3AV1A

The human nucleosome structure containing the histone variant h3.2
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
96
structure length
96
Chain Sequence
b'HRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGER'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.2
publication title Structures of human nucleosomes containing major histone H3 variants
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 31
structure length 96
sequence length 96
chains with identical sequence E
ec nomenclature
pdb deposition date 2011-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3av1A00
3UT9D 5B24D 3AZMB 5AV8D 4G91C 5CP6C 5F99B 1KX3D 5AY8A 1F66B 3AN2D 3TU4B 4R8PD 4WV4B 5G49A 3AZIC 3B6GC 3W99A 1P3PC 4Z66D 2F8NK 5FUGA 3MGPA 5E5AC 4J8WA 5B33B 5B2ID 3REHA 3W96D 4LD9C 1M18D 1P3GB 3AZHA 3V9RA 1ZLAD 5AY8B 4J8VC 5G49B 5B24A 3B0BA 2PYOD 3LELD 5AV8A 3W99B 3C1BC 1M1AD 5GT3C 1KX3A 5FUGB 3X1SB 3LZ0D 3MGPB 4J8WB 3AN2A 4R8PA 1AOIA 3MNNB 2L5AA 1P3LD 1EQZC 4EO5C 4XZQD 3REIA 3AZHB 3V9RB 5F99C 2NQBC 3AYWA 3W96A 3B6FA 5AVCA 1M18A 5GXQC 3RELC 1HTAA 3X1TD 3MVDB 3W98A 3KXBD 4WU8D 3AZGA 3UT9B 5B24B 1P3KA 5AV8B 1KX3B 3O62C 3WA9C 5CP6D 3AN2B 1P3BC 4R8PB 1AOIB 3AZID 3B6GD 3REIB 1P3PD 3AYWB 4NE6A 3B6FB 5E5AD 3WKJD 3W96B 1M18B 1P3LA 3W98B 2AROC 3W99C 4LD9D 1P3OA 1JFIB 3AZGB 1P3KB 3MGPC 5JRGA 5GT0C 3REHC 3X1TA 5B1MD 1M19D 1Q9CA 5CPKC 5B32A 3KXBA 4WNNA 4WU8A 4DRAA 1HQ3C 1N1JA 2JSSA 3VH6T 5AV6A 5CP6A 3C1BD 5GT3D 3VH5T 4J8XC 1P3LB 1KX4C 4XZQB 5B40A 1P3OB 2YFWA 5JRGB 5F99D 2NQBD 3X1TB 5B32B 2CWEA 3KXBB 4LD9A 4WNNB 5GXQD 4WU8B 3RELD 1U35C 2HUEB 3REIC 3AYWC 3B6FC 5CP6B 5AVCC 4X23C 3O62D 4J8VA 3W98C 3WA9D 1P3BD 1P3KC 5B40B 2YFWB 3MGSC 5B32G 2CV5A 3A6NA 5AY8D 3B0CW 4LD9B 5AVBA 1P3MA 1EQZA 2AROD 3W99D 2NQBA 3MGPD 5GT0D 3REHD 4J8VB 5CPKD 1KX5C 1P3OC 1HQ3D 5JRGC 3C1BB 5GSUA 3O62A 3WA9A 4NFTA 5B32C 2CV5B 2HUEC 3LJAC 5AVBB 5AV6C 1EQZB 4EO5B 1F1EA 3AZEA 2HIOC 2NQBB 4E44A 5BO0A 3KWQC 3B0DB 3AV2A 5B2JC 1A7WA 5GXQB 3RELB 3AFAC 1AOID 2AROA 5B40C 1U35D 1KU5A 3REID 5GT0A 1H3OA 2RVQC 3O62B 3AYWD 4YS3C 5CPKA 3B6FD 1BH8A 3WA9B 5AVCD 3AZJA 1P3BB 4UUZA 3W98D 1HQ3A 3VH6W 3AZGD 1ID3C 1P3KD 4JJNC 3AZEB 5CPIC 3WTPC 4G92C 2IO5C 4ZUXA 5BO0B 3NQJA 3MGSD 3AV2B 4J8XA 1KX4A 2AROB 2BYKA 4WU9A 3VH6A 3C1CA 4QLCA 3X1UA 5GT0B 3A6NC 1H3OB 3REHB 2CV5C 5CPKB 3AZJB 5BNXA 5AVBC 1U35A 3MGQA 1P3MC 4UUZB 3VH5A 1HQ3B 1KX5D 1P3OD 3B0DC 5JRGD 4NE5A 4ZUXB 4X23A 3NQJB 5B32D 5C3IC 4J8XB 1KX4B 3LJAD 5GSUC 1BH9A 3NQUA 2BYKB 5AV6D 4WU9B 3MGSA 3C1CB 1TZYC 4QLCB 5BNXB 1U35B 3AFAD 4KUDC 3AZEC 4HGAC 3UTBA 5B40D 1P3AC 3AV2C 2BYMA 5AVCB 4X23B 1B6WA 5AV5C 4J8UC 1KX5A 3AZKC 4H9NA 3X1VC 1BH9B 3NQUB 2NZDC 4JJND 3WTPD 3MGSB 5CPID 3AZJC 4J8VD 3KUYA 3LJAA 3MGRC 2HIOA 4ZUXC 3KWQA 2BYMB 5B2JA 5KDMA 3A6ND 3REKA 2CV5D 3AFAA 1KX5B 4H9NB 1WWSA 4Z5TC 5AVBD 5CPJC 4WU9C 1P3MD 1EQZD 1S32C 3C1CC 3REJC 4QLCC 3X1UC 1R4VA 4YS3A 3AZFA 2FJ7C 1ULYA 3MGQC 3KUYB 1N1JB 1P3IC 3LJAB 5BNVA 5BT1C 5AV6B 1ID3A 4JJNA 5B0YC 3WTPA 5CPIA 5GSUD 2HIOB 5B31A 4H9QA 3KWQB 1TZYD 5DNMC 5B2JB 5AV9A 5KDMB 3REKB 1P3FC 5BS7A 3AFAB 2YFVA 4KUDD 3AZED 4XUJA 2F8NA 4YS3B 3AZFB 1P3AD 3AV2D 5AV5D 4J8UD 3W97C 4YM6C 3UTBC 3WAAA 4Z66C 3AZKD 5JA4A 5BNVB 1ID3B 4JJNB 3WTPB 4G92B 5B2IC 5CPIB 2IO5B 5B31B 3X1VD 2NZDD 5AV9B 3AZJD 2YFVB 5B1LA 3MGRD 1TZYA 4XUJB 5B0ZC 4ZUXD 2F8NB 3A6NB 3LZ1A 3KUYC 4H9SA 3AV1C 4J8XD 1P3MB 1KX4D 4KUDA 3WAAB 5JA4B 1TAFA 5B31G 4WU9D 1S32D 3C1CD 1P3AA 4QLCD 3X1UD 3AZLC 3REKC 5AV5A 4J8UA 1F66A 3TU4A 4AWLC 2FJ7D 3AZKA 5C3IB 3MGQD 1P3ID 5B1LB 5GSUB 2F8NG 3X1VA 2NZDA 5BT1D 3AZFC 4M6BA 1TZYB 4X23D 3LZ1B 5DNMD 3MGRA 4KUDB 4HGAB 1TAFB 5B31C 1P3AB 3VH5W 5AV9C 5AV5B 5BS7C 4J8UB 5DNNC 3AZKB 4Z5TA 5CPJA 3W97D 1S32A 4YM6D 3UTBD 4XUJC 3REJA 3X1SA 3X1VB 1P34A 2NZDB 3WKJC 3AZNC 3UTAA 1BH8B 2FJ7A 3MNNA 1P3IA 3WAAC 4KGCC 3MGRB 5B0YA 1M19C 5B1MC 3R45A 5DNMA 5B0ZD 3MVDA 1P3FA 3KUYD 3UT9A 5B1LC 3AV1D 4Z5TB 5CPJB 1S32B 3REJB 3X1UB 2HIOD 1P34B 3KWQD 3LZ1C 3UTAB 4H9SC 5B2JD 3AZLD 2FJ7B 3REKD 3B0CT 3W97A 3MGQB 1P3IB 4YM6A 4Z66A 3AZMC 3KSYA 5B0YB 5B2IA 2RVQD 4E45A 1F66C 4YS3D 4CSRA 3TU4C 3AZFD 3R45B 5DNMB 5CHLB 1P3FB 2F8NH 4H9RA 1JFIA 4CAYA 1ID3D 1ZLAA 5B33C 5B0ZA 5B31D 4NE3A 1P3GC 5AV9D 3AV1A 2PYOA 3LELA 5DNND 3W97B 1M1AA 4YM6B 3UTBB 4Z66B 4H9OA 3LZ0A 4XUJD 5B2IB 3AZLA 5AY8C 2F8ND 3AZND 4CSRB 4WZSB 4Z2MG 4XZQA 4H9RB 4KHAA 3WAAD 4CAYB 4KGCD 3X1SC 1P34C 4J8WC 1ZLAB 3UTAC 5B0ZB 3MNNC 3AV1B 2PYOB 3LELB 2LY8A 3AZHC 1M1AB 4H9OB 5B1LD 3LZ0B 4ZBJB 1WWIA 3AZLB 3MVDC 5DNNA 3LZ1D 4AWLB 3UT9C 3AZIA 5B24C 3B6GA 5AV8C 1P3PA 4KHAB 1KX3C 3AZMD 3WKJA 5E5AA 3AZNA 3AN2C 4R8PC 1AOIC 1F66D 3TU4D 4KGCA 1M19A 5B1MA 4H9PA 4H9QB 4G91B 3W96C 5B33D 1M18C 5DNNB 3AZGC 1P3GD 3AZIB 3B6GB 1ZLAC 3C1BA 1P3PB 5GT3A 3WKJB 5E5AB 3AZNB 2PYOC 3LELC 1M1AC 4DRBA 3LZ0C 4Z5TD 3AZMA 4ZBJC 5CPJD 4KGCB 5F99A 3REJD 3X1SD 5B1MB 1M19B 1B67A 4H9PB 4J8WD 1P34D 3UTAD 4Z2MH 5GXQA 3RELA 1P3LC 4XZQC 3WTPE 3MNND 3AZHD 5B0YD 5GT3B 5B33A 3X1TC 1BFMA 3KXBC 1P3BA 4WU8C 1P3GA 3MVDD 1P3FD
