3AV1A

The human nucleosome structure containing the histone variant h3.2
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
96
structure length
96
Chain Sequence
HRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords Histone H3.2
publication title Structures of human nucleosomes containing major histone H3 variants
pubmed doi rcsb
source organism Homo sapiens
total genus 31
structure length 96
sequence length 96
chains with identical sequence E
ec nomenclature
pdb deposition date 2011-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3av1A00
5DNMB 3WAAD 4Z66A 3KXBB 3MGQC 1KX4D 1P34D 3W97B 5CPKA 3X1VD 3W99B 3KUYD 3AZNB 4H9NB 5AY8B 4Z66D 3AV2C 3AZKA 5CPKD 3UT9C 3REHB 1BH9A 1P3PB 3A6NC 3TU4A 3B0DB 4EO5B 3AZKD 3LELB 4YS3A 2L5AA 5GT0A 3TU4D 3R45A 5CPJB 1P3GA 1ZLAA 2F8NH 4YM6B 5DNNA 4YS3D 3UTAB 3REKD 5GT0D 4CSRA 3REJA 5B0ZB 2AROA 1EQZB 4Z2MH 1P3GD 5C3IB 3W96A 1ZLAD 4H9OB 4J8WC 3UTBC 4QLCC 1P3LD 5DNND 1P3MC 3AYWB 3O62B 3B0DC 5BNVA 3REJD 2AROD 3NQJA 3MVDC 3LELC 3W96D 3AZJA 5B31C 5F99C 4CAYB 4Z5TB 3W98A 3WA9A 3AZJD 5B2JB 4UUZA 3KWQA 3UTAC 4WU9B 1KX3B 1ID3C 1EQZC 2PYOB 3W98D 2BYKB 3WA9D 3AZFA 3AZEA 4WV4B 4J8UB 3KWQD 3O62C 3AZLA 5JRGA 2F8NG 5B33C 3AZFD 3AZED 3AZLD 4Z5TC 4Z2MG 5GXQB 3X1TA 4WU8C 1BFMA 5JRGD 5DNMA 5AV9C 3LZ1B 1TZYB 3WTPB 5AV8A 3W99A 3AZNA 4WZSB 5B40A 4WU9C 5AY8A 3X1TD 1KX3C 4KHAB 5AVCB 5B32G 5DNMD 3LZ0B 5AV8D 2F8NB 4KGCB 5G49B 2NZDB 3AV1C 3W99D 3REHA 5AV6C 3AZND 1M19C 5B40D 3B6GB 5AY8D 5B2IA 1M18C 1P3PA 5CP6B 3LJAB 3X1UB 5B2ID 1P3PD 4H9QA 3WKJB 1P3FC 4YM6A 3AZHC 4HGAB 5B1LC 3LZ0C 2NZDC 5B0ZA 3AZMC 3B6GC 1AOIC 1WWSA 5B24A 3MGRA 3VH5A 5B0ZD 5JA4A 3B6FC 1HQ3B 1P3KD 4J8XC 5GT3A 3X1UC 3C1CC 4ZUXB 1U35C 5B24D 3MGRD 2YFVB 2CV5B 1S32B 3REIA 5BNXA 2YFWB 5GT3D 3C1BB 3VH6T 5B2JA 5CHLB 3REID 5E5AC 1A7WA 5B0YC 1P3AC 4J8UA 3RELA 3AZIB 4AWLC 2FJ7C 1B67A 1HQ3C 1M1AA 3X1VC 5GSUB 3KUYC 4JJNC 4J8UD 3KSYA 3RELD 4XUJA 5B1MB 3MGQB 2BYMB 3LZ1A 1M1AD 1TZYA 5CPIC 4XUJD 5AVBD 3AV2B 5AVCA 3LZ1D 3MGPA 3UT9B 1TZYD 2F8NA 4J8VB 3AZIC 5AVCD 3MGPD 2F8ND 3AN2C 3MNNA 3B0BA 3REKC 1Q9CA 5B1MC 2HIOB 5B32A 5B31G 1P3GC 3MNND 1P3LC 1KU5A 5DNNC 4XZQC 2AROC 5B32D 4J8WB 3UTBB 4QLCB 4H9RB 1P3MB 4J8VC 3MGSA 3AFAA 3MVDB 2NQBC 5B31B 5F99B 4ZUXA 3W98C 2HIOC 3MGSD 3AFAD 2CV5A 3WA9C 2LY8A 3X1SA 3C1BA 1ID3B 5KDMB 4ZUXD 2CV5D 1H3OB 3X1SD 3AZEC 3AZGA 2F8NK 3C1BD 5JRGC 5B33B 3AZGD 3NQUA 5GSUA 4WU8B 1N1JB 5AV9B 5AV8C 4KUDA 4LD9A 4X23B 5GSUD 1JFIA 1P3IA 3V9RB 1P3BC 1P3OC 4KUDD 3AV2A 4LD9D 3AV1B 1M19B 5AV6B 1P3ID 1M18B 5AV5A 3A6NA 1BH8A 3AV2D 5AV5D 3KXBA 3A6ND 3W97A 1KX5B 4X23C 4H9NA 1P3FB 3AZHB 5B1LB 3KXBD 3AZMB 3W97D 1P3KC 4J8WA 1AOIB 4QLCA 4H9RA 1P3MA 5BO0B 1F66B 3MGRC 3B6FB 3MVDA 3REHD 3LELA 4J8XB 5BS7A 5B31A 4J8WD 4QLCD 3C1CB 1P3MD 1U35B 5CPJA 1KX5C 3MVDD 3LELD 1TAFB 3UTAA 4R8PC 1EQZA 5CPJD 5E5AB 5B0YB 4H9OA 1P3AB 4YM6D 1F66C 3AYWA 3UTAD 3O62A 3WAAB 5FUGB 1EQZD 4AWLB 2FJ7B 1M1AC 3X1VB 4JJNB 3KUYB 2HUEC 3AYWD 4CAYA 3O62D 4Z5TA 3B0CT 4WU8A 4XUJC 5AVBC 1N1JA 4NE3A 5CPIB 4Z5TD 4WU9A 4WU8D 1KX3A 2PYOA 2BYKA 4ZBJB 3MGPC 3AZKB 4E45A 5B2JD 4M6BA 5AV6A 1F1EA 3WAAC 4WU9D 1KX3D 1KX4C 2PYOD 1P34C 3AN2B 4NFTA 3MNNC 4YS3B 1WWIA 5GXQA 3REKB 5GT0B 4Z66C 5CPKC 3WTPA 1P3GB 5B32C 1P3LB 5DNNB 4XZQB 1P3FA 5GXQD 5BT1D 3VH6A 4CSRB 4ZBJC 4KHAA 2AROB 4KGCA 5B1LA 3LZ0A 3AZKC 3WTPD 2NZDA 5G49A 3W96B 3B6GA 1P3FD 3TU4C 4KGCD 3MGSC 3LZ0D 3AFAC 1ULYA 2NQBB 2NZDD 5CP6A 3B6FA 4YS3C 3B6GD 4J8XA 3LJAA 3X1UA 5GT0C 3C1CA 3W98B 3B0CW 4H9SA 1U35A 3WA9B 1ZLAC 5CP6D 3B6FD 4J8XD 4UUZB 3VH6W 3LJAD 3X1UD 3KWQB 3WKJA 3C1CD 3REJC 1U35D 3W96C 3AZFB 4H9PB 3AZEB 3AZGC 3WKJD 3AZLB 5JRGB 4G91B 2FJ7A 3AZJC 1HQ3A 2IO5B 2RVQD 3KUYA 4JJNA 4G92C 2YFVA 5AV8B 1S32A 2FJ7D 4KUDC 4LD9C 1HQ3D 2YFWA 3KWQC 4JJND 5CPIA 5B40B 1P3IC 1P3BB 1P3OB 1S32D 3AZFC 3AZLC 5CPID 5B2IB 4DRBA 5AV5C 3AZIA 4G91C 1B6WA 2IO5C 3AN2A 4WNNB 3X1TC 5DNMC 5B1MA 3REKA 3KXBC 3MGQA 2BYMA 3AZID 3W97C 4H9QB 3W99C 3AZNC 3AN2D 5B40C 5AY8C 1P3LA 1HTAA 4XZQA 5B1MD 3MGQD 3UT9A 1P3KB 3REHC 5B2IC 4XZQD 4J8VA 1P3PC 5B24B 3MGRB 4EO5C 5JA4B 3UT9D 2NQBA 5BS7C 5GT3B 4J8VD 2HIOA 5CPJC 3REIB 5BNXB 2NQBD 4YM6C 4R8PB 5B0ZC 2HIOD 5C3IC 3UTBA 4H9PA 2CWEA 3AYWC 3RELB 5B24C 1M1AB 3UTBD 2HUEB 5GT3C 5F99A 4XUJB 5AVBB 2JSSA 3REIC 5B31D 1R4VA 5B2JC 5F99D 1ID3A 5KDMA 1P3BA 1P3OA 2PYOC 3MGPB 1H3OA 4J8UC 3RELC 4NE5A 1ID3D 1KX4B 1P3BD 3VH5T 1P34B 1P3OD 5B33A 3MNNB 4WNNA 4Z66B 5BT1C 5GXQC 5AV9A 3LZ1C 5CPKB 1TZYC 5B33D 5B32B 3WTPC 4X23A 3V9RA 5AV9D 5AVCC 4KGCC 3AV1A 1M19A 1BH9B 4X23D 1P3KA 1M18A 3TU4B 3MGSB 3AFAB 4E44A 5CP6C 3AV1D 1M19D 5AV6D 1M18D 3LJAC 3R45B 3WTPE 4H9SC 1ZLAB 3X1SB 1KX5A 3WKJC 3REJB 3AZHA 4HGAC 4R8PA 3AZMA 1KX5D 3AZGB 2RVQC 1AOIA 1F66A 5BNVB 5BO0A 3AZHD 5B1LD 3NQJB 4R8PD 3VH5W 3AZMD 3AZJB 3NQUB 1AOID 4G92B 1F66D 4ZUXC 4NE6A 5AVBA 2CV5C 1S32C 3X1SC 4KUDB 4LD9B 1JFIB 1P3IB 1TAFA 3C1BC 4DRAA 5E5AA 5B0YA 1P3AA 5AV5B 3WAAA 5FUGA 3A6NB 1BH8B 1KX4A 1P34A 5E5AD 3X1VA 5B0YD 5GSUC 1P3AD 3X1TB
