5B40A

The nucleosome structure containing h2b-k120 and h4-k31 monoubiquitinations
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
94
structure length
94
Chain Sequence
YRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLAAIHAKRVTIMPKDIQLARRIRGER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.2
publication title Monoubiquitination of histones H2B and H4 changes the nucleosome stability without affecting the nucleosome structure
rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 32
structure length 94
sequence length 94
chains with identical sequence E
ec nomenclature
pdb deposition date 2016-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5b40A00
4KHAA 4WNNA 3AZFD 1F66B 3LZ0A 1S32B 3WA9B 3LJAB 4NE6A 3MVDD 1P3KB 1P3MC 3AZKB 3MNNA 1KX5B 3AZJB 4G91B 1U35A 3AV1A 3MGQC 3AZIA 3B6FA 5DNMD 4WU8D 4KUDC 4J8UD 1BH8A 1F66D 4H9RA 5GT0C 3WKJD 3WA9D 3LJAD 1P3KD 5B31C 1P3PD 5BNXA 3X1UC 3REID 3AZKD 1KX5D 3KXBB 3REHA 4Z66B 2IO5B 3AZMB 5B24A 4JJNB 3AFAB 3REKA 4ZUXA 5B40D 4KHAB 4WNNB 1M1AC 1KX4A 5CPIA 4HGAC 1P3IA 5KDMA 3AN2C 3W98B 3MNNB 4M6BA 3C1BA 3AZFC 5AV8B 1U35B 3AV1B 3AZIB 5AV6A 5B33A 4JJND 3AFAD 5GT3A 1BH8B 5CP6A 4H9RB 5DNMC 4WU8C 4J8UC 1ZLAA 1TZYA 2HUEB 5BNXB 3MNND 1F66C 3W98D 5AV8D 4WU9D 1Q9CA 3REHB 1S32C 3WKJC 1U35D 3WA9C 3LJAC 3V9RA 3AV1D 3AZID 1P3FA 5GXQA 5B24B 3REKB 5CHLB 1P3KC 1P3PC 4ZUXB 3REIC 3AZKC 4X23A 3AZEA 1KX5C 4G91C 3LELA 1EQZD 2FJ7A 4WZSB 3RELB 2CV5A 1KX4B 5CPIB 5CPJA 5B40C 1P3IB 5KDMB 3X1SA 3C1BB 1F1EA 1HQ3A 3REHD 2NQBA 5AV6B 5B33B 5F99A 3REKD 4ZUXD 3KXBC 5CPKB 4Z66C 3AZLA 2IO5C 1A7WA 4JJNC 5B2JA 3AFAC 3RELD 2YFWB 4H9OA 5CPID 1ZLAB 1P3ID 1TZYB 4ZBJB 4WV4B 3B0BA 4LD9B 5JRGD 1P3GB 3V9RB 1P3FB 3W98C 3MNNC 4X23B 4Z5TB 3AZEB 5AV8C 4WU9C 4Z2MG 3LELB 4YS3A 1U35C 3KUYD 1TAFA 3AV1C 5CPKD 3AZIC 2FJ7B 3KWQB 1ID3A 1WWIA 3VH5T 5B0ZD 2CV5B 1P3MD 5B2ID 1ZLAD 1EQZC 3AZNA 3NQJA 1HQ3B 4LD9D 2NQBB 1P3GD 1P3FD 1AOIA 3AZED 4Z5TD 3LELD 3C1CA 3REHC 3AZLB 3B0CW 2FJ7D 5B0YA 2PYOA 3MGPA 3O62D 5B24C 5B2JB 5AV9A 3KWQD 3REKC 2CV5D 4H9OB 4ZUXC 5B32G 2F8NK 5B32B 3RELC 5CPIC 1P3IC 5BO0A 4QLCD 5AVBA 3B6GA 1M1AD 5JRGC 3UTAA 4YS3B 3B0CT 1TAFB 4H9QA 1ID3B 4R8PB 1P3BA 4J8VA 3KUYC 3AZNB 5CPKC 2HIOD 3UT9B 1P34A 5AVCD 5B0ZC 5B2IC 5B32D 4CSRA 1ZLAC 3W99B 5AV5A 1TZYC 3WTPA 4NE3A 3W96D 4LD9C 4YS3D 1P3GC 5B0YB 1P3FC 3MGPB 5AV9B 4YM6D 4R8PD 4X23C 4Z5TC 3MGRA 3AZEC 3VH5A 3LELC 3AZND 2FJ7C 1S32D 3UT9D 3O62C 3KWQC 1JFIB 2CV5C 5BO0B 4G92B 5E5AA 2BYMB 1BH9A 3W99D 5AVBB 3AZJD 3B6GB 3W97B 4J8XA 3UTAB 1HQ3C 5BS7C 3MGSA 4H9QB 2NQBC 1KX3A 1P3AA 5B0YD 5AY8A 4QLCC 3MGPD 5AV9D 1P3BB 2RVQD 4CAYA 3LZ0B 4J8VB 5B1MA 3AZLC 5BT1D 5B2JC 4CSRB 3LZ1A 2HIOC 3WTPB 3KXBD 5AVCC 3B6GD 3W97D 3B6FB 4Z66D 1BFMA 5B32C 3AZMD 1P3OA 3W96C 3X1TA 4XZQA 3LZ0D 4YS3C 5G49A 3A6NA 4NE5A 4YM6C 4R8PC 4UUZA 1BH9B 3AZNC 3WTPD 3UT9C 4J8XB 3B6FD 1KX3B 1ULYA 1P3AB 5AY8B 3W99C 3X1VA 3AZJC 4CAYB 3WAAA 3AYWA 5B1MB 2AROA 5B0YC 3MGPC 5AV9C 2RVQC 3TU4A 3LZ1B 1M18A 5BT1C 4AWLB 1P3OB 5B24D 5B1LA 5GT3B 1KX3D 1P3AD 4XUJA 3B6GC 3X1TB 3W97C 5CP6B 4KUDA 3UTAC 3AZMC 3A6NB 3VH5W 1KX4D 4UUZB 5GT0A 3LZ1D 3C1BD 3LZ0C 4E44A 5B31A 4J8WA 5GXQB 5AV6D 5B33D 1P3OD 3X1VB 5GT3D 3VH6A 3WTPC 5FUGA 3AYWB 3B6FC 5CP6D 3AZGA 5CPJB 2AROB 3TU4B 2LY8A 3X1SB 1M18B 1TZYD 1B67A 5GXQD 5F99B 5B1LB 3R45A 2HUEC 4X23D 3MVDA 4XUJB 4J8XC 3AYWD 2BYKA 5CPJD 1KX3C 1P3AC 2NZDA 5GT0B 4WU8A 3TU4D 3X1SD 1M18D 1HQ3D 1KX4C 4J8WB 2NQBD 3LZ1C 3C1BC 5F99D 3WKJA 5B1LD 1P3KA 5FUGB 1P3PA 1KU5A 4XUJD 3REIA 3AZLD 5AV6C 3AZGB 5B33C 4AWLC 2F8NH 1P3OC 5B2JD 5GT3C 3AZHA 3X1TC 3NQJB 5B40A 5CP6C 3A6NC 1AOIB 3R45B 5JA4A 1R4VA 4ZBJC 3MVDB 3C1CB 2PYOB 5GXQC 1ID3D 2BYKB 3AZGD 2NZDB 1P3LA 3UTBA 3X1VC 4WU8B 1M19A 4JJNA 3AYWC 1N1JA 5CPJC 2AROC 3TU4C 1AOID 3WKJB 3X1SC 1M18C 1P3PB 3W98A 3REIB 3VH6W 2F8NA 3C1CD 5AV8A 4WU9A 2PYOD 5F99C 5B1LC 5DNNA 2NZDD 3AZHB 3REJA 4XUJC 1P34B 5B40B 3AV2A 1EQZA 3B0DB 4KGCA 5AV5B 5JA4B 5GSUA 3NQUA 5AVBD 3VH6T 3UTAD 4J8WC 4H9SA 5BNVA 1P3BD 1P3LB 3MGRB 3UTBB 1M19B 4J8VD 3AZHD 1P34D 1ID3C 4H9PA 1N1JB 4E45A 3AZGC 4H9NA 5E5AB 2F8NG 5AV5D 3RELA 3MGSB 4Z2MH 2F8NB 4WU9B 2JSSA 1B6WA 1AOIC 5JRGA 5DNNB 3MVDC 1P3LD 3MGRD 3REJB 3UTBD 1M19D 3C1CC 3AV2B 4NFTA 2PYOC 1EQZB 3KUYA 5CPKA 4KGCB 2NZDC 5B0ZA 5E5AD 1P3MA 5GSUB 3NQUB 5B2IA 2YFWA 5C3IB 4J8XD 3MGSD 2F8ND 3MGQA 4G92C 5BNVB 2YFVA 5AY8D 4LD9A 5AVBC 5DNND 1P3GA 4XZQB 2CWEA 3REJD 5G49B 5B1MD 4Z5TA 3AV2D 4H9PB 1P3BC 4H9NB 1H3OA 3O62A 3KWQA 4J8VC 3AZHC 4KGCD 4EO5B 5GSUD 1P34C 3X1UA 4DRAA 3B0DC 5JRGB 5BS7A 5AV5C 3WAAB 3X1TD 1HTAA 4XZQD 4QLCA 1M1AA 3A6ND 3KUYB 1P3LC 3MGRC 5B0ZB 3UTBC 1M19C 1P3MB 3AN2A 5B2IB 3AZFA 2HIOA 5AVCA 3MGQB 5E5AC 2YFVB 3X1VD 5B32A 4DRBA 4KUDB 3WAAD 3MGSC 3KSYA 3W96A 2AROD 5B31G 5AY8C 5DNMA 5DNNC 1H3OB 3O62B 4J8UA 3REJC 4YM6A 5B31B 4R8PA 5B1MC 3AV2C 3X1UB 1F66A 1S32A 3UT9A 3WA9A 3LJAA 4KGCC 3MGQD 5GSUC 3AZKA 1KX5A 5C3IC 4QLCB 3W99A 4KUDD 3AZJA 1M1AB 4H9SC 5GT0D 4HGAB 3WTPE 4XZQC 3AN2B 3AZFB 5B31D 3X1UD 4J8WD 2HIOB 5AVCB 1JFIA 4EO5C 1WWSA 2BYMA 3KXBA 2L5AA 3W96B 3W97A 4Z66A 5DNMB 3AZMA 3AFAA 3WAAC 4J8UB 4YM6B 3AN2D