chains in the Genus database with same CATH superfamily
3UT9D 5B24D 3AZMB 5AV8D 4G91C 5CP6C 5F99B 1KX3D 5AY8A 1F66B 3AN2D 3TU4B 4R8PD 4WV4B 5G49A 3AZIC 3B6GC 3AL0C 3W99A 1P3PC 3KFUG 4Z66D 2F8NK 5FUGA 3MGPA 5E5AC 4J8WA 5B33B 5B2ID 3REHA 3W96D 4LD9C 2ZM5A 1M18D 1P3GB 3AZHA 3V9RA 1ZLAD 5AY8B 4J8VC 5G49B 5B24A 3B0BA 2PYOD 3LELD 5AV8A 3W99B 2F2AC 3C1BC 1M1AD 5GT3C 1KX3A 3A1IA 5FUGB 3X1SB 3LZ0D 3MGPB 4J8WB 3AN2A 4R8PA 1AOIA 3MNNB 2L5AA 1P3LD 1EQZC 4EO5C 4XZQD 3REIA 3AZHB 3V9RB 5F99C 2NQBC 3AYWA 3W96A 3B6FA 5AVCA 1M18A 3A1KA 5GXQC 3RELC 1HTAA 3H0MC 3X1TD 3MVDB 3W98A 3KXBD 4DQYB 4WU8D 2Y2PA 3UT9B 3AZGA 5B24B 1P3KA 5AV8B 1KX3B 3O62C 3WA9C 5CP6D 3AN2B 1P3BC 4R8PB 1AOIB 3H0LC 3AZID 3B6GD 3REIB 1P3PD 3AYWB 4NE6A 3B6FB 5E5AD 3WKJD 3W96B 1M18B 1P3LA 3W98B 2AROC 3W99C 4LD9D 1P3OA 1JFIB 3AZGB 1P3KB 3MGPC 5JRGA 5GT0C 3REHC 3X1TA 5B1MD 1M19D 1Q9CA 5CPKC 5B32A 3KXBA 4WNNA 4WU8A 4DRAA 1HQ3C 1N1JA 2JSSA 3VH6T 5AV6A 5CP6A 3C1BD 5GT3D 3VH5T 4J8XC 1P3LB 1KX4C 4XZQB 5B40A 1P3OB 2G5IC 2YFWA 5JRGB 5F99D 2NQBD 3X1TB 5B32B 2CWEA 3KXBB 4LD9A 4WNNB 5GXQD 4WU8B 3RELD 1U35C 2JE5A 2HUEB 3REIC 3AYWC 3B6FC 5CP6B 5AVCC 4X23C 3O62D 4J8VA 3W98C 3WA9D 1P3BD 1P3KC 2BG1A 5B40B 2YFWB 3P5JB 5B32G 3MGSC 2CV5A 3A6NA 5AY8D 3B0CW 4LD9B 1T3UA 5AVBA 1P3MA 1EQZA 2AROD 3W99D 3IP4C 2NQBA 3MGPD 5GT0D 3REHD 4J8VB 5CPKD 1KX5C 1P3OC 1HQ3D 5JRGC 3C1BB 2Y2OA 5GSUA 3O62A 3WA9A 4NFTA 5B32C 2CV5B 2HUEC 2ZY3A 3LJAC 5AVBB 5AV6C 1EQZB 4EO5B 1F1EA 3AZEA 2HIOC 3F6TA 4E44A 2NQBB 5BO0A 3KWQC 3B0DB 3AV2A 5B2JC 1A7WA 5GXQB 3RELB 3AFAC 2W8SA 1AOID 2AROA 5B40C 2Y2HA 1U35D 1KU5A 3REID 5GT0A 1H3OA 2RVQC 3O62B 3AYWD 4YS3C 5CPKA 3B6FD 1BH8A 3WA9B 5AVCD 3AZJA 1P3BB 4UUZA 3W98D 1HQ3A 2RIQA 3VH6W 3AZGD 1ID3C 1P3KD 4JJNC 3AZEB 5CPIC 3WTPC 4G92C 2IO5C 4ZUXA 5BO0B 3NQJA 3MGSD 3AV2B 4J8XA 1KX4A 2AROB 2BYKA 4WU9A 3VH6A 3C1CA 4QLCA 3X1UA 5GT0B 3A6NC 1H3OB 2Y2KA 3REHB 2CV5C 5CPKB 3AZJB 5BNXA 5AVBC 1U35A 3MGQA 1P3MC 4UUZB 3VH5A 1HQ3B 1KX5D 2Y2MA 1P3OD 3B0DC 5JRGD 4NE5A 4ZUXB 4X23A 3NQJB 5B32D 5C3IC 4J8XB 1KX4B 2Y2IA 3LJAD 5GSUC 1BH9A 3NQUA 2BYKB 5AV6D 4WU9B 3MGSA 3C1CB 1TZYC 4QLCB 5BNXB 1U35B 3AFAD 4KUDC 3AZEC 2FFFB 4HGAC 3UTBA 5B40D 1P3AC 3AV2C 2BYMA 5AVCB 4X23B 1B6WA 5AV5C 4J8UC 1KX5A 3AZKC 4H9NA 2J8PA 3EPKA 3X1VC 1BH9B 3NQUB 2NZDC 4JJND 3WTPD 3MGSB 5CPID 3AZJC 4J8VD 3KUYA 3LJAA 3MGRC 2HIOA 4ZUXC 3KWQA 2Y2QA 2BYMB 5B2JA 5KDMA 3A6ND 3REKA 2XD1A 2CV5D 3AFAA 1KX5B 4H9NB 1WWSA 4Z5TC 5AVBD 5CPJC 4WU9C 1P3MD 1EQZD 1S32C 3C1CC 3REJC 4QLCC 3X1UC 1R4VA 4YS3A 3AZFA 2FJ7C 3EPHA 1ULYA 3MGQC 3KUYB 1N1JB 1P3IC 2Y2JA 3LJAB 5BNVA 5BT1C 5AV6B 1ID3A 4JJNA 5B0YC 3WTPA 5CPIA 5GSUD 2HIOB 5B31A 4H9QA 3KWQB 2ZY2A 1TZYD 5DNMC 5B2JB 5AV9A 5KDMB 3REKB 1P3FC 5BS7A 3AFAB 3FDDA 2YFVA 4KUDD 3AZED 4XUJA 2F8NA 3EG5B 4YS3B 3AZFB 1P3AD 3AV2D 5AV5D 4J8UD 3W97C 4YM6C 3UTBC 3WAAA 4Z66C 3AZKD 5JA4A 5BNVB 1ID3B 1Z2CB 4JJNB 3WTPB 4G92B 5B2IC 2DF4C 2IO5B 5CPIB 5B31B 3X1VD 2NZDD 4WJ3C 1W2EA 5AV9B 3AZJD 2YFVB 5B1LA 3MGRD 1TZYA 4XUJB 5B0ZC 4ZUXD 2F8NB 3A6NB 3LZ1A 3KUYC 4H9SA 2JCHA 3AV1C 4J8XD 1P3MB 1KX4D 4KUDA 3WAAB 5JA4B 1TAFA 5B31G 4WU9D 1S32D 3C1CD 1P3AA 4QLCD 3X1UD 3AZLC 3REKC 5AV5A 4J8UA 1F66A 3TU4A 4AWLC 2FJ7D 3AZKA 5C3IB 3MGQD 1P3ID 5B1LB 5GSUB 2F8NG 3X1VA 2ZY5A 5BT1D 2NZDA 3AZFC 4M6BA 1TZYB 4X23D 3LZ1B 5DNMD 3MGRA 4KUDB 4HGAB 1TAFB 5B31C 1P3AB 3VH5W 5AV9C 5AV5B 5BS7C 4J8UB 5DNNC 3AZKB 4Z5TA 5CPJA 3W97D 2VQRA 1S32A 4YM6D 3UTBD 4XUJC 3REJA 3X1SA 3X1VB 1P34A 2NZDB 3WKJC 3AZNC 3UTAA 1BH8B 2FJ7A 3MNNA 1P3IA 3WAAC 4KGCC 3MGRB 2Y2LA 5B0YA 2DQNC 2ZY4A 1M19C 5B1MC 3R45A 5DNMA 5B0ZD 3MVDA 1P3FA 3KUYD 3UT9A 2UWXA 5B1LC 3AV1D 4Z5TB 5CPJB 1S32B 3REJB 3X1UB 2HIOD 1P34B 3KWQD 1PZRA 3LZ1C 3UTAB 4H9SC 5B2JD 3AZLD 2FJ7B 3REKD 3B0CT 3W97A 3MGQB 1P3IB 4YM6A 4Z66A 3AZMC 2XD5A 3KSYA 2Y2NA 5B0YB 5B2IA 2RVQD 4E45A 1F66C 4YS3D 4CSRA 3TU4C 3AZFD 3R45B 5DNMB 5CHLB 1P3FB 