5B40A

The nucleosome structure containing h2b-k120 and h4-k31 monoubiquitinations
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
94
structure length
94
Chain Sequence
YRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLAAIHAKRVTIMPKDIQLARRIRGER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords Histone H3.2
publication title Monoubiquitination of histones H2B and H4 changes the nucleosome stability without affecting the nucleosome structure
rcsb
source organism Homo sapiens
total genus 32
structure length 94
sequence length 94
chains with identical sequence E
ec nomenclature
pdb deposition date 2016-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5b40A00
1ID3D 5FUGB 3A6NB 3AZIB 3NQJA 5CPIA 4WZSB 4UUZA 4CAYA 1F66B 4AWLC 3WA9B 4Z5TC 3C1CA 4J8XB 1F1EA 4AWLB 1U35D 3AZJB 3AZHA 3REID 3W98B 3AZFC 3WTPC 2HIOB 3KXBA 1P34C 1BH8A 1ZLAC 3KWQD 3O62B 4J8UD 3WTPB 1P34B 5F99A 3MVDC 4YM6C 3AYWC 3A6ND 2FJ7D 1KX5C 4Z2MH 4NFTA 4YM6B 5B2IA 5AV9C 1M18C 5B1LB 4LD9A 1M1AA 5AV9B 4CSRB 1A7WA 4Z5TD 3MGRC 5AY8A 2HIOD 3MGRB 3AZFD 3WTPD 1P34D 1ZLAD 5GT0B 1N1JA 3UTBA 3AZMB 3RELA 2YFWA 5KDMB 3AZLB 5GXQA 3LZ1A 3MVDD 4YM6D 3AYWD 3VH6T 3UTAA 1KX5D 3AZKB 3V9RA 3AZEA 2L5AA 1AOIB 3REHA 5AV9D 1M18D 1P3IA 3MGRD 3R45A 5B0ZC 3LELC 2NZDC 5B2JC 1P3GC 5CP6B 3X1VB 1P3PC 5GT0D 5B1MB 3LJAC 3MGQC 4JJNC 4YS3B 3TU4C 1P3GB 1EQZC 3AFAA 4JJNB 4NE3A 1P3OC 3TU4B 1EQZB 1R4VA 3AV1C 4G92C 4KUDA 1P3BB 4QLCC 3C1BA 4XZQC 3AZNA 3WAAA 4J8VA 1S32A 5CPKC 3B0BA 5GSUC 5B0ZD 5AV6A 3MNNC 4XUJC 2IO5C 3LELD 5GSUB 5B2JD 4ZUXB 1P3GD 4HGAB 2NZDD 1P3KA 4KHAB 1P3PD 3LJAD 4XUJB 4X23C 3MGQD 4JJND 5AVCA 3TU4D 5DNMA 1EQZD 5B32A 4WU8B 4X23B 1P3OD 5B24B 5AV8C 3WKJB 3AV1D 1TAFA 3REJB 5GT3A 5AV8B 5BT1C 4QLCD 2F8NG 4XZQD 2NQBA 1WWIA 5CPKD 5E5AA 3MGPB 3C1CC 5CHLB 3W97A 5GSUD 3MNND 4XUJD 3AZHC 3KXBC 4X23D 4H9QA 5AV8D 3B6FC 3W96A 4J8WA 2RVQC 3REKB 4DRBA 5AV5A 1P3AC 5B2IC 1ID3B 3B6FB 4NE5A 1P3AB 2BYMB 5BT1D 1KX3A 