chains in the Genus database with same CATH superfamily
4KHAA 4WNNA 3AZFD 2VQRA 3LZ0A 1F66B 1S32B 3WA9B 3LJAB 4NE6A 3MVDD 1P3KB 1P3MC 3AZKB 2Y2MA 3MNNA 1KX5B 3AZJB 4G91B 2DF4C 1U35A 3AV1A 3MGQC 3AZIA 3B6FA 5DNMD 4WU8D 2XD5A 4KUDC 4J8UD 1BH8A 1F66D 4H9RA 2ZY4A 5GT0C 3WKJD 3WA9D 3LJAD 1P3KD 5B31C 1P3PD 5BNXA 3X1UC 3REID 3AZKD 1KX5D 3KXBB 3H0LC 3REHA 4Z66B 2IO5B 3AZMB 2XD1A 5B24A 4JJNB 3AFAB 3REKA 4ZUXA 5B40D 4KHAB 4WNNB 1M1AC 1KX4A 5CPIA 4HGAC 1P3IA 5KDMA 3AN2C 3W98B 3MNNB 4M6BA 3C1BA 3AZFC 5AV8B 1U35B 3AV1B 3AZIB 5AV6A 5B33A 4JJND 3AFAD 5GT3A 1BH8B 5CP6A 4H9RB 5DNMC 4WU8C 4J8UC 1ZLAA 2Y2JA 2Y2IA 1TZYA 2HUEB 4UPKA 5BNXB 3MNND 1F66C 3W98D 5AV8D 4WU9D 1Q9CA 3REHB 1S32C 3WKJC 1U35D 3WA9C 3LJAC 3V9RA 3AV1D 3AZID 1P3FA 5GXQA 5B24B 3REKB 5CHLB 1P3KC 2UWXA 1P3PC 4ZUXB 3REIC 3AZKC 4X23A 3AZEA 1KX5C 4G91C 3LELA 1EQZD 2FJ7A 4WZSB 3RELB 2CV5A 1KX4B 5CPIB 5CPJA 5B40C 1P3IB 1PZRA 5KDMB 3X1SA 3C1BB 1F1EA 1HQ3A 3A1KA 3REHD 2NQBA 5AV6B 5B33B 5F99A 3REKD 4ZUXD 3KXBC 5CPKB 4Z66C 3AZLA 2IO5C 1A7WA 4JJNC 5B2JA 3AFAC 3RELD 2YFWB 4H9OA 5CPID 1ZLAB 1P3ID 1TZYB 4ZBJB 4WV4B 3B0BA 4LD9B 5JRGD 1P3GB 3V9RB 1P3FB 3W98C 3MNNC 4X23B 4Z5TB 3AZEB 5AV8C 4WU9C 4Z2MG 3LELB 4YS3A 1U35C 3KUYD 1TAFA 3H0MC 3AV1C 3AZIC 5CPKD 3KWQB 1ID3A 2FJ7B 1WWIA 3VH5T 5B0ZD 2CV5B 1P3MD 5B2ID 1ZLAD 1EQZC 3AZNA 3NQJA 1HQ3B 2ZY5A 2DQNC 4LD9D 2NQBB 1P3GD 1P3FD 1AOIA 3AZED 4Z5TD 3LELD 3C1CA 3REHC 3AZLB 3B0CW 2FJ7D 5B0YA 2PYOA 3MGPA 3O62D 5B24C 5B2JB 5AV9A 3KWQD 2ZM5A 3REKC 4H9OB 3FDDA 4ZUXC 2CV5D 5B32G 2Y2KA 2F8NK 5B32B 3RELC 5CPIC 1P3IC 5BO0A 4QLCD 5AVBA 3B6GA 1M1AD 5JRGC 3UTAA 4YS3B 3B0CT 1TAFB 4H9QA 1ID3B 4R8PB 1P3BA 4J8VA 3KUYC 3AZNB 5CPKC 2HIOD 3UT9B 4WJ3C 1P34A 5AVCD 5B0ZC 5B2IC 5B32D 4CSRA 1ZLAC 3W99B 5AV5A 1TZYC 3WTPA 4NE3A 3W96D 2Y2LA 4LD9C 4YS3D 1P3GC 5B0YB 1P3FC 3MGPB 2RIQA 5AV9B 4YM6D 4R8PD 4X23C 4Z5TC 2ZY3A 3MGRA 3AZEC 3VH5A 3LELC 3AZND 2FJ7C 1S32D 3UT9D 3O62C 3KWQC 1JFIB 2CV5C 5BO0B 4G92B 5E5AA 2BYMB 1BH9A 3W99D 5AVBB 3AZJD 3B6GB 3W97B 4J8XA 3UTAB 1HQ3C 5BS7C 3MGSA 4H9QB 2NQBC 1KX3A 1P3AA 5B0YD 5AY8A 4QLCC 3MGPD 5AV9D 1P3BB 2RVQD 4CAYA 3LZ0B 4J8VB 5B1MA 3AZLC 5BT1D 5B2JC 4CSRB 3LZ1A 2HIOC 3WTPB 3KXBD 5AVCC 3B6GD 3W97D 3B6FB 4Z66D 1BFMA 5B32C 3AZMD 1P3OA 2Y2NA 3W96C 3X1TA 4XZQA 3LZ0D 4YS3C 5G49A 3A6NA 4NE5A 4YM6C 4R8PC 4UUZA 1BH9B 3AZNC 3WTPD 3UT9C 4J8XB 3B6FD 1KX3B 1ULYA 1P3AB 5AY8B 3W99C 3X1VA 3AZJC 4CAYB 3WAAA 3AYWA 5B1MB 2AROA 5B0YC 3MGPC 5AV9C 2RVQC 3TU4A 3LZ1B 1M18A 3KFUG 3F6TA 5BT1C 4AWLB 1P3OB 5B24D 5B1LA 5GT3B 1KX3D 1P3AD 2Y2OA 4XUJA 3B6GC 3X1TB 3W97C 5CP6B 4KUDA 3EPJA 3UTAC 3AZMC 2F2AC 3A6NB 3VH5W 3IP4C 1KX4D 4UUZB 5GT0A 3LZ1D 3C1BD 3LZ0C 4E44A 5B31A 4J8WA 5GXQB 2ZY2A 5AV6D 5B33D 1P3OD 3X1VB 5GT3D 3VH6A 3H0RC 3WTPC 5FUGA 3AYWB 3B6FC 5CP6D 3AZGA 5CPJB 2AROB 3TU4B 2LY8A 3X1SB 1M18B 1TZYD 1B67A 2Y2PA 3EPKA 5GXQD 5F99B 5B1LB 3R45A 2HUEC 4X23D 3MVDA 4XUJB 4J8XC 3AYWD 2BYKA 5CPJD 1KX3C 1P3AC 2NZDA 5GT0B 4WU8A 3TU4D 3X1SD 1M18D 1HQ3D 1KX4C 1Z2CB 4J8WB 2NQBD 3LZ1C 3C1BC 5F99D 3WKJA 5B1LD 1P3KA 5FUGB 1P3PA 1KU5A 4XUJD 3REIA 3AZLD 5AV6C 3AZGB 5B33C 4AWLC 2F8NH 1P3OC 5B2JD 3A1IA 5GT3C 3AZHA 3X1TC 3NQJB 5B40A 5CP6C 3A6NC 2J8PA 1AOIB 3EPLA 3R45B 5JA4A 1R4VA 4ZBJC 3MVDB 3C1CB 2PYOB 5GXQC 1ID3D 2BYKB 3AZGD 2NZDB 1P3LA 3UTBA 3X1VC 4WU8B 1M19A 4JJNA 3AYWC 1N1JA 5CPJC 2AROC 3TU4C 1AOID 3WKJB 3X1SC 1M18C 2G5HC 1P3PB 3REIB 3VH6W 2F8NA 3W98A 3C1CD 5AV8A 4WU9A 2PYOD 5F99C 1W2EA 5B1LC 5DNNA 2NZDD 3AZHB 3REJA 4XUJC 1P34B 5B40B 3AV2A 1EQZA 3B0DB 4KGCA 5AV5B 5JA4B 5GSUA 3NQUA 5AVBD 3VH6T 3UTAD 4J8WC 4H9SA 5BNVA 1P3BD 1P3LB 3MGRB 3UTBB 1M19B 4J8VD 3AZHD 1P34D 1ID3C 4H9PA 1N1JB 4E45A 3AZGC 4H9NA 5E5AB 2F8NG 5AV5D 3RELA 3MGSB 4Z2MH 2F8NB 3AL0C 4WU9B 2JSSA 1B6WA 1AOIC 5JRGA 5DNNB 2Y2QA 3MVDC 1P3LD 3MGRD 3REJB 3UTBD 1M19D 3C1CC 3AV2B 