2F8NH 4H9RA 1JFIA 4CAYA 1ID3D 1ZLAA 5B33C 5B0ZA 5B31D 4NE3A 1P3GC 5AV9D 3AV1A 2PYOA 3LELA 5DNND 3W97B 3H0RC 1M1AA 4YM6B 3UTBB 4Z66B 4H9OA 3LZ0A 4XUJD 5B2IB 3AZLA 5AY8C 2F8ND 3AZND 4CSRB 4WZSB 4Z2MG 4XZQA 4H9RB 4KHAA 3WAAD 4CAYB 4KGCD 3X1SC 1P34C 4J8WC 1ZLAB 3UTAC 5B0ZB 3MNNC 3AV1B 2PYOB 3LELB 2LY8A 3AZHC 1M1AB 3EPJA 4H9OB 5B1LD 3LZ0B 4ZBJB 1WWIA 3AZLB 3MVDC 5DNNA 3LZ1D 4AWLB 3UT9C 3AZIA 5B24C 3B6GA 5AV8C 1P3PA 4KHAB 1KX3C 3EPLA 3AZMD 3WKJA 5E5AA 2G5HC 3AZNA 3AN2C 4R8PC 1AOIC 1F66D 3TU4D 4KGCA 1M19A 5B1MA 4H9PA 4H9QB 4G91B 3W96C 5B33D 1M18C 5DNNB 3AZGC 1P3GD 3AZIB 3B6GB 1ZLAC 3C1BA 1P3PB 5GT3A 3WKJB 5E5AB 3AZNB 2PYOC 3LELC 1M1AC 4DRBA 3LZ0C 4Z5TD 3AZMA 4ZBJC 5CPJD 4KGCB 5F99A 3REJD 3X1SD 5B1MB 1M19B 1B67A 4H9PB 4J8WD 1P34D 3UTAD 4Z2MH 5GXQA 2Y2GA 3RELA 1P3LC 4XZQC 3WTPE 3MNND 4UPKA 3AZHD 5B0YD 5GT3B 5B33A 3X1TC 1BFMA 3KXBC 1P3BA 4WU8C 1P3GA 3MVDD 1P3FD
chains in the Genus database with same CATH topology
3UT9D 5B24D 3AZMB 5AV8D 4G91C 5CP6C 5F99B 1KX3D 5AY8A 1F66B 3AN2D 3TU4B 4R8PD 4WV4B 5G49A 3AZIC 3B6GC 3AL0C 3W99A 1P3PC 3KFUG 4Z66D 2F8NK 5FUGA 3MGPA 5E5AC 4J8WA 5B33B 5B2ID 3REHA 3W96D 4LD9C 2ZM5A 1M18D 1P3GB 3AZHA 3V9RA 1ZLAD 5AY8B 4J8VC 5G49B 5B24A 3B0BA 2PYOD 3LELD 5AV8A 3W99B 2F2AC 3C1BC 1M1AD 5GT3C 1KX3A 3A1IA 5FUGB 3X1SB 3LZ0D 3MGPB 4J8WB 3AN2A 4R8PA 1AOIA 3MNNB 2L5AA 1P3LD 1EQZC 4EO5C 4XZQD 3REIA 3AZHB 3V9RB 5F99C 2NQBC 3AYWA 3W96A 3B6FA 5AVCA 1M18A 3A1KA 5GXQC 3RELC 1HTAA 3H0MC 3X1TD 3MVDB 3W98A 3KXBD 4DQYB 4WU8D 2Y2PA 3UT9B 3AZGA 5B24B 1P3KA 5AV8B 1KX3B 3O62C 3WA9C 5CP6D 3AN2B 1P3BC 4R8PB 1AOIB 3H0LC 3AZID 3B6GD 3REIB 1P3PD 3AYWB 4NE6A 3B6FB 5E5AD 3WKJD 3W96B 1M18B 1P3LA 3W98B 2AROC 3W99C 4LD9D 1P3OA 1JFIB 3AZGB 1P3KB 3MGPC 5JRGA 5GT0C 3REHC 3X1TA 5B1MD 1M19D 1Q9CA 5CPKC 5B32A 3KXBA 4WNNA 4WU8A 4DRAA 1HQ3C 1N1JA 2JSSA 3VH6T 5AV6A 5CP6A 3C1BD 5GT3D 3VH5T 4J8XC 1P3LB 1KX4C 4XZQB 5B40A 1P3OB 2G5IC 2YFWA 5JRGB 5F99D 2NQBD 3X1TB 5B32B 2CWEA 3KXBB 4LD9A 4WNNB 5GXQD 4WU8B 3RELD 1U35C 2JE5A 2HUEB 3REIC 3AYWC 3B6FC 5CP6B 5AVCC 4X23C 3O62D 4J8VA 3W98C 3WA9D 1P3BD 1P3KC 2BG1A 5B40B 2YFWB 3P5JB 5B32G 3MGSC 2CV5A 3A6NA 5AY8D 3B0CW 4LD9B 1T3UA 5AVBA 1P3MA 1EQZA 2AROD 3W99D 3IP4C 2NQBA 3MGPD 5GT0D 3REHD 4J8VB 5CPKD 1KX5C 1P3OC 1HQ3D 5JRGC 3C1BB 2Y2OA 5GSUA 3O62A 3WA9A 4NFTA 5B32C 2CV5B 2HUEC 2ZY3A 3LJAC 5AVBB 5AV6C 1EQZB 4EO5B 1F1EA 3AZEA 2HIOC 3F6TA 4E44A 2NQBB 5BO0A 3KWQC 3B0DB 3AV2A 5B2JC 1A7WA 5GXQB 3RELB 3AFAC 2W8SA 1AOID 2AROA 5B40C 2Y2HA 1U35D 1KU5A 3REID 5GT0A 1H3OA 2RVQC 3O62B 3AYWD 4YS3C 5CPKA 3B6FD 1BH8A 3WA9B 5AVCD 3AZJA 1P3BB 4UUZA 3W98D 1HQ3A 2RIQA 3VH6W 3AZGD 1ID3C 1P3KD 4JJNC 3AZEB 5CPIC 3WTPC 4G92C 2IO5C 4ZUXA 5BO0B 3NQJA 3MGSD 3AV2B 4J8XA 1KX4A 2AROB 2BYKA 4WU9A 3VH6A 3C1CA 4QLCA 3X1UA 5GT0B 3A6NC 1H3OB 2Y2KA 3REHB 2CV5C 5CPKB 3AZJB 5BNXA 5AVBC 1U35A 3MGQA 1P3MC 4UUZB 3VH5A 1HQ3B 1KX5D 2Y2MA 1P3OD 3B0DC 5JRGD 4NE5A 4ZUXB 4X23A 3NQJB 5B32D 5C3IC 4J8XB 1KX4B 2Y2IA 3LJAD 5GSUC 1BH9A 3NQUA 2BYKB 5AV6D 4WU9B 3MGSA 3C1CB 1TZYC 4QLCB 5BNXB 1U35B 3AFAD 4KUDC 3AZEC 2FFFB 4HGAC 3UTBA 5B40D 1P3AC 3AV2C 2BYMA 5AVCB 4X23B 1B6WA 5AV5C 4J8UC 1KX5A 3AZKC 4H9NA 2J8PA 3EPKA 3X1VC 1BH9B 3NQUB 2NZDC 4JJND 3WTPD 3MGSB 5CPID 3AZJC 4J8VD 3KUYA 3LJAA 3MGRC 2HIOA 4ZUXC 3KWQA 2Y2QA 2BYMB 5B2JA 5KDMA 3A6ND 3REKA 2XD1A 2CV5D 3AFAA 1KX5B 4H9NB 1WWSA 4Z5TC 5AVBD 5CPJC 4WU9C 1P3MD 1EQZD 1S32C 3C1CC 3REJC 4QLCC 3X1UC 1R4VA 4YS3A 3AZFA 2FJ7C 3EPHA 1ULYA 3MGQC 3KUYB 1N1JB 1P3IC 2Y2JA 3LJAB 5BNVA 5BT1C 5AV6B 1ID3A 4JJNA 5B0YC 3WTPA 5CPIA 5GSUD 2HIOB 5B31A 4H9QA 3KWQB 2ZY2A 1TZYD 5DNMC 5B2JB 5AV9A 5KDMB 3REKB 1P3FC 5BS7A 3AFAB 3FDDA 2YFVA 4KUDD 3AZED 4XUJA 2F8NA 3EG5B 4YS3B 3AZFB 1P3AD 3AV2D 5AV5D 4J8UD 3W97C 4YM6C 3UTBC 3WAAA 4Z66C 3AZKD 5JA4A 5BNVB 1ID3B 1Z2CB 4JJNB 3WTPB 4G92B 5B2IC 2DF4C 2IO5B 5CPIB 5B31B 3X1VD 2NZDD 4WJ3C 1W2EA 5AV9B 3AZJD 2YFVB 5B1LA 3MGRD 1TZYA 4XUJB 5B0ZC 4ZUXD 2F8NB 3A6NB 3LZ1A 3KUYC 4H9SA 2JCHA 3AV1C 4J8XD 1P3MB 1KX4D 4KUDA 3WAAB 5JA4B 1TAFA 5B31G 4WU9D 1S32D 3C1CD 1P3AA 4QLCD 3X1UD 3AZLC 3REKC 5AV5A 4J8UA 1F66A 3TU4A 4AWLC 2FJ7D 3AZKA 5C3IB 3MGQD 1P3ID 5B1LB 5GSUB 2F8NG 3X1VA 2ZY5A 5BT1D 2NZDA 3AZFC 4M6BA 1TZYB 4X23D 3LZ1B 5DNMD 3MGRA 4KUDB 4HGAB 1TAFB 5B31C 1P3AB 3VH5W 5AV9C 5AV5B 5BS7C 4J8UB 5DNNC 3AZKB 4Z5TA 5CPJA 3W97D 2VQRA 1S32A 4YM6D 3UTBD 4XUJC 3REJA 3X1SA 3X1VB 1P34A 2NZDB 3WKJC 3AZNC 3UTAA 1BH8B 2FJ7A 3MNNA 1P3IA 3WAAC 4KGCC 3MGRB 2Y2LA 