4CSRB

High resolution crystal structure of the histone fold dimer (nf-yb)-(nf-yc)
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
82
structure length
82
Chain Sequence
RVQELPLARIKKIMKLDEDVKMISAEAPVLFAKAAQIFITELTLRAWIHTEDNKRRTLQRNDIAMAITKFDQFDFLIDIVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
publication title High Resolution Crystal Structure of the Histone Fold Dimer (NF-Yb)-(NF-Yc)
rcsb
source organism Homo sapiens
total genus 26
structure length 82
sequence length 82
ec nomenclature
pdb deposition date 2014-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00808 CBFD_NFYB_HMF Histone-like transcription factor (CBF/NF-Y) and archaeal histone
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4csrB00
3AZHD 4H9SA 5B32C 5CPIC 2BYMA 5GT3A 3LJAA 5CPJD 4UUZB 3KXBB 3LELB 1P34B 1M1AC 3AZID 3MVDA 3B6GA 3REKC 3TU4B 4H9NB 1U35C 5CPKC 4AWLC 5B1LB 5CPJC 5CP6C 3AZIC 4X23A 2YFWB 5BO0B 5KDMB 3O62B 1KX5A 4ZUXB 2NQBC 3WKJD 5AV5A 3WAAB 5B2JC 2CWEA 3B6FA 3VH6A 5B24A 4NE3A 4WV4B 5DNMB 3NQJA 1ID3A 3WKJC 3WA9C 1P3GD 1EQZC 2IO5C 5AV6D 4LD9A 3NQUA 1P3IA 3MGQA 2L5AA 5G49B 3X1VC 3AYWC 3MNNA 1P3GC 4J8WB 3AFAA 5AV6C 5B32G 2BYMB 5GT3B 3LJAB 1S32A 1M19D 4ZUXD 1P3MA 3MVDB 4HGAC 5DNND 4G91C 1N1JA 3B0BA 1P3PD 3UTBA 3UTAB 3AZLA 4X23B 5DNNC 4Z66B 2YFVA 1P3PC 3KUYD 1P3LB 5AV9C 5AY8B 3C1BB 3C1CD 1JFIA 4Z2MG 4H9RA 5B32A 5CPIA 5B0ZA 5B33D 4KUDB 1ZLAA 4H9PB 4ZBJC 5JRGD 1M1AA 3KUYC 3REKA 5GT0A 1U35A 5CPKA 3VH5A 3B0CW 5B2IA 5AVCB 5CPJA 5JRGC 4LD9B 5CP6A 3NQUB 1P3IB 4J8VB 3W97D 5BNVA 1F66D 4KHAB 5B0YA 2NQBA 5B2JA 1KX3B 2F8NK 3X1UD 3UT9A 5F99B 1P3MB 3W97C 2PYOA 3W98D 3REJC 1F66C 3AZED 3WTPD 3AZGA 4J8XA 3AZJA 3B0DB 3X1UC 3UTBB 4R8PA 3WA9A 4DRAA 1EQZA 3AZLB 1P3FA 3W98C 2AROB 5JA4A 3WTPC 3KWQA 1HQ3B 3REID 2YFVB 3X1VA 3AYWA 1KX4D 5B1MD 2JSSA 5B40B 1A7WA 4J8UD 3REHA 3LZ1C 5AV6A 5GXQD 4H9RB 3AZKD 3AZMB 1TZYD 5B0ZB 3REIC 4E45A 4YM6A 5B31D 1ZLAB 5AVBD 2NZDD 1M1AB 1AOID 5B1MC 5GT0B 4J8UC 1U35B 3AZKC 5GXQC 5CPKB 1TZYC 5B2IB 3RELD 3A6NB 5B31C 3AV1A 3AV2A 3W99D 2HIOD 5AVBC 5CP6B 3AZFD 1P3BD 1AOIC 2NZDC 1BH8A 5DNNA 4EO5C 4JJND 2F8ND 3AN2D 5B0YB 3RELC 1P3PA 3W99C 2BYKA 2HIOC 5AV9A 3MGPD 5B2JB 4G92B 3AZFC 1P3BC 3UT9B 4JJNC 3AZHC 2PYOB 1P3OD 3X1SB 3AZGB 4J8XB 3MGPC 3KUYA 3AZMD 3AZJB 5C3IC 4NFTA 5BS7C 3X1TD 4R8PB 4WU8D 4QLCD 1EQZB 3WA9B 5AV8D 1P3FB 1P3OC 5JA4B 3KWQB 1R4VA 4H9QA 3W96D 4XUJD 5AV8C 3REHB 4KGCD 4YS3D 3WTPE 4XZQA 4YM6B 1B6WA 3W96C 3KXBD 3LELD 1P34D 3REJA 2CV5B 3MGSB 3TU4D 3AV1B 5B31G 5GSUA 3X1UA 3AV2B 5B1LD 5E5AA 3MGRB 1M18B 3KXBC 3AZNA 3W98A 4H9OA 4Z5TB 3TU4C 4Z2MH 3O62D 5B1LC 3V9RA 5AV9B 3B6GB 3LZ1A 3WAAD 1P3KA 3REIA 2F8NG 1P3AA 3O62C 1M19C 4ZUXC 5DNMD 4WU9A 4WNNA 3AZKA 3WAAC 1TZYA 4WZSB 2FJ7A 1KX5B 5B31A 3LZ0A 5AVBA 2NZDA 1AOIA 5AV5B 3B6FB 5B24B 3RELA 1M18D 3W99A 4XZQB 3NQJB 3AZFA 4J8WD 1P3BA 1ID3B 5GT3D 3LJAD 2RVQD 3C1CC 3AZHA 2F8NA 1B67A 5B33C 3MVDD 3MGPA 3AZIA 3MGQB 5GSUB 3R45A 5GT3C 3LJAC 2RVQC 5E5AB 3MNNB 3UTAD 3AZNB 1H3OA 4H9OB 4X23D 3AFAB 3MVDC 1S32B 4Z66D 5AV8A 3UTAC 3LZ1B 1P3LD 5AY8D 3C1BD 4X23C 1P3KB 1N1JB 3WKJA 5FUGA 3W96A 5B24D 4Z66C 1P3AB 4KUDD 4WU9B 1ID3D 1P3LC 5AY8C 3C1BC 3AZEC 2FJ7B 3LZ0B 2HUEB 4KUDC 5AVCD 1P3GA 1JFIB 4LD9D 1P3ID 3MGQD 5B32B 4J8VD 5CPIB 3TU4A 3MNND 5BNXA 3B0CT 5AVCC 1KX4C 3AFAD 5BT1D 3REKB 4LD9C 1KX3D 1S32D 3AZHB 1P3IC 5F99D 4J8VC 4AWLB 5BO0A 5CPJB 1P3MD 5KDMA 3O62A 1M19A 4ZUXA 3AZIB 5BT1C 1KX3C 5BNVB 3UTBD 5F99C 3AZLD 2NQBB 2AROD 1HQ3D 3B0DC 3UTBC 5B40D 3AZLC 3AN2C 3WKJB 2AROC 5B0ZD 3C1CA 1HQ3C 1KU5A 1ZLAD 5G49A 1M1AD 2IO5B 5B33A 5B40C 5GT0D 5JRGA 1BH9A 3VH6W 1U35D 1TAFA 4NE5A 3AZMC 5CPKD 5B0ZC 5B2ID 1F1EA 3A6ND 3AYWB 3X1TC 3X1VB 4WU8C 4QLCC 1P3GB 1ZLAC 5CP6D 5AV6B 5GT0C 5BNXB 1ULYA 5B2IC 5B0YD 3A6NC 2F8NH 3W97A 2NQBD 3UTAA 4XUJC 4HGAB 1F66A 5B2JD 3UT9D 4KGCC 4YS3C 4G91B 4Z66A 2PYOD 1M19B 4CSRA 5B0YC 3X1SD 3AZGD 3LELC 4J8XD 4G92C 1P34C 1P3LA 2LY8A 3AZJD 5AY8A 1BH8B 1WWIA 5DNNB 3WTPA 3C1BA 3UT9C 3AZEA 4R8PD 3WA9D 1EQZD 1P3PB 4KUDA 1P3FD 2PYOC 4H9PA 2BYKB 3X1SC 3KWQD 3AZGC 4J8XC 3AZJC 3X1VD 1HTAA 4R8PC 3AYWD 4ZBJB 3REHD 5AVCA 1P3FC 1KX4A 5B1MA 3KUYB 3C1CB 3KWQC 4J8UA 4YM6D 3VH6T 5GXQA 4J8VA 5B33B 5JRGB 4KHAA 3REHC 1BH9B 1TAFB 4H9QB 5DNMC 2CV5D 3MGSD 1KX3A 4YM6C 3AV1D 3AV2D 5F99A 3MGRD 4DRBA 2HIOA 3VH5W 4Z5TD 5CHLB 2CV5C 3MGSC 4JJNA 3AV1C 3W97B 3KSYA 3AV2C 3MGRC 5AV9D 3REJB 3AN2A 1F66B 1M18C 3B6GD 2AROA 1BFMA 4Z5TC 4J8WC 1HQ3A 4H9SC 3X1UB 1Q9CA 5BS7A 4CSRB 4E44A 