4NFTA 2PYOC 1EQZB 2FFFB 3KUYA 5CPKA 4KGCB 2NZDC 5B0ZA 5E5AD 1P3MA 5GSUB 3NQUB 5B2IA 2YFWA 5C3IB 4J8XD 3MGSD 2JCHA 2F8ND 3MGQA 4G92C 5BNVB 2YFVA 5AY8D 4LD9A 5AVBC 5DNND 1P3GA 4XZQB 2CWEA 3REJD 5G49B 5B1MD 4Z5TA 3AV2D 4H9PB 1P3BC 4H9NB 2Y2HA 1H3OA 3O62A 3KWQA 3EG5B 4J8VC 3AZHC 4KGCD 4EO5B 3P5JB 5GSUD 1P34C 3X1UA 4DRAA 3B0DC 5JRGB 5BS7A 5AV5C 3WAAB 1T3UA 1HTAA 2G5IC 3X1TD 4QLCA 4XZQD 1M1AA 3A6ND 3KUYB 1P3LC 3MGRC 5B0ZB 3UTBC 1M19C 1P3MB 3AN2A 5B2IB 3AZFA 2HIOA 5AVCA 3MGQB 5E5AC 2YFVB 3X1VD 5B32A 4DRBA 4KUDB 3WAAD 3MGSC 2Y2GA 3KSYA 3W96A 2AROD 5B31G 5AY8C 5DNMA 5DNNC 1H3OB 3O62B 4J8UA 3REJC 4YM6A 5B31B 4R8PA 5B1MC 3AV2C 3X1UB 1F66A 1S32A 3UT9A 3WA9A 3LJAA 4KGCC 3MGQD 5GSUC 3AZKA 1KX5A 5C3IC 4QLCB 3W99A 4KUDD 3AZJA 1M1AB 4DQYB 3EPHA 4H9SC 5GT0D 2JE5A 4HGAB 3WTPE 4XZQC 3AN2B 3AZFB 5B31D 2BG1A 3X1UD 4J8WD 2HIOB 5AVCB 1JFIA 4EO5C 1WWSA 2BYMA 3KXBA 2L5AA 3W96B 3W97A 4Z66A 5DNMB 2W8SA 3AZMA 3AFAA 3WAAC 4J8UB 4YM6B 3AN2D
chains in the Genus database with same CATH topology
4KHAA 4WNNA 3AZFD 2VQRA 3LZ0A 1F66B 1S32B 3WA9B 3LJAB 4NE6A 3MVDD 1P3KB 1P3MC 3AZKB 2Y2MA 3MNNA 1KX5B 3AZJB 4G91B 2DF4C 1U35A 3AV1A 3MGQC 3AZIA 3B6FA 5DNMD 4WU8D 2XD5A 4KUDC 4J8UD 1BH8A 1F66D 4H9RA 2ZY4A 5GT0C 3WKJD 3WA9D 3LJAD 1P3KD 5B31C 1P3PD 5BNXA 3X1UC 3REID 3AZKD 1KX5D 3KXBB 3H0LC 3REHA 4Z66B 2IO5B 3AZMB 2XD1A 5B24A 4JJNB 3AFAB 3REKA 4ZUXA 5B40D 4KHAB 4WNNB 1M1AC 1KX4A 5CPIA 4HGAC 1P3IA 5KDMA 3AN2C 3W98B 3MNNB 4M6BA 3C1BA 3AZFC 5AV8B 1U35B 3AV1B 3AZIB 5AV6A 5B33A 4JJND 3AFAD 5GT3A 1BH8B 5CP6A 4H9RB 5DNMC 4WU8C 4J8UC 1ZLAA 2Y2JA 2Y2IA 1TZYA 2HUEB 4UPKA 5BNXB 3MNND 1F66C 3W98D 5AV8D 4WU9D 1Q9CA 3REHB 1S32C 3WKJC 1U35D 3WA9C 3LJAC 3V9RA 3AV1D 3AZID 1P3FA 5GXQA 5B24B 3REKB 5CHLB 1P3KC 2UWXA 1P3PC 4ZUXB 3REIC 3AZKC 4X23A 3AZEA 1KX5C 4G91C 3LELA 1EQZD 2FJ7A 4WZSB 3RELB 2CV5A 1KX4B 5CPIB 5CPJA 5B40C 1P3IB 1PZRA 5KDMB 3X1SA 3C1BB 1F1EA 1HQ3A 3A1KA 3REHD 2NQBA 5AV6B 5B33B 5F99A 3REKD 4ZUXD 3KXBC 5CPKB 4Z66C 3AZLA 2IO5C 1A7WA 4JJNC 5B2JA 3AFAC 3RELD 2YFWB 4H9OA 5CPID 1ZLAB 1P3ID 1TZYB 4ZBJB 4WV4B 3B0BA 4LD9B 5JRGD 1P3GB 3V9RB 1P3FB 3W98C 3MNNC 4X23B 4Z5TB 3AZEB 5AV8C 4WU9C 4Z2MG 3LELB 4YS3A 1U35C 3KUYD 1TAFA 3H0MC 3AV1C 3AZIC 5CPKD 3KWQB 1ID3A 2FJ7B 1WWIA 3VH5T 5B0ZD 2CV5B 1P3MD 5B2ID 1ZLAD 1EQZC 3AZNA 3NQJA 1HQ3B 2ZY5A 2DQNC 4LD9D 2NQBB 1P3GD 1P3FD 1AOIA 3AZED 4Z5TD 3LELD 3C1CA 3REHC 3AZLB 3B0CW 2FJ7D 5B0YA 2PYOA 3MGPA 3O62D 5B24C 5B2JB 5AV9A 3KWQD 2ZM5A 3REKC 4H9OB 3FDDA 4ZUXC 2CV5D 5B32G 2Y2KA 2F8NK 5B32B 3RELC 5CPIC 1P3IC 5BO0A 4QLCD 5AVBA 3B6GA 1M1AD 5JRGC 3UTAA 4YS3B 3B0CT 1TAFB 4H9QA 1ID3B 4R8PB 1P3BA 4J8VA 3KUYC 3AZNB 5CPKC 2HIOD 3UT9B 4WJ3C 1P34A 5AVCD 5B0ZC 5B2IC 5B32D 4CSRA 1ZLAC 3W99B 5AV5A 1TZYC 3WTPA 4NE3A 3W96D 2Y2LA 4LD9C 4YS3D 1P3GC 5B0YB 1P3FC 3MGPB 2RIQA 5AV9B 4YM6D 4R8PD 4X23C 4Z5TC 2ZY3A 3MGRA 3AZEC 3VH5A 3LELC 3AZND 2FJ7C 1S32D 3UT9D 3O62C 3KWQC 1JFIB 2CV5C 5BO0B 4G92B 5E5AA 2BYMB 1BH9A 3W99D 5AVBB 3AZJD 3B6GB 3W97B 4J8XA 3UTAB 1HQ3C 5BS7C 3MGSA 4H9QB 2NQBC 1KX3A 1P3AA 5B0YD 5AY8A 4QLCC 3MGPD 5AV9D 1P3BB 2RVQD 4CAYA 3LZ0B 4J8VB 5B1MA 3AZLC 5BT1D 5B2JC 4CSRB 3LZ1A 2HIOC 3WTPB 3KXBD 5AVCC 3B6GD 3W97D 3B6FB 4Z66D 1BFMA 5B32C 3AZMD 1P3OA 2Y2NA 3W96C 3X1TA 4XZQA 3LZ0D 4YS3C 5G49A 3A6NA 4NE5A 4YM6C 4R8PC 4UUZA 1BH9B 3AZNC 3WTPD 3UT9C 4J8XB 3B6FD 1KX3B 1ULYA 1P3AB 5AY8B 3W99C 3X1VA 3AZJC 4CAYB 3WAAA 3AYWA 5B1MB 2AROA 5B0YC 3MGPC 5AV9C 2RVQC 3TU4A 3LZ1B 1M18A 3KFUG 3F6TA 5BT1C 4AWLB 1P3OB 5B24D 5B1LA 5GT3B 1KX3D 1P3AD 2Y2OA 4XUJA 3B6GC 3X1TB 3W97C 5CP6B 4KUDA 3EPJA 3UTAC 3AZMC 2F2AC 3A6NB 3VH5W 3IP4C 1KX4D 4UUZB 5GT0A 3LZ1D 3C1BD 3LZ0C 4E44A 5B31A 4J8WA 5GXQB 2ZY2A 5AV6D 5B33D 1P3OD 3X1VB 5GT3D 3VH6A 3H0RC 3WTPC 5FUGA 3AYWB 3B6FC 5CP6D 3AZGA 5CPJB 2AROB 3TU4B 2LY8A 3X1SB 1M18B 1TZYD 1B67A 2Y2PA 3EPKA 5GXQD 5F99B 5B1LB 3R45A 2HUEC 4X23D 3MVDA 4XUJB 4J8XC 3AYWD 2BYKA 5CPJD 1KX3C 1P3AC 2NZDA 5GT0B 4WU8A 3TU4D 3X1SD 1M18D 1HQ3D 1KX4C 1Z2CB 4J8WB 2NQBD 3LZ1C 3C1BC 5F99D 3WKJA 5B1LD 1P3KA 5FUGB 1P3PA 1KU5A 4XUJD 3REIA 3AZLD 5AV6C 3AZGB 5B33C 4AWLC 2F8NH 1P3OC 5B2JD 3A1IA 5GT3C 3AZHA 3X1TC 3NQJB 5B40A 5CP6C 3A6NC 2J8PA 1AOIB 3EPLA 3R45B 5JA4A 1R4VA 4ZBJC 3MVDB 3C1CB 2PYOB 5GXQC 1ID3D 2BYKB 3AZGD 2NZDB 1P3LA 3UTBA 3X1VC 4WU8B 1M19A 4JJNA 3AYWC 1N1JA 5CPJC 2AROC 3TU4C 1AOID 3WKJB 3X1SC 1M18C 2G5HC 1P3PB 3REIB 3VH6W 2F8NA 3W98A 3C1CD 5AV8A 4WU9A 2PYOD 5F99C 1W2EA 5B1LC 5DNNA 2NZDD 3AZHB 3REJA 4XUJC 1P34B 