5B0YA 2DQNC 2ZY4A 1M19C 5B1MC 3R45A 5DNMA 5B0ZD 3MVDA 1P3FA 3KUYD 3UT9A 2UWXA 5B1LC 3AV1D 4Z5TB 5CPJB 1S32B 3REJB 3X1UB 2HIOD 1P34B 3KWQD 1PZRA 3LZ1C 3UTAB 4H9SC 5B2JD 3AZLD 2FJ7B 3REKD 3B0CT 3W97A 3MGQB 1P3IB 4YM6A 4Z66A 3AZMC 2XD5A 3KSYA 2Y2NA 5B0YB 5B2IA 2RVQD 4E45A 1F66C 4YS3D 4CSRA 3TU4C 3AZFD 3R45B 5DNMB 5CHLB 1P3FB 2F8NH 4H9RA 1JFIA 4CAYA 1ID3D 1ZLAA 5B33C 5B0ZA 5B31D 4NE3A 1P3GC 5AV9D 3AV1A 2PYOA 3LELA 5DNND 3W97B 3H0RC 1M1AA 4YM6B 3UTBB 4Z66B 4H9OA 3LZ0A 4XUJD 5B2IB 3AZLA 5AY8C 2F8ND 3AZND 4CSRB 4WZSB 4Z2MG 4XZQA 4H9RB 4KHAA 3WAAD 4CAYB 4KGCD 3X1SC 1P34C 4J8WC 1ZLAB 3UTAC 5B0ZB 3MNNC 3AV1B 2PYOB 3LELB 2LY8A 3AZHC 1M1AB 3EPJA 4H9OB 5B1LD 3LZ0B 4ZBJB 1WWIA 3AZLB 3MVDC 5DNNA 3LZ1D 4AWLB 3UT9C 3AZIA 5B24C 3B6GA 5AV8C 1P3PA 4KHAB 1KX3C 3EPLA 3AZMD 3WKJA 5E5AA 2G5HC 3AZNA 3AN2C 4R8PC 1AOIC 1F66D 3TU4D 4KGCA 1M19A 5B1MA 4H9PA 4H9QB 4G91B 3W96C 5B33D 1M18C 5DNNB 3AZGC 1P3GD 3AZIB 3B6GB 1ZLAC 3C1BA 1P3PB 5GT3A 3WKJB 5E5AB 3AZNB 2PYOC 3LELC 1M1AC 4DRBA 3LZ0C 4Z5TD 3AZMA 4ZBJC 5CPJD 4KGCB 5F99A 3REJD 3X1SD 5B1MB 1M19B 1B67A 4H9PB 4J8WD 1P34D 3UTAD 4Z2MH 5GXQA 2Y2GA 3RELA 1P3LC 4XZQC 3WTPE 3MNND 4UPKA 3AZHD 5B0YD 5GT3B 5B33A 3X1TC 1BFMA 3KXBC 1P3BA 4WU8C 1P3GA 3MVDD 1P3FD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UT9 D;  5B24 D;  3AZM B;  5AV8 D;  4G91 C;  5CP6 C;  5F99 B;  1KX3 D;  5AY8 A;  1F66 B;  3AN2 D;  3TU4 B;  4R8P D;  4WV4 B;  5G49 A;  3AZI C;  3B6G C;  3W99 A;  1P3P C;  4Z66 D;  2F8N K;  5FUG A;  3MGP A;  5E5A C;  4J8W A;  5B33 B;  5B2I D;  3REH A;  3W96 D;  4LD9 C;  1M18 D;  1P3G B;  3AZH A;  3V9R A;  1ZLA D;  5AY8 B;  4J8V C;  5G49 B;  5B24 A;  3B0B A;  2PYO D;  3LEL D;  5AV8 A;  3W99 B;  3C1B C;  1M1A D;  5GT3 C;  1KX3 A;  5FUG B;  3X1S B;  3LZ0 D;  3MGP B;  4J8W B;  3AN2 A;  4R8P A;  1AOI A;  3MNN B;  2L5A A;  1P3L D;  1EQZ C;  4EO5 C;  4XZQ D;  3REI A;  3AZH B;  3V9R B;  5F99 C;  2NQB C;  3AYW A;  3W96 A;  3B6F A;  5AVC A;  1M18 A;  5GXQ C;  3REL C;  1HTA A;  3X1T D;  3MVD B;  3W98 A;  3KXB D;  4WU8 D;  3AZG A;  3UT9 B;  5B24 B;  1P3K A;  5AV8 B;  1KX3 B;  3O62 C;  3WA9 C;  5CP6 D;  3AN2 B;  1P3B C;  4R8P B;  1AOI B;  3AZI D;  3B6G D;  3REI B;  1P3P D;  3AYW B;  4NE6 A;  3B6F B;  5E5A D;  3WKJ D;  3W96 B;  1M18 B;  1P3L A;  3W98 B;  2ARO C;  3W99 C;  4LD9 D;  1P3O A;  1JFI B;  3AZG B;  1P3K B;  3MGP C;  5JRG A;  5GT0 C;  3REH C;  3X1T A;  5B1M D;  1M19 D;  1Q9C A;  5CPK C;  5B32 A;  3KXB A;  4WNN A;  4WU8 A;  4DRA A;  1HQ3 C;  1N1J A;  2JSS A;  3VH6 T;  5AV6 A;  5CP6 A;  3C1B D;  5GT3 D;  3VH5 T;  4J8X C;  1P3L B;  1KX4 C;  4XZQ B;  5B40 A;  1P3O B;  2YFW A;  5JRG B;  5F99 D;  2NQB D;  3X1T B;  5B32 B;  2CWE A;  3KXB B;  4LD9 A;  4WNN B;  5GXQ D;  4WU8 B;  3REL D;  1U35 C;  2HUE B;  3REI C;  3AYW C;  3B6F C;  5CP6 B;  5AVC C;  4X23 C;  3O62 D;  4J8V A;  3W98 C;  3WA9 D;  1P3B D;  1P3K C;  5B40 B;  2YFW B;  3MGS C;  5B32 G;  2CV5 A;  3A6N A;  5AY8 D;  3B0C W;  4LD9 B;  5AVB A;  1P3M A;  1EQZ A;  2ARO D;  3W99 D;  2NQB A;  3MGP D;  5GT0 D;  3REH D;  4J8V B;  5CPK D;  1KX5 C;  1P3O C;  1HQ3 D;  5JRG C;  3C1B B;  5GSU A;  3O62 A;  3WA9 A;  4NFT A;  5B32 C;  2CV5 B;  2HUE C;  3LJA C;  5AVB B;  5AV6 C;  1EQZ B;  4EO5 B;  1F1E A;  3AZE A;  2HIO C;  2NQB B;  4E44 A;  5BO0 A;  3KWQ C;  3B0D B;  3AV2 A;  5B2J C;  1A7W A;  5GXQ B;  3REL B;  3AFA C;  1AOI D;  2ARO A;  5B40 C;  1U35 D;  1KU5 A;  3REI D;  5GT0 A;  1H3O A;  2RVQ C;  3O62 B;  3AYW D;  4YS3 C;  5CPK A;  3B6F D;  1BH8 A;  3WA9 B;  5AVC D;  3AZJ A;  1P3B B;  4UUZ A;  3W98 D;  1HQ3 A;  3VH6 W;  3AZG D;  1ID3 C;  1P3K D;  4JJN C;  3AZE B;  5CPI C;  3WTP C;  4G92 C;  2IO5 C;  4ZUX A;  5BO0 B;  3NQJ A;  3MGS D;  3AV2 B;  4J8X A;  1KX4 A;  2ARO B;  2BYK A;  4WU9 A;  3VH6 A;  3C1C A;  4QLC A;  3X1U A;  5GT0 B;  3A6N C;  1H3O B;  3REH B;  2CV5 C;  5CPK B;  3AZJ B;  5BNX A;  5AVB C;  1U35 A;  3MGQ A;  1P3M C;  4UUZ B;  3VH5 A;  1HQ3 B;  1KX5 D;  1P3O D;  3B0D C;  5JRG D;  4NE5 A;  4ZUX B;  4X23 A;  3NQJ B;  5B32 D;  5C3I C;  4J8X B;  1KX4 B;  3LJA D;  5GSU C;  1BH9 A;  3NQU A;  2BYK B;  5AV6 D;  4WU9 B;  3MGS A;  3C1C B;  1TZY C;  4QLC B;  5BNX B;  1U35 B;  3AFA D;  4KUD C;  3AZE C;  4HGA C;  3UTB A;  5B40 D;  1P3A C;  3AV2 C;  2BYM A;  5AVC B;  4X23 B;  1B6W A;  5AV5 C;  4J8U C;  1KX5 A;  3AZK C;  4H9N A;  3X1V C;  1BH9 B;  3NQU B;  2NZD C;  4JJN D;  3WTP D;  3MGS B;  5CPI D;  3AZJ C;  4J8V