chains in the Genus database with same CATH superfamily
5DNMB 3WAAD 4Z66A 3KXBB 3MGQC 1KX4D 1P34D 3W97B 5CPKA 3X1VD 3W99B 3KUYD 3AZNB 4H9NB 3H0RC 5AY8B 4Z66D 3AV2C 3AZKA 5CPKD 3UT9C 3REHB 2JCHA 1BH9A 1P3PB 3A6NC 3TU4A 3B0DB 4EO5B 3AZKD 3LELB 4YS3A 2L5AA 5GT0A 2ZM5A 3TU4D 3R45A 5CPJB 1P3GA 1ZLAA 2F8NH 4YM6B 5DNNA 4YS3D 3UTAB 3REKD 5GT0D 4CSRA 3REJA 5B0ZB 2AROA 1EQZB 4Z2MH 1P3GD 5C3IB 3W96A 1ZLAD 4H9OB 4J8WC 3UTBC 4QLCC 1P3LD 5DNND 1P3MC 3AYWB 3O62B 2Y2JA 3B0DC 5BNVA 3REJD 2AROD 2ZY5A 3NQJA 3MVDC 3LELC 3W96D 3AZJA 5B31C 5F99C 4CAYB 4Z5TB 3W98A 2JE5A 3WA9A 3AZJD 5B2JB 4UUZA 3KWQA 3UTAC 4WU9B 1KX3B 1ID3C 1EQZC 2PYOB 3W98D 2BYKB 3WA9D 3AZFA 2G5IC 3AZEA 4WV4B 4J8UB 3KWQD 3O62C 3AZLA 5JRGA 2F8NG 5B33C 3AZFD 3AZED 3AZLD 4Z5TC 4Z2MG 5GXQB 3X1TA 4WU8C 1BFMA 5JRGD 5DNMA 5AV9C 3LZ1B 1TZYB 3WTPB 5AV8A 3W99A 3AZNA 4WZSB 5B40A 4WU9C 5AY8A 3X1TD 1KX3C 4KHAB 5AVCB 5B32G 5DNMD 3LZ0B 5AV8D 2F8NB 4KGCB 5G49B 2NZDB 3AV1C 3W99D 3REHA 5AV6C 3AZND 1M19C 5B40D 3B6GB 5AY8D 5B2IA 1M18C 2W8SA 1P3PA 5CP6B 3LJAB 3X1UB 5B2ID 1P3PD 4H9QA 3WKJB 1P3FC 4YM6A 3AZHC 4HGAB 5B1LC 3LZ0C 2NZDC 5B0ZA 3AZMC 3B6GC 1AOIC 1WWSA 5B24A 3MGRA 3VH5A 5B0ZD 5JA4A 3B6FC 1HQ3B 1P3KD 4J8XC 5GT3A 3X1UC 3C1CC 4ZUXB 1U35C 5B24D 3MGRD 2YFVB 2XD5A 4WJ3C 2CV5B 1S32B 3REIA 5BNXA 2YFWB 5GT3D 3C1BB 3VH6T 5B2JA 5CHLB 3REID 5E5AC 1A7WA 5B0YC 1P3AC 1W2EA 4J8UA 3RELA 3AZIB 4AWLC 2FJ7C 1B67A 1HQ3C 1M1AA 3X1VC 5GSUB 3KUYC 4JJNC 4J8UD 3KSYA 3RELD 4XUJA 3EPKA 5B1MB 3MGQB 2BYMB 3LZ1A 1M1AD 1TZYA 5CPIC 4XUJD 5AVBD 3AV2B 5AVCA 3LZ1D 3MGPA 3UT9B 1TZYD 2F8NA 3A1KA 4J8VB 3AZIC 5AVCD 3MGPD 2F8ND 3AN2C 3MNNA 3B0BA 3REKC 1Q9CA 5B1MC 2HIOB 5B32A 5B31G 1P3GC 3MNND 1P3LC 1KU5A 5DNNC 4XZQC 2AROC 5B32D 4J8WB 3UTBB 4QLCB 4H9RB 1P3MB 4J8VC 3MGSA 3AFAA 3MVDB 2NQBC 5B31B 5F99B 4ZUXA 3W98C 2HIOC 3MGSD 3AFAD 2CV5A 3WA9C 2LY8A 3X1SA 3C1BA 1ID3B 2RIQA 5KDMB 4ZUXD 2CV5D 1H3OB 3X1SD 3AZEC 3EG5B 3AZGA 2F8NK 3C1BD 5JRGC 5B33B 3AZGD 3NQUA 5GSUA 4WU8B 1N1JB 5AV9B 5AV8C 4KUDA 4LD9A 4X23B 5GSUD 1JFIA 1P3IA 3V9RB 1P3BC 1P3OC 4KUDD 3AV2A 4LD9D 3AV1B 1M19B 5AV6B 1P3ID 1M18B 5AV5A 2Y2MA 3A6NA 1BH8A 2Y2OA 3AV2D 2Y2QA 5AV5D 3KXBA 2Y2PA 3FDDA 3A6ND 3W97A 1KX5B 4X23C 4H9NA 1P3FB 3EPJA 3AZHB 5B1LB 3KXBD 3AZMB 3W97D 1P3KC 4J8WA 1AOIB 4QLCA 4H9RA 1P3MA 5BO0B 1F66B 3MGRC 2Y2HA 3B6FB 3MVDA 3REHD 2Y2NA 3LELA 4J8XB 5BS7A 5B31A 4J8WD 4QLCD 3C1CB 1P3MD 1U35B 5CPJA 2Y2LA 1KX5C 3MVDD 3LELD 1TAFB 3UTAA 4R8PC 2DQNC 1EQZA 5CPJD 3KFUG 5E5AB 5B0YB 4H9OA 1P3AB 4YM6D 1F66C 3AYWA 3UTAD 4UPKA 3O62A 3WAAB 5FUGB 1EQZD 4AWLB 2FJ7B 2Y2KA 1M1AC 3X1VB 4JJNB 3KUYB 2HUEC 3AYWD 4CAYA 3O62D 4Z5TA 3B0CT 4WU8A 4XUJC 5AVBC 1N1JA 4NE3A 5CPIB 4Z5TD 4WU9A 4WU8D 1KX3A 2PYOA 2BYKA 4ZBJB 3MGPC 3AZKB 4E45A 5B2JD 4M6BA 5AV6A 1F1EA 3WAAC 4WU9D 1KX3D 1KX4C 2PYOD 1P34C 3AN2B 4NFTA 3A1IA 3MNNC 1WWIA 4YS3B 5GXQA 3REKB 5GT0B 4Z66C 2VQRA 3F6TA 3WTPA 5CPKC 1P3GB 5B32C 1P3LB 5DNNB 4XZQB 1P3FA 5GXQD 5BT1D 3VH6A 4CSRB 4ZBJC 4KHAA 2AROB 4KGCA 5B1LA 2XD1A 3LZ0A 3WTPD 3AZKC 5G49A 2NZDA 3W96B 3B6GA 2Y2IA 1P3FD 2ZY3A 3TU4C 4KGCD 3MGSC 3LZ0D 3AFAC 1ULYA 2NQBB 2NZDD 5CP6A 3B6FA 4YS3C 3B6GD 4J8XA 3LJAA 3X1UA 5GT0C 3C1CA 3W98B 3B0CW 4H9SA 1U35A 3WA9B 1ZLAC 5CP6D 3B6FD 4J8XD 4UUZB 3VH6W 3LJAD 3X1UD 3KWQB 3WKJA 3C1CD 3REJC 1U35D 2ZY2A 3W96C 3AZFB 4H9PB 3AZEB 3AZGC 3EPLA 3WKJD 3AZLB 5JRGB 4G91B 2FJ7A 3AZJC 1HQ3A 2IO5B 2RVQD 3KUYA 4JJNA 4G92C 2YFVA 2F2AC 5AV8B 1S32A 2FJ7D 4KUDC 4LD9C 1HQ3D 2YFWA 3KWQC 4JJND 5CPIA 5B40B 1P3IC 2BG1A 1P3BB 1P3OB 1S32D 3AZFC 3AZLC 5CPID 5B2IB 4DRBA 5AV5C 3AZIA 4G91C 1B6WA 2IO5C 3AN2A 4WNNB 3X1TC 5DNMC 5B1MA 3REKA 3KXBC 3MGQA 2BYMA 2FFFB 3AZID 3W97C 4H9QB 3W99C 3AZNC 3AN2D 2ZY4A 5B40C 5AY8C 1P3LA 1HTAA 3H0LC 4XZQA 5B1MD 3MGQD 3UT9A 2J8PA 1P3KB 3REHC 5B2IC 4XZQD 4J8VA 1P3PC 5B24B 3MGRB 4EO5C 5JA4B 3UT9D 2NQBA 5BS7C 5GT3B 4J8VD 2HIOA 5CPJC 3REIB 5BNXB 2NQBD 4YM6C 4R8PB 5B0ZC 2HIOD 2UWXA 1T3UA 5C3IC 