5B40B 3AV2A 1EQZA 3B0DB 4KGCA 5AV5B 5JA4B 5GSUA 3NQUA 5AVBD 3VH6T 3UTAD 4J8WC 4H9SA 5BNVA 1P3BD 1P3LB 3MGRB 3UTBB 1M19B 4J8VD 3AZHD 1P34D 1ID3C 4H9PA 1N1JB 4E45A 3AZGC 4H9NA 5E5AB 2F8NG 5AV5D 3RELA 3MGSB 4Z2MH 2F8NB 3AL0C 4WU9B 2JSSA 1B6WA 1AOIC 5JRGA 5DNNB 2Y2QA 3MVDC 1P3LD 3MGRD 3REJB 3UTBD 1M19D 3C1CC 3AV2B 4NFTA 2PYOC 1EQZB 2FFFB 3KUYA 5CPKA 4KGCB 2NZDC 5B0ZA 5E5AD 1P3MA 5GSUB 3NQUB 5B2IA 2YFWA 5C3IB 4J8XD 3MGSD 2JCHA 2F8ND 3MGQA 4G92C 5BNVB 2YFVA 5AY8D 4LD9A 5AVBC 5DNND 1P3GA 4XZQB 2CWEA 3REJD 5G49B 5B1MD 4Z5TA 3AV2D 4H9PB 1P3BC 4H9NB 2Y2HA 1H3OA 3O62A 3KWQA 3EG5B 4J8VC 3AZHC 4KGCD 4EO5B 3P5JB 5GSUD 1P34C 3X1UA 4DRAA 3B0DC 5JRGB 5BS7A 5AV5C 3WAAB 1T3UA 1HTAA 2G5IC 3X1TD 4QLCA 4XZQD 1M1AA 3A6ND 3KUYB 1P3LC 3MGRC 5B0ZB 3UTBC 1M19C 1P3MB 3AN2A 5B2IB 3AZFA 2HIOA 5AVCA 3MGQB 5E5AC 2YFVB 3X1VD 5B32A 4DRBA 4KUDB 3WAAD 3MGSC 2Y2GA 3KSYA 3W96A 2AROD 5B31G 5AY8C 5DNMA 5DNNC 1H3OB 3O62B 4J8UA 3REJC 4YM6A 5B31B 4R8PA 5B1MC 3AV2C 3X1UB 1F66A 1S32A 3UT9A 3WA9A 3LJAA 4KGCC 3MGQD 5GSUC 3AZKA 1KX5A 5C3IC 4QLCB 3W99A 4KUDD 3AZJA 1M1AB 4DQYB 3EPHA 4H9SC 5GT0D 2JE5A 4HGAB 3WTPE 4XZQC 3AN2B 3AZFB 5B31D 2BG1A 3X1UD 4J8WD 2HIOB 5AVCB 1JFIA 4EO5C 1WWSA 2BYMA 3KXBA 2L5AA 3W96B 3W97A 4Z66A 5DNMB 2W8SA 3AZMA 3AFAA 3WAAC 4J8UB 4YM6B 3AN2D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KHA A;  4WNN A;  3AZF D;  1F66 B;  3LZ0 A;  1S32 B;  3WA9 B;  3LJA B;  4NE6 A;  3MVD D;  1P3K B;  1P3M C;  3AZK B;  3MNN A;  1KX5 B;  3AZJ B;  4G91 B;  1U35 A;  3AV1 A;  3MGQ C;  3AZI A;  3B6F A;  5DNM D;  4WU8 D;  4KUD C;  4J8U D;  1BH8 A;  1F66 D;  4H9R A;  5GT0 C;  3WKJ D;  3WA9 D;  3LJA D;  1P3K D;  5B31 C;  1P3P D;  5BNX A;  3X1U C;  3REI D;  3AZK D;  1KX5 D;  3KXB B;  3REH A;  4Z66 B;  2IO5 B;  3AZM B;  5B24 A;  4JJN B;  3AFA B;  3REK A;  4ZUX A;  5B40 D;  4KHA B;  4WNN B;  1M1A C;  1KX4 A;  5CPI A;  4HGA C;  1P3I A;  5KDM A;  3AN2 C;  3W98 B;  3MNN B;  4M6B A;  3C1B A;  3AZF C;  5AV8 B;  1U35 B;  3AV1 B;  3AZI B;  5AV6 A;  5B33 A;  4JJN D;  3AFA D;  5GT3 A;  1BH8 B;  5CP6 A;  4H9R B;  5DNM C;  4WU8 C;  4J8U C;  1ZLA A;  1TZY A;  2HUE B;  5BNX B;  3MNN D;  1F66 C;  3W98 D;  5AV8 D;  4WU9 D;  1Q9C A;  3REH B;  1S32 C;  3WKJ C;  1U35 D;  3WA9 C;  3LJA C;  3V9R A;  3AV1 D;  3AZI D;  1P3F A;  5GXQ A;  5B24 B;  3REK B;  5CHL B;  1P3K C;  1P3P C;  4ZUX B;  3REI C;  3AZK C;  4X23 A;  3AZE A;  1KX5 C;  4G91 C;  3LEL A;  1EQZ D;  2FJ7 A;  4WZS B;  3REL B;  2CV5 A;  1KX4 B;  5CPI B;  5CPJ A;  5B40 C;  1P3I B;  5KDM B;  3X1S A;  3C1B B;  1F1E A;  1HQ3 A;  3REH D;  2NQB A;  5AV6 B;  5B33 B;  5F99 A;  3REK D;  4ZUX D;  3KXB C;  5CPK B;  4Z66 C;  3AZL A;  2IO5 C;  1A7W A;  4JJN C;  5B2J A;  3AFA C;  3REL D;  2YFW B;  4H9O A;  5CPI D;  1ZLA B;  1P3I D;  1TZY B;  4ZBJ B;  4WV4 B;  3B0B A;  4LD9 B;  5JRG D;  1P3G B;  3V9R B;  1P3F B;  3W98 C;  3MNN C;  4X23 B;  4Z5T B;  3AZE B;  5AV8 C;  4WU9 C;  4Z2M G;  3LEL B;  4YS3 A;  1U35 C;  3KUY D;  1TAF A;  3AV1 C;  5CPK D;  3AZI C;  2FJ7 B;  3KWQ B;  1ID3 A;  1WWI A;  3VH5 T;  5B0Z D;  2CV5 B;  1P3M D;  5B2I D;  1ZLA D;  1EQZ C;  3AZN A;  3NQJ A;  1HQ3 B;  4LD9 D;  2NQB B;  1P3G D;  1P3F D;  1AOI A;  3AZE D;  4Z5T D;  3LEL D;  3C1C A;  3REH C;  3AZL B;  3B0C W;  2FJ7 D;  5B0Y A;  2PYO A;  3MGP A;  3O62 D;  5B24 C;  5B2J B;  5AV9 A;  3KWQ D;  3REK C;  2CV5 D;  4H9O B;  4ZUX C;  5B32 G;  2F8N K;  5B32 B;  3REL C;  5CPI C;  1P3I C;  5BO0 A;  4QLC D;  5AVB A;  3B6G A;  1M1A D;  5JRG C;  3UTA A;  4YS3 B;  3B0C T;  1TAF B;  4H9Q A;  1ID3 B;  4R8P B;  1P3B A;  4J8V A;  3KUY C;  3AZN B;  5CPK C;  2HIO D;  3UT9 B;  1P34 A;  5AVC D;  5B0Z C;  5B2I C;  5B32 D;  4CSR A;  1ZLA C;  3W99 B;  5AV5 A;  1TZY C;  3WTP A;  4NE3 A;  3W96 D;  4LD9 C;  4YS3 D;  1P3G C;  5B0Y B;  1P3F C;  3MGP B;  5AV9 B;  4YM6 D;  4R8P D;  4X23 C;  4Z5T C;  3MGR A;  3AZE C;  3VH5 A;  3LEL C;  3AZN D;  2FJ7 C;  1S32 D;  3UT9 D;  3O62 C;  3KWQ C;  1JFI B;  2CV5 C;  5BO0 B;  4G92 B;  5E5A A;  2BYM B;  1BH9 A;  3W99 D;  5AVB B;  3AZJ D;  3B6G B;  3W97 B;  4J8X A;  3UTA B;  1HQ3 C;  5BS7 C;  3MGS A;  4H9Q B;  2NQB C;  1KX3 A;  1P3A A;  5B0Y D;  5AY8 A;  4QLC C;  3MGP D;  5AV9 D;  1P3B B;  2RVQ D;  4CAY A;  3LZ0 B;  4J8V B;  5B1M A;  3AZL C;  5BT1 D;  5B2J C;  4CSR B;  3LZ1 A;  2HIO C;  3WTP B;  3KXB D;  5AVC C;  3B6G D;  3W97 D;  3B6F B;  4Z66 D;  1BFM A;  5B32 C;  3AZM D;  1P3O A;  3W96 C;  3X1T A;  4XZQ A;  