D;  3KUY A;  3LJA A;  3MGR C;  2HIO A;  4ZUX C;  3KWQ A;  2BYM B;  5B2J A;  5KDM A;  3A6N D;  3REK A;  2CV5 D;  3AFA A;  1KX5 B;  4H9N B;  1WWS A;  4Z5T C;  5AVB D;  5CPJ C;  4WU9 C;  1P3M D;  1EQZ D;  1S32 C;  3C1C C;  3REJ C;  4QLC C;  3X1U C;  1R4V A;  4YS3 A;  3AZF A;  2FJ7 C;  1ULY A;  3MGQ C;  3KUY B;  1N1J B;  1P3I C;  3LJA B;  5BNV A;  5BT1 C;  5AV6 B;  1ID3 A;  4JJN A;  5B0Y C;  3WTP A;  5CPI A;  5GSU D;  2HIO B;  5B31 A;  4H9Q A;  3KWQ B;  1TZY D;  5DNM C;  5B2J B;  5AV9 A;  5KDM B;  3REK B;  1P3F C;  5BS7 A;  3AFA B;  2YFV A;  4KUD D;  3AZE D;  4XUJ A;  2F8N A;  4YS3 B;  3AZF B;  1P3A D;  3AV2 D;  5AV5 D;  4J8U D;  3W97 C;  4YM6 C;  3UTB C;  3WAA A;  4Z66 C;  3AZK D;  5JA4 A;  5BNV B;  1ID3 B;  4JJN B;  3WTP B;  4G92 B;  5B2I C;  5CPI B;  2IO5 B;  5B31 B;  3X1V D;  2NZD D;  5AV9 B;  3AZJ D;  2YFV B;  5B1L A;  3MGR D;  1TZY A;  4XUJ B;  5B0Z C;  4ZUX D;  2F8N B;  3A6N B;  3LZ1 A;  3KUY C;  4H9S A;  3AV1 C;  4J8X D;  1P3M B;  1KX4 D;  4KUD A;  3WAA B;  5JA4 B;  1TAF A;  5B31 G;  4WU9 D;  1S32 D;  3C1C D;  1P3A A;  4QLC D;  3X1U D;  3AZL C;  3REK C;  5AV5 A;  4J8U A;  1F66 A;  3TU4 A;  4AWL C;  2FJ7 D;  3AZK A;  5C3I B;  3MGQ D;  1P3I D;  5B1L B;  5GSU B;  2F8N G;  3X1V A;  2NZD A;  5BT1 D;  3AZF C;  4M6B A;  1TZY B;  4X23 D;  3LZ1 B;  5DNM D;  3MGR A;  4KUD B;  4HGA B;  1TAF B;  5B31 C;  1P3A B;  3VH5 W;  5AV9 C;  5AV5 B;  5BS7 C;  4J8U B;  5DNN C;  3AZK B;  4Z5T A;  5CPJ A;  3W97 D;  1S32 A;  4YM6 D;  3UTB D;  4XUJ C;  3REJ A;  3X1S A;  3X1V B;  1P34 A;  2NZD B;  3WKJ C;  3AZN C;  3UTA A;  1BH8 B;  2FJ7 A;  3MNN A;  1P3I A;  3WAA C;  4KGC C;  3MGR B;  5B0Y A;  1M19 C;  5B1M C;  3R45 A;  5DNM A;  5B0Z D;  3MVD A;  1P3F A;  3KUY D;  3UT9 A;  5B1L C;  3AV1 D;  4Z5T B;  5CPJ B;  1S32 B;  3REJ B;  3X1U B;  2HIO D;  1P34 B;  3KWQ D;  3LZ1 C;  3UTA B;  4H9S C;  5B2J D;  3AZL D;  2FJ7 B;  3REK D;  3B0C T;  3W97 A;  3MGQ B;  1P3I B;  4YM6 A;  4Z66 A;  3AZM C;  3KSY A;  5B0Y B;  5B2I A;  2RVQ D;  4E45 A;  1F66 C;  4YS3 D;  4CSR A;  3TU4 C;  3AZF D;  3R45 B;  5DNM B;  5CHL B;  1P3F B;  2F8N H;  4H9R A;  1JFI A;  4CAY A;  1ID3 D;  1ZLA A;  5B33 C;  5B0Z A;  5B31 D;  4NE3 A;  1P3G C;  5AV9 D;  3AV1 A;  2PYO A;  3LEL A;  5DNN D;  3W97 B;  1M1A A;  4YM6 B;  3UTB B;  4Z66 B;  4H9O A;  3LZ0 A;  4XUJ D;  5B2I B;  3AZL A;  5AY8 C;  2F8N D;  3AZN D;  4CSR B;  4WZS B;  4Z2M G;  4XZQ A;  4H9R B;  4KHA A;  3WAA D;  4CAY B;  4KGC D;  3X1S C;  1P34 C;  4J8W C;  1ZLA B;  3UTA C;  5B0Z B;  3MNN C;  3AV1 B;  2PYO B;  3LEL B;  2LY8 A;  3AZH C;  1M1A B;  4H9O B;  5B1L D;  3LZ0 B;  4ZBJ B;  1WWI A;  3AZL B;  3MVD C;  5DNN A;  3LZ1 D;  4AWL B;  3UT9 C;  3AZI A;  5B24 C;  3B6G A;  5AV8 C;  1P3P A;  4KHA B;  1KX3 C;  3AZM D;  3WKJ A;  5E5A A;  3AZN A;  3AN2 C;  4R8P C;  1AOI C;  1F66 D;  3TU4 D;  4KGC A;  1M19 A;  5B1M A;  4H9P A;  4H9Q B;  4G91 B;  3W96 C;  5B33 D;  1M18 C;  5DNN B;  3AZG C;  1P3G D;  3AZI B;  3B6G B;  1ZLA C;  3C1B A;  1P3P B;  5GT3 A;  3WKJ B;  5E5A B;  3AZN B;  2PYO C;  3LEL C;  1M1A C;  4DRB A;  3LZ0 C;  4Z5T D;  3AZM A;  4ZBJ C;  5CPJ D;  4KGC B;  5F99 A;  3REJ D;  3X1S D;  5B1M B;  1M19 B;  1B67 A;  4H9P B;  4J8W D;  1P34 D;  3UTA D;  4Z2M H;  5GXQ A;  3REL A;  1P3L C;  4XZQ C;  3WTP E;  3MNN D;  3AZH D;  5B0Y D;  5GT3 B;  5B33 A;  3X1T C;  1BFM A;  3KXB C;  1P3B A;  4WU8 C;  1P3G A;  3MVD D;  1P3F D; 
#chains in the Genus database with same CATH topology
 3UT9 D;  5B24 D;  3AZM B;  5AV8 D;  4G91 C;  5CP6 C;  5F99 B;  1KX3 D;  5AY8 A;  1F66 B;  3AN2 D;  3TU4 B;  4R8P D;  4WV4 B;  5G49 A;  3AZI C;  3B6G C;  3AL0 C;  3W99 A;  1P3P C;  3KFU G;  4Z66 D;  2F8N K;  5FUG A;  3MGP A;  5E5A C;  4J8W A;  5B33 B;  5B2I D;  3REH A;  3W96 D;  4LD9 C;  2ZM5 A;  1M18 D;  1P3G B;  3AZH A;  3V9R A;  1ZLA D;  5AY8 B;  4J8V C;  5G49 B;  5B24 A;  3B0B A;  2PYO D;  3LEL D;  5AV8 A;  3W99 B;  2F2A C;  3C1B C;  1M1A D;  5GT3 C;  1KX3 A;  3A1I A;  5FUG B;  3X1S B;  3LZ0 D;  3MGP B;  4J8W B;  3AN2 A;  4R8P A;  1AOI A;  3MNN B;  2L5A A;  1P3L D;  1EQZ C;  4EO5 C;  4XZQ D;  3REI A;  3AZH B;  3V9R B;  5F99 C;  2NQB C;  3AYW A;  3W96 A;  3B6F A;  5AVC A;  1M18 A;  3A1K A;  5GXQ C;  3REL C;  1HTA A;  3H0M C;  3X1T D;  3MVD B;  3W98 A;  3KXB D;  4DQY B;  4WU8 D;  2Y2P A;  3UT9 B;  3AZG A;  5B24 B;  1P3K A;  5AV8 B;  1KX3 B;  3O62 C;  3WA9 C;  5CP6 D;  3AN2 B;  1P3B C;  4R8P B;  1AOI