AZM C;  3B6G D;  5B1L C;  5B0Z D;  3AFA C;  3W97 A;  5GT0 B;  3W98 B;  4KGC A;  2YFW A;  4H9N A;  3MGR B;  2ARO A;  3LZ1 A;  3B6G B;  3AZI A;  5B0Z B;  5CPJ D;  4WNN A;  4Z5T C;  2NQB D;  3MNN C;  4R8P C;  2RVQ D;  3WA9 D;  4H9O A;  3UTA D;  5B33 A;  4H9P B;  4WU8 D;  2Y2I A;  4EO5 B;  4Z66 D;  3TU4 C;  2NQB B;  3UT9 D;  1KX5 A;  3NQJ B;  2F8N D;  3AZF C;  3WA9 B;  1P3P A;  3C1C C;  4WV4 B;  3UTA B;  5AV5 A;  3B6F D;  5BO0 B;  3A6N C;  4WU8 B;  1EQZ A;  5B31 A;  3NQU B;  3UT9 B;  2F8N B;  5GT3 D;  3AZM A;  3AZN A;  4X23 C;  3AFA A;  3VH6 W;  1AOI C;  3B6F B;  5B2I C;  1P3O B;  5AVB A;  3WTP A;  1M1A C;  3AZL C;  4CAY A;  3WAA D;  4J8U C;  3EPK A;  5GT3 B;  3REK C;  1P3L A;  2HUE C;  4Z5T A;  5B2J D;  3MNN A;  4R8P A;  1P3F C;  4UPK A;  2Y2L A;  2Y2Q A;  1Q9C A;  1N1J A;  5B1M C;  4YM6 D;  4J8W D;  4J8X C;  3WAA B;  2HIO A;  4XZQ D;  2PYO A;  2ZY2 A;  4ZBJ C;  5CP6 D;  3KFU G;  1U35 C;  4Z2M H;  5B2J B;  4E44 A;  5B0Y D;  3X1V A;  1HQ3 C;  1HTA A;  2XD5 A;  3F6T A;  3REH D;  1P3G C;  4DRA A;  4YM6 B;  5GXQ D;  4J8W B;  4XZQ B;  1P34 C;  5CPI C;  5DNN D;  3LEL A;  4XUJ A;  1P3K D;  3KUY A;  5B40 C;  3UTB D;  3REH B;  4X23 A;  3C1B A;  4J8V C;  4H9S C;  5GXQ B;  1AOI A;  2IO5 B;  5B2I A;  2ZM5 A;  1S32 D;  1F66 D;  1M19 C;  3MGS D;  5DNN B;  3MVD B;  2XD1 A;  5B32 C;  4QLC D;  3MGQ C;  1M1A A;  2NZD D;  1JFI B;  4J8U A;  4G92 C;  3W98 A;  3REK A;  3W97 D;  2J8P A;  3UTB B;  5BNV B;  3EPH A;  3AZE C;  4KGC D;  2ZY5 A;  3MGR A;  1S32 B;  1F66 B;  4KUD C;  3MGS B;  1P3A A;  5B1M A;  4QLC B;  2NZD B;  3MGP C;  4J8X A;  1U35 A;  1KX4 D;  3KXB D;  3WKJ A;  5AV9 D;  2G5H C;  4CSR B;  1KX4 B;  5KDM A;  5B40 A;  5BNX B;  3H0M C;  3V9R A;  4H9S A;  3B0C W;  3REL D;  5JRG D;  3X1T D;  3KXB B;  5AV9 B;  3AZK C;  1M19 A;  5AY8 A;  5B32 A;  3MGQ A;  5B1L D;  2ARO C;  4H9R A;  3B0C T;  1WWS A;  3REI D;  3X1S A;  3O62 D;  3AZE A;  3REL B;  5JRG B;  3AN2 A;  5B1L B;  3MGP A;  3AZH D;  4R8P D;  3REI B;  5DNM A;  3O62 B;  5AV6 D;  4HGA C;  4DRB A;  1ID3 D;  5BS7 C;  5F99 D;  3AZJ B;  3REJ C;  3TU4 D;  2JE5 A;  3AZH B;  1KX3 C;  3AZF D;  5AV6 B;  3C1C D;  1ID3 B;  1TZY C;  3EG5 B;  2G5I C;  5F99 B;  1P3I C;  3AZN C;  3LJA A;  3B0D C;  3A6N D;  5GSU D;  3TU4 B;  3AZK A;  5AVB C;  3WTP