3LZ0 D;  4YS3 C;  5G49 A;  3A6N A;  4NE5 A;  4YM6 C;  4R8P C;  4UUZ A;  1BH9 B;  3AZN C;  3WTP D;  3UT9 C;  4J8X B;  3B6F D;  1KX3 B;  1ULY A;  1P3A B;  5AY8 B;  3W99 C;  3X1V A;  3AZJ C;  4CAY B;  3WAA A;  3AYW A;  5B1M B;  2ARO A;  5B0Y C;  3MGP C;  5AV9 C;  2RVQ C;  3TU4 A;  3LZ1 B;  1M18 A;  5BT1 C;  4AWL B;  1P3O B;  5B24 D;  5B1L A;  5GT3 B;  1KX3 D;  1P3A D;  4XUJ A;  3B6G C;  3X1T B;  3W97 C;  5CP6 B;  4KUD A;  3UTA C;  3AZM C;  3A6N B;  3VH5 W;  1KX4 D;  4UUZ B;  5GT0 A;  3LZ1 D;  3C1B D;  3LZ0 C;  4E44 A;  5B31 A;  4J8W A;  5GXQ B;  5AV6 D;  5B33 D;  1P3O D;  3X1V B;  5GT3 D;  3VH6 A;  3WTP C;  5FUG A;  3AYW B;  3B6F C;  5CP6 D;  3AZG A;  5CPJ B;  2ARO B;  3TU4 B;  2LY8 A;  3X1S B;  1M18 B;  1TZY D;  1B67 A;  5GXQ D;  5F99 B;  5B1L B;  3R45 A;  2HUE C;  4X23 D;  3MVD A;  4XUJ B;  4J8X C;  3AYW D;  2BYK A;  5CPJ D;  1KX3 C;  1P3A C;  2NZD A;  5GT0 B;  4WU8 A;  3TU4 D;  3X1S D;  1M18 D;  1HQ3 D;  1KX4 C;  4J8W B;  2NQB D;  3LZ1 C;  3C1B C;  5F99 D;  3WKJ A;  5B1L D;  1P3K A;  5FUG B;  1P3P A;  1KU5 A;  4XUJ D;  3REI A;  3AZL D;  5AV6 C;  3AZG B;  5B33 C;  4AWL C;  2F8N H;  1P3O C;  5B2J D;  5GT3 C;  3AZH A;  3X1T C;  3NQJ B;  5B40 A;  5CP6 C;  3A6N C;  1AOI B;  3R45 B;  5JA4 A;  1R4V A;  4ZBJ C;  3MVD B;  3C1C B;  2PYO B;  5GXQ C;  1ID3 D;  2BYK B;  3AZG D;  2NZD B;  1P3L A;  3UTB A;  3X1V C;  4WU8 B;  1M19 A;  4JJN A;  3AYW C;  1N1J A;  5CPJ C;  2ARO C;  3TU4 C;  1AOI D;  3WKJ B;  3X1S C;  1M18 C;  1P3P B;  3W98 A;  3REI B;  3VH6 W;  2F8N A;  3C1C D;  5AV8 A;  4WU9 A;  2PYO D;  5F99 C;  5B1L C;  5DNN A;  2NZD D;  3AZH B;  3REJ A;  4XUJ C;  1P34 B;  5B40 B;  3AV2 A;  1EQZ A;  3B0D B;  4KGC A;  5AV5 B;  5JA4 B;  5GSU A;  3NQU A;  5AVB D;  3VH6 T;  3UTA D;  4J8W C;  4H9S A;  5BNV A;  1P3B D;  1P3L B;  3MGR B;  3UTB B;  1M19 B;  4J8V D;  3AZH D;  1P34 D;  1ID3 C;  4H9P A;  1N1J B;  4E45 A;  3AZG C;  4H9N A;  5E5A B;  2F8N G;  5AV5 D;  3REL A;  3MGS B;  4Z2M H;  2F8N B;  4WU9 B;  2JSS A;  1B6W A;  1AOI C;  5JRG A;  5DNN B;  3MVD C;  1P3L D;  3MGR D;  3REJ B;  3UTB D;  1M19 D;  3C1C C;  3AV2 B;  4NFT A;  2PYO C;  1EQZ B;  3KUY A;  5CPK A;  4KGC B;  2NZD C;  5B0Z A;  5E5A D;  1P3M A;  5GSU B;  3NQU B;  5B2I A;  2YFW A;  5C3I B;  4J8X D;  3MGS D;  2F8N D;  3MGQ A;  4G92 C;  5BNV B;  2YFV A;  5AY8 D;  4LD9 A;  5AVB C;  5DNN D;  1P3G A;  4XZQ B;  2CWE A;  3REJ D;  5G49 B;  5B1M D;  4Z5T A;  3AV2 D;  4H9P B;  1P3B C;  4H9N B;  1H3O A;  3O62 A;  3KWQ A;  4J8V C;  3AZH C;  4KGC D;  4EO5 B;  5GSU D;  1P34 C;  3X1U A;  4DRA A;  3B0D C;  5JRG B;  5BS7 A;  5AV5 C;  3WAA B;  3X1T D;  1HTA A;  4XZQ D;  4QLC A;  1M1A A;  3A6N D;  3KUY B;  1P3L C;  3MGR C;  5B0Z B;  3UTB C;  1M19 C;  1P3M B;  3AN2 A;  5B2I B;  3AZF A;  2HIO A;  5AVC A;  3MGQ B;  5E5A C;  2YFV B;  3X1V D;  5B32 A;  4DRB A;  4KUD B;  3WAA D;  3MGS C;  3KSY A;  3W96 A;  2ARO D;  5B31 G;  5AY8 C;  5DNM A;  5DNN C;  1H3O B;  3O62 B;  4J8U A;  3REJ C;  4YM6 A;  5B31 B;  4R8P A;  5B1M C;  3AV2 C;  3X1U B;  1F66 A;  1S32 A;  3UT9 A;  3WA9 A;  3LJA A;  4KGC C;  3MGQ D;  5GSU C;  3AZK A;  1KX5 A;  5C3I C;  4QLC B;  3W99 A;  4KUD D;  3AZJ A;  1M1A B;  4H9S C;  5GT0 D;  4HGA B;  3WTP E;  4XZQ C;  3AN2 B;  3AZF B;  5B31 D;  3X1U D;  4J8W D;  2HIO B;  5AVC B;  1JFI A;  4EO5 C;  1WWS A;  2BYM A;  3KXB A;  2L5A A;  3W96 B;  3W97 A;  4Z66 A;  5DNM B;  3AZM A;  3AFA A;  3WAA C;  4J8U B;  4YM6 B;  3AN2 D; 
#chains in the Genus database with same CATH topology
 4KHA A;  4WNN A;  3AZF D;  2VQR A;  3LZ0 A;  1F66 B;  1S32 B;  3WA9 B;  3LJA B;  4NE6 A;  3MVD D;  1P3K B;  1P3M C;  3AZK B;  2Y2M A;  3MNN A;  1KX5 B;  3AZJ B;  4G91 B;  2DF4 C;  1U35 A;  3AV1 A;  3MGQ C;  3AZI A;  3B6F A;  5DNM D;  4WU8 D;  2XD5 A;  4KUD C;  4J8U D;  1BH8 A;  1F66 D;  4H9R A;  2ZY4 A;  5GT0 C;  3WKJ D;  3WA9 D;  3LJA D;  1P3K D;  5B31 C;  1P3P D;  5BNX A;  3X1U C;  3REI D;  3AZK D;  1KX5 D;  3KXB B;  3H0L C;  3REH A;  4Z66 B;  2IO5 B;  3AZM B;  2XD1 A;  5B24 A;  4JJN B;  3AFA B;  3REK A;  4ZUX A;  5B40 D;  4KHA B;  4WNN B;  1M1A C;  1KX4 A;  5CPI A;  4HGA C;  1P3I A;  5KDM A;  3AN2 C;  3W98 B;  3MNN B;  4M6B A;  3C1B A;  3AZF C;  5AV8 B;  1U35 B;  3AV1 B;  3AZI B;  5AV6 A;  5B33 A;  4JJN D;  3AFA D;  5GT3 A;  1BH8 B;  5CP6 A;  4H9R B;  5DNM C;  4WU8 C;  4J8U C;  1ZLA A;  2Y2J A;  2Y2I A;  1TZY A;  2HUE B;  4UPK A;  5BNX B;  3MNN D;  1F66 C;  3W98 D;  