3UTBA 4H9PA 2CWEA 3AYWC 3RELB 5B24C 1M1AB 3UTBD 2HUEB 5GT3C 2G5HC 5F99A 3EPHA 4XUJB 5AVBB 2JSSA 3REIC 5B31D 1R4VA 5B2JC 5F99D 1ID3A 5KDMA 1P3BA 1P3OA 2PYOC 3IP4C 3MGPB 1H3OA 4J8UC 3RELC 4NE5A 1ID3D 1KX4B 1P3BD 3VH5T 1P34B 1P3OD 5B33A 3MNNB 4WNNA 4Z66B 5BT1C 5GXQC 5AV9A 3LZ1C 5CPKB 3AL0C 1TZYC 5B33D 5B32B 3WTPC 4X23A 3V9RA 5AV9D 1Z2CB 5AVCC 4KGCC 3AV1A 1M19A 1BH9B 4X23D 1P3KA 1M18A 1PZRA 3TU4B 3H0MC 3MGSB 3AFAB 2Y2GA 4E44A 5CP6C 3AV1D 1M19D 5AV6D 1M18D 3LJAC 3R45B 3WTPE 4H9SC 1ZLAB 3X1SB 1KX5A 2DF4C 3WKJC 3REJB 3AZHA 4HGAC 4R8PA 3AZMA 1KX5D 3AZGB 2RVQC 1AOIA 1F66A 5BNVB 5BO0A 3AZHD 5B1LD 3NQJB 4R8PD 3VH5W 3AZMD 3AZJB 3NQUB 1AOID 4DQYB 4G92B 1F66D 4ZUXC 4NE6A 5AVBA 2CV5C 1S32C 3X1SC 4KUDB 4LD9B 1JFIB 1P3IB 1TAFA 3C1BC 4DRAA 5E5AA 5B0YA 1P3AA 5AV5B 3WAAA 3P5JB 5FUGA 3A6NB 1BH8B 1KX4A 1P34A 5E5AD 3X1VA 5B0YD 5GSUC 1P3AD 3X1TB
chains in the Genus database with same CATH topology
5DNMB 3WAAD 4Z66A 3KXBB 3MGQC 1KX4D 1P34D 3W97B 5CPKA 3X1VD 3W99B 3KUYD 3AZNB 4H9NB 3H0RC 5AY8B 4Z66D 3AV2C 3AZKA 5CPKD 3UT9C 3REHB 2JCHA 1BH9A 1P3PB 3A6NC 3TU4A 3B0DB 4EO5B 3AZKD 3LELB 4YS3A 2L5AA 5GT0A 2ZM5A 3TU4D 3R45A 5CPJB 1P3GA 1ZLAA 2F8NH 4YM6B 5DNNA 4YS3D 3UTAB 3REKD 5GT0D 4CSRA 3REJA 5B0ZB 2AROA 1EQZB 4Z2MH 1P3GD 5C3IB 3W96A 1ZLAD 4H9OB 4J8WC 3UTBC 4QLCC 1P3LD 5DNND 1P3MC 3AYWB 3O62B 2Y2JA 3B0DC 5BNVA 3REJD 2AROD 2ZY5A 3NQJA 3MVDC 3LELC 3W96D 3AZJA 5B31C 5F99C 4CAYB 4Z5TB 3W98A 2JE5A 3WA9A 3AZJD 5B2JB 4UUZA 3KWQA 3UTAC 4WU9B 1KX3B 1ID3C 1EQZC 2PYOB 3W98D 2BYKB 3WA9D 3AZFA 2G5IC 3AZEA 4WV4B 4J8UB 3KWQD 3O62C 3AZLA 5JRGA 2F8NG 5B33C 3AZFD 3AZED 3AZLD 4Z5TC 4Z2MG 5GXQB 3X1TA 4WU8C 1BFMA 5JRGD 5DNMA 5AV9C 3LZ1B 1TZYB 3WTPB 5AV8A 3W99A 3AZNA 4WZSB 5B40A 4WU9C 5AY8A 3X1TD 1KX3C 4KHAB 5AVCB 5B32G 5DNMD 3LZ0B 5AV8D 2F8NB 4KGCB 5G49B 2NZDB 3AV1C 3W99D 3REHA 5AV6C 3AZND 1M19C 5B40D 3B6GB 5AY8D 5B2IA 1M18C 2W8SA 1P3PA 5CP6B 3LJAB 3X1UB 5B2ID 1P3PD 4H9QA 3WKJB 1P3FC 4YM6A 3AZHC 4HGAB 5B1LC 3LZ0C 2NZDC 5B0ZA 3AZMC 3B6GC 1AOIC 1WWSA 5B24A 3MGRA 3VH5A 5B0ZD 5JA4A 3B6FC 1HQ3B 1P3KD 4J8XC 5GT3A 3X1UC 3C1CC 4ZUXB 1U35C 5B24D 3MGRD 2YFVB 2XD5A 4WJ3C 2CV5B 1S32B 3REIA 5BNXA 2YFWB 5GT3D 3C1BB 3VH6T 5B2JA 5CHLB 3REID 5E5AC 1A7WA 5B0YC 1P3AC 1W2EA 4J8UA 3RELA 3AZIB 4AWLC 2FJ7C 1B67A 1HQ3C 1M1AA 3X1VC 5GSUB 3KUYC 4JJNC 4J8UD 3KSYA 3RELD 4XUJA 3EPKA 5B1MB 3MGQB 2BYMB 3LZ1A 1M1AD 1TZYA 5CPIC 4XUJD 5AVBD 3AV2B 5AVCA 3LZ1D 3MGPA 3UT9B 1TZYD 2F8NA 3A1KA 4J8VB 3AZIC 5AVCD 3MGPD 2F8ND 3AN2C 3MNNA 3B0BA 3REKC 1Q9CA 5B1MC 2HIOB 5B32A 5B31G 1P3GC 3MNND 1P3LC 1KU5A 5DNNC 4XZQC 2AROC 5B32D 4J8WB 3UTBB 4QLCB 4H9RB 1P3MB 4J8VC 3MGSA 3AFAA 3MVDB 2NQBC 5B31B 5F99B 4ZUXA 3W98C 2HIOC 3MGSD 3AFAD 2CV5A 3WA9C 2LY8A 3X1SA 3C1BA 1ID3B 2RIQA 5KDMB 4ZUXD 2CV5D 1H3OB 3X1SD 3AZEC 3EG5B 3AZGA 2F8NK 3C1BD 5JRGC 5B33B 3AZGD 3NQUA 5GSUA 4WU8B 1N1JB 5AV9B 5AV8C 4KUDA 4LD9A 4X23B 5GSUD 1JFIA 1P3IA 3V9RB 1P3BC 1P3OC 4KUDD 3AV2A 4LD9D 3AV1B 1M19B 5AV6B 1P3ID 1M18B 5AV5A 2Y2MA 3A6NA 1BH8A 2Y2OA 3AV2D 2Y2QA 5AV5D 3KXBA 2Y2PA 3FDDA 3A6ND 3W97A 1KX5B 4X23C 4H9NA 1P3FB 3EPJA 3AZHB 5B1LB 3KXBD 3AZMB 3W97D 1P3KC 4J8WA 1AOIB 4QLCA 4H9RA 1P3MA 5BO0B 1F66B 3MGRC 2Y2HA 3B6FB 3MVDA 3REHD 2Y2NA 3LELA 4J8XB 5BS7A 5B31A 4J8WD 4QLCD 3C1CB 1P3MD 1U35B 5CPJA 2Y2LA 1KX5C 3MVDD 3LELD 1TAFB 3UTAA 4R8PC 2DQNC 1EQZA 5CPJD 3KFUG 5E5AB 5B0YB 4H9OA 1P3AB 4YM6D 1F66C 3AYWA 3UTAD 4UPKA 3O62A 3WAAB 5FUGB 1EQZD 4AWLB 2FJ7B 2Y2KA 1M1AC 3X1VB 4JJNB 3KUYB 2HUEC 3AYWD 4CAYA 3O62D 4Z5TA 3B0CT 4WU8A 4XUJC 5AVBC 1N1JA 4NE3A 5CPIB 4Z5TD 4WU9A 4WU8D 1KX3A 2PYOA 2BYKA 4ZBJB 3MGPC 3AZKB 4E45A 5B2JD 4M6BA 5AV6A 1F1EA 3WAAC 4WU9D 1KX3D 1KX4C 2PYOD 1P34C 3AN2B 4NFTA 3A1IA 3MNNC 1WWIA 4YS3B 5GXQA 3REKB 5GT0B 4Z66C 2VQRA 3F6TA 3WTPA 5CPKC 1P3GB 5B32C 1P3LB 5DNNB 4XZQB 1P3FA 5GXQD 5BT1D 3VH6A 4CSRB 4ZBJC 4KHAA 2AROB 4KGCA 5B1LA 2XD1A 3LZ0A 3WTPD 3AZKC 5G49A 2NZDA 3W96B 3B6GA 2Y2IA 1P3FD 2ZY3A 3TU4C 4KGCD 3MGSC 3LZ0D 3AFAC 1ULYA 2NQBB 2NZDD 5CP6A 3B6FA 4YS3C 3B6GD 4J8XA 3LJAA 3X1UA 5GT0C 3C1CA 3W98B 3B0CW 4H9SA 1U35A 3WA9B 1ZLAC 5CP6D 3B6FD 4J8XD 4UUZB 3VH6W 3LJAD 3X1UD 3KWQB 3WKJA 3C1CD 3REJC 1U35D 2ZY2A 3W96C 3AZFB 4H9PB 3AZEB 3AZGC 3EPLA 3WKJD 3AZLB 5JRGB 4G91B 2FJ7A 3AZJC 1HQ3A 2IO5B 2RVQD 3KUYA 4JJNA 4G92C 2YFVA 2F2AC 5AV8B 1S32A 2FJ7D 4KUDC 4LD9C 1HQ3D 2YFWA 3KWQC 4JJND 5CPIA 5B40B 1P3IC 2BG1A 1P3BB 1P3OB 1S32D 3AZFC 3AZLC 5CPID 5B2IB 4DRBA 5AV5C 3AZIA 4G91C 1B6WA 