B;  3H0L C;  3AZI D;  3B6G D;  3REI B;  1P3P D;  3AYW B;  4NE6 A;  3B6F B;  5E5A D;  3WKJ D;  3W96 B;  1M18 B;  1P3L A;  3W98 B;  2ARO C;  3W99 C;  4LD9 D;  1P3O A;  1JFI B;  3AZG B;  1P3K B;  3MGP C;  5JRG A;  5GT0 C;  3REH C;  3X1T A;  5B1M D;  1M19 D;  1Q9C A;  5CPK C;  5B32 A;  3KXB A;  4WNN A;  4WU8 A;  4DRA A;  1HQ3 C;  1N1J A;  2JSS A;  3VH6 T;  5AV6 A;  5CP6 A;  3C1B D;  5GT3 D;  3VH5 T;  4J8X C;  1P3L B;  1KX4 C;  4XZQ B;  5B40 A;  1P3O B;  2G5I C;  2YFW A;  5JRG B;  5F99 D;  2NQB D;  3X1T B;  5B32 B;  2CWE A;  3KXB B;  4LD9 A;  4WNN B;  5GXQ D;  4WU8 B;  3REL D;  1U35 C;  2JE5 A;  2HUE B;  3REI C;  3AYW C;  3B6F C;  5CP6 B;  5AVC C;  4X23 C;  3O62 D;  4J8V A;  3W98 C;  3WA9 D;  1P3B D;  1P3K C;  2BG1 A;  5B40 B;  2YFW B;  3P5J B;  5B32 G;  3MGS C;  2CV5 A;  3A6N A;  5AY8 D;  3B0C W;  4LD9 B;  1T3U A;  5AVB A;  1P3M A;  1EQZ A;  2ARO D;  3W99 D;  3IP4 C;  2NQB A;  3MGP D;  5GT0 D;  3REH D;  4J8V B;  5CPK D;  1KX5 C;  1P3O C;  1HQ3 D;  5JRG C;  3C1B B;  2Y2O A;  5GSU A;  3O62 A;  3WA9 A;  4NFT A;  5B32 C;  2CV5 B;  2HUE C;  2ZY3 A;  3LJA C;  5AVB B;  5AV6 C;  1EQZ B;  4EO5 B;  1F1E A;  3AZE A;  2HIO C;  3F6T A;  4E44 A;  2NQB B;  5BO0 A;  3KWQ C;  3B0D B;  3AV2 A;  5B2J C;  1A7W A;  5GXQ B;  3REL B;  3AFA C;  2W8S A;  1AOI D;  2ARO A;  5B40 C;  2Y2H A;  1U35 D;  1KU5 A;  3REI D;  5GT0 A;  1H3O A;  2RVQ C;  3O62 B;  3AYW D;  4YS3 C;  5CPK A;  3B6F D;  1BH8 A;  3WA9 B;  5AVC D;  3AZJ A;  1P3B B;  4UUZ A;  3W98 D;  1HQ3 A;  2RIQ A;  3VH6 W;  3AZG D;  1ID3 C;  1P3K D;  4JJN C;  3AZE B;  5CPI C;  3WTP C;  4G92 C;  2IO5 C;  4ZUX A;  5BO0 B;  3NQJ A;  3MGS D;  3AV2 B;  4J8X A;  1KX4 A;  2ARO B;  2BYK A;  4WU9 A;  3VH6 A;  3C1C A;  4QLC A;  3X1U A;  5GT0 B;  3A6N C;  1H3O B;  2Y2K A;  3REH B;  2CV5 C;  5CPK B;  3AZJ B;  5BNX A;  5AVB C;  1U35 A;  3MGQ A;  1P3M C;  4UUZ B;  3VH5 A;  1HQ3 B;  1KX5 D;  2Y2M A;  1P3O D;  3B0D C;  5JRG D;  4NE5 A;  4ZUX B;  4X23 A;  3NQJ B;  5B32 D;  5C3I C;  4J8X B;  1KX4 B;  2Y2I A;  3LJA D;  5GSU C;  1BH9 A;  3NQU A;  2BYK B;  5AV6 D;  4WU9 B;  3MGS A;  3C1C B;  1TZY C;  4QLC B;  5BNX B;  1U35 B;  3AFA D;  4KUD C;  3AZE C;  2FFF B;  4HGA C;  3UTB A;  5B40 D;  1P3A C;  3AV2 C;  2BYM A;  5AVC B;  4X23 B;  1B6W A;  5AV5 C;  4J8U C;  1KX5 A;  3AZK C;  4H9N A;  2J8P A;  3EPK A;  3X1V C;  1BH9 B;  3NQU B;  2NZD C;  4JJN D;  3WTP D;  3MGS B;  5CPI D;  3AZJ C;  4J8V D;  3KUY A;  3LJA A;  3MGR C;  2HIO A;  4ZUX C;  3KWQ A;  2Y2Q A;  2BYM B;  5B2J A;  5KDM A;  3A6N D;  3REK A;  2XD1 A;  2CV5 D;  3AFA A;  1KX5 B;  4H9N B;  1WWS A;  4Z5T C;  5AVB D;  5CPJ C;  4WU9 C;  1P3M D;  1EQZ D;  1S32 C;  3C1C C;  3REJ C;  4QLC C;  3X1U C;  1R4V A;  4YS3 A;  3AZF A;  2FJ7 C;  3EPH A;  1ULY A;  3MGQ C;  3KUY B;  1N1J B;  1P3I C;  2Y2J A;  3LJA B;  5BNV A;  5BT1 C;  5AV6 B;  1ID3 A;  4JJN A;  5B0Y C;  3WTP A;  5CPI A;  5GSU D;  2HIO B;  5B31 A;  4H9Q A;  3KWQ B;  2ZY2 A;  1TZY D;  5DNM C;  5B2J B;  5AV9 A;  5KDM B;  3REK B;  1P3F C;  5BS7 A;  3AFA B;  3FDD A;  2YFV A;  4KUD D;  3AZE D;  4XUJ A;  2F8N A;  3EG5 B;  4YS3 B;  3AZF B;  1P3A D;  3AV2 D;  5AV5 D;  4J8U D;  3W97 C;  4YM6 C;  3UTB C;  3WAA A;  4Z66 C;  3AZK D;  5JA4 A;  5BNV B;  1ID3 B;  1Z2C B;  4JJN B;  3WTP B;  4G92 B;  5B2I C;  2DF4 C;  2IO5 B;  5CPI B;  5B31 B;  3X1V D;  2NZD D;  4WJ3 C;  1W2E A;  5AV9 B;  3AZJ D;  2YFV B;  5B1L A;  3MGR D;  1TZY A;  4XUJ B;  5B0Z C;  4ZUX D;  2F8N B;  3A6N B;  3LZ1 A;  3KUY C;  4H9S A;  2JCH A;  3AV1 C;  4J8X D;  1P3M B;  1KX4 D;  4KUD A;  3WAA B;  5JA4 B;  1TAF A;  5B31 G;  4WU9 D;  1S32 D;  3C1C D;  1P3A A;  4QLC D;  3X1U D;  3AZL C;  3REK C;  5AV5 A;  4J8U A;  1F66 A;  3TU4 A;  4AWL C;  2FJ7 D;  3AZK A;  5C3I B;  3MGQ D;  1P3I D;  5B1L B;  5GSU B;  2F8N G;  3X1V A;  2ZY5 A;  5BT1 D;  2NZD A;  3AZF C;  4M6B A;  1TZY B;  4X23 D;  3LZ1 B;  5DNM D;  3MGR A;  4KUD B;  4HGA B;  1TAF B;  5B31 C;  1P3A B;  3VH5 W;  5AV9 C;  5AV5 B;  5BS7 C;  4J8U B;  5DNN C;  3AZK B;  4Z5T A;  5CPJ A;  3W97 D;  2VQR A;  1S32 A;  4YM6 D;  3UTB D;  4XUJ C;  3REJ A;  3X1S A;  3X1V B;  1P34 A;  2NZD B;  3WKJ C;  3AZN C;  3UTA A;  1BH8 B;  2FJ7 A;  3MNN A;  1P3I A;  3WAA C;  4KGC C;  3MGR B;  2Y2L A;  5B0Y A;  2DQN C;  2ZY4 A;  1M19 C;  5B1M C;  3R45 A;  5DNM A;  5B0Z D;  3MVD A;  1P3F A;  3KUY D;  3UT9 A;  2UWX A;  5B1L C;  3AV1 D;  4Z5T B;  5CPJ B;  1S32 B;  3REJ B;  3X1U