5AV8 D;  4WU9 D;  1Q9C A;  3REH B;  1S32 C;  3WKJ C;  1U35 D;  3WA9 C;  3LJA C;  3V9R A;  3AV1 D;  3AZI D;  1P3F A;  5GXQ A;  5B24 B;  3REK B;  5CHL B;  1P3K C;  2UWX A;  1P3P C;  4ZUX B;  3REI C;  3AZK C;  4X23 A;  3AZE A;  1KX5 C;  4G91 C;  3LEL A;  1EQZ D;  2FJ7 A;  4WZS B;  3REL B;  2CV5 A;  1KX4 B;  5CPI B;  5CPJ A;  5B40 C;  1P3I B;  1PZR A;  5KDM B;  3X1S A;  3C1B B;  1F1E A;  1HQ3 A;  3A1K A;  3REH D;  2NQB A;  5AV6 B;  5B33 B;  5F99 A;  3REK D;  4ZUX D;  3KXB C;  5CPK B;  4Z66 C;  3AZL A;  2IO5 C;  1A7W A;  4JJN C;  5B2J A;  3AFA C;  3REL D;  2YFW B;  4H9O A;  5CPI D;  1ZLA B;  1P3I D;  1TZY B;  4ZBJ B;  4WV4 B;  3B0B A;  4LD9 B;  5JRG D;  1P3G B;  3V9R B;  1P3F B;  3W98 C;  3MNN C;  4X23 B;  4Z5T B;  3AZE B;  5AV8 C;  4WU9 C;  4Z2M G;  3LEL B;  4YS3 A;  1U35 C;  3KUY D;  1TAF A;  3H0M C;  3AV1 C;  3AZI C;  5CPK D;  3KWQ B;  1ID3 A;  2FJ7 B;  1WWI A;  3VH5 T;  5B0Z D;  2CV5 B;  1P3M D;  5B2I D;  1ZLA D;  1EQZ C;  3AZN A;  3NQJ A;  1HQ3 B;  2ZY5 A;  2DQN C;  4LD9 D;  2NQB B;  1P3G D;  1P3F D;  1AOI A;  3AZE D;  4Z5T D;  3LEL D;  3C1C A;  3REH C;  3AZL B;  3B0C W;  2FJ7 D;  5B0Y A;  2PYO A;  3MGP A;  3O62 D;  5B24 C;  5B2J B;  5AV9 A;  3KWQ D;  2ZM5 A;  3REK C;  4H9O B;  3FDD A;  4ZUX C;  2CV5 D;  5B32 G;  2Y2K A;  2F8N K;  5B32 B;  3REL C;  5CPI C;  1P3I C;  5BO0 A;  4QLC D;  5AVB A;  3B6G A;  1M1A D;  5JRG C;  3UTA A;  4YS3 B;  3B0C T;  1TAF B;  4H9Q A;  1ID3 B;  4R8P B;  1P3B A;  4J8V A;  3KUY C;  3AZN B;  5CPK C;  2HIO D;  3UT9 B;  4WJ3 C;  1P34 A;  5AVC D;  5B0Z C;  5B2I C;  5B32 D;  4CSR A;  1ZLA C;  3W99 B;  5AV5 A;  1TZY C;  3WTP A;  4NE3 A;  3W96 D;  2Y2L A;  4LD9 C;  4YS3 D;  1P3G C;  5B0Y B;  1P3F C;  3MGP B;  2RIQ A;  5AV9 B;  4YM6 D;  4R8P D;  4X23 C;  4Z5T C;  2ZY3 A;  3MGR A;  3AZE C;  3VH5 A;  3LEL C;  3AZN D;  2FJ7 C;  1S32 D;  3UT9 D;  3O62 C;  3KWQ C;  1JFI B;  2CV5 C;  5BO0 B;  4G92 B;  5E5A A;  2BYM B;  1BH9 A;  3W99 D;  5AVB B;  3AZJ D;  3B6G B;  3W97 B;  4J8X A;  3UTA B;  1HQ3 C;  5BS7 C;  3MGS A;  4H9Q B;  2NQB C;  1KX3 A;  1P3A A;  5B0Y D;  5AY8 A;  4QLC C;  3MGP D;  5AV9 D;  1P3B B;  2RVQ D;  4CAY A;  3LZ0 B;  4J8V B;  5B1M A;  3AZL C;  5BT1 D;  5B2J C;  4CSR B;  3LZ1 A;  2HIO C;  3WTP B;  3KXB D;  5AVC C;  3B6G D;  3W97 D;  3B6F B;  4Z66 D;  1BFM A;  5B32 C;  3AZM D;  1P3O A;  2Y2N A;  3W96 C;  3X1T A;  4XZQ A;  3LZ0 D;  4YS3 C;  5G49 A;  3A6N A;  4NE5 A;  4YM6 C;  4R8P C;  4UUZ A;  1BH9 B;  3AZN C;  3WTP D;  3UT9 C;  4J8X B;  3B6F D;  1KX3 B;  1ULY A;  1P3A B;  5AY8 B;  3W99 C;  3X1V A;  3AZJ C;  4CAY B;  3WAA A;  3AYW A;  5B1M B;  2ARO A;  5B0Y C;  3MGP C;  5AV9 C;  2RVQ C;  3TU4 A;  3LZ1 B;  1M18 A;  3KFU G;  3F6T A;  5BT1 C;  4AWL B;  1P3O B;  5B24 D;  5B1L A;  5GT3 B;  1KX3 D;  1P3A D;  2Y2O A;  4XUJ A;  3B6G C;  3X1T B;  3W97 C;  5CP6 B;  4KUD A;  3EPJ A;  3UTA C;  3AZM C;  2F2A C;  3A6N B;  3VH5 W;  3IP4 C;  1KX4 D;  4UUZ B;  5GT0 A;  3LZ1 D;  3C1B D;  3LZ0 C;  4E44 A;  5B31 A;  4J8W A;  5GXQ B;  2ZY2 A;  5AV6 D;  5B33 D;  1P3O D;  3X1V B;  5GT3 D;  3VH6 A;  3H0R C;  3WTP C;  5FUG A;  3AYW B;  3B6F C;  5CP6 D;  3AZG A;  5CPJ B;  2ARO B;  3TU4 B;  2LY8 A;  3X1S B;  1M18 B;  1TZY D;  1B67 A;  2Y2P A;  3EPK A;  5GXQ D;  5F99 B;  5B1L B;  3R45 A;  2HUE C;  4X23 D;  3MVD A;  4XUJ B;  4J8X C;  3AYW D;  2BYK A;  5CPJ D;  1KX3 C;  1P3A C;  2NZD A;  5GT0 B;  4WU8 A;  3TU4 D;  3X1S D;  1M18 D;  1HQ3 D;  1KX4 C;  1Z2C B;  4J8W B;  2NQB D;  3LZ1 C;  3C1B C;  5F99 D;  3WKJ A;  5B1L D;  1P3K A;  5FUG B;  1P3P A;  1KU5 A;  4XUJ D;  3REI A;  3AZL D;  5AV6 C;  3AZG B;  5B33 C;  4AWL C;  2F8N H;  1P3O C;  5B2J D;  3A1I A;  5GT3 C;  3AZH A;  3X1T C;  3NQJ B;  5B40 A;  5CP6 C;  3A6N C;  2J8P A;  1AOI B;  3EPL A;  3R45 B;  5JA4 A;  1R4V A;  4ZBJ C;  3MVD B;  3C1C B;  2PYO B;  5GXQ C;  1ID3 D;  2BYK B;  3AZG D;  2NZD B;  1P3L A;  3UTB A;  3X1V C;  4WU8 B;  1M19 A;  4JJN A;  3AYW C;  1N1J A;  5CPJ C;  2ARO C;  3TU4 C;  1AOI D;  3WKJ B;  3X1S C;  1M18 C;  2G5H C;  1P3P B;  3REI B;  3VH6 W;  2F8N A;  3W98 A;  3C1C D;  5AV8 A;  4WU9 A;  2PYO D;  5F99 C;  1W2E A;  5B1L C;  5DNN A;  2NZD D;  3AZH B;  3REJ A;  4XUJ C;  1P34 B;  5B40 B;  3AV2 A;  1EQZ A;  3B0D B;  4KGC A;  5AV5 B;  5JA4 B;  5GSU A;  3NQU A;  5AVB D;  3VH6 T;  3UTA D;  4J8W C;  4H9S A;  5BNV A;  1P3B D;  1P3L B;  3MGR B;  3UTB B;  1M19 B;  4J8V D;  3AZH D;  1P34 D;  1ID3 C;  4H9P A;  1N1J