3W98B 1P3OA 5B40A 3AZEB 3WTPB 1WWSA 3B6GC 3AZMA 1KX5D 3X1TA 4WU8A 3V9RB 4QLCA 5AV5D 3REIB 4CAYA 3B6FD 1KX5C 3A6NA 1KX4B 5B1MB 4XUJA 4XZQD 4J8UB 4WNNB 4KGCA 5AV5C 5GXQB 3AZKB 4YS3A 1TZYB 4M6BA 5B31B 3B6FC 5AVBB 2NZDB 5B24C 3REJD 1AOIB 4UUZA 3KXBA 3LELA 3VH5T 1P34A 4XZQC 4EO5B 1ID3C 5GSUD 5E5AD 4H9NA 3RELB 3AZND 3W99B 2HIOB 5B1LA 3AZFB 1P3BB 3X1SA 4JJNB 3MGQC 5GSUC 2F8NB 2YFWA 5E5AC 3AN2B 3MNNC 3LZ1D 3AZNC 3MGPB 3AFAC 1P3KD 5C3IB 3R45B 3WAAA 1S32C 1P3AD 1P3OB 4WU9D 1H3OB 1P3MC 5DNMA 2FJ7D 1P3KC 3LZ0D 3X1TB 4WU8B 4QLCB 5AV8B 1P3AC 4WU9C 4CAYB 5FUGB 2CV5A 5B32D 5CPID 3MGSA 2FJ7C 3W96B 4NE6A 3LZ0C 2HUEC 4XUJB 3MGRA 1M18A 4KGCB 4YS3B 3REKD 4Z5TA 4J8WA
chains in the Genus database with same CATH superfamily
3AZHD 4H9SA 5B32C 5CPIC 2BYMA 5GT3A 3LJAA 5CPJD 4UUZB 3KXBB 3LELB 1P34B 1M1AC 3AZID 3MVDA 3B6GA 3REKC 4UPKA 3TU4B 2XD1A 4H9NB 1U35C 5CPKC 4AWLC 5B1LB 5CPJC 5CP6C 3AZIC 2VQRA 4X23A 2YFWB 5BO0B 5KDMB 3O62B 1KX5A 4ZUXB 2NQBC 1Z2CB 3WKJD 5AV5A 3WAAB 5B2JC 2CWEA 3B6FA 3VH6A 5B24A 4NE3A 4WV4B 5DNMB 3NQJA 1ID3A 3WKJC 2Y2LA 3WA9C 1P3GD 1EQZC 1T3UA 2IO5C 5AV6D 4LD9A 3NQUA 1P3IA 3MGQA 2L5AA 5G49B 3X1VC 3AYWC 3MNNA 1W2EA 1P3GC 2BG1A 4J8WB 3AFAA 5AV6C 5B32G 2BYMB 5GT3B 3LJAB 1S32A 1M19D 4ZUXD 1P3MA 3MVDB 4HGAC 5DNND 4G91C 1N1JA 3B0BA 1P3PD 3UTBA 3UTAB 3AZLA 4X23B 5DNNC 3EG5B 4Z66B 2YFVA 1P3PC 3KUYD 1P3LB 5AV9C 5AY8B 3C1BB 3C1CD 2JCHA 1JFIA 4Z2MG 4H9RA 5B32A 5CPIA 5B0ZA 5B33D 4KUDB 1ZLAA 4H9PB 4ZBJC 5JRGD 1M1AA 3KUYC 3REKA 5GT0A 1U35A 5CPKA 3VH5A 3B0CW 5B2IA 5AVCB 5CPJA 5JRGC 4LD9B 5CP6A 3NQUB 1P3IB 4J8VB 3W97D 5BNVA 3EPHA 1F66D 4KHAB 5B0YA 2NQBA 3AL0C 3EPLA 5B2JA 1KX3B 2F8NK 3X1UD 3UT9A 5F99B 1P3MB 3W97C 2PYOA 3W98D 3REJC 1F66C 3AZED 3WTPD 3AZGA 4J8XA 3AZJA 3B0DB 3X1UC 3UTBB 4R8PA 3WA9A 4DRAA 1EQZA 3AZLB 2Y2QA 1P3FA 3W98C 2AROB 5JA4A 3WTPC 3KWQA 1HQ3B 3REID 2G5HC 2YFVB 3X1VA 3AYWA 1KX4D 5B1MD 5B40B 2JSSA 1A7WA 4J8UD 3REHA 3LZ1C 5AV6A 5GXQD 4H9RB 3AZKD 3AZMB 1TZYD 5B0ZB 3REIC 4E45A 4YM6A 5B31D 1ZLAB 5AVBD 2NZDD 1M1AB 1AOID 3FDDA 2ZY4A 5B1MC 5GT0B 4J8UC 1U35B 3AZKC 5GXQC 5CPKB 1TZYC 5B2IB 3RELD 3A6NB 5B31C 3AV1A 3AV2A 3W99D 2HIOD 5AVBC 5CP6B 3AZFD 1P3BD 1AOIC 2NZDC 1BH8A 5DNNA 4EO5C 4JJND 2F8ND 3AN2D 5B0YB 3RELC 1P3PA 3W99C 2BYKA 2HIOC 5AV9A 3MGPD 5B2JB 4G92B 3AZFC 1P3BC 3UT9B 2FFFB 4JJNC 3AZHC 2PYOB 1P3OD 3X1SB 3AZGB 4J8XB 3MGPC 3KUYA 3AZMD 3AZJB 2RIQA 3A1KA 5C3IC 4NFTA 5BS7C 3X1TD 4R8PB 4WU8D 4QLCD 1EQZB 3WA9B 5AV8D 1P3FB 1P3OC 5JA4B 2J8PA 3KWQB 1R4VA 4H9QA 3W96D 4XUJD 5AV8C 3REHB 4KGCD 4YS3D 3EPJA 3WTPE 4XZQA 4YM6B 1B6WA 3W96C 3KXBD 3LELD 1P34D 3REJA 3KFUG 2CV5B 3MGSB 3TU4D 3AV1B 5B31G 5GSUA 3X1UA 3AV2B 5B1LD 5E5AA 3MGRB 1M18B 3KXBC 3AZNA 3W98A 4H9OA 4Z5TB 3P5JB 3TU4C 3H0RC 4Z2MH 3O62D 5B1LC 3V9RA 5AV9B 2Y2HA 3B6GB 3LZ1A 2Y2MA 3WAAD 1P3KA 3REIA 2F8NG 4WJ3C 1P3AA 3O62C 1M19C 4ZUXC 5DNMD 4WU9A 4WNNA 3AZKA 3WAAC 1TZYA 4WZSB 2FJ7A 1KX5B 5B31A 3LZ0A 5AVBA 2Y2IA 1AOIA 2NZDA 2W8SA 5AV5B 2ZY5A 3B6FB 5B24B 3RELA 1M18D 2DF4C 3W99A 4XZQB 3NQJB 3AZFA 4J8WD 1P3BA 1ID3B 5GT3D 3LJAD 2RVQD 3C1CC 2ZM5A 3AZHA 2F8NA 1B67A 5B33C 2ZY3A 3MVDD 3MGPA 3AZIA 3MGQB 5GSUB 3R45A 5GT3C 3LJAC 2RVQC 5E5AB 3MNNB 3UTAD 3AZNB 1H3OA 4H9OB 4X23D 3AFAB 3MVDC 1S32B 4Z66D 5AV8A 3UTAC 3LZ1B 1P3LD 5AY8D 3C1BD 4X23C 1P3KB 1N1JB 3WKJA 5FUGA 3W96A 5B24D 4Z66C 1P3AB 4KUDD 2Y2OA 4WU9B 1ID3D 1P3LC 5AY8C 3C1BC 3AZEC 2FJ7B 3LZ0B 2HUEB 4KUDC 5AVCD 1P3GA 1JFIB 4LD9D 1P3ID 3MGQD 5B32B 4J8VD 5CPIB 3TU4A 3MNND 5BNXA 3B0CT 5AVCC 1KX4C 2UWXA 3AFAD 5BT1D 3REKB 4LD9C 1KX3D 1S32D 3AZHB 1P3IC 5F99D 4J8VC 4AWLB 2Y2NA 5BO0A 5CPJB 1P3MD 5KDMA 3O62A 1M19A 4ZUXA 3AZIB 5BT1C 1KX3C 5BNVB 3UTBD 5F99C 3AZLD 2NQBB 2AROD 1HQ3D 3B0DC 3UTBC 4DQYB 5B40D 3AZLC 3AN2C 3WKJB 2AROC 5B0ZD 3C1CA 1HQ3C 1KU5A 2XD5A 1ZLAD 5G49A 1M1AD 2IO5B 5B33A 3H0MC 5B40C 5GT0D 5JRGA 1BH9A 3VH6W 1U35D 1TAFA 4NE5A 3AZMC 5CPKD 5B0ZC 5B2ID 1F1EA 3A6ND 3AYWB 3X1TC 3X1VB 4WU8C 4QLCC 1P3GB 1ZLAC 5CP6D 5AV6B 5GT0C 2G5IC 5BNXB 1ULYA 5B2IC 5B0YD 3A6NC 2F8NH 3W97A 2NQBD 3UTAA 4XUJC 4HGAB 1F66A 5B2JD 3UT9D 4KGCC 4YS3C 4G91B 4Z66A 2PYOD 1M19B 4CSRA 5B0YC 3X1SD 3AZGD 3LELC 4J8XD 4G92C 1P34C 1P3LA 2LY8A 3AZJD 5AY8A 1BH8B 1WWIA 5DNNB 3WTPA 3C1BA 3UT9C 3AZEA 4R8PD 3WA9D 1EQZD 1P3PB 4KUDA 1P3FD 2PYOC 4H9PA 2BYKB 2Y2PA 3X1SC 3KWQD 3AZGC 4J8XC 3AZJC 3X1VD 1HTAA 4R8PC 3AYWD 4ZBJB 2Y2GA 3REHD 5AVCA 1P3FC 2Y2KA 1KX4A 5B1MA 3KUYB 3C1CB 3KWQC 4J8UA 4YM6D 3VH6T 5GXQA 4J8VA 5B33B 5JRGB 2JE5A 4KHAA 1BH9B 