C;  3VH6 A;  2JSS A;  4WU9 C;  3AZF B;  5JA4 A;  1R4V A;  3C1C B;  1BH9 A;  1P3L C;  5AV8 D;  3A6N B;  5GSU B;  3A1I A;  4YS3 C;  1P3M D;  3AZL D;  1TAF B;  5AVC A;  1M18 C;  2RIQ A;  4J8U D;  5E5A A;  1H3O B;  2F8N K;  2HIO C;  2PYO C;  5CPJ B;  1P3F D;  4JJN A;  5AV8 B;  1P3M B;  5BS7 A;  3X1U D;  3X1V C;  3AZL B;  3R45 A;  3AV2 C;  4ZUX D;  4UUZ A;  3W99 D;  2F2A C;  3REJ A;  1ZLA D;  1U35 D;  3KWQ A;  1P3B A;  1HQ3 D;  2ZY4 A;  4Z66 B;  4XUJ C;  2BYM B;  3LEL C;  1P3F B;  3KUY C;  1KX3 A;  1P3G D;  1TZY A;  3X1U B;  1P3I A;  1P34 D;  4ZUX B;  3C1B C;  4LD9 C;  5BT1 C;  5CPI D;  3W99 B;  1ZLA B;  5C3I C;  1HQ3 B;  2YFV A;  2FJ7 D;  4WU9 A;  1P3G B;  5GT0 C;  4J8V D;  3W96 D;  3W98 C;  3VH6 T;  4AWL C;  4NFT A;  1P34 B;  5CPK A;  4YS3 A;  3MGR C;  1M18 A;  4NE5 A;  1P3A C;  2FJ7 B;  5B0Z C;  3W96 B;  3A1K A;  1A7W A;  4J8V B;  2CV5 A;  1WWI A;  5G49 A;  4KUD D;  3AV1 D;  2VQR A;  2F8N G;  3AV2 A;  4G91 C;  4G92 B;  3FDD A;  4EO5 C;  3B0B A;  3WKJ C;  3AYW D;  3LZ0 A;  5CP6 B;  3AZJ A;  3AV1 B;  5B0Y B;  4H9Q B;  3AZG D;  5B24 D;  5FUG B;  1ULY A;  4WU8 C;  1Z2C B;  4LD9 A;  2BYK B;  1BH8 A;  2Y2M A;  3UT9 C;  4M6B A;  4NE3 A;  3AYW B;  4KHA B;  5AY8 C;  1P3K B;  5GT0 A;  3B6F C;  3AZG B;  1P3O C;  5B24 B;  3X1S C;  3AN2 C;  2ARO D;  5GT3 C;  3B6G A;  5B0Z A;  3LZ1 D;  3AZI D;  3W97 B;  1TAF A;  5DNM C;  4KGC B;  1H3O A;  2YFW B;  3WAA C;  4H9P A;  5B33 D;  5CPJ A;  3LZ1 B;  3AZI B;  2NQB A;  5B2J C;  4WNN B;  3NQJ A;  1KX5 D;  3WA9 A;  3UTA A;  4YM6 C;  1P3P D;  4H9O B;  5BO0 A;  5AV5 D;  4XZQ C;  5B33 B;  4WU8 A;  3LJA C;  4Z66 A;  1EQZ D;  3NQU A;  5B31 D;  3UT9 A;  2F8N A;  1KX5 B;  3AZM D;  1P3I D;  3AZN D;  5GXQ C;  1P3P B;  2IO5 C;  3AFA D;  1P3O A;  5AV5 B;  3B6F A;  3AL0 C;  5AVB D;  3WTP D;  3MVD C;  1EQZ B;  5B31 B;  3X1T B;  5AVC C;  5GT3 A;  3UTB C;  3AZM B;  5E5A C;  3AZN B;  1P3L D;  4Z5T D;  3AFA B;  3MNN D;  1S32 C;  1F66 C;  3MGS C;  4JJN C;  3WTP B;  1M18 D;  3H0L C;  2NZD C;  2BG1 A;  3WAA A;  4CAY B;  2HIO D;  2PYO D;  5B2J A;  4Z5T B;  3KWQ C;  3MNN B;  3X1V D;  4R8P B;  1P3B C;  3KSY A;  3AV2 D;  4YM6 A;  4WZS B;  2JCH A;  4J8W A;  1N1J B;  4XZQ A;  2HIO B;  5CP6 A;  3LEL D;  4XUJ D;  1KX4 C;  5B31 G;  5B0Y A;  2PYO B;  3KUY D;  3X1V