B;  4E45 A;  3AZG C;  4H9N A;  5E5A B;  2F8N G;  5AV5 D;  3REL A;  3MGS B;  4Z2M H;  2F8N B;  3AL0 C;  4WU9 B;  2JSS A;  1B6W A;  1AOI C;  5JRG A;  5DNN B;  2Y2Q A;  3MVD C;  1P3L D;  3MGR D;  3REJ B;  3UTB D;  1M19 D;  3C1C C;  3AV2 B;  4NFT A;  2PYO C;  1EQZ B;  2FFF B;  3KUY A;  5CPK A;  4KGC B;  2NZD C;  5B0Z A;  5E5A D;  1P3M A;  5GSU B;  3NQU B;  5B2I A;  2YFW A;  5C3I B;  4J8X D;  3MGS D;  2JCH A;  2F8N D;  3MGQ A;  4G92 C;  5BNV B;  2YFV A;  5AY8 D;  4LD9 A;  5AVB C;  5DNN D;  1P3G A;  4XZQ B;  2CWE A;  3REJ D;  5G49 B;  5B1M D;  4Z5T A;  3AV2 D;  4H9P B;  1P3B C;  4H9N B;  2Y2H A;  1H3O A;  3O62 A;  3KWQ A;  3EG5 B;  4J8V C;  3AZH C;  4KGC D;  4EO5 B;  3P5J B;  5GSU D;  1P34 C;  3X1U A;  4DRA A;  3B0D C;  5JRG B;  5BS7 A;  5AV5 C;  3WAA B;  1T3U A;  1HTA A;  2G5I C;  3X1T D;  4QLC A;  4XZQ D;  1M1A A;  3A6N D;  3KUY B;  1P3L C;  3MGR C;  5B0Z B;  3UTB C;  1M19 C;  1P3M B;  3AN2 A;  5B2I B;  3AZF A;  2HIO A;  5AVC A;  3MGQ B;  5E5A C;  2YFV B;  3X1V D;  5B32 A;  4DRB A;  4KUD B;  3WAA D;  3MGS C;  2Y2G A;  3KSY A;  3W96 A;  2ARO D;  5B31 G;  5AY8 C;  5DNM A;  5DNN C;  1H3O B;  3O62 B;  4J8U A;  3REJ C;  4YM6 A;  5B31 B;  4R8P A;  5B1M C;  3AV2 C;  3X1U B;  1F66 A;  1S32 A;  3UT9 A;  3WA9 A;  3LJA A;  4KGC C;  3MGQ D;  5GSU C;  3AZK A;  1KX5 A;  5C3I C;  4QLC B;  3W99 A;  4KUD D;  3AZJ A;  1M1A B;  4DQY B;  3EPH A;  4H9S C;  5GT0 D;  2JE5 A;  4HGA B;  3WTP E;  4XZQ C;  3AN2 B;  3AZF B;  5B31 D;  2BG1 A;  3X1U D;  4J8W D;  2HIO B;  5AVC B;  1JFI A;  4EO5 C;  1WWS A;  2BYM A;  3KXB A;  2L5A A;  3W96 B;  3W97 A;  4Z66 A;  5DNM B;  2W8S A;  3AZM A;  3AFA A;  3WAA C;  4J8U B;  4YM6 B;  3AN2 D; 
#chains in the Genus database with same CATH homology
 4KHA A;  4WNN A;  3AZF D;  2VQR A;  3LZ0 A;  1F66 B;  1S32 B;  3WA9 B;  3LJA B;  4NE6 A;  3MVD D;  1P3K B;  1P3M C;  3AZK B;  2Y2M A;  3MNN A;  1KX5 B;  3AZJ B;  4G91 B;  2DF4 C;  1U35 A;  3AV1 A;  3MGQ C;  3AZI A;  3B6F A;  5DNM D;  4WU8 D;  2XD5 A;  4KUD C;  4J8U D;  1BH8 A;  1F66 D;  4H9R A;  2ZY4 A;  5GT0 C;  3WKJ D;  3WA9 D;  3LJA D;  1P3K D;  5B31 C;  1P3P D;  5BNX A;  3X1U C;  3REI D;  3AZK D;  1KX5 D;  3KXB B;  3H0L C;  3REH A;  4Z66 B;  2IO5 B;  3AZM B;  2XD1 A;  5B24 A;  4JJN B;  3AFA B;  3REK A;  4ZUX A;  5B40 D;  4KHA B;  4WNN B;  1M1A C;  1KX4 A;  5CPI A;  4HGA C;  1P3I A;  5KDM A;  3AN2 C;  3W98 B;  3MNN B;  4M6B A;  3C1B A;  3AZF C;  5AV8 B;  1U35 B;  3AV1 B;  3AZI B;  5AV6 A;  5B33 A;  4JJN D;  3AFA D;  5GT3 A;  1BH8 B;  5CP6 A;  4H9R B;  5DNM C;  4WU8 C;  4J8U C;  1ZLA A;  2Y2J A;  2Y2I A;  1TZY A;  2HUE B;  4UPK A;  5BNX B;  3MNN D;  1F66 C;  3W98 D;  5AV8 D;  4WU9 D;  1Q9C A;  3REH B;  1S32 C;  3WKJ C;  1U35 D;  3WA9 C;  3LJA C;  3V9R A;  3AV1 D;  3AZI D;  1P3F A;  5GXQ A;  5B24 B;  3REK B;  5CHL B;  1P3K C;  2UWX A;  1P3P C;  4ZUX B;  3REI C;  3AZK C;  4X23 A;  3AZE A;  1KX5 C;  4G91 C;  3LEL A;  1EQZ D;  2FJ7 A;  4WZS B;  3REL B;  2CV5 A;  1KX4 B;  5CPI B;  5CPJ A;  5B40 C;  1P3I B;  1PZR A;  5KDM B;  3X1S A;  3C1B B;  1F1E A;  1HQ3 A;  3A1K A;  3REH D;  2NQB A;  5AV6 B;  5B33 B;  5F99 A;  3REK D;  4ZUX D;  3KXB C;  5CPK B;  4Z66 C;  3AZL A;  2IO5 C;  1A7W A;  4JJN C;  5B2J A;  3AFA C;  3REL D;  2YFW B;  4H9O A;  5CPI D;  1ZLA B;  1P3I D;  1TZY B;  4ZBJ B;  4WV4 B;  3B0B A;  4LD9 B;  5JRG D;  1P3G B;  3V9R B;  1P3F B;  3W98 C;  3MNN C;  4X23 B;  4Z5T B;  3AZE B;  5AV8 C;  4WU9 C;  4Z2M G;  3LEL B;  4YS3 A;  1U35 C;  3KUY D;  1TAF A;  3H0M C;  3AV1 C;  3AZI C;  5CPK D;  3KWQ B;  1ID3 A;  2FJ7 B;  1WWI A;  3VH5 T;  5B0Z D;  2CV5 B;  1P3M D;  5B2I D;  1ZLA D;  1EQZ C;  3AZN A;  3NQJ A;  1HQ3 B;  2ZY5 A;  2DQN C;  4LD9 D;  2NQB B;  1P3G D;  1P3F D;  1AOI A;  3AZE D;  4Z5T D;  3LEL D;  3C1C A;  3REH C;  3AZL B;  3B0C W;  2FJ7 D;  5B0Y A;  2PYO A;  3MGP A;  3O62 D;  5B24 C;  5B2J B;  5AV9 A;  3KWQ D;  2ZM5 A;  3REK C;  4H9O B;  3FDD A;  4ZUX C;  2CV5 D;  5B32 G;  2Y2K A;  2F8N K;  5B32 B;  3REL C;  5CPI C;  1P3I C;  5BO0 A;  4QLC D;  5AVB A;  3B6G A;  1M1A D;  5JRG C;  3UTA A;  4YS3 B;  3B0C T;  1TAF B;  4H9Q A;  1ID3 B;  4R8P B;  1P3B A;  4J8V A;  3KUY C;  3AZN B;  5CPK C;  2HIO D;  3UT9 B;  4WJ3 C;  1P34 A;  5AVC D;  5B0Z C;  5B2I C;  5B32 D;  4CSR A;  1ZLA C;  3W99 B;  5AV5 A;  1TZY C;  3WTP A;  4NE3 A;  3W96 D;  2Y2L A;  4LD9 C;  4YS3 D;  1P3G C;  5B0Y B;  1P3F C;  3MGP B;  2RIQ A;  5AV9 B;  4YM6 