2F2AC 3REHC 1TAFB 4H9QB 5DNMC 2CV5D 3MGSD 1KX3A 4YM6C 3AV1D 3AV2D 5F99A 3MGRD 4DRBA 2HIOA 3VH5W 4Z5TD 5CHLB 2CV5C 3MGSC 4JJNA 3AV1C 3W97B 3KSYA 3AV2C 3MGRC 5AV9D 3REJB 3AN2A 1F66B 1PZRA 1M18C 3B6GD 2AROA 1BFMA 2ZY2A 2Y2JA 4Z5TC 4J8WC 1HQ3A 4H9SC 3X1UB 1Q9CA 5BS7A 3EPKA 4CSRB 4E44A 3W98B 1P3OA 5B40A 3AZEB 3WTPB 1WWSA 3B6GC 3AZMA 1KX5D 3X1TA 4WU8A 3V9RB 4QLCA 5AV5D 3A1IA 3REIB 4CAYA 3B6FD 1KX5C 3A6NA 1KX4B 5B1MB 4XUJA 3F6TA 4XZQD 4J8UB 4WNNB 4KGCA 5AV5C 5GXQB 3AZKB 4YS3A 1TZYB 3IP4C 4M6BA 5B31B 3B6FC 5AVBB 2NZDB 5B24C 3REJD 2DQNC 1AOIB 4UUZA 3KXBA 3LELA 3VH5T 1P34A 4XZQC 4EO5B 1ID3C 5GSUD 5E5AD 4H9NA 3RELB 3AZND 3W99B 2HIOB 5B1LA 3AZFB 1P3BB 3X1SA 4JJNB 3MGQC 5GSUC 2F8NB 2YFWA 5E5AC 3AN2B 3MNNC 3LZ1D 3AZNC 3MGPB 3AFAC 1P3KD 5C3IB 3R45B 3WAAA 3H0LC 1S32C 1P3AD 1P3OB 4WU9D 1H3OB 1P3MC 5DNMA 2FJ7D 1P3KC 3LZ0D 3X1TB 4WU8B 4QLCB 5AV8B 1P3AC 4WU9C 4CAYB 5FUGB 2CV5A 5B32D 5CPID 3MGSA 2FJ7C 3W96B 4NE6A 3LZ0C 2HUEC 4XUJB 3MGRA 1M18A 4KGCB 4YS3B 3REKD 4Z5TA 4J8WA
chains in the Genus database with same CATH topology
3AZHD 4H9SA 5B32C 5CPIC 2BYMA 5GT3A 3LJAA 5CPJD 4UUZB 3KXBB 3LELB 1P34B 1M1AC 3AZID 3MVDA 3B6GA 3REKC 4UPKA 3TU4B 2XD1A 4H9NB 1U35C 5CPKC 4AWLC 5B1LB 5CPJC 5CP6C 3AZIC 2VQRA 4X23A 2YFWB 5BO0B 5KDMB 3O62B 1KX5A 4ZUXB 2NQBC 1Z2CB 3WKJD 5AV5A 3WAAB 5B2JC 2CWEA 3B6FA 3VH6A 5B24A 4NE3A 4WV4B 5DNMB 3NQJA 1ID3A 3WKJC 2Y2LA 3WA9C 1P3GD 1EQZC 1T3UA 2IO5C 5AV6D 4LD9A 3NQUA 1P3IA 3MGQA 2L5AA 5G49B 3X1VC 3AYWC 3MNNA 1W2EA 1P3GC 2BG1A 4J8WB 3AFAA 5AV6C 5B32G 2BYMB 5GT3B 3LJAB 1S32A 1M19D 4ZUXD 1P3MA 3MVDB 4HGAC 5DNND 4G91C 1N1JA 3B0BA 1P3PD 3UTBA 3UTAB 3AZLA 4X23B 5DNNC 3EG5B 4Z66B 2YFVA 1P3PC 3KUYD 1P3LB 5AV9C 5AY8B 3C1BB 3C1CD 2JCHA 1JFIA 4Z2MG 4H9RA 5B32A 5CPIA 5B0ZA 5B33D 4KUDB 1ZLAA 4H9PB 4ZBJC 5JRGD 1M1AA 3KUYC 3REKA 5GT0A 1U35A 5CPKA 3VH5A 3B0CW 5B2IA 5AVCB 5CPJA 5JRGC 4LD9B 5CP6A 3NQUB 1P3IB 4J8VB 3W97D 5BNVA 3EPHA 1F66D 4KHAB 5B0YA 2NQBA 3AL0C 3EPLA 5B2JA 1KX3B 2F8NK 3X1UD 3UT9A 5F99B 1P3MB 3W97C 2PYOA 3W98D 3REJC 1F66C 3AZED 3WTPD 3AZGA 4J8XA 3AZJA 3B0DB 3X1UC 3UTBB 4R8PA 3WA9A 4DRAA 1EQZA 3AZLB 2Y2QA 1P3FA 3W98C 2AROB 5JA4A 3WTPC 3KWQA 1HQ3B 3REID 2G5HC 2YFVB 3X1VA 3AYWA 1KX4D 5B1MD 5B40B 2JSSA 1A7WA 4J8UD 3REHA 3LZ1C 5AV6A 5GXQD 4H9RB 3AZKD 3AZMB 1TZYD 5B0ZB 3REIC 4E45A 4YM6A 5B31D 1ZLAB 5AVBD 2NZDD 1M1AB 1AOID 3FDDA 2ZY4A 5B1MC 5GT0B 4J8UC 1U35B 3AZKC 5GXQC 5CPKB 1TZYC 5B2IB 3RELD 3A6NB 5B31C 3AV1A 3AV2A 3W99D 2HIOD 5AVBC 5CP6B 3AZFD 1P3BD 1AOIC 2NZDC 1BH8A 5DNNA 4EO5C 4JJND 2F8ND 3AN2D 5B0YB 3RELC 1P3PA 3W99C 2BYKA 2HIOC 5AV9A 3MGPD 5B2JB 4G92B 3AZFC 1P3BC 3UT9B 2FFFB 4JJNC 3AZHC 2PYOB 1P3OD 3X1SB 3AZGB 4J8XB 3MGPC 3KUYA 3AZMD 3AZJB 2RIQA 3A1KA 5C3IC 4NFTA 5BS7C 3X1TD 4R8PB 4WU8D 4QLCD 1EQZB 3WA9B 5AV8D 1P3FB 1P3OC 5JA4B 2J8PA 3KWQB 1R4VA 4H9QA 3W96D 4XUJD 5AV8C 3REHB 4KGCD 4YS3D 3EPJA 3WTPE 4XZQA 4YM6B 1B6WA 3W96C 3KXBD 3LELD 1P34D 3REJA 3KFUG 2CV5B 3MGSB 3TU4D 3AV1B 5B31G 5GSUA 3X1UA 3AV2B 5B1LD 5E5AA 3MGRB 1M18B 3KXBC 3AZNA 3W98A 4H9OA 4Z5TB 3P5JB 3TU4C 3H0RC 4Z2MH 3O62D 5B1LC 3V9RA 5AV9B 2Y2HA 3B6GB 3LZ1A 2Y2MA 3WAAD 1P3KA 3REIA 2F8NG 4WJ3C 1P3AA 3O62C 1M19C 4ZUXC 5DNMD 4WU9A 4WNNA 3AZKA 3WAAC 1TZYA 4WZSB 2FJ7A 1KX5B 5B31A 3LZ0A 5AVBA 2Y2IA 1AOIA 2NZDA 2W8SA 5AV5B 2ZY5A 3B6FB 5B24B 3RELA 1M18D 2DF4C 3W99A 4XZQB 3NQJB 3AZFA 4J8WD 1P3BA 1ID3B 5GT3D 3LJAD 2RVQD 3C1CC 2ZM5A 3AZHA 2F8NA 1B67A 5B33C 2ZY3A 3MVDD 3MGPA 3AZIA 3MGQB 5GSUB 3R45A 5GT3C 3LJAC 2RVQC 5E5AB 3MNNB 3UTAD 3AZNB 1H3OA 4H9OB 4X23D 3AFAB 3MVDC 1S32B 4Z66D 5AV8A 3UTAC 3LZ1B 1P3LD 5AY8D 3C1BD 4X23C 1P3KB 1N1JB 3WKJA 5FUGA 3W96A 5B24D 4Z66C 1P3AB 4KUDD 2Y2OA 4WU9B 1ID3D 1P3LC 5AY8C 3C1BC 3AZEC 2FJ7B 3LZ0B 2HUEB 4KUDC 5AVCD 1P3GA 1JFIB 4LD9D 1P3ID 3MGQD 5B32B 4J8VD 5CPIB 3TU4A 3MNND 5BNXA 3B0CT 5AVCC 1KX4C 2UWXA 3AFAD 5BT1D 3REKB 4LD9C 1KX3D 1S32D 3AZHB 1P3IC 5F99D 4J8VC 4AWLB 2Y2NA 5BO0A 5CPJB 1P3MD 5KDMA 3O62A 1M19A 4ZUXA 3AZIB 5BT1C 1KX3C 5BNVB 3UTBD 5F99C 3AZLD 2NQBB 2AROD 1HQ3D 3B0DC 3UTBC 4DQYB 5B40D 3AZLC 3AN2C 3WKJB 2AROC 5B0ZD 3C1CA 1HQ3C 1KU5A 2XD5A 1ZLAD 5G49A 1M1AD 2IO5B 5B33A 3H0MC 5B40C 5GT0D 5JRGA 1BH9A 3VH6W 1U35D 1TAFA 4NE5A 3AZMC 5CPKD 5B0ZC 5B2ID 1F1EA 3A6ND 3AYWB 3X1TC 3X1VB 4WU8C 4QLCC 1P3GB 1ZLAC 5CP6D 5AV6B 5GT0C 2G5IC 5BNXB 1ULYA 5B2IC 5B0YD 3A6NC 2F8NH 3W97A 2NQBD 3UTAA 4XUJC 4HGAB 1F66A 5B2JD 3UT9D 4KGCC 4YS3C 4G91B 4Z66A 2PYOD 1M19B 4CSRA 5B0YC 3X1SD 3AZGD 3LELC 4J8XD 4G92C 1P34C 