B;  2HIO D;  1P34 B;  3KWQ D;  1PZR A;  3LZ1 C;  3UTA B;  4H9S C;  5B2J D;  3AZL D;  2FJ7 B;  3REK D;  3B0C T;  3W97 A;  3MGQ B;  1P3I B;  4YM6 A;  4Z66 A;  3AZM C;  2XD5 A;  3KSY A;  2Y2N A;  5B0Y B;  5B2I A;  2RVQ D;  4E45 A;  1F66 C;  4YS3 D;  4CSR A;  3TU4 C;  3AZF D;  3R45 B;  5DNM B;  5CHL B;  1P3F B;  2F8N H;  4H9R A;  1JFI A;  4CAY A;  1ID3 D;  1ZLA A;  5B33 C;  5B0Z A;  5B31 D;  4NE3 A;  1P3G C;  5AV9 D;  3AV1 A;  2PYO A;  3LEL A;  5DNN D;  3W97 B;  3H0R C;  1M1A A;  4YM6 B;  3UTB B;  4Z66 B;  4H9O A;  3LZ0 A;  4XUJ D;  5B2I B;  3AZL A;  5AY8 C;  2F8N D;  3AZN D;  4CSR B;  4WZS B;  4Z2M G;  4XZQ A;  4H9R B;  4KHA A;  3WAA D;  4CAY B;  4KGC D;  3X1S C;  1P34 C;  4J8W C;  1ZLA B;  3UTA C;  5B0Z B;  3MNN C;  3AV1 B;  2PYO B;  3LEL B;  2LY8 A;  3AZH C;  1M1A B;  3EPJ A;  4H9O B;  5B1L D;  3LZ0 B;  4ZBJ B;  1WWI A;  3AZL B;  3MVD C;  5DNN A;  3LZ1 D;  4AWL B;  3UT9 C;  3AZI A;  5B24 C;  3B6G A;  5AV8 C;  1P3P A;  4KHA B;  1KX3 C;  3EPL A;  3AZM D;  3WKJ A;  5E5A A;  2G5H C;  3AZN A;  3AN2 C;  4R8P C;  1AOI C;  1F66 D;  3TU4 D;  4KGC A;  1M19 A;  5B1M A;  4H9P A;  4H9Q B;  4G91 B;  3W96 C;  5B33 D;  1M18 C;  5DNN B;  3AZG C;  1P3G D;  3AZI B;  3B6G B;  1ZLA C;  3C1B A;  1P3P B;  5GT3 A;  3WKJ B;  5E5A B;  3AZN B;  2PYO C;  3LEL C;  1M1A C;  4DRB A;  3LZ0 C;  4Z5T D;  3AZM A;  4ZBJ C;  5CPJ D;  4KGC B;  5F99 A;  3REJ D;  3X1S D;  5B1M B;  1M19 B;  1B67 A;  4H9P B;  4J8W D;  1P34 D;  3UTA D;  4Z2M H;  5GXQ A;  2Y2G A;  3REL A;  1P3L C;  4XZQ C;  3WTP E;  3MNN D;  4UPK A;  3AZH D;  5B0Y D;  5GT3 B;  5B33 A;  3X1T C;  1BFM A;  3KXB C;  1P3B A;  4WU8 C;  1P3G A;  3MVD D;  1P3F D; 
#chains in the Genus database with same CATH homology
 3UT9 D;  5B24 D;  3AZM B;  5AV8 D;  4G91 C;  5CP6 C;  5F99 B;  1KX3 D;  5AY8 A;  1F66 B;  3AN2 D;  3TU4 B;  4R8P D;  4WV4 B;  5G49 A;  3AZI C;  3B6G C;  3AL0 C;  3W99 A;  1P3P C;  3KFU G;  4Z66 D;  2F8N K;  5FUG A;  3MGP A;  5E5A C;  4J8W A;  5B33 B;  5B2I D;  3REH A;  3W96 D;  4LD9 C;  2ZM5 A;  1M18 D;  1P3G B;  3AZH A;  3V9R A;  1ZLA D;  5AY8 B;  4J8V C;  5G49 B;  5B24 A;  3B0B A;  2PYO D;  3LEL D;  5AV8 A;  3W99 B;  2F2A C;  3C1B C;  1M1A D;  5GT3 C;  1KX3 A;  3A1I A;  5FUG B;  3X1S B;  3LZ0 D;  3MGP B;  4J8W B;  3AN2 A;  4R8P A;  1AOI A;  3MNN B;  2L5A A;  1P3L D;  1EQZ C;  4EO5 C;  4XZQ D;  3REI A;  3AZH B;  3V9R B;  5F99 C;  2NQB C;  3AYW A;  3W96 A;  3B6F A;  5AVC A;  1M18 A;  3A1K A;  5GXQ C;  3REL C;  1HTA A;  3H0M C;  3X1T D;  3MVD B;  3W98 A;  3KXB D;  4DQY B;  4WU8 D;  2Y2P A;  3UT9 B;  3AZG A;  5B24 B;  1P3K A;  5AV8 B;  1KX3 B;  3O62 C;  3WA9 C;  5CP6 D;  3AN2 B;  1P3B C;  4R8P B;  1AOI B;  3H0L C;  3AZI D;  3B6G D;  3REI B;  1P3P D;  3AYW B;  4NE6 A;  3B6F B;  5E5A D;  3WKJ D;  3W96 B;  1M18 B;  1P3L A;  3W98 B;  2ARO C;  3W99 C;  4LD9 D;  1P3O A;  1JFI B;  3AZG B;  1P3K B;  3MGP C;  5JRG A;  5GT0 C;  3REH C;  3X1T A;  5B1M D;  1M19 D;  1Q9C A;  5CPK C;  5B32 A;  3KXB A;  4WNN A;  4WU8 A;  4DRA A;  1HQ3 C;  1N1J A;  2JSS A;  3VH6 T;  5AV6 A;  5CP6 A;  3C1B D;  5GT3 D;  3VH5 T;  4J8X C;  1P3L B;  1KX4 C;  4XZQ B;  5B40 A;  1P3O B;  2G5I C;  2YFW A;  5JRG B;  5F99 D;  2NQB D;  3X1T B;  5B32 B;  2CWE A;  3KXB B;  4LD9 A;  4WNN B;  5GXQ D;  4WU8 B;  3REL D;  1U35 C;  2JE5 A;  2HUE B;  3REI C;  3AYW C;  3B6F C;  5CP6 B;  5AVC C;  4X23 C;  3O62 D;  4J8V A;  3W98 C;  3WA9 D;  1P3B D;  1P3K C;  2BG1 A;  5B40 B;  2YFW B;  3P5J B;  5B32 G;  3MGS C;  2CV5 A;  3A6N A;  5AY8 D;  3B0C W;  4LD9 B;  1T3U A;  5AVB A;  1P3M A;  1EQZ A;  2ARO D;  3W99 D;  3IP4 C;  2NQB A;  3MGP D;  5GT0 D;  3REH D;  4J8V B;  5CPK D;  1KX5 C;  1P3O C;  1HQ3 D;  5JRG C;  3C1B B;  2Y2O A;  5GSU A;  3O62 A;  3WA9 A;  4NFT A;  5B32 C;  2CV5 B;  2HUE C;  2ZY3 A;  3LJA C;  5AVB B;  5AV6 C;  1EQZ B;  4EO5 B;  1F1E A;  3AZE A;  2HIO C;  3F6T A;  4E44 A;  2NQB B;  5BO0 A;  3KWQ C;  3B0D B;  3AV2 A;  5B2J C;  1A7W A;  5GXQ B;  3REL B;  3AFA C;  2W8S A;  1AOI D;  2ARO A;  5B40 C;  2Y2H A;  1U35 D;  1KU5 A;  3REI D;  5GT0 A;  1H3O A;  2RVQ C;  3O62 B;  3AYW D;  4YS3 C;  5CPK A;  3B6F D;  1BH8 A;  3WA9 B;  5AVC D;  3AZJ A;  1P3B B;  4UUZ A;  3W98 D;  1HQ3 A;  2RIQ A;  3VH6 W;  3AZG D;  1ID3 C;  1P3K D;  4JJN C;  3AZE B;  5CPI C;  3WTP C;  4G92 C;  2IO5 C;  4ZUX A;  5BO0 B;  3NQJ A;  3MGS D;  3AV2 B;  4J8X A;  1KX4 A;  2ARO B;  2BYK A;  4WU9 A;  3VH6 A;  3C1C