D;  4R8P D;  4X23 C;  4Z5T C;  2ZY3 A;  3MGR A;  3AZE C;  3VH5 A;  3LEL C;  3AZN D;  2FJ7 C;  1S32 D;  3UT9 D;  3O62 C;  3KWQ C;  1JFI B;  2CV5 C;  5BO0 B;  4G92 B;  5E5A A;  2BYM B;  1BH9 A;  3W99 D;  5AVB B;  3AZJ D;  3B6G B;  3W97 B;  4J8X A;  3UTA B;  1HQ3 C;  5BS7 C;  3MGS A;  4H9Q B;  2NQB C;  1KX3 A;  1P3A A;  5B0Y D;  5AY8 A;  4QLC C;  3MGP D;  5AV9 D;  1P3B B;  2RVQ D;  4CAY A;  3LZ0 B;  4J8V B;  5B1M A;  3AZL C;  5BT1 D;  5B2J C;  4CSR B;  3LZ1 A;  2HIO C;  3WTP B;  3KXB D;  5AVC C;  3B6G D;  3W97 D;  3B6F B;  4Z66 D;  1BFM A;  5B32 C;  3AZM D;  1P3O A;  2Y2N A;  3W96 C;  3X1T A;  4XZQ A;  3LZ0 D;  4YS3 C;  5G49 A;  3A6N A;  4NE5 A;  4YM6 C;  4R8P C;  4UUZ A;  1BH9 B;  3AZN C;  3WTP D;  3UT9 C;  4J8X B;  3B6F D;  1KX3 B;  1ULY A;  1P3A B;  5AY8 B;  3W99 C;  3X1V A;  3AZJ C;  4CAY B;  3WAA A;  3AYW A;  5B1M B;  2ARO A;  5B0Y C;  3MGP C;  5AV9 C;  2RVQ C;  3TU4 A;  3LZ1 B;  1M18 A;  3KFU G;  3F6T A;  5BT1 C;  4AWL B;  1P3O B;  5B24 D;  5B1L A;  5GT3 B;  1KX3 D;  1P3A D;  2Y2O A;  4XUJ A;  3B6G C;  3X1T B;  3W97 C;  5CP6 B;  4KUD A;  3EPJ A;  3UTA C;  3AZM C;  2F2A C;  3A6N B;  3VH5 W;  3IP4 C;  1KX4 D;  4UUZ B;  5GT0 A;  3LZ1 D;  3C1B D;  3LZ0 C;  4E44 A;  5B31 A;  4J8W A;  5GXQ B;  2ZY2 A;  5AV6 D;  5B33 D;  1P3O D;  3X1V B;  5GT3 D;  3VH6 A;  3H0R C;  3WTP C;  5FUG A;  3AYW B;  3B6F C;  5CP6 D;  3AZG A;  5CPJ B;  2ARO B;  3TU4 B;  2LY8 A;  3X1S B;  1M18 B;  1TZY D;  1B67 A;  2Y2P A;  3EPK A;  5GXQ D;  5F99 B;  5B1L B;  3R45 A;  2HUE C;  4X23 D;  3MVD A;  4XUJ B;  4J8X C;  3AYW D;  2BYK A;  5CPJ D;  1KX3 C;  1P3A C;  2NZD A;  5GT0 B;  4WU8 A;  3TU4 D;  3X1S D;  1M18 D;  1HQ3 D;  1KX4 C;  1Z2C B;  4J8W B;  2NQB D;  3LZ1 C;  3C1B C;  5F99 D;  3WKJ A;  5B1L D;  1P3K A;  5FUG B;  1P3P A;  1KU5 A;  4XUJ D;  3REI A;  3AZL D;  5AV6 C;  3AZG B;  5B33 C;  4AWL C;  2F8N H;  1P3O C;  5B2J D;  3A1I A;  5GT3 C;  3AZH A;  3X1T C;  3NQJ B;  5B40 A;  5CP6 C;  3A6N C;  2J8P A;  1AOI B;  3EPL A;  3R45 B;  5JA4 A;  1R4V A;  4ZBJ C;  3MVD B;  3C1C B;  2PYO B;  5GXQ C;  1ID3 D;  2BYK B;  3AZG D;  2NZD B;  1P3L A;  3UTB A;  3X1V C;  4WU8 B;  1M19 A;  4JJN A;  3AYW C;  1N1J A;  5CPJ C;  2ARO C;  3TU4 C;  1AOI D;  3WKJ B;  3X1S C;  1M18 C;  2G5H C;  1P3P B;  3REI B;  3VH6 W;  2F8N A;  3W98 A;  3C1C D;  5AV8 A;  4WU9 A;  2PYO D;  5F99 C;  1W2E A;  5B1L C;  5DNN A;  2NZD D;  3AZH B;  3REJ A;  4XUJ C;  1P34 B;  5B40 B;  3AV2 A;  1EQZ A;  3B0D B;  4KGC A;  5AV5 B;  5JA4 B;  5GSU A;  3NQU A;  5AVB D;  3VH6 T;  3UTA D;  4J8W C;  4H9S A;  5BNV A;  1P3B D;  1P3L B;  3MGR B;  3UTB B;  1M19 B;  4J8V D;  3AZH D;  1P34 D;  1ID3 C;  4H9P A;  1N1J B;  4E45 A;  3AZG C;  4H9N A;  5E5A B;  2F8N G;  5AV5 D;  3REL A;  3MGS B;  4Z2M H;  2F8N B;  3AL0 C;  4WU9 B;  2JSS A;  1B6W A;  1AOI C;  5JRG A;  5DNN B;  2Y2Q A;  3MVD C;  1P3L D;  3MGR D;  3REJ B;  3UTB D;  1M19 D;  3C1C C;  3AV2 B;  4NFT A;  2PYO C;  1EQZ B;  2FFF B;  3KUY A;  5CPK A;  4KGC B;  2NZD C;  5B0Z A;  5E5A D;  1P3M A;  5GSU B;  3NQU B;  5B2I A;  2YFW A;  5C3I B;  4J8X D;  3MGS D;  2JCH A;  2F8N D;  3MGQ A;  4G92 C;  5BNV B;  2YFV A;  5AY8 D;  4LD9 A;  5AVB C;  5DNN D;  1P3G A;  4XZQ B;  2CWE A;  3REJ D;  5G49 B;  5B1M D;  4Z5T A;  3AV2 D;  4H9P B;  1P3B C;  4H9N B;  2Y2H A;  1H3O A;  3O62 A;  3KWQ A;  3EG5 B;  4J8V C;  3AZH C;  4KGC D;  4EO5 B;  3P5J B;  5GSU D;  1P34 C;  3X1U A;  4DRA A;  3B0D C;  5JRG B;  5BS7 A;  5AV5 C;  3WAA B;  1T3U A;  1HTA A;  2G5I C;  3X1T D;  4QLC A;  4XZQ D;  1M1A A;  3A6N D;  3KUY B;  1P3L C;  3MGR C;  5B0Z B;  3UTB C;  1M19 C;  1P3M B;  3AN2 A;  5B2I B;  3AZF A;  2HIO A;  5AVC A;  3MGQ B;  5E5A C;  2YFV B;  3X1V D;  5B32 A;  4DRB A;  4KUD B;  3WAA D;  3MGS C;  2Y2G A;  3KSY A;  3W96 A;  2ARO D;  5B31 G;  5AY8 C;  5DNM A;  5DNN C;  1H3O B;  3O62 B;  4J8U A;  3REJ C;  4YM6 A;  5B31 B;  4R8P A;  5B1M C;  3AV2 C;  3X1U B;  1F66 A;  1S32 A;  3UT9 A;  3WA9 A;  3LJA A;  4KGC C;  3MGQ D;  5GSU C;  3AZK A;  1KX5 A;  5C3I C;  4QLC B;  3W99 A;  4KUD D;  3AZJ A;  1M1A B;  4DQY B;  3EPH A;  4H9S C;  5GT0 D;  2JE5 A;  4HGA B;  3WTP E;  4XZQ C;  3AN2 B;  3AZF B;  5B31 D;  2BG1 A;  3X1U D;  4J8W D;  2HIO B;  5AVC B;  1JFI A;  4EO5 C;  1WWS A;  2BYM A;  3KXB A;  2L5A A;  3W96 B;  3W97 A;  4Z66 A;  5DNM B;  2W8S A;  3AZM A;  3AFA A;  3WAA C;  4J8U B;  4YM6 B;  3AN2 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...