1P3LA 2LY8A 3AZJD 5AY8A 1BH8B 1WWIA 5DNNB 3WTPA 3C1BA 3UT9C 3AZEA 4R8PD 3WA9D 1EQZD 1P3PB 4KUDA 1P3FD 2PYOC 4H9PA 2BYKB 2Y2PA 3X1SC 3KWQD 3AZGC 4J8XC 3AZJC 3X1VD 1HTAA 4R8PC 3AYWD 4ZBJB 2Y2GA 3REHD 5AVCA 1P3FC 2Y2KA 1KX4A 5B1MA 3KUYB 3C1CB 3KWQC 4J8UA 4YM6D 3VH6T 5GXQA 4J8VA 5B33B 5JRGB 2JE5A 4KHAA 1BH9B 2F2AC 3REHC 1TAFB 4H9QB 5DNMC 2CV5D 3MGSD 1KX3A 4YM6C 3AV1D 3AV2D 5F99A 3MGRD 4DRBA 2HIOA 3VH5W 4Z5TD 5CHLB 2CV5C 3MGSC 4JJNA 3AV1C 3W97B 3KSYA 3AV2C 3MGRC 5AV9D 3REJB 3AN2A 1F66B 1PZRA 1M18C 3B6GD 2AROA 1BFMA 2ZY2A 2Y2JA 4Z5TC 4J8WC 1HQ3A 4H9SC 3X1UB 1Q9CA 5BS7A 3EPKA 4CSRB 4E44A 3W98B 1P3OA 5B40A 3AZEB 3WTPB 1WWSA 3B6GC 3AZMA 1KX5D 3X1TA 4WU8A 3V9RB 4QLCA 5AV5D 3A1IA 3REIB 4CAYA 3B6FD 1KX5C 3A6NA 1KX4B 5B1MB 4XUJA 3F6TA 4XZQD 4J8UB 4WNNB 4KGCA 5AV5C 5GXQB 3AZKB 4YS3A 1TZYB 3IP4C 4M6BA 5B31B 3B6FC 5AVBB 2NZDB 5B24C 3REJD 2DQNC 1AOIB 4UUZA 3KXBA 3LELA 3VH5T 1P34A 4XZQC 4EO5B 1ID3C 5GSUD 5E5AD 4H9NA 3RELB 3AZND 3W99B 2HIOB 5B1LA 3AZFB 1P3BB 3X1SA 4JJNB 3MGQC 5GSUC 2F8NB 2YFWA 5E5AC 3AN2B 3MNNC 3LZ1D 3AZNC 3MGPB 3AFAC 1P3KD 5C3IB 3R45B 3WAAA 3H0LC 1S32C 1P3AD 1P3OB 4WU9D 1H3OB 1P3MC 5DNMA 2FJ7D 1P3KC 3LZ0D 3X1TB 4WU8B 4QLCB 5AV8B 1P3AC 4WU9C 4CAYB 5FUGB 2CV5A 5B32D 5CPID 3MGSA 2FJ7C 3W96B 4NE6A 3LZ0C 2HUEC 4XUJB 3MGRA 1M18A 4KGCB 4YS3B 3REKD 4Z5TA 4J8WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AZH D;  4H9S A;  5B32 C;  5CPI C;  2BYM A;  5GT3 A;  3LJA A;  5CPJ D;  4UUZ B;  3KXB B;  3LEL B;  1P34 B;  1M1A C;  3AZI D;  3MVD A;  3B6G A;  3REK C;  3TU4 B;  4H9N B;  1U35 C;  5CPK C;  4AWL C;  5B1L B;  5CPJ C;  5CP6 C;  3AZI C;  4X23 A;  2YFW B;  5BO0 B;  5KDM B;  3O62 B;  1KX5 A;  4ZUX B;  2NQB C;  3WKJ D;  5AV5 A;  3WAA B;  5B2J C;  2CWE A;  3B6F A;  3VH6 A;  5B24 A;  4NE3 A;  4WV4 B;  5DNM B;  3NQJ A;  1ID3 A;  3WKJ C;  3WA9 C;  1P3G D;  1EQZ C;  2IO5 C;  5AV6 D;  4LD9 A;  3NQU A;  1P3I A;  3MGQ A;  2L5A A;  5G49 B;  3X1V C;  3AYW C;  3MNN A;  1P3G C;  4J8W B;  3AFA A;  5AV6 C;  5B32 G;  2BYM B;  5GT3 B;  3LJA B;  1S32 A;  1M19 D;  4ZUX D;  1P3M A;  3MVD B;  4HGA C;  5DNN D;  4G91 C;  1N1J A;  3B0B A;  1P3P D;  3UTB A;  3UTA B;  3AZL A;  4X23 B;  5DNN C;  4Z66 B;  2YFV A;  1P3P C;  3KUY D;  1P3L B;  5AV9 C;  5AY8 B;  3C1B B;  3C1C D;  1JFI A;  4Z2M G;  4H9R A;  5B32 A;  5CPI A;  5B0Z A;  5B33 D;  4KUD B;  1ZLA A;  4H9P B;  4ZBJ C;  5JRG D;  1M1A A;  3KUY C;  3REK A;  5GT0 A;  1U35 A;  5CPK A;  3VH5 A;  3B0C W;  5B2I A;  5AVC B;  5CPJ A;  5JRG C;  4LD9 B;  5CP6 A;  3NQU B;  1P3I B;  4J8V B;  3W97 D;  5BNV A;  1F66 D;  4KHA B;  5B0Y A;  2NQB A;  5B2J A;  1KX3 B;  2F8N K;  3X1U D;  3UT9 A;  5F99 B;  1P3M B;  3W97 C;  2PYO A;  3W98 D;  3REJ C;  1F66 C;  3AZE D;  3WTP D;  3AZG A;  4J8X A;  3AZJ A;  3B0D B;  3X1U C;  3UTB B;  4R8P A;  3WA9 A;  4DRA A;  1EQZ A;  3AZL B;  1P3F A;  3W98 C;  2ARO B;  5JA4 A;  3WTP C;  3KWQ A;  1HQ3 B;  3REI D;  2YFV B;  3X1V A;  3AYW A;  1KX4 D;  5B1M D;  2JSS A;  5B40 B;  1A7W A;  4J8U D;  3REH A;  3LZ1 C;  5AV6 A;  5GXQ D;  4H9R B;  3AZK D;  3AZM B;  1TZY D;  5B0Z B;  3REI C;  4E45 A;  4YM6 A;  5B31 D;  1ZLA B;  5AVB D;  2NZD D;  1M1A B;  1AOI D;  5B1M C;  5GT0 B;  4J8U C;  1U35 B;  3AZK C;  5GXQ C;  5CPK B;  1TZY C;  5B2I B;  3REL D;  3A6N B;  5B31 C;  3AV1 A;  3AV2 A;  3W99 D;  2HIO D;  5AVB C;  5CP6 B;  3AZF D;  1P3B D;  1AOI C;  2NZD C;  1BH8 A;  5DNN A;  4EO5 C;  4JJN D;  2F8N D;  3AN2 D;  5B0Y B;  3REL C;  1P3P A;  3W99 C;  2BYK A;  2HIO C;  5AV9 A;  3MGP D;  5B2J B;  4G92 B;  3AZF C;  1P3B C;  3UT9 B;  4JJN C;  3AZH C;  2PYO B;  1P3O D;  3X1S B;  3AZG B;  4J8X B;  3MGP C;  3KUY A;  3AZM D;  3AZJ B;  5C3I C;  4NFT A;  5BS7 C;  3X1T D;  4R8P B;  4WU8 D;  4QLC D;  1EQZ B;  3WA9 B;  5AV8 D;  1P3F B;  1P3O C;  5JA4 B;  3KWQ B;  1R4V A;  4H9Q A;  3W96 D;  4XUJ D;  5AV8 C;  3REH B;  4KGC D;  4YS3 D;  3WTP E;  4XZQ A;  4YM6 B;  1B6W A;  3W96 C;  3KXB D;  3LEL D;  1P34 D;  3REJ A;  2CV5 B;  3MGS B;  3TU4 D;  3AV1 B;  5B31 G;  5GSU A;  3X1U A;  3AV2 B;  5B1L D;  5E5A A;  3MGR B;  1M18 B;  3KXB C;  3AZN A;  3W98 A;  4H9O A;  4Z5T B;  3TU4 C;  4Z2M H;  3O62 D;  5B1L C;  3V9R A;  5AV9 B;  3B6G B;  3LZ1 A;  3WAA D;  1P3K A;  3REI A;  2F8N G;  1P3A A;  3O62 C;  1M19 C;  4ZUX C;  5DNM D;  4WU9 A;  4WNN A;  3AZK A;  3WAA C;  1TZY A;  4WZS B;  2FJ7 A;  1KX5 B;  5B31 A;  3LZ0 A;  5AVB A;  2NZD A;  1AOI A;  5AV5 B;  3B6F B;  5B24 B;  3REL A;  1M18 D;  