2IO5C 3AN2A 4WNNB 3X1TC 5DNMC 5B1MA 3REKA 3KXBC 3MGQA 2BYMA 2FFFB 3AZID 3W97C 4H9QB 3W99C 3AZNC 3AN2D 2ZY4A 5B40C 5AY8C 1P3LA 1HTAA 3H0LC 4XZQA 5B1MD 3MGQD 3UT9A 2J8PA 1P3KB 3REHC 5B2IC 4XZQD 4J8VA 1P3PC 5B24B 3MGRB 4EO5C 5JA4B 3UT9D 2NQBA 5BS7C 5GT3B 4J8VD 2HIOA 5CPJC 3REIB 5BNXB 2NQBD 4YM6C 4R8PB 5B0ZC 2HIOD 2UWXA 1T3UA 5C3IC 3UTBA 4H9PA 2CWEA 3AYWC 3RELB 5B24C 1M1AB 3UTBD 2HUEB 5GT3C 2G5HC 5F99A 3EPHA 4XUJB 5AVBB 2JSSA 3REIC 5B31D 1R4VA 5B2JC 5F99D 1ID3A 5KDMA 1P3BA 1P3OA 2PYOC 3IP4C 3MGPB 1H3OA 4J8UC 3RELC 4NE5A 1ID3D 1KX4B 1P3BD 3VH5T 1P34B 1P3OD 5B33A 3MNNB 4WNNA 4Z66B 5BT1C 5GXQC 5AV9A 3LZ1C 5CPKB 3AL0C 1TZYC 5B33D 5B32B 3WTPC 4X23A 3V9RA 5AV9D 1Z2CB 5AVCC 4KGCC 3AV1A 1M19A 1BH9B 4X23D 1P3KA 1M18A 1PZRA 3TU4B 3H0MC 3MGSB 3AFAB 2Y2GA 4E44A 5CP6C 3AV1D 1M19D 5AV6D 1M18D 3LJAC 3R45B 3WTPE 4H9SC 1ZLAB 3X1SB 1KX5A 2DF4C 3WKJC 3REJB 3AZHA 4HGAC 4R8PA 3AZMA 1KX5D 3AZGB 2RVQC 1AOIA 1F66A 5BNVB 5BO0A 3AZHD 5B1LD 3NQJB 4R8PD 3VH5W 3AZMD 3AZJB 3NQUB 1AOID 4DQYB 4G92B 1F66D 4ZUXC 4NE6A 5AVBA 2CV5C 1S32C 3X1SC 4KUDB 4LD9B 1JFIB 1P3IB 1TAFA 3C1BC 4DRAA 5E5AA 5B0YA 1P3AA 5AV5B 3WAAA 3P5JB 5FUGA 3A6NB 1BH8B 1KX4A 1P34A 5E5AD 3X1VA 5B0YD 5GSUC 1P3AD 3X1TB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DNM B;  3WAA D;  4Z66 A;  3KXB B;  3MGQ C;  1KX4 D;  1P34 D;  3W97 B;  5CPK A;  3X1V D;  3W99 B;  3KUY D;  3AZN B;  4H9N B;  5AY8 B;  4Z66 D;  3AV2 C;  3AZK A;  5CPK D;  3UT9 C;  3REH B;  1BH9 A;  1P3P B;  3A6N C;  3TU4 A;  3B0D B;  4EO5 B;  3AZK D;  3LEL B;  4YS3 A;  2L5A A;  5GT0 A;  3TU4 D;  3R45 A;  5CPJ B;  1P3G A;  1ZLA A;  2F8N H;  4YM6 B;  5DNN A;  4YS3 D;  3UTA B;  3REK D;  5GT0 D;  4CSR A;  3REJ A;  5B0Z B;  2ARO A;  1EQZ B;  4Z2M H;  1P3G D;  5C3I B;  3W96 A;  1ZLA D;  4H9O B;  4J8W C;  3UTB C;  4QLC C;  1P3L D;  5DNN D;  1P3M C;  3AYW B;  3O62 B;  3B0D C;  5BNV A;  3REJ D;  2ARO D;  3NQJ A;  3MVD C;  3LEL C;  3W96 D;  3AZJ A;  5B31 C;  5F99 C;  4CAY B;  4Z5T B;  3W98 A;  3WA9 A;  3AZJ D;  5B2J B;  4UUZ A;  3KWQ A;  3UTA C;  4WU9 B;  1KX3 B;  1ID3 C;  1EQZ C;  2PYO B;  3W98 D;  2BYK B;  3WA9 D;  3AZF A;  3AZE A;  4WV4 B;  4J8U B;  3KWQ D;  3O62 C;  3AZL A;  5JRG A;  2F8N G;  5B33 C;  3AZF D;  3AZE D;  3AZL D;  4Z5T C;  4Z2M G;  5GXQ B;  3X1T A;  4WU8 C;  1BFM A;  5JRG D;  5DNM A;  5AV9 C;  3LZ1 B;  1TZY B;  3WTP B;  5AV8 A;  3W99 A;  3AZN A;  4WZS B;  5B40 A;  4WU9 C;  5AY8 A;  3X1T D;  1KX3 C;  4KHA B;  5AVC B;  5B32 G;  5DNM D;  3LZ0 B;  5AV8 D;  2F8N B;  4KGC B;  5G49 B;  2NZD B;  3AV1 C;  3W99 D;  3REH A;  5AV6 C;  3AZN D;  1M19 C;  5B40 D;  3B6G B;  5AY8 D;  5B2I A;  1M18 C;  1P3P A;  5CP6 B;  3LJA B;  3X1U B;  5B2I D;  1P3P D;  4H9Q A;  3WKJ B;  1P3F C;  4YM6 A;  3AZH C;  4HGA B;  5B1L C;  3LZ0 C;  2NZD C;  5B0Z A;  3AZM C;  3B6G C;  1AOI C;  1WWS A;  5B24 A;  3MGR A;  3VH5 A;  5B0Z D;  5JA4 A;  3B6F C;  1HQ3 B;  1P3K D;  4J8X C;  5GT3 A;  3X1U C;  3C1C C;  4ZUX B;  1U35 C;  5B24 D;  3MGR D;  2YFV B;  2CV5 B;  1S32 B;  3REI A;  5BNX A;  2YFW B;  5GT3 D;  3C1B B;  3VH6 T;  5B2J A;  5CHL B;  3REI D;  5E5A C;  1A7W A;  5B0Y C;  1P3A C;  4J8U A;  3REL A;  3AZI B;  4AWL C;  2FJ7 C;  1B67 A;  1HQ3 C;  1M1A A;  3X1V C;  5GSU B;  3KUY C;  4JJN C;  4J8U D;  3KSY A;  3REL D;  4XUJ A;  5B1M B;  3MGQ B;  2BYM B;  3LZ1 A;  1M1A D;  1TZY A;  5CPI C;  4XUJ D;  5AVB D;  3AV2 B;  5AVC A;  3LZ1 D;  3MGP A;  3UT9 B;  1TZY D;  2F8N A;  4J8V B;  3AZI C;  5AVC D;  3MGP D;  2F8N D;  3AN2 C;  3MNN A;  3B0B A;  3REK C;  1Q9C A;  5B1M C;  2HIO B;  5B32 A;  5B31 G;  1P3G C;  3MNN D;  1P3L C;  1KU5 A;  5DNN C;  4XZQ C;  2ARO C;  5B32 D;  4J8W B;  3UTB B;  4QLC B;  4H9R B;  1P3M B;  4J8V C;  3MGS A;  3AFA A;  3MVD B;  2NQB C;  5B31 B;  5F99 B;  4ZUX A;  3W98 C;  2HIO C;  3MGS D;  3AFA D;  2CV5 A;  3WA9 C;  2LY8 A;  3X1S A;  3C1B A;  1ID3 B;  5KDM B;  4ZUX D;  2CV5 D;  1H3O B;  3X1S D;  3AZE C;  3AZG A;  2F8N K;  3C1B D;  5JRG C;  5B33 B;  3AZG D;  3NQU A;  5GSU A;  4WU8 B;  1N1J B;  5AV9 B;  5AV8 C;  4KUD A;  4LD9 A;  4X23 B;  5GSU D;  1JFI A;  1P3I A;  3V9R B;  1P3B C;  1P3O C;  4KUD D;  3AV2 A;  4LD9 D;  3AV1 B;  1M19 B;  5AV6 B;  1P3I D;  1M18 B;  5AV5 A;  3A6N A;  1BH8 A;  3AV2 D;  5AV5 D;  3KXB A;  3A6N D;  3W97 A;  1KX5 B;  4X23 C;  4H9N A;  1P3F B;  3AZH B;  5B1L B;  3KXB D;  3AZM B;  3W97 D;  1P3K C;  4J8W A;  1AOI B;  4QLC A;  4H9R A;  1P3M A;  5BO0 B;  1F66 B;  