A;  4QLC A;  3X1U A;  5GT0 B;  3A6N C;  1H3O B;  2Y2K A;  3REH B;  2CV5 C;  5CPK B;  3AZJ B;  5BNX A;  5AVB C;  1U35 A;  3MGQ A;  1P3M C;  4UUZ B;  3VH5 A;  1HQ3 B;  1KX5 D;  2Y2M A;  1P3O D;  3B0D C;  5JRG D;  4NE5 A;  4ZUX B;  4X23 A;  3NQJ B;  5B32 D;  5C3I C;  4J8X B;  1KX4 B;  2Y2I A;  3LJA D;  5GSU C;  1BH9 A;  3NQU A;  2BYK B;  5AV6 D;  4WU9 B;  3MGS A;  3C1C B;  1TZY C;  4QLC B;  5BNX B;  1U35 B;  3AFA D;  4KUD C;  3AZE C;  2FFF B;  4HGA C;  3UTB A;  5B40 D;  1P3A C;  3AV2 C;  2BYM A;  5AVC B;  4X23 B;  1B6W A;  5AV5 C;  4J8U C;  1KX5 A;  3AZK C;  4H9N A;  2J8P A;  3EPK A;  3X1V C;  1BH9 B;  3NQU B;  2NZD C;  4JJN D;  3WTP D;  3MGS B;  5CPI D;  3AZJ C;  4J8V D;  3KUY A;  3LJA A;  3MGR C;  2HIO A;  4ZUX C;  3KWQ A;  2Y2Q A;  2BYM B;  5B2J A;  5KDM A;  3A6N D;  3REK A;  2XD1 A;  2CV5 D;  3AFA A;  1KX5 B;  4H9N B;  1WWS A;  4Z5T C;  5AVB D;  5CPJ C;  4WU9 C;  1P3M D;  1EQZ D;  1S32 C;  3C1C C;  3REJ C;  4QLC C;  3X1U C;  1R4V A;  4YS3 A;  3AZF A;  2FJ7 C;  3EPH A;  1ULY A;  3MGQ C;  3KUY B;  1N1J B;  1P3I C;  2Y2J A;  3LJA B;  5BNV A;  5BT1 C;  5AV6 B;  1ID3 A;  4JJN A;  5B0Y C;  3WTP A;  5CPI A;  5GSU D;  2HIO B;  5B31 A;  4H9Q A;  3KWQ B;  2ZY2 A;  1TZY D;  5DNM C;  5B2J B;  5AV9 A;  5KDM B;  3REK B;  1P3F C;  5BS7 A;  3AFA B;  3FDD A;  2YFV A;  4KUD D;  3AZE D;  4XUJ A;  2F8N A;  3EG5 B;  4YS3 B;  3AZF B;  1P3A D;  3AV2 D;  5AV5 D;  4J8U D;  3W97 C;  4YM6 C;  3UTB C;  3WAA A;  4Z66 C;  3AZK D;  5JA4 A;  5BNV B;  1ID3 B;  1Z2C B;  4JJN B;  3WTP B;  4G92 B;  5B2I C;  2DF4 C;  2IO5 B;  5CPI B;  5B31 B;  3X1V D;  2NZD D;  4WJ3 C;  1W2E A;  5AV9 B;  3AZJ D;  2YFV B;  5B1L A;  3MGR D;  1TZY A;  4XUJ B;  5B0Z C;  4ZUX D;  2F8N B;  3A6N B;  3LZ1 A;  3KUY C;  4H9S A;  2JCH A;  3AV1 C;  4J8X D;  1P3M B;  1KX4 D;  4KUD A;  3WAA B;  5JA4 B;  1TAF A;  5B31 G;  4WU9 D;  1S32 D;  3C1C D;  1P3A A;  4QLC D;  3X1U D;  3AZL C;  3REK C;  5AV5 A;  4J8U A;  1F66 A;  3TU4 A;  4AWL C;  2FJ7 D;  3AZK A;  5C3I B;  3MGQ D;  1P3I D;  5B1L B;  5GSU B;  2F8N G;  3X1V A;  2ZY5 A;  5BT1 D;  2NZD A;  3AZF C;  4M6B A;  1TZY B;  4X23 D;  3LZ1 B;  5DNM D;  3MGR A;  4KUD B;  4HGA B;  1TAF B;  5B31 C;  1P3A B;  3VH5 W;  5AV9 C;  5AV5 B;  5BS7 C;  4J8U B;  5DNN C;  3AZK B;  4Z5T A;  5CPJ A;  3W97 D;  2VQR A;  1S32 A;  4YM6 D;  3UTB D;  4XUJ C;  3REJ A;  3X1S A;  3X1V B;  1P34 A;  2NZD B;  3WKJ C;  3AZN C;  3UTA A;  1BH8 B;  2FJ7 A;  3MNN A;  1P3I A;  3WAA C;  4KGC C;  3MGR B;  2Y2L A;  5B0Y A;  2DQN C;  2ZY4 A;  1M19 C;  5B1M C;  3R45 A;  5DNM A;  5B0Z D;  3MVD A;  1P3F A;  3KUY D;  3UT9 A;  2UWX A;  5B1L C;  3AV1 D;  4Z5T B;  5CPJ B;  1S32 B;  3REJ B;  3X1U B;  2HIO D;  1P34 B;  3KWQ D;  1PZR A;  3LZ1 C;  3UTA B;  4H9S C;  5B2J D;  3AZL D;  2FJ7 B;  3REK D;  3B0C T;  3W97 A;  3MGQ B;  1P3I B;  4YM6 A;  4Z66 A;  3AZM C;  2XD5 A;  3KSY A;  2Y2N A;  5B0Y B;  5B2I A;  2RVQ D;  4E45 A;  1F66 C;  4YS3 D;  4CSR A;  3TU4 C;  3AZF D;  3R45 B;  5DNM B;  5CHL B;  1P3F B;  2F8N H;  4H9R A;  1JFI A;  4CAY A;  1ID3 D;  1ZLA A;  5B33 C;  5B0Z A;  5B31 D;  4NE3 A;  1P3G C;  5AV9 D;  3AV1 A;  2PYO A;  3LEL A;  5DNN D;  3W97 B;  3H0R C;  1M1A A;  4YM6 B;  3UTB B;  4Z66 B;  4H9O A;  3LZ0 A;  4XUJ D;  5B2I B;  3AZL A;  5AY8 C;  2F8N D;  3AZN D;  4CSR B;  4WZS B;  4Z2M G;  4XZQ A;  4H9R B;  4KHA A;  3WAA D;  4CAY B;  4KGC D;  3X1S C;  1P34 C;  4J8W C;  1ZLA B;  3UTA C;  5B0Z B;  3MNN C;  3AV1 B;  2PYO B;  3LEL B;  2LY8 A;  3AZH C;  1M1A B;  3EPJ A;  4H9O B;  5B1L D;  3LZ0 B;  4ZBJ B;  1WWI A;  3AZL B;  3MVD C;  5DNN A;  3LZ1 D;  4AWL B;  3UT9 C;  3AZI A;  5B24 C;  3B6G A;  5AV8 C;  1P3P A;  4KHA B;  1KX3 C;  3EPL A;  3AZM D;  3WKJ A;  5E5A A;  2G5H C;  3AZN A;  3AN2 C;  4R8P C;  1AOI C;  1F66 D;  3TU4 D;  4KGC A;  1M19 A;  5B1M A;  4H9P A;  4H9Q B;  4G91 B;  3W96 C;  5B33 D;  1M18 C;  5DNN B;  3AZG C;  1P3G D;  3AZI B;  3B6G B;  1ZLA C;  3C1B A;  1P3P B;  5GT3 A;  3WKJ B;  5E5A B;  3AZN B;  2PYO C;  3LEL C;  1M1A C;  4DRB A;  3LZ0 C;  4Z5T D;  3AZM A;  4ZBJ C;  5CPJ D;  4KGC B;  5F99 A;  3REJ D;  3X1S D;  5B1M B;  1M19 B;  1B67 A;  4H9P B;  4J8W D;  1P34 D;  3UTA D;  4Z2M H;  5GXQ A;  2Y2G A;  3REL A;  1P3L C;  4XZQ C;  3WTP E;  3MNN D;  4UPK A;  3AZH D;  5B0Y D;  5GT3 B;  5B33 A;  3X1T C;  1BFM A;  3KXB C;  1P3B A;  4WU8 C;  1P3G A;  3MVD D;  1P3F D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...