B;  3REH A;  5GXQ A;  4X23 D;  3C1B D;  5BT1 D;  1AOI D;  5B2I D;  4WJ3 C;  2FFF B;  5DNN A;  3MVD A;  5CPK C;  2DQN C;  1P3K A;  3LEL B;  4XUJ B;  1M1A D;  1JFI A;  3KUY B;  3UTB A;  5BNV A;  3W98 D;  2CWE A;  3REK D;  4X23 B;  3C1B B;  2CV5 C;  1AOI B;  5JRG C;  5B2I B;  3MGR D;  1S32 A;  1F66 A;  3MGS A;  2Y2K A;  3VH5 A;  4QLC A;  1P3A D;  2NZD A;  1M1A B;  5B1M D;  4J8X D;  4J8U B;  3REI C;  3REK B;  3O62 C;  4AWL B;  2HUE B;  3LZ0 C;  3AZJ C;  1KU5 A;  1P3A B;  5B1M B;  4J8X B;  3AZH C;  3WKJ D;  4CSR A;  4E45 A;  1KX4 A;  5AV6 C;  4ZBJ B;  1ID3 C;  1U35 B;  5BNX A;  5B40 D;  5F99 C;  4Z2M G;  4G91 B;  1F1E A;  3KXB A;  5AV9 A;  1PZR A;  1BFM A;  3WKJ B;  5CPI B;  1M19 D;  3H0R C;  5AY8 D;  5B32 D;  3MGQ D;  3EPJ A;  2Y2G A;  2ZY3 A;  5KDM B;  5B40 B;  2Y2N A;  1P3O D;  3B6G C;  5GSU C;  3X1S D;  3V9R B;  3VH5 W;  3AZE D;  3REL A;  5JRG A;  2W8S A;  3X1T A;  3AN2 D;  4NE6 A;  4DQY B;  2Y2H A;  1M19 B;  5B1L A;  5AY8 B;  5B32 B;  3MGQ B;  3MGP D;  3VH5 T;  4H9R B;  3REI A;  5CPJ C;  3O62 A;  5AV8 C;  2NQB C;  5DNM D;  3X1S B;  1P3M C;  3AZE B;  1B6W A;  2RVQ C;  3AN2 B;  3WA9 C;  3UTA C;  4KUD B;  3MGP B;  2DF4 C;  3AZH A;  4Z66 C;  5AV6 A;  5DNM B;  1ID3 A;  3X1U C;  2Y2O A;  5F99 A;  4ZUX C;  3LJA D;  3W99 C;  1ZLA C;  3TU4 A;  5CHL B;  3AZK D;  3AZF A;  3C1C A;  5B32 G;  3A6N A;  5GSU A;  3LJA B;  3MVD D;  3AZK B;  5AVC D;  2FJ7 C;  3W96 C;  4H9N B;  5E5A D;  2ARO B;  5JA4 B;  4WU9 B;  1BH9 B;  5AV8 A;  2F8N H;  2L5A A;  1P3M A;  4JJN D;  3AZL A;  5AVC B;  4J8W C;  5E5A B;  3REJ D;  3KWQ D;  1P3F A;  5CP6 C;  2BYM A;  1P3B D;  1KX3 D;  3AV1 C;  5B0Y C;  4JJN B;  3X1U A;  4HGA B;  1TZY D;  3REH C;  3R45 B;  4ZUX A;  3W99 A;  1ZLA A;  4UUZ B;  3REJ B;  3AYW C;  1HQ3 A;  5DNN C;  3KWQ B;  2UWX A;  1P3B B;  1P3K C;  1KX3 B;  4WU9 D;  1P3G A;  2Y2J A;  3AZG C;  5B24 C;  1TZY B;  1P34 A;  1P3I B;  5CPI A;  3B0D B;  5CPK D;  4YS3 D;  2LY8 A;  5AVB B;  2FJ7 A;  4QLC C;  2Y2P A;  2YFV B;  3W96 A;  4J8V A; 
#chains in the Genus database with same CATH homology