3W99 A;  4XZQ B;  3NQJ B;  3AZF A;  4J8W D;  1P3B A;  1ID3 B;  5GT3 D;  3LJA D;  2RVQ D;  3C1C C;  3AZH A;  2F8N A;  1B67 A;  5B33 C;  3MVD D;  3MGP A;  3AZI A;  3MGQ B;  5GSU B;  3R45 A;  5GT3 C;  3LJA C;  2RVQ C;  5E5A B;  3MNN B;  3UTA D;  3AZN B;  1H3O A;  4H9O B;  4X23 D;  3AFA B;  3MVD C;  1S32 B;  4Z66 D;  5AV8 A;  3UTA C;  3LZ1 B;  1P3L D;  5AY8 D;  3C1B D;  4X23 C;  1P3K B;  1N1J B;  3WKJ A;  5FUG A;  3W96 A;  5B24 D;  4Z66 C;  1P3A B;  4KUD D;  4WU9 B;  1ID3 D;  1P3L C;  5AY8 C;  3C1B C;  3AZE C;  2FJ7 B;  3LZ0 B;  2HUE B;  4KUD C;  5AVC D;  1P3G A;  1JFI B;  4LD9 D;  1P3I D;  3MGQ D;  5B32 B;  4J8V D;  5CPI B;  3TU4 A;  3MNN D;  5BNX A;  3B0C T;  5AVC C;  1KX4 C;  3AFA D;  5BT1 D;  3REK B;  4LD9 C;  1KX3 D;  1S32 D;  3AZH B;  1P3I C;  5F99 D;  4J8V C;  4AWL B;  5BO0 A;  5CPJ B;  1P3M D;  5KDM A;  3O62 A;  1M19 A;  4ZUX A;  3AZI B;  5BT1 C;  1KX3 C;  5BNV B;  3UTB D;  5F99 C;  3AZL D;  2NQB B;  2ARO D;  1HQ3 D;  3B0D C;  3UTB C;  5B40 D;  3AZL C;  3AN2 C;  3WKJ B;  2ARO C;  5B0Z D;  3C1C A;  1HQ3 C;  1KU5 A;  1ZLA D;  5G49 A;  1M1A D;  2IO5 B;  5B33 A;  5B40 C;  5GT0 D;  5JRG A;  1BH9 A;  3VH6 W;  1U35 D;  1TAF A;  4NE5 A;  3AZM C;  5CPK D;  5B0Z C;  5B2I D;  1F1E A;  3A6N D;  3AYW B;  3X1T C;  3X1V B;  4WU8 C;  4QLC C;  1P3G B;  1ZLA C;  5CP6 D;  5AV6 B;  5GT0 C;  5BNX B;  1ULY A;  5B2I C;  5B0Y D;  3A6N C;  2F8N H;  3W97 A;  2NQB D;  3UTA A;  4XUJ C;  4HGA B;  1F66 A;  5B2J D;  3UT9 D;  4KGC C;  4YS3 C;  4G91 B;  4Z66 A;  2PYO D;  1M19 B;  4CSR A;  5B0Y C;  3X1S D;  3AZG D;  3LEL C;  4J8X D;  4G92 C;  1P34 C;  1P3L A;  2LY8 A;  3AZJ D;  5AY8 A;  1BH8 B;  1WWI A;  5DNN B;  3WTP A;  3C1B A;  3UT9 C;  3AZE A;  4R8P D;  3WA9 D;  1EQZ D;  1P3P B;  4KUD A;  1P3F D;  2PYO C;  4H9P A;  2BYK B;  3X1S C;  3KWQ D;  3AZG C;  4J8X C;  3AZJ C;  3X1V D;  1HTA A;  4R8P C;  3AYW D;  4ZBJ B;  3REH D;  5AVC A;  1P3F C;  1KX4 A;  5B1M A;  3KUY B;  3C1C B;  3KWQ C;  4J8U A;  4YM6 D;  3VH6 T;  5GXQ A;  4J8V A;  5B33 B;  5JRG B;  4KHA A;  3REH C;  1BH9 B;  1TAF B;  4H9Q B;  5DNM C;  2CV5 D;  3MGS D;  1KX3 A;  4YM6 C;  3AV1 D;  3AV2 D;  5F99 A;  3MGR D;  4DRB A;  2HIO A;  3VH5 W;  4Z5T D;  5CHL B;  2CV5 C;  3MGS C;  4JJN A;  3AV1 C;  3W97 B;  3KSY A;  3AV2 C;  3MGR C;  5AV9 D;  3REJ B;  3AN2 A;  1F66 B;  1M18 C;  3B6G D;  2ARO A;  1BFM A;  4Z5T C;  4J8W C;  1HQ3 A;  4H9S C;  3X1U B;  1Q9C A;  5BS7 A;  4CSR B;  4E44 A;  3W98 B;  1P3O A;  5B40 A;  3AZE B;  3WTP B;  1WWS A;  3B6G C;  3AZM A;  1KX5 D;  3X1T A;  4WU8 A;  3V9R B;  4QLC A;  5AV5 D;  3REI B;  4CAY A;  3B6F D;  1KX5 C;  3A6N A;  1KX4 B;  5B1M B;  4XUJ A;  4XZQ D;  4J8U B;  4WNN B;  4KGC A;  5AV5 C;  5GXQ B;  3AZK B;  4YS3 A;  1TZY B;  4M6B A;  5B31 B;  3B6F C;  5AVB B;  2NZD B;  5B24 C;  3REJ D;  1AOI B;  4UUZ A;  3KXB A;  3LEL A;  3VH5 T;  1P34 A;  4XZQ C;  4EO5 B;  1ID3 C;  5GSU D;  5E5A D;  4H9N A;  3REL B;  3AZN D;  3W99 B;  2HIO B;  5B1L A;  3AZF B;  1P3B B;  3X1S A;  4JJN B;  3MGQ C;  5GSU C;  2F8N B;  2YFW A;  5E5A C;  3AN2 B;  3MNN C;  3LZ1 D;  3AZN C;  3MGP B;  3AFA C;  1P3K D;  5C3I B;  3R45 B;  3WAA A;  1S32 C;  1P3A D;  1P3O B;  4WU9 D;  1H3O B;  1P3M C;  5DNM A;  2FJ7 D;  1P3K C;  3LZ0 D;  3X1T B;  4WU8 B;  4QLC B;  5AV8 B;  1P3A C;  4WU9 C;  4CAY B;  5FUG B;  2CV5 A;  5B32 D;  5CPI D;  3MGS A;  2FJ7 C;  3W96 B;  4NE6 A;  3LZ0 C;  2HUE C;  4XUJ B;  3MGR A;  1M18 A;  4KGC B;  4YS3 B;  3REK D;  4Z5T A;  4J8W A; 
#chains in the Genus database with same CATH topology
 3AZH D;  4H9S A;  5B32 C;  5CPI C;  2BYM A;  5GT3 A;  3LJA A;  5CPJ D;  4UUZ B;  3KXB B;  3LEL B;  1P34 B;  1M1A C;  3AZI D;  3MVD A;  3B6G A;  3REK C;  4UPK A;  3TU4 B;  2XD1 A;  4H9N B;  1U35 C;  5CPK C;  4AWL C;  5B1L B;  5CPJ C;  5CP6 C;  3AZI C;  2VQR A;  4X23 A;  2YFW B;  5BO0 B;  5KDM B;  3O62 B;  1KX5 A;  4ZUX B;  2NQB C;  1Z2C B;  3WKJ D;  5AV5 A;  3WAA B;  5B2J C;  2CWE A;  3B6F A;  3VH6 A;  5B24 A;  4NE3 A;  4WV4 B;  5DNM B;  3NQJ A;  1ID3 A;  3WKJ C;  2Y2L A;  3WA9 C;  1P3G D;  1EQZ C;  1T3U A;  2IO5 C;  5AV6 D;  4LD9 A;  3NQU A;  1P3I A;  3MGQ A;  2L5A A;  5G49 B;  3X1V C;  3AYW C;  3MNN A;  1W2E A;  1P3G C;  2BG1 A;  4J8W B;  3AFA A;  5AV6 C;  5B32 G;  2BYM B;  5GT3 B;  3LJA B;  1S32 A;  1M19 D;  4ZUX D;  1P3M A;  3MVD B;  4HGA C;  5DNN D;  4G91 C;  1N1J A;  3B0B A;  1P3P D;  3UTB A;  3UTA B;  3AZL A;  4X23 B;  5DNN C;  3EG5 B;  4Z66 B;  