3MGR C;  3B6F B;  3MVD A;  3REH D;  3LEL A;  4J8X B;  5BS7 A;  5B31 A;  4J8W D;  4QLC D;  3C1C B;  1P3M D;  1U35 B;  5CPJ A;  1KX5 C;  3MVD D;  3LEL D;  1TAF B;  3UTA A;  4R8P C;  1EQZ A;  5CPJ D;  5E5A B;  5B0Y B;  4H9O A;  1P3A B;  4YM6 D;  1F66 C;  3AYW A;  3UTA D;  3O62 A;  3WAA B;  5FUG B;  1EQZ D;  4AWL B;  2FJ7 B;  1M1A C;  3X1V B;  4JJN B;  3KUY B;  2HUE C;  3AYW D;  4CAY A;  3O62 D;  4Z5T A;  3B0C T;  4WU8 A;  4XUJ C;  5AVB C;  1N1J A;  4NE3 A;  5CPI B;  4Z5T D;  4WU9 A;  4WU8 D;  1KX3 A;  2PYO A;  2BYK A;  4ZBJ B;  3MGP C;  3AZK B;  4E45 A;  5B2J D;  4M6B A;  5AV6 A;  1F1E A;  3WAA C;  4WU9 D;  1KX3 D;  1KX4 C;  2PYO D;  1P34 C;  3AN2 B;  4NFT A;  3MNN C;  4YS3 B;  1WWI A;  5GXQ A;  3REK B;  5GT0 B;  4Z66 C;  5CPK C;  3WTP A;  1P3G B;  5B32 C;  1P3L B;  5DNN B;  4XZQ B;  1P3F A;  5GXQ D;  5BT1 D;  3VH6 A;  4CSR B;  4ZBJ C;  4KHA A;  2ARO B;  4KGC A;  5B1L A;  3LZ0 A;  3AZK C;  3WTP D;  2NZD A;  5G49 A;  3W96 B;  3B6G A;  1P3F D;  3TU4 C;  4KGC D;  3MGS C;  3LZ0 D;  3AFA C;  1ULY A;  2NQB B;  2NZD D;  5CP6 A;  3B6F A;  4YS3 C;  3B6G D;  4J8X A;  3LJA A;  3X1U A;  5GT0 C;  3C1C A;  3W98 B;  3B0C W;  4H9S A;  1U35 A;  3WA9 B;  1ZLA C;  5CP6 D;  3B6F D;  4J8X D;  4UUZ B;  3VH6 W;  3LJA D;  3X1U D;  3KWQ B;  3WKJ A;  3C1C D;  3REJ C;  1U35 D;  3W96 C;  3AZF B;  4H9P B;  3AZE B;  3AZG C;  3WKJ D;  3AZL B;  5JRG B;  4G91 B;  2FJ7 A;  3AZJ C;  1HQ3 A;  2IO5 B;  2RVQ D;  3KUY A;  4JJN A;  4G92 C;  2YFV A;  5AV8 B;  1S32 A;  2FJ7 D;  4KUD C;  4LD9 C;  1HQ3 D;  2YFW A;  3KWQ C;  4JJN D;  5CPI A;  5B40 B;  1P3I C;  1P3B B;  1P3O B;  1S32 D;  3AZF C;  3AZL C;  5CPI D;  5B2I B;  4DRB A;  5AV5 C;  3AZI A;  4G91 C;  1B6W A;  2IO5 C;  3AN2 A;  4WNN B;  3X1T C;  5DNM C;  5B1M A;  3REK A;  3KXB C;  3MGQ A;  2BYM A;  3AZI D;  3W97 C;  4H9Q B;  3W99 C;  3AZN C;  3AN2 D;  5B40 C;  5AY8 C;  1P3L A;  1HTA A;  4XZQ A;  5B1M D;  3MGQ D;  3UT9 A;  1P3K B;  3REH C;  5B2I C;  4XZQ D;  4J8V A;  1P3P C;  5B24 B;  3MGR B;  4EO5 C;  5JA4 B;  3UT9 D;  2NQB A;  5BS7 C;  5GT3 B;  4J8V D;  2HIO A;  5CPJ C;  3REI B;  5BNX B;  2NQB D;  4YM6 C;  4R8P B;  5B0Z C;  2HIO D;  5C3I C;  3UTB A;  4H9P A;  2CWE A;  3AYW C;  3REL B;  5B24 C;  1M1A B;  3UTB D;  2HUE B;  5GT3 C;  5F99 A;  4XUJ B;  5AVB B;  2JSS A;  3REI C;  5B31 D;  1R4V A;  5B2J C;  5F99 D;  1ID3 A;  5KDM A;  1P3B A;  1P3O A;  2PYO C;  3MGP B;  1H3O A;  4J8U C;  3REL C;  4NE5 A;  1ID3 D;  1KX4 B;  1P3B D;  3VH5 T;  1P34 B;  1P3O D;  5B33 A;  3MNN B;  4WNN A;  4Z66 B;  5BT1 C;  5GXQ C;  5AV9 A;  3LZ1 C;  5CPK B;  1TZY C;  5B33 D;  5B32 B;  3WTP C;  4X23 A;  3V9R A;  5AV9 D;  5AVC C;  4KGC C;  3AV1 A;  1M19 A;  1BH9 B;  4X23 D;  1P3K A;  1M18 A;  3TU4 B;  3MGS B;  3AFA B;  4E44 A;  5CP6 C;  3AV1 D;  1M19 D;  5AV6 D;  1M18 D;  3LJA C;  3R45 B;  3WTP E;  4H9S C;  1ZLA B;  3X1S B;  1KX5 A;  3WKJ C;  3REJ B;  3AZH A;  4HGA C;  4R8P A;  3AZM A;  1KX5 D;  3AZG B;  2RVQ C;  1AOI A;  1F66 A;  5BNV B;  5BO0 A;  3AZH D;  5B1L D;  3NQJ B;  4R8P D;  3VH5 W;  3AZM D;  3AZJ B;  3NQU B;  1AOI D;  4G92 B;  1F66 D;  4ZUX C;  4NE6 A;  5AVB A;  2CV5 C;  1S32 C;  3X1S C;  4KUD B;  4LD9 B;  1JFI B;  1P3I B;  1TAF A;  3C1B C;  4DRA A;  5E5A A;  5B0Y A;  1P3A A;  5AV5 B;  3WAA A;  5FUG A;  3A6N B;  1BH8 B;  1KX4 A;  1P34 A;  5E5A D;  3X1V A;  5B0Y D;  5GSU C;  1P3A D;  3X1T B; 
#chains in the Genus database with same CATH topology
 5DNM B;  3WAA D;  4Z66 A;  3KXB B;  3MGQ C;  1KX4 D;  1P34 D;  3W97 B;  5CPK A;  3X1V D;  3W99 B;  3KUY D;  3AZN B;  4H9N B;  3H0R C;  5AY8 B;  4Z66 D;  3AV2 C;  3AZK A;  5CPK D;  3UT9 C;  3REH B;  2JCH A;  1BH9 A;  1P3P B;  3A6N C;  3TU4 A;  3B0D B;  4EO5 B;  3AZK D;  3LEL B;  4YS3 A;  2L5A A;  5GT0 A;  2ZM5 A;  3TU4 D;  3R45 A;  5CPJ B;  1P3G A;  1ZLA A;  2F8N H;  4YM6 B;  5DNN A;  4YS3 D;  3UTA B;  3REK D;  5GT0 D;  4CSR A;  3REJ A;  5B0Z B;  2ARO A;  1EQZ B;  4Z2M H;  1P3G D;  5C3I B;  3W96 A;  1ZLA D;  4H9O B;  4J8W C;  3UTB C;  4QLC C;  1P3L D;  5DNN D;  1P3M C;  3AYW B;  3O62 B;  2Y2J A;  3B0D C;  5BNV A;  3REJ D;  2ARO D;  2ZY5 A;  3NQJ A;  3MVD C;  3LEL C;  3W96 D;  3AZJ A;  5B31 C;  5F99 C;  4CAY B;  4Z5T B;  3W98 A;  2JE5 A;  3WA9 A;  3AZJ D;  5B2J B;  4UUZ A;  3KWQ A;  3UTA C;  4WU9 B;  1KX3 B;  1ID3 C;  1EQZ C;  2PYO B;  3W98 D;  2BYK B;  3WA9 D;  3AZF A;  2G5I C;  3AZE A;  4WV4 B;  4J8U B;  3KWQ D;  3O62 