 3W97 C;  2CV5 D;  3P5J B;  4KGC C;  1P3L B;  5CPK B;  4YS3 B;  3IP4 C;  1M18 B;  3LZ1 C;  3AZI C;  1W2E A;  2CV5 B;  3LZ0 D;  4KUD A;  3AV1 A;  5G49 B;  4H9Q A;  3AZJ D;  5FUG A;  3AV2 B;  5B33 C;  1T3U A;  2BYK A;  4LD9 D;  3KXB C;  5AV9 C;  3AYW A;  1KX5 C;  4KHA A;  3WTP E;  3LZ0 B;  1P3P C;  3AZG A;  5AV5 C;  5B24 A;  5GT0 D;  3EPL A;  1EQZ C;  1B67 A;  5B31 C;  4LD9 B;  3REL C;  3X1T C;  1BH8 B;  5C3I B;  3AZM C;  3B6G D;  5B1L C;  5B0Z D;  3AFA C;  3W97 A;  5GT0 B;  3W98 B;  4KGC A;  2YFW A;  4H9N A;  3MGR B;  2ARO A;  3LZ1 A;  3B6G B;  3AZI A;  5B0Z B;  5CPJ D;  4WNN A;  4Z5T C;  2NQB D;  3MNN C;  4R8P C;  2RVQ D;  3WA9 D;  4H9O A;  3UTA D;  5B33 A;  4H9P B;  4WU8 D;  2Y2I A;  4EO5 B;  4Z66 D;  3TU4 C;  2NQB B;  3UT9 D;  1KX5 A;  3NQJ B;  2F8N D;  3AZF C;  3WA9 B;  1P3P A;  3C1C C;  4WV4 B;  3UTA B;  5AV5 A;  3B6F D;  5BO0 B;  3A6N C;  4WU8 B;  1EQZ A;  5B31 A;  3NQU B;  3UT9 B;  2F8N B;  5GT3 D;  3AZM A;  3AZN A;  4X23 C;  3AFA A;  3VH6 W;  1AOI C;  3B6F B;  5B2I C;  1P3O B;  5AVB A;  3WTP A;  1M1A C;  3AZL C;  4CAY A;  3WAA D;  4J8U C;  3EPK A;  5GT3 B;  3REK C;  1P3L A;  2HUE C;  4Z5T A;  5B2J D;  3MNN A;  4R8P A;  1P3F C;  4UPK A;  2Y2L A;  2Y2Q A;  1Q9C A;  1N1J A;  5B1M C;  4YM6 D;  4J8W D;  4J8X C;  3WAA B;  2HIO A;  4XZQ D;  2PYO A;  2ZY2 A;  4ZBJ C;  5CP6 D;  3KFU G;  1U35 C;  4Z2M H;  5B2J B;  4E44 A;  5B0Y D;  3X1V A;  1HQ3 C;  1HTA A;  2XD5 A;  3F6T A;  3REH D;  1P3G C;  4DRA A;  4YM6 B;  5GXQ D;  4J8W B;  4XZQ B;  1P34 C;  5CPI C;  5DNN D;  3LEL A;  4XUJ A;  1P3K D;  3KUY A;  5B40 C;  3UTB D;  3REH B;  4X23 A;  3C1B A;  4J8V C;  4H9S C;  5GXQ B;  1AOI A;  2IO5 B;  5B2I A;  2ZM5 A;  1S32 D;  1F66 D;  1M19 C;  3MGS D;  5DNN B;  3MVD B;  2XD1 A;  5B32 C;  4QLC D;  3MGQ C;  1M1A A;  2NZD D;  1JFI B;  4J8U A;  4G92 C;  3W98 A;  3REK A;  3W97 D;  2J8P A;  3UTB B;  5BNV B;  3EPH A;  3AZE C;  4KGC D;  2ZY5 A;  3MGR A;  1S32 B;  1F66 B;  4KUD C;  3MGS B;  1P3A A;  5B1M A;  4QLC B;  2NZD B;  3MGP C;  4J8X A;  1U35 A;  1KX4 D;  3KXB D;  3WKJ A;  5AV9 D;  2G5H C;  4CSR B;  1KX4 B;  5KDM A;  5B40 A;  5BNX B;  3H0M C;  3V9R A;  4H9S A;  3B0C W;  3REL D;  5JRG D;  3X1T D;  3KXB B;  5AV9 B;  3AZK C;  1M19 A;  5AY8 A;  5B32 A;  3MGQ A;  5B1L D;  2ARO C;  4H9R A;  3B0C T;  1WWS A;  3REI D;  3X1S A;  3O62 D;  3AZE A;  3REL B;  5JRG B;  3AN2 A;  5B1L B;  3MGP A;  3AZH D;  4R8P D;  3REI B;  5DNM A;  3O62 B;  5AV6 D;  4HGA C;  4DRB A;  1ID3 D;  5BS7 C;  5F99 D;  