2YFV A;  1P3P C;  3KUY D;  1P3L B;  5AV9 C;  5AY8 B;  3C1B B;  3C1C D;  2JCH A;  1JFI A;  4Z2M G;  4H9R A;  5B32 A;  5CPI A;  5B0Z A;  5B33 D;  4KUD B;  1ZLA A;  4H9P B;  4ZBJ C;  5JRG D;  1M1A A;  3KUY C;  3REK A;  5GT0 A;  1U35 A;  5CPK A;  3VH5 A;  3B0C W;  5B2I A;  5AVC B;  5CPJ A;  5JRG C;  4LD9 B;  5CP6 A;  3NQU B;  1P3I B;  4J8V B;  3W97 D;  5BNV A;  3EPH A;  1F66 D;  4KHA B;  5B0Y A;  2NQB A;  3AL0 C;  3EPL A;  5B2J A;  1KX3 B;  2F8N K;  3X1U D;  3UT9 A;  5F99 B;  1P3M B;  3W97 C;  2PYO A;  3W98 D;  3REJ C;  1F66 C;  3AZE D;  3WTP D;  3AZG A;  4J8X A;  3AZJ A;  3B0D B;  3X1U C;  3UTB B;  4R8P A;  3WA9 A;  4DRA A;  1EQZ A;  3AZL B;  2Y2Q A;  1P3F A;  3W98 C;  2ARO B;  5JA4 A;  3WTP C;  3KWQ A;  1HQ3 B;  3REI D;  2G5H C;  2YFV B;  3X1V A;  3AYW A;  1KX4 D;  5B1M D;  5B40 B;  2JSS A;  1A7W A;  4J8U D;  3REH A;  3LZ1 C;  5AV6 A;  5GXQ D;  4H9R B;  3AZK D;  3AZM B;  1TZY D;  5B0Z B;  3REI C;  4E45 A;  4YM6 A;  5B31 D;  1ZLA B;  5AVB D;  2NZD D;  1M1A B;  1AOI D;  3FDD A;  2ZY4 A;  5B1M C;  5GT0 B;  4J8U C;  1U35 B;  3AZK C;  5GXQ C;  5CPK B;  1TZY C;  5B2I B;  3REL D;  3A6N B;  5B31 C;  3AV1 A;  3AV2 A;  3W99 D;  2HIO D;  5AVB C;  5CP6 B;  3AZF D;  1P3B D;  1AOI C;  2NZD C;  1BH8 A;  5DNN A;  4EO5 C;  4JJN D;  2F8N D;  3AN2 D;  5B0Y B;  3REL C;  1P3P A;  3W99 C;  2BYK A;  2HIO C;  5AV9 A;  3MGP D;  5B2J B;  4G92 B;  3AZF C;  1P3B C;  3UT9 B;  2FFF B;  4JJN C;  3AZH C;  2PYO B;  1P3O D;  3X1S B;  3AZG B;  4J8X B;  3MGP C;  3KUY A;  3AZM D;  3AZJ B;  2RIQ A;  3A1K A;  5C3I C;  4NFT A;  5BS7 C;  3X1T D;  4R8P B;  4WU8 D;  4QLC D;  1EQZ B;  3WA9 B;  5AV8 D;  1P3F B;  1P3O C;  5JA4 B;  2J8P A;  3KWQ B;  1R4V A;  4H9Q A;  3W96 D;  4XUJ D;  5AV8 C;  3REH B;  4KGC D;  4YS3 D;  3EPJ A;  3WTP E;  4XZQ A;  4YM6 B;  1B6W A;  3W96 C;  3KXB D;  3LEL D;  1P34 D;  3REJ A;  3KFU G;  2CV5 B;  3MGS B;  3TU4 D;  3AV1 B;  5B31 G;  5GSU A;  3X1U A;  3AV2 B;  5B1L D;  5E5A A;  3MGR B;  1M18 B;  3KXB C;  3AZN A;  3W98 A;  4H9O A;  4Z5T B;  3P5J B;  3TU4 C;  3H0R C;  4Z2M H;  3O62 D;  5B1L C;  3V9R A;  5AV9 B;  2Y2H A;  3B6G B;  3LZ1 A;  2Y2M A;  3WAA D;  1P3K A;  3REI A;  2F8N G;  4WJ3 C;  1P3A A;  3O62 C;  1M19 C;  4ZUX C;  5DNM D;  4WU9 A;  4WNN A;  3AZK A;  3WAA C;  1TZY A;  4WZS B;  2FJ7 A;  1KX5 B;  5B31 A;  3LZ0 A;  5AVB A;  2Y2I A;  1AOI A;  2NZD A;  2W8S A;  5AV5 B;  2ZY5 A;  3B6F B;  5B24 B;  3REL A;  1M18 D;  2DF4 C;  3W99 A;  4XZQ B;  3NQJ B;  3AZF A;  4J8W D;  1P3B A;  1ID3 B;  5GT3 D;  3LJA D;  2RVQ D;  3C1C C;  2ZM5 A;  3AZH A;  2F8N A;  1B67 A;  5B33 C;  2ZY3 A;  3MVD D;  3MGP A;  3AZI A;  3MGQ B;  5GSU B;  3R45 A;  5GT3 C;  3LJA C;  2RVQ C;  5E5A B;  3MNN B;  3UTA D;  3AZN B;  1H3O A;  4H9O B;  4X23 D;  3AFA B;  3MVD C;  1S32 B;  4Z66 D;  5AV8 A;  3UTA C;  3LZ1 B;  1P3L D;  5AY8 D;  3C1B D;  4X23 C;  1P3K B;  1N1J B;  3WKJ A;  5FUG A;  3W96 A;  5B24 D;  4Z66 C;  1P3A B;  4KUD D;  2Y2O A;  4WU9 B;  1ID3 D;  1P3L C;  5AY8 C;  3C1B C;  3AZE C;  2FJ7 B;  3LZ0 B;  2HUE B;  4KUD C;  5AVC D;  1P3G A;  1JFI B;  4LD9 D;  1P3I D;  3MGQ D;  5B32 B;  4J8V D;  5CPI B;  3TU4 A;  3MNN D;  5BNX A;  3B0C T;  5AVC C;  1KX4 C;  2UWX A;  3AFA D;  5BT1 D;  3REK B;  4LD9 C;  1KX3 D;  1S32 D;  3AZH B;  1P3I C;  5F99 D;  4J8V C;  4AWL B;  2Y2N A;  5BO0 A;  5CPJ B;  1P3M D;  5KDM A;  3O62 A;  1M19 A;  4ZUX A;  3AZI B;  5BT1 C;  1KX3 C;  5BNV B;  3UTB D;  5F99 C;  3AZL D;  2NQB B;  2ARO D;  1HQ3 D;  3B0D C;  3UTB C;  4DQY B;  5B40 D;  3AZL C;  3AN2 C;  3WKJ B;  2ARO C;  5B0Z D;  3C1C A;  1HQ3 C;  1KU5 A;  2XD5 A;  1ZLA D;  5G49 A;  1M1A D;  2IO5 B;  5B33 A;  3H0M C;  5B40 C;  5GT0 D;  5JRG A;  1BH9 A;  3VH6 W;  1U35 D;  1TAF A;  4NE5 A;  3AZM C;  5CPK D;  5B0Z C;  5B2I D;  1F1E A;  3A6N D;  3AYW B;  3X1T C;  3X1V B;  4WU8 C;  4QLC C;  1P3G B;  1ZLA C;  5CP6 D;  5AV6 B;  5GT0 C;  2G5I C;  5BNX B;  1ULY A;  5B2I C;  5B0Y D;  3A6N C;  2F8N H;  3W97 A;  2NQB D;  3UTA A;  4XUJ C;  4HGA B;  1F66 A;  5B2J D;  3UT9 D;  4KGC C;  4YS3 C;  4G91 B;  4Z66 A;  2PYO D;  1M19 B;  4CSR A;  5B0Y C;  3X1S D;  3AZG D;  3LEL C;  4J8X D;  4G92 C;  1P34 C;  1P3L A;  2LY8 A;  3AZJ D;  5AY8 A;  1BH8 B;  1WWI A;  5DNN B;  3WTP A;  3C1B A;  3UT9 C;  3AZE A;  4R8P D;  3WA9 D;  1EQZ D;  1P3P B;  4KUD A;  1P3F D;  2PYO C;  4H9P A;  2BYK B;  2Y2P A;  3X1S C;  3KWQ D;  3AZG C;  4J8X C;  3AZJ C;  3X1V D;  1HTA A;  4R8P C;  3AYW D;  