C;  3AZL A;  5JRG A;  2F8N G;  5B33 C;  3AZF D;  3AZE D;  3AZL D;  4Z5T C;  4Z2M G;  5GXQ B;  3X1T A;  4WU8 C;  1BFM A;  5JRG D;  5DNM A;  5AV9 C;  3LZ1 B;  1TZY B;  3WTP B;  5AV8 A;  3W99 A;  3AZN A;  4WZS B;  5B40 A;  4WU9 C;  5AY8 A;  3X1T D;  1KX3 C;  4KHA B;  5AVC B;  5B32 G;  5DNM D;  3LZ0 B;  5AV8 D;  2F8N B;  4KGC B;  5G49 B;  2NZD B;  3AV1 C;  3W99 D;  3REH A;  5AV6 C;  3AZN D;  1M19 C;  5B40 D;  3B6G B;  5AY8 D;  5B2I A;  1M18 C;  2W8S A;  1P3P A;  5CP6 B;  3LJA B;  3X1U B;  5B2I D;  1P3P D;  4H9Q A;  3WKJ B;  1P3F C;  4YM6 A;  3AZH C;  4HGA B;  5B1L C;  3LZ0 C;  2NZD C;  5B0Z A;  3AZM C;  3B6G C;  1AOI C;  1WWS A;  5B24 A;  3MGR A;  3VH5 A;  5B0Z D;  5JA4 A;  3B6F C;  1HQ3 B;  1P3K D;  4J8X C;  5GT3 A;  3X1U C;  3C1C C;  4ZUX B;  1U35 C;  5B24 D;  3MGR D;  2YFV B;  2XD5 A;  4WJ3 C;  2CV5 B;  1S32 B;  3REI A;  5BNX A;  2YFW B;  5GT3 D;  3C1B B;  3VH6 T;  5B2J A;  5CHL B;  3REI D;  5E5A C;  1A7W A;  5B0Y C;  1P3A C;  1W2E A;  4J8U A;  3REL A;  3AZI B;  4AWL C;  2FJ7 C;  1B67 A;  1HQ3 C;  1M1A A;  3X1V C;  5GSU B;  3KUY C;  4JJN C;  4J8U D;  3KSY A;  3REL D;  4XUJ A;  3EPK A;  5B1M B;  3MGQ B;  2BYM B;  3LZ1 A;  1M1A D;  1TZY A;  5CPI C;  4XUJ D;  5AVB D;  3AV2 B;  5AVC A;  3LZ1 D;  3MGP A;  3UT9 B;  1TZY D;  2F8N A;  3A1K A;  4J8V B;  3AZI C;  5AVC D;  3MGP D;  2F8N D;  3AN2 C;  3MNN A;  3B0B A;  3REK C;  1Q9C A;  5B1M C;  2HIO B;  5B32 A;  5B31 G;  1P3G C;  3MNN D;  1P3L C;  1KU5 A;  5DNN C;  4XZQ C;  2ARO C;  5B32 D;  4J8W B;  3UTB B;  4QLC B;  4H9R B;  1P3M B;  4J8V C;  3MGS A;  3AFA A;  3MVD B;  2NQB C;  5B31 B;  5F99 B;  4ZUX A;  3W98 C;  2HIO C;  3MGS D;  3AFA D;  2CV5 A;  3WA9 C;  2LY8 A;  3X1S A;  3C1B A;  1ID3 B;  2RIQ A;  5KDM B;  4ZUX D;  2CV5 D;  1H3O B;  3X1S D;  3AZE C;  3EG5 B;  3AZG A;  2F8N K;  3C1B D;  5JRG C;  5B33 B;  3AZG D;  3NQU A;  5GSU A;  4WU8 B;  1N1J B;  5AV9 B;  5AV8 C;  4KUD A;  4LD9 A;  4X23 B;  5GSU D;  1JFI A;  1P3I A;  3V9R B;  1P3B C;  1P3O C;  4KUD D;  3AV2 A;  4LD9 D;  3AV1 B;  1M19 B;  5AV6 B;  1P3I D;  1M18 B;  5AV5 A;  2Y2M A;  3A6N A;  1BH8 A;  2Y2O A;  3AV2 D;  2Y2Q A;  5AV5 D;  3KXB A;  2Y2P A;  3FDD A;  3A6N D;  3W97 A;  1KX5 B;  4X23 C;  4H9N A;  1P3F B;  3EPJ A;  3AZH B;  5B1L B;  3KXB D;  3AZM B;  3W97 D;  1P3K C;  4J8W A;  1AOI B;  4QLC A;  4H9R A;  1P3M A;  5BO0 B;  1F66 B;  3MGR C;  2Y2H A;  3B6F B;  3MVD A;  3REH D;  2Y2N A;  3LEL A;  4J8X B;  5BS7 A;  5B31 A;  4J8W D;  4QLC D;  3C1C B;  1P3M D;  1U35 B;  5CPJ A;  2Y2L A;  1KX5 C;  3MVD D;  3LEL D;  1TAF B;  3UTA A;  4R8P C;  2DQN C;  1EQZ A;  5CPJ D;  3KFU G;  5E5A B;  5B0Y B;  4H9O A;  1P3A B;  4YM6 D;  1F66 C;  3AYW A;  3UTA D;  4UPK A;  3O62 A;  3WAA B;  5FUG B;  1EQZ D;  4AWL B;  2FJ7 B;  2Y2K A;  1M1A C;  3X1V B;  4JJN B;  3KUY B;  2HUE C;  3AYW D;  4CAY A;  3O62 D;  4Z5T A;  3B0C T;  4WU8 A;  4XUJ C;  5AVB C;  1N1J A;  4NE3 A;  5CPI B;  4Z5T D;  4WU9 A;  4WU8 D;  1KX3 A;  2PYO A;  2BYK A;  4ZBJ B;  3MGP C;  3AZK B;  4E45 A;  5B2J D;  4M6B A;  5AV6 A;  1F1E A;  3WAA C;  4WU9 D;  1KX3 D;  1KX4 C;  2PYO D;  1P34 C;  3AN2 B;  4NFT A;  3A1I A;  3MNN C;  1WWI A;  4YS3 B;  5GXQ A;  3REK B;  5GT0 B;  4Z66 C;  2VQR A;  3F6T A;  3WTP A;  5CPK C;  1P3G B;  5B32 C;  1P3L B;  5DNN B;  4XZQ B;  1P3F A;  5GXQ D;  5BT1 D;  3VH6 A;  4CSR B;  4ZBJ C;  4KHA A;  2ARO B;  4KGC A;  5B1L A;  2XD1 A;  3LZ0 A;  3WTP D;  3AZK C;  5G49 A;  2NZD A;  3W96 B;  3B6G A;  2Y2I A;  1P3F D;  2ZY3 A;  3TU4 C;  4KGC D;  3MGS C;  3LZ0 D;  3AFA C;  1ULY A;  2NQB B;  2NZD D;  5CP6 A;  3B6F A;  4YS3 C;  3B6G D;  4J8X A;  3LJA A;  3X1U A;  5GT0 C;  3C1C A;  3W98 B;  3B0C W;  4H9S A;  1U35 A;  3WA9 B;  1ZLA C;  5CP6 D;  3B6F D;  4J8X D;  4UUZ B;  3VH6 W;  3LJA D;  3X1U D;  3KWQ B;  3WKJ A;  3C1C D;  3REJ C;  1U35 D;  2ZY2 A;  3W96 C;  3AZF B;  4H9P B;  3AZE B;  3AZG C;  3EPL A;  3WKJ D;  3AZL B;  5JRG B;  4G91 B;  2FJ7 A;  3AZJ C;  1HQ3 A;  2IO5 B;  2RVQ D;  3KUY A;  4JJN A;  4G92 C;  2YFV A;  2F2A C;  5AV8 B;  1S32 A;  2FJ7 D;  4KUD C;  4LD9 C;  1HQ3 D;  2YFW A;  3KWQ C;  4JJN D;  5CPI A;  5B40 B;  1P3I C;  2BG1 A;  1P3B B;  1P3O B;  1S32 D;  3AZF C;  3AZL C;  5CPI D;  5B2I B;  4DRB A;  5AV5 C;  3AZI A;  4G91 C;  1B6W A;  2IO5 C;  3AN2 A;  4WNN B;  3X1T C;  5DNM C;  5B1M A;  3REK A;  3KXB C;  3MGQ A;  2BYM A;  2FFF B;  3AZI D;  3W97 C;  4H9Q B;  3W99 C;  3AZN C;  3AN2 D;  