3AZJ B;  3REJ C;  3TU4 D;  2JE5 A;  3AZH B;  1KX3 C;  3AZF D;  5AV6 B;  3C1C D;  1ID3 B;  1TZY C;  3EG5 B;  2G5I C;  5F99 B;  1P3I C;  3AZN C;  3LJA A;  3B0D C;  3A6N D;  5GSU D;  3TU4 B;  3AZK A;  5AVB C;  3WTP C;  3VH6 A;  2JSS A;  4WU9 C;  3AZF B;  5JA4 A;  1R4V A;  3C1C B;  1BH9 A;  1P3L C;  5AV8 D;  3A6N B;  5GSU B;  3A1I A;  4YS3 C;  1P3M D;  3AZL D;  1TAF B;  5AVC A;  1M18 C;  2RIQ A;  4J8U D;  5E5A A;  1H3O B;  2F8N K;  2HIO C;  2PYO C;  5CPJ B;  1P3F D;  4JJN A;  5AV8 B;  1P3M B;  5BS7 A;  3X1U D;  3X1V C;  3AZL B;  3R45 A;  3AV2 C;  4ZUX D;  4UUZ A;  3W99 D;  2F2A C;  3REJ A;  1ZLA D;  1U35 D;  3KWQ A;  1P3B A;  1HQ3 D;  2ZY4 A;  4Z66 B;  4XUJ C;  2BYM B;  3LEL C;  1P3F B;  3KUY C;  1KX3 A;  1P3G D;  1TZY A;  3X1U B;  1P3I A;  1P34 D;  4ZUX B;  3C1B C;  4LD9 C;  5BT1 C;  5CPI D;  3W99 B;  1ZLA B;  5C3I C;  1HQ3 B;  2YFV A;  2FJ7 D;  4WU9 A;  1P3G B;  5GT0 C;  4J8V D;  3W96 D;  3W98 C;  3VH6 T;  4AWL C;  4NFT A;  1P34 B;  5CPK A;  4YS3 A;  3MGR C;  1M18 A;  4NE5 A;  1P3A C;  2FJ7 B;  5B0Z C;  3W96 B;  3A1K A;  1A7W A;  4J8V B;  2CV5 A;  1WWI A;  5G49 A;  4KUD D;  3AV1 D;  2VQR A;  2F8N G;  3AV2 A;  4G91 C;  4G92 B;  3FDD A;  4EO5 C;  3B0B A;  3WKJ C;  3AYW D;  3LZ0 A;  5CP6 B;  3AZJ A;  3AV1 B;  5B0Y B;  4H9Q B;  3AZG D;  5B24 D;  5FUG B;  1ULY A;  4WU8 C;  1Z2C B;  4LD9 A;  2BYK B;  1BH8 A;  2Y2M A;  3UT9 C;  4M6B A;  4NE3 A;  3AYW B;  4KHA B;  5AY8 C;  1P3K B;  5GT0 A;  3B6F C;  3AZG B;  1P3O C;  5B24 B;  3X1S C;  3AN2 C;  2ARO D;  5GT3 C;  3B6G A;  5B0Z A;  3LZ1 D;  3AZI D;  3W97 B;  1TAF A;  5DNM C;  4KGC B;  1H3O A;  2YFW B;  3WAA C;  4H9P A;  5B33 D;  5CPJ A;  3LZ1 B;  3AZI B;  2NQB A;  5B2J C;  4WNN B;  3NQJ A;  1KX5 D;  3WA9 A;  3UTA A;  4YM6 C;  1P3P D;  4H9O B;  5BO0 A;  5AV5 D;  4XZQ C;  5B33 B;  4WU8 A;  3LJA C;  4Z66 A;  1EQZ D;  3NQU A;  5B31 D;  3UT9 A;  2F8N A;  1KX5 B;  3AZM D;  1P3I D;  3AZN D;  5GXQ C;  1P3P B;  2IO5 C;  3AFA D;  1P3O A;  5AV5 B;  3B6F A;  3AL0 C;  5AVB D;  3WTP D;  3MVD C;  1EQZ B;  5B31 B;  3X1T B;  5AVC C;  5GT3 A;  3UTB C;  3AZM B;  5E5A C;  3AZN B;  1P3L D;  4Z5T D;  3AFA B;  3MNN D;  1S32 C;  1F66 C;  3MGS C;  4JJN C;  3WTP B;  1M18 D;  3H0L C;  2NZD C;  2BG1 A;  3WAA A;  4CAY B;  2HIO D;  2PYO D;  5B2J A;  4Z5T