4ZBJ B;  2Y2G A;  3REH D;  5AVC A;  1P3F C;  2Y2K A;  1KX4 A;  5B1M A;  3KUY B;  3C1C B;  3KWQ C;  4J8U A;  4YM6 D;  3VH6 T;  5GXQ A;  4J8V A;  5B33 B;  5JRG B;  2JE5 A;  4KHA A;  1BH9 B;  2F2A C;  3REH C;  1TAF B;  4H9Q B;  5DNM C;  2CV5 D;  3MGS D;  1KX3 A;  4YM6 C;  3AV1 D;  3AV2 D;  5F99 A;  3MGR D;  4DRB A;  2HIO A;  3VH5 W;  4Z5T D;  5CHL B;  2CV5 C;  3MGS C;  4JJN A;  3AV1 C;  3W97 B;  3KSY A;  3AV2 C;  3MGR C;  5AV9 D;  3REJ B;  3AN2 A;  1F66 B;  1PZR A;  1M18 C;  3B6G D;  2ARO A;  1BFM A;  2ZY2 A;  2Y2J A;  4Z5T C;  4J8W C;  1HQ3 A;  4H9S C;  3X1U B;  1Q9C A;  5BS7 A;  3EPK A;  4CSR B;  4E44 A;  3W98 B;  1P3O A;  5B40 A;  3AZE B;  3WTP B;  1WWS A;  3B6G C;  3AZM A;  1KX5 D;  3X1T A;  4WU8 A;  3V9R B;  4QLC A;  5AV5 D;  3A1I A;  3REI B;  4CAY A;  3B6F D;  1KX5 C;  3A6N A;  1KX4 B;  5B1M B;  4XUJ A;  3F6T A;  4XZQ D;  4J8U B;  4WNN B;  4KGC A;  5AV5 C;  5GXQ B;  3AZK B;  4YS3 A;  1TZY B;  3IP4 C;  4M6B A;  5B31 B;  3B6F C;  5AVB B;  2NZD B;  5B24 C;  3REJ D;  2DQN C;  1AOI B;  4UUZ A;  3KXB A;  3LEL A;  3VH5 T;  1P34 A;  4XZQ C;  4EO5 B;  1ID3 C;  5GSU D;  5E5A D;  4H9N A;  3REL B;  3AZN D;  3W99 B;  2HIO B;  5B1L A;  3AZF B;  1P3B B;  3X1S A;  4JJN B;  3MGQ C;  5GSU C;  2F8N B;  2YFW A;  5E5A C;  3AN2 B;  3MNN C;  3LZ1 D;  3AZN C;  3MGP B;  3AFA C;  1P3K D;  5C3I B;  3R45 B;  3WAA A;  3H0L C;  1S32 C;  1P3A D;  1P3O B;  4WU9 D;  1H3O B;  1P3M C;  5DNM A;  2FJ7 D;  1P3K C;  3LZ0 D;  3X1T B;  4WU8 B;  4QLC B;  5AV8 B;  1P3A C;  4WU9 C;  4CAY B;  5FUG B;  2CV5 A;  5B32 D;  5CPI D;  3MGS A;  2FJ7 C;  3W96 B;  4NE6 A;  3LZ0 C;  2HUE C;  4XUJ B;  3MGR A;  1M18 A;  4KGC B;  4YS3 B;  3REK D;  4Z5T A;  4J8W A; 
#chains in the Genus database with same CATH homology
 3AZH D;  4H9S A;  5B32 C;  5CPI C;  2BYM A;  5GT3 A;  3LJA A;  5CPJ D;  4UUZ B;  3KXB B;  3LEL B;  1P34 B;  1M1A C;  3AZI D;  3MVD A;  3B6G A;  3REK C;  4UPK A;  3TU4 B;  2XD1 A;  4H9N B;  1U35 C;  5CPK C;  4AWL C;  5B1L B;  5CPJ C;  5CP6 C;  3AZI C;  2VQR A;  4X23 A;  2YFW B;  5BO0 B;  5KDM B;  3O62 B;  1KX5 A;  4ZUX B;  2NQB C;  1Z2C B;  3WKJ D;  5AV5 A;  3WAA B;  5B2J C;  2CWE A;  3B6F A;  3VH6 A;  5B24 A;  4NE3 A;  4WV4 B;  5DNM B;  3NQJ A;  1ID3 A;  3WKJ C;  2Y2L A;  3WA9 C;  1P3G D;  1EQZ C;  1T3U A;  2IO5 C;  5AV6 D;  4LD9 A;  3NQU A;  1P3I A;  3MGQ A;  2L5A A;  5G49 B;  3X1V C;  3AYW C;  3MNN A;  1W2E A;  1P3G C;  2BG1 A;  4J8W B;  3AFA A;  5AV6 C;  5B32 G;  2BYM B;  5GT3 B;  3LJA B;  1S32 A;  1M19 D;  4ZUX D;  1P3M A;  3MVD B;  4HGA C;  5DNN D;  4G91 C;  1N1J A;  3B0B A;  1P3P D;  3UTB A;  3UTA B;  3AZL A;  4X23 B;  5DNN C;  3EG5 B;  4Z66 B;  2YFV A;  1P3P C;  3KUY D;  1P3L B;  5AV9 C;  5AY8 B;  3C1B B;  3C1C D;  2JCH A;  1JFI A;  4Z2M G;  4H9R A;  5B32 A;  5CPI A;  5B0Z A;  5B33 D;  4KUD B;  1ZLA A;  4H9P B;  4ZBJ C;  5JRG D;  1M1A A;  3KUY C;  3REK A;  5GT0 A;  1U35 A;  5CPK A;  3VH5 A;  3B0C W;  5B2I A;  5AVC B;  5CPJ A;  5JRG C;  4LD9 B;  5CP6 A;  3NQU B;  1P3I B;  4J8V B;  3W97 D;  5BNV A;  3EPH A;  1F66 D;  4KHA B;  5B0Y A;  2NQB A;  3AL0 C;  3EPL A;  5B2J A;  1KX3 B;  2F8N K;  3X1U D;  3UT9 A;  5F99 B;  1P3M B;  3W97 C;  2PYO A;  3W98 D;  3REJ C;  1F66 C;  3AZE D;  3WTP D;  3AZG A;  4J8X A;  3AZJ A;  3B0D B;  3X1U C;  3UTB B;  4R8P A;  3WA9 A;  4DRA A;  1EQZ A;  3AZL B;  2Y2Q A;  1P3F A;  3W98 C;  2ARO B;  5JA4 A;  3WTP C;  3KWQ A;  1HQ3 B;  3REI D;  2G5H C;  2YFV B;  3X1V A;  3AYW A;  1KX4 D;  5B1M D;  5B40 B;  2JSS A;  1A7W A;  4J8U D;  3REH A;  3LZ1 C;  5AV6 A;  5GXQ D;  4H9R B;  3AZK D;  3AZM B;  1TZY D;  5B0Z B;  3REI C;  4E45 A;  4YM6 A;  5B31 D;  1ZLA B;  5AVB D;  2NZD D;  1M1A B;  1AOI D;  3FDD A;  2ZY4 A;  5B1M C;  5GT0 B;  4J8U C;  1U35 B;  3AZK C;  5GXQ C;  5CPK B;  1TZY C;  5B2I B;  3REL D;  3A6N B;  5B31 C;  3AV1 A;  3AV2 A;  3W99 D;  2HIO D;  5AVB C;  5CP6 B;  3AZF D;  1P3B D;  1AOI C;  2NZD C;  1BH8 A;  5DNN A;  4EO5 C;  4JJN D;  2F8N D;  3AN2 D;  5B0Y B;  3REL C;  1P3P A;  3W99 C;  2BYK A;  2HIO C;  5AV9 A;  3MGP D;  5B2J B;  4G92 B;  3AZF C;  1P3B C;  3UT9 B;  2FFF B;  4JJN C;  3AZH C;  2PYO B;  1P3O D;  3X1S B;  3AZG B;  4J8X B;  3MGP C;  3KUY A;  3AZM D;  3AZJ B;  2RIQ A;  3A1K A;  5C3I C;  4NFT A;  5BS7 C;  3X1T D;  4R8P B;  4WU8 D;  4QLC D;  1EQZ B;  3WA9 B;  5AV8 D;  1P3F B;  1P3O C;  5JA4 B;  2J8P A;  3KWQ B;  1R4V A;  4H9Q A;  3W96 D;  4XUJ D;  5AV8 C;  3REH B;  4KGC