2ZY4 A;  5B40 C;  5AY8 C;  1P3L A;  1HTA A;  3H0L C;  4XZQ A;  5B1M D;  3MGQ D;  3UT9 A;  2J8P A;  1P3K B;  3REH C;  5B2I C;  4XZQ D;  4J8V A;  1P3P C;  5B24 B;  3MGR B;  4EO5 C;  5JA4 B;  3UT9 D;  2NQB A;  5BS7 C;  5GT3 B;  4J8V D;  2HIO A;  5CPJ C;  3REI B;  5BNX B;  2NQB D;  4YM6 C;  4R8P B;  5B0Z C;  2HIO D;  2UWX A;  1T3U A;  5C3I C;  3UTB A;  4H9P A;  2CWE A;  3AYW C;  3REL B;  5B24 C;  1M1A B;  3UTB D;  2HUE B;  5GT3 C;  2G5H C;  5F99 A;  3EPH A;  4XUJ B;  5AVB B;  2JSS A;  3REI C;  5B31 D;  1R4V A;  5B2J C;  5F99 D;  1ID3 A;  5KDM A;  1P3B A;  1P3O A;  2PYO C;  3IP4 C;  3MGP B;  1H3O A;  4J8U C;  3REL C;  4NE5 A;  1ID3 D;  1KX4 B;  1P3B D;  3VH5 T;  1P34 B;  1P3O D;  5B33 A;  3MNN B;  4WNN A;  4Z66 B;  5BT1 C;  5GXQ C;  5AV9 A;  3LZ1 C;  5CPK B;  3AL0 C;  1TZY C;  5B33 D;  5B32 B;  3WTP C;  4X23 A;  3V9R A;  5AV9 D;  1Z2C B;  5AVC C;  4KGC C;  3AV1 A;  1M19 A;  1BH9 B;  4X23 D;  1P3K A;  1M18 A;  1PZR A;  3TU4 B;  3H0M C;  3MGS B;  3AFA B;  2Y2G A;  4E44 A;  5CP6 C;  3AV1 D;  1M19 D;  5AV6 D;  1M18 D;  3LJA C;  3R45 B;  3WTP E;  4H9S C;  1ZLA B;  3X1S B;  1KX5 A;  2DF4 C;  3WKJ C;  3REJ B;  3AZH A;  4HGA C;  4R8P A;  3AZM A;  1KX5 D;  3AZG B;  2RVQ C;  1AOI A;  1F66 A;  5BNV B;  5BO0 A;  3AZH D;  5B1L D;  3NQJ B;  4R8P D;  3VH5 W;  3AZM D;  3AZJ B;  3NQU B;  1AOI D;  4DQY B;  4G92 B;  1F66 D;  4ZUX C;  4NE6 A;  5AVB A;  2CV5 C;  1S32 C;  3X1S C;  4KUD B;  4LD9 B;  1JFI B;  1P3I B;  1TAF A;  3C1B C;  4DRA A;  5E5A A;  5B0Y A;  1P3A A;  5AV5 B;  3WAA A;  3P5J B;  5FUG A;  3A6N B;  1BH8 B;  1KX4 A;  1P34 A;  5E5A D;  3X1V A;  5B0Y D;  5GSU C;  1P3A D;  3X1T B; 
#chains in the Genus database with same CATH homology
 5DNM B;  3WAA D;  4Z66 A;  3KXB B;  3MGQ C;  1KX4 D;  1P34 D;  3W97 B;  5CPK A;  3X1V D;  3W99 B;  3KUY D;  3AZN B;  4H9N B;  3H0R C;  5AY8 B;  4Z66 D;  3AV2 C;  3AZK A;  5CPK D;  3UT9 C;  3REH B;  2JCH A;  1BH9 A;  1P3P B;  3A6N C;  3TU4 A;  3B0D B;  4EO5 B;  3AZK D;  3LEL B;  4YS3 A;  2L5A A;  5GT0 A;  2ZM5 A;  3TU4 D;  3R45 A;  5CPJ B;  1P3G A;  1ZLA A;  2F8N H;  4YM6 B;  5DNN A;  4YS3 D;  3UTA B;  3REK D;  5GT0 D;  4CSR A;  3REJ A;  5B0Z B;  2ARO A;  1EQZ B;  4Z2M H;  1P3G D;  5C3I B;  3W96 A;  1ZLA D;  4H9O B;  4J8W C;  3UTB C;  4QLC C;  1P3L D;  5DNN D;  1P3M C;  3AYW B;  3O62 B;  2Y2J A;  3B0D C;  5BNV A;  3REJ D;  2ARO D;  2ZY5 A;  3NQJ A;  3MVD C;  3LEL C;  3W96 D;  3AZJ A;  5B31 C;  5F99 C;  4CAY B;  4Z5T B;  3W98 A;  2JE5 A;  3WA9 A;  3AZJ D;  5B2J B;  4UUZ A;  3KWQ A;  3UTA C;  4WU9 B;  1KX3 B;  1ID3 C;  1EQZ C;  2PYO B;  3W98 D;  2BYK B;  3WA9 D;  3AZF A;  2G5I C;  3AZE A;  4WV4 B;  4J8U B;  3KWQ D;  3O62 C;  3AZL A;  5JRG A;  2F8N G;  5B33 C;  3AZF D;  3AZE D;  3AZL D;  4Z5T C;  4Z2M G;  5GXQ B;  3X1T A;  4WU8 C;  1BFM A;  5JRG D;  5DNM A;  5AV9 C;  3LZ1 B;  1TZY B;  3WTP B;  5AV8 A;  3W99 A;  3AZN A;  4WZS B;  5B40 A;  4WU9 C;  5AY8 A;  3X1T D;  1KX3 C;  4KHA B;  5AVC B;  5B32 G;  5DNM D;  3LZ0 B;  5AV8 D;  2F8N B;  4KGC B;  5G49 B;  2NZD B;  3AV1 C;  3W99 D;  3REH A;  5AV6 C;  3AZN D;  1M19 C;  5B40 D;  3B6G B;  5AY8 D;  5B2I A;  1M18 C;  2W8S A;  1P3P A;  5CP6 B;  3LJA B;  3X1U B;  5B2I D;  1P3P D;  4H9Q A;  3WKJ B;  1P3F C;  4YM6 A;  3AZH C;  4HGA B;  5B1L C;  3LZ0 C;  2NZD C;  5B0Z A;  3AZM C;  3B6G C;  1AOI C;  1WWS A;  5B24 A;  3MGR A;  3VH5 A;  5B0Z D;  5JA4 A;  3B6F C;  1HQ3 B;  1P3K D;  4J8X C;  5GT3 A;  3X1U C;  3C1C C;  4ZUX B;  1U35 C;  5B24 D;  3MGR D;  2YFV B;  2XD5 A;  4WJ3 C;  2CV5 B;  1S32 B;  3REI A;  5BNX A;  2YFW B;  5GT3 D;  3C1B B;  3VH6 T;  5B2J A;  5CHL B;  3REI D;  5E5A C;  1A7W A;  5B0Y C;  1P3A C;  1W2E A;  4J8U A;  3REL A;  3AZI B;  4AWL C;  2FJ7 C;  1B67 A;  1HQ3 C;  1M1A A;  3X1V C;  5GSU B;  3KUY C;  4JJN C;  4J8U D;  3KSY A;  3REL D;  4XUJ A;  3EPK A;  5B1M B;  3MGQ B;  2BYM B;  3LZ1 A;  1M1A D;  1TZY A;  5CPI C;  4XUJ D;  5AVB D;  3AV2 B;  5AVC A;  3LZ1 D;  3MGP A;  3UT9 B;  1TZY D;  2F8N A;  3A1K A;  4J8V B;  3AZI C;  5AVC D;  3MGP D;  2F8N D;  3AN2 C;  3MNN A;  3B0B A;  3REK C;  1Q9C A;  5B1M C;  2HIO B;  5B32 A;  5B31 G;  1P3G C;  3MNN D;  1P3L C;  1KU5 A;  5DNN C;  4XZQ C;  2ARO C;  5B32 D;  4J8W B;  3UTB B;  4QLC B;  4H9R B;  1P3M B;  4J8V C;  3MGS A;  3AFA A;  3MVD B;  2NQB C;  5B31 B;  5F99 B;  4ZUX A;  3W98 C;  2HIO C;  3MGS D;  3AFA D;  2CV5 A;  3WA9 C;  2LY8 A;  3X1S A;  3C1B