B;  3KWQ C;  3MNN B;  3X1V D;  4R8P B;  1P3B C;  3KSY A;  3AV2 D;  4YM6 A;  4WZS B;  2JCH A;  4J8W A;  1N1J B;  4XZQ A;  2HIO B;  5CP6 A;  3LEL D;  4XUJ D;  1KX4 C;  5B31 G;  5B0Y A;  2PYO B;  3KUY D;  3X1V B;  3REH A;  5GXQ A;  4X23 D;  3C1B D;  5BT1 D;  1AOI D;  5B2I D;  4WJ3 C;  2FFF B;  5DNN A;  3MVD A;  5CPK C;  2DQN C;  1P3K A;  3LEL B;  4XUJ B;  1M1A D;  1JFI A;  3KUY B;  3UTB A;  5BNV A;  3W98 D;  2CWE A;  3REK D;  4X23 B;  3C1B B;  2CV5 C;  1AOI B;  5JRG C;  5B2I B;  3MGR D;  1S32 A;  1F66 A;  3MGS A;  2Y2K A;  3VH5 A;  4QLC A;  1P3A D;  2NZD A;  1M1A B;  5B1M D;  4J8X D;  4J8U B;  3REI C;  3REK B;  3O62 C;  4AWL B;  2HUE B;  3LZ0 C;  3AZJ C;  1KU5 A;  1P3A B;  5B1M B;  4J8X B;  3AZH C;  3WKJ D;  4CSR A;  4E45 A;  1KX4 A;  5AV6 C;  4ZBJ B;  1ID3 C;  1U35 B;  5BNX A;  5B40 D;  5F99 C;  4Z2M G;  4G91 B;  1F1E A;  3KXB A;  5AV9 A;  1PZR A;  1BFM A;  3WKJ B;  5CPI B;  1M19 D;  3H0R C;  5AY8 D;  5B32 D;  3MGQ D;  3EPJ A;  2Y2G A;  2ZY3 A;  5KDM B;  5B40 B;  2Y2N A;  1P3O D;  3B6G C;  5GSU C;  3X1S D;  3V9R B;  3VH5 W;  3AZE D;  3REL A;  5JRG A;  2W8S A;  3X1T A;  3AN2 D;  4NE6 A;  4DQY B;  2Y2H A;  1M19 B;  5B1L A;  5AY8 B;  5B32 B;  3MGQ B;  3MGP D;  3VH5 T;  4H9R B;  3REI A;  5CPJ C;  3O62 A;  5AV8 C;  2NQB C;  5DNM D;  3X1S B;  1P3M C;  3AZE B;  1B6W A;  2RVQ C;  3AN2 B;  3WA9 C;  3UTA C;  4KUD B;  3MGP B;  2DF4 C;  3AZH A;  4Z66 C;  5AV6 A;  5DNM B;  1ID3 A;  3X1U C;  2Y2O A;  5F99 A;  4ZUX C;  3LJA D;  3W99 C;  1ZLA C;  3TU4 A;  5CHL B;  3AZK D;  3AZF A;  3C1C A;  5B32 G;  3A6N A;  5GSU A;  3LJA B;  3MVD D;  3AZK B;  5AVC D;  2FJ7 C;  3W96 C;  4H9N B;  5E5A D;  2ARO B;  5JA4 B;  4WU9 B;  1BH9 B;  5AV8 A;  2F8N H;  2L5A A;  1P3M A;  4JJN D;  3AZL A;  5AVC B;  4J8W C;  5E5A B;  3REJ D;  3KWQ D;  1P3F A;  5CP6 C;  2BYM A;  1P3B D;  1KX3 D;  3AV1 C;  5B0Y C;  4JJN B;  3X1U A;  4HGA B;  1TZY D;  3REH C;  3R45 B;  4ZUX A;  3W99 A;  1ZLA A;  4UUZ B;  3REJ B;  3AYW C;  1HQ3 A;  5DNN C;  3KWQ B;  2UWX A;  1P3B B;  1P3K C;  1KX3 B;  4WU9 D;  1P3G A;  2Y2J A;  3AZG C;  5B24 C;  1TZY B;  1P34 A;  1P3I B;  5CPI A;  3B0D B;  5CPK D;  4YS3 D;  2LY8 A;  5AVB B;  2FJ7 A;  4QLC C;  2Y2P A;  2YFV B;  3W96 A;  4J8V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...