D;  4YS3 D;  3EPJ A;  3WTP E;  4XZQ A;  4YM6 B;  1B6W A;  3W96 C;  3KXB D;  3LEL D;  1P34 D;  3REJ A;  3KFU G;  2CV5 B;  3MGS B;  3TU4 D;  3AV1 B;  5B31 G;  5GSU A;  3X1U A;  3AV2 B;  5B1L D;  5E5A A;  3MGR B;  1M18 B;  3KXB C;  3AZN A;  3W98 A;  4H9O A;  4Z5T B;  3P5J B;  3TU4 C;  3H0R C;  4Z2M H;  3O62 D;  5B1L C;  3V9R A;  5AV9 B;  2Y2H A;  3B6G B;  3LZ1 A;  2Y2M A;  3WAA D;  1P3K A;  3REI A;  2F8N G;  4WJ3 C;  1P3A A;  3O62 C;  1M19 C;  4ZUX C;  5DNM D;  4WU9 A;  4WNN A;  3AZK A;  3WAA C;  1TZY A;  4WZS B;  2FJ7 A;  1KX5 B;  5B31 A;  3LZ0 A;  5AVB A;  2Y2I A;  1AOI A;  2NZD A;  2W8S A;  5AV5 B;  2ZY5 A;  3B6F B;  5B24 B;  3REL A;  1M18 D;  2DF4 C;  3W99 A;  4XZQ B;  3NQJ B;  3AZF A;  4J8W D;  1P3B A;  1ID3 B;  5GT3 D;  3LJA D;  2RVQ D;  3C1C C;  2ZM5 A;  3AZH A;  2F8N A;  1B67 A;  5B33 C;  2ZY3 A;  3MVD D;  3MGP A;  3AZI A;  3MGQ B;  5GSU B;  3R45 A;  5GT3 C;  3LJA C;  2RVQ C;  5E5A B;  3MNN B;  3UTA D;  3AZN B;  1H3O A;  4H9O B;  4X23 D;  3AFA B;  3MVD C;  1S32 B;  4Z66 D;  5AV8 A;  3UTA C;  3LZ1 B;  1P3L D;  5AY8 D;  3C1B D;  4X23 C;  1P3K B;  1N1J B;  3WKJ A;  5FUG A;  3W96 A;  5B24 D;  4Z66 C;  1P3A B;  4KUD D;  2Y2O A;  4WU9 B;  1ID3 D;  1P3L C;  5AY8 C;  3C1B C;  3AZE C;  2FJ7 B;  3LZ0 B;  2HUE B;  4KUD C;  5AVC D;  1P3G A;  1JFI B;  4LD9 D;  1P3I D;  3MGQ D;  5B32 B;  4J8V D;  5CPI B;  3TU4 A;  3MNN D;  5BNX A;  3B0C T;  5AVC C;  1KX4 C;  2UWX A;  3AFA D;  5BT1 D;  3REK B;  4LD9 C;  1KX3 D;  1S32 D;  3AZH B;  1P3I C;  5F99 D;  4J8V C;  4AWL B;  2Y2N A;  5BO0 A;  5CPJ B;  1P3M D;  5KDM A;  3O62 A;  1M19 A;  4ZUX A;  3AZI B;  5BT1 C;  1KX3 C;  5BNV B;  3UTB D;  5F99 C;  3AZL D;  2NQB B;  2ARO D;  1HQ3 D;  3B0D C;  3UTB C;  4DQY B;  5B40 D;  3AZL C;  3AN2 C;  3WKJ B;  2ARO C;  5B0Z D;  3C1C A;  1HQ3 C;  1KU5 A;  2XD5 A;  1ZLA D;  5G49 A;  1M1A D;  2IO5 B;  5B33 A;  3H0M C;  5B40 C;  5GT0 D;  5JRG A;  1BH9 A;  3VH6 W;  1U35 D;  1TAF A;  4NE5 A;  3AZM C;  5CPK D;  5B0Z C;  5B2I D;  1F1E A;  3A6N D;  3AYW B;  3X1T C;  3X1V B;  4WU8 C;  4QLC C;  1P3G B;  1ZLA C;  5CP6 D;  5AV6 B;  5GT0 C;  2G5I C;  5BNX B;  1ULY A;  5B2I C;  5B0Y D;  3A6N C;  2F8N H;  3W97 A;  2NQB D;  3UTA A;  4XUJ C;  4HGA B;  1F66 A;  5B2J D;  3UT9 D;  4KGC C;  4YS3 C;  4G91 B;  4Z66 A;  2PYO D;  1M19 B;  4CSR A;  5B0Y C;  3X1S D;  3AZG D;  3LEL C;  4J8X D;  4G92 C;  1P34 C;  1P3L A;  2LY8 A;  3AZJ D;  5AY8 A;  1BH8 B;  1WWI A;  5DNN B;  3WTP A;  3C1B A;  3UT9 C;  3AZE A;  4R8P D;  3WA9 D;  1EQZ D;  1P3P B;  4KUD A;  1P3F D;  2PYO C;  4H9P A;  2BYK B;  2Y2P A;  3X1S C;  3KWQ D;  3AZG C;  4J8X C;  3AZJ C;  3X1V D;  1HTA A;  4R8P C;  3AYW D;  4ZBJ B;  2Y2G A;  3REH D;  5AVC A;  1P3F C;  2Y2K A;  1KX4 A;  5B1M A;  3KUY B;  3C1C B;  3KWQ C;  4J8U A;  4YM6 D;  3VH6 T;  5GXQ A;  4J8V A;  5B33 B;  5JRG B;  2JE5 A;  4KHA A;  1BH9 B;  2F2A C;  3REH C;  1TAF B;  4H9Q B;  5DNM C;  2CV5 D;  3MGS D;  1KX3 A;  4YM6 C;  3AV1 D;  3AV2 D;  5F99 A;  3MGR D;  4DRB A;  2HIO A;  3VH5 W;  4Z5T D;  5CHL B;  2CV5 C;  3MGS C;  4JJN A;  3AV1 C;  3W97 B;  3KSY A;  3AV2 C;  3MGR C;  5AV9 D;  3REJ B;  3AN2 A;  1F66 B;  1PZR A;  1M18 C;  3B6G D;  2ARO A;  1BFM A;  2ZY2 A;  2Y2J A;  4Z5T C;  4J8W C;  1HQ3 A;  4H9S C;  3X1U B;  1Q9C A;  5BS7 A;  3EPK A;  4CSR B;  4E44 A;  3W98 B;  1P3O A;  5B40 A;  3AZE B;  3WTP B;  1WWS A;  3B6G C;  3AZM A;  1KX5 D;  3X1T A;  4WU8 A;  3V9R B;  4QLC A;  5AV5 D;  3A1I A;  3REI B;  4CAY A;  3B6F D;  1KX5 C;  3A6N A;  1KX4 B;  5B1M B;  4XUJ A;  3F6T A;  4XZQ D;  4J8U B;  4WNN B;  4KGC A;  5AV5 C;  5GXQ B;  3AZK B;  4YS3 A;  1TZY B;  3IP4 C;  4M6B A;  5B31 B;  3B6F C;  5AVB B;  2NZD B;  5B24 C;  3REJ D;  2DQN C;  1AOI B;  4UUZ A;  3KXB A;  3LEL A;  3VH5 T;  1P34 A;  4XZQ C;  4EO5 B;  1ID3 C;  5GSU D;  5E5A D;  4H9N A;  3REL B;  3AZN D;  3W99 B;  2HIO B;  5B1L A;  3AZF B;  1P3B B;  3X1S A;  4JJN B;  3MGQ C;  5GSU C;  2F8N B;  2YFW A;  5E5A C;  3AN2 B;  3MNN C;  3LZ1 D;  3AZN C;  3MGP B;  3AFA C;  1P3K D;  5C3I B;  3R45 B;  3WAA A;  3H0L C;  1S32 C;  1P3A D;  1P3O B;  4WU9 D;  1H3O B;  1P3M C;  5DNM A;  2FJ7 D;  1P3K C;  3LZ0 D;  3X1T B;  4WU8 B;  4QLC B;  5AV8 B;  1P3A C;  4WU9 C;  4CAY B;  5FUG B;  2CV5 A;  5B32 D;  5CPI D;  3MGS A;  2FJ7 C;  3W96 B;  4NE6 A;  3LZ0 C;  2HUE C;  4XUJ B;  3MGR A;  1M18 A;  4KGC B;  4YS3 B;  3REK D;  4Z5T A;  4J8W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...