A;  1ID3 B;  2RIQ A;  5KDM B;  4ZUX D;  2CV5 D;  1H3O B;  3X1S D;  3AZE C;  3EG5 B;  3AZG A;  2F8N K;  3C1B D;  5JRG C;  5B33 B;  3AZG D;  3NQU A;  5GSU A;  4WU8 B;  1N1J B;  5AV9 B;  5AV8 C;  4KUD A;  4LD9 A;  4X23 B;  5GSU D;  1JFI A;  1P3I A;  3V9R B;  1P3B C;  1P3O C;  4KUD D;  3AV2 A;  4LD9 D;  3AV1 B;  1M19 B;  5AV6 B;  1P3I D;  1M18 B;  5AV5 A;  2Y2M A;  3A6N A;  1BH8 A;  2Y2O A;  3AV2 D;  2Y2Q A;  5AV5 D;  3KXB A;  2Y2P A;  3FDD A;  3A6N D;  3W97 A;  1KX5 B;  4X23 C;  4H9N A;  1P3F B;  3EPJ A;  3AZH B;  5B1L B;  3KXB D;  3AZM B;  3W97 D;  1P3K C;  4J8W A;  1AOI B;  4QLC A;  4H9R A;  1P3M A;  5BO0 B;  1F66 B;  3MGR C;  2Y2H A;  3B6F B;  3MVD A;  3REH D;  2Y2N A;  3LEL A;  4J8X B;  5BS7 A;  5B31 A;  4J8W D;  4QLC D;  3C1C B;  1P3M D;  1U35 B;  5CPJ A;  2Y2L A;  1KX5 C;  3MVD D;  3LEL D;  1TAF B;  3UTA A;  4R8P C;  2DQN C;  1EQZ A;  5CPJ D;  3KFU G;  5E5A B;  5B0Y B;  4H9O A;  1P3A B;  4YM6 D;  1F66 C;  3AYW A;  3UTA D;  4UPK A;  3O62 A;  3WAA B;  5FUG B;  1EQZ D;  4AWL B;  2FJ7 B;  2Y2K A;  1M1A C;  3X1V B;  4JJN B;  3KUY B;  2HUE C;  3AYW D;  4CAY A;  3O62 D;  4Z5T A;  3B0C T;  4WU8 A;  4XUJ C;  5AVB C;  1N1J A;  4NE3 A;  5CPI B;  4Z5T D;  4WU9 A;  4WU8 D;  1KX3 A;  2PYO A;  2BYK A;  4ZBJ B;  3MGP C;  3AZK B;  4E45 A;  5B2J D;  4M6B A;  5AV6 A;  1F1E A;  3WAA C;  4WU9 D;  1KX3 D;  1KX4 C;  2PYO D;  1P34 C;  3AN2 B;  4NFT A;  3A1I A;  3MNN C;  1WWI A;  4YS3 B;  5GXQ A;  3REK B;  5GT0 B;  4Z66 C;  2VQR A;  3F6T A;  3WTP A;  5CPK C;  1P3G B;  5B32 C;  1P3L B;  5DNN B;  4XZQ B;  1P3F A;  5GXQ D;  5BT1 D;  3VH6 A;  4CSR B;  4ZBJ C;  4KHA A;  2ARO B;  4KGC A;  5B1L A;  2XD1 A;  3LZ0 A;  3WTP D;  3AZK C;  5G49 A;  2NZD A;  3W96 B;  3B6G A;  2Y2I A;  1P3F D;  2ZY3 A;  3TU4 C;  4KGC D;  3MGS C;  3LZ0 D;  3AFA C;  1ULY A;  2NQB B;  2NZD D;  5CP6 A;  3B6F A;  4YS3 C;  3B6G D;  4J8X A;  3LJA A;  3X1U A;  5GT0 C;  3C1C A;  3W98 B;  3B0C W;  4H9S A;  1U35 A;  3WA9 B;  1ZLA C;  5CP6 D;  3B6F D;  4J8X D;  4UUZ B;  3VH6 W;  3LJA D;  3X1U D;  3KWQ B;  3WKJ A;  3C1C D;  3REJ C;  1U35 D;  2ZY2 A;  3W96 C;  3AZF B;  4H9P B;  3AZE B;  3AZG C;  3EPL A;  3WKJ D;  3AZL B;  5JRG B;  4G91 B;  2FJ7 A;  3AZJ C;  1HQ3 A;  2IO5 B;  2RVQ D;  3KUY A;  4JJN A;  4G92 C;  2YFV A;  2F2A C;  5AV8 B;  1S32 A;  2FJ7 D;  4KUD C;  4LD9 C;  1HQ3 D;  2YFW A;  3KWQ C;  4JJN D;  5CPI A;  5B40 B;  1P3I C;  2BG1 A;  1P3B B;  1P3O B;  1S32 D;  3AZF C;  3AZL C;  5CPI D;  5B2I B;  4DRB A;  5AV5 C;  3AZI A;  4G91 C;  1B6W A;  2IO5 C;  3AN2 A;  4WNN B;  3X1T C;  5DNM C;  5B1M A;  3REK A;  3KXB C;  3MGQ A;  2BYM A;  2FFF B;  3AZI D;  3W97 C;  4H9Q B;  3W99 C;  3AZN C;  3AN2 D;  2ZY4 A;  5B40 C;  5AY8 C;  1P3L A;  1HTA A;  3H0L C;  4XZQ A;  5B1M D;  3MGQ D;  3UT9 A;  2J8P A;  1P3K B;  3REH C;  5B2I C;  4XZQ D;  4J8V A;  1P3P C;  5B24 B;  3MGR B;  4EO5 C;  5JA4 B;  3UT9 D;  2NQB A;  5BS7 C;  5GT3 B;  4J8V D;  2HIO A;  5CPJ C;  3REI B;  5BNX B;  2NQB D;  4YM6 C;  4R8P B;  5B0Z C;  2HIO D;  2UWX A;  1T3U A;  5C3I C;  3UTB A;  4H9P A;  2CWE A;  3AYW C;  3REL B;  5B24 C;  1M1A B;  3UTB D;  2HUE B;  5GT3 C;  2G5H C;  5F99 A;  3EPH A;  4XUJ B;  5AVB B;  2JSS A;  3REI C;  5B31 D;  1R4V A;  5B2J C;  5F99 D;  1ID3 A;  5KDM A;  1P3B A;  1P3O A;  2PYO C;  3IP4 C;  3MGP B;  1H3O A;  4J8U C;  3REL C;  4NE5 A;  1ID3 D;  1KX4 B;  1P3B D;  3VH5 T;  1P34 B;  1P3O D;  5B33 A;  3MNN B;  4WNN A;  4Z66 B;  5BT1 C;  5GXQ C;  5AV9 A;  3LZ1 C;  5CPK B;  3AL0 C;  1TZY C;  5B33 D;  5B32 B;  3WTP C;  4X23 A;  3V9R A;  5AV9 D;  1Z2C B;  5AVC C;  4KGC C;  3AV1 A;  1M19 A;  1BH9 B;  4X23 D;  1P3K A;  1M18 A;  1PZR A;  3TU4 B;  3H0M C;  3MGS B;  3AFA B;  2Y2G A;  4E44 A;  5CP6 C;  3AV1 D;  1M19 D;  5AV6 D;  1M18 D;  3LJA C;  3R45 B;  3WTP E;  4H9S C;  1ZLA B;  3X1S B;  1KX5 A;  2DF4 C;  3WKJ C;  3REJ B;  3AZH A;  4HGA C;  4R8P A;  3AZM A;  1KX5 D;  3AZG B;  2RVQ C;  1AOI A;  1F66 A;  5BNV B;  5BO0 A;  3AZH D;  5B1L D;  3NQJ B;  4R8P D;  3VH5 W;  3AZM D;  3AZJ B;  3NQU B;  1AOI D;  4DQY B;  4G92 B;  1F66 D;  4ZUX C;  4NE6 A;  5AVB A;  2CV5 C;  1S32 C;  3X1S C;  4KUD B;  4LD9 B;  1JFI B;  1P3I B;  1TAF A;  3C1B C;  4DRA A;  5E5A A;  5B0Y A;  1P3A A;  5AV5 B;  3WAA A;  3P5J B;  5FUG A;  3A6N B;  1BH8 B;  1KX4 A;  1P34 A;  5E5A D;  3X1V A;  5B0Y D;  5GSU C;  1P3A D;  3X1T B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...