5G49A 1KX4A 4WU9A 1M1AC 3C1CD 1H3OB 2YFVA 5AY8C 3AV2A 1U35B 4E45A 3AZHD 3KXBD 1M19A 3NQUB 5DNNA 4J8UB 3RELC 1TZYA 5GXQC 1BH9B 3B6FD 5BO0A 3RELB 2RVQD 3UTAC 2FJ7B 3LZ0A 5B31C 1P3LA 1P3AD 5B2ID 5B31B 5B33A 2F8NA 1M1AD 2PYOA 4H9RA 4Z5TB 3X1SA 5AY8D 3B0DC 1P3MA 4H9OA 3X1UA 3AZFB 3X1TA 5AVBA 1ZLAB 3AFAC 1P3FA 3RELD 5GXQD 3MVDB 5B0YA 3AYWB 5B40A 4G91C 4KUDC 3UTAD 5B31D 1KX5B 3AN2A 5JA4B 5JRGA 3C1BC 2F8NH 3AZNC 3WAAC 4J8VC 1S32C 1M18B 2AROA 3B6GA 1KU5A 1Q9CA 3AZGC 1P3KC 3VH5A 5AVCC 5DNMC 2BYKB 3AZGB 5B32C 3AFAD 1JFIA 5DNMB 4KGCC 3KUYA 5GT3C 4KUDD 4KGCB 4Z66A 4H9SA 1HQ3A 4R8PA 3AZND 3WAAD 4J8VD 2NQBC 1S32D 5E5AC 2CV5A 5BNVA 3REIA 4H9PA 2NQBB 3W99A 3MGSA 5E5AB 3KWQA 5B0ZB 1WWSA 4H9NB 3LELB 2NZDB 5B2JB 2CWEA 3AZGD 5CPJA 1P3KD 1P3PB 3LJAB 5AVCD 4ZBJC 5FUGA 5DNMD 3A6NA 5B32D 5BNXB 3MGQB 3AZIA 3B0CW 1P3OB 4KGCD 2JSSA 4J8WC 3AV1B 5GT3D 1F66A 5AV5C 4G92B 3WA9A 4J8XA 3VH5W 2F8NK 3UT9A 1KX3C 4QLCB 1KX4C 3AZJA 4XZQB 2NQBD 3W98A 1KX4B 2HIOA 5CPKB 5E5AD 3O62A 1P34A 3WTPA 3MNNB 2IO5B 4WNNB 4YM6A 4WV4B 5DNNC 3WTPE 2HUEC 1TZYC 4J8WD 4EO5C 5B1LA 3LZ0C 1P3LC 5AV5D 5AV9A 4CSRA 5CPIC 3NQJB 1KX3D 5CPIB 2LY8A 1B67A 4E44A 3MGRA 1KX4D 4UUZB 4CAYB 2PYOC 3C1CB 5GT0A 3X1SC 2PYOB 4H9RB 3AZMA 5KDMA 3AZLA 3AZHB 3X1UC 3KXBB 5AVBC 1BH8B 3AZKA 3B0CT 5F99C 5DNND 1P3FC 1TZYD 5F99B 1AOIA 5C3IC 5B40C 3LZ0D 4DRAA 5B2IB 5CPID 1HTAA 4LD9C 5CP6A 3X1VA 2AROC 4LD9B 2PYOD 5B1MA 3VH6A 1M1AB 4YS3A 1P3GA 3X1SD 4JJNA 5AY8B 1EQZA 3X1UD 5AVBD 3UTBC 5F99D 1N1JB 3LZ1C 1P3FD 3UTBB 1P3BA 2YFWB 3KUYC 5GXQB 3LZ1B 3AZEC 4Z66C 3UTAB 3V9RB 3AZEB 3REHC 4H9SC 1HQ3C 4R8PC 4LD9D 1P3IC 3REHB 5GSUA 4ZUXA 2AROD 4KHAA 1P3IB 4XUJA 2CV5C 3REIC 3W99C 4WU8A 3MGSC 4X23A 3R45B 3KSYA 5B24A 3B0DB 3MGSB 5CPJC 3WKJA 3REJA 5AV8A 3UTBD 3AZIC 3AFAB 3LZ1D 5B31G 3VH6W 3KUYD 3AZED 1F66C 4G91B 4KUDB 4Z66D 3WA9C 3MGPA 4J8XC 3REHD 3UT9C 1HQ3D 3C1BB 4R8PD 3AZJC 1P3ID 3UT9B 3AZNB 4J8VB 3W98C 3WAAB 2HIOC 1S32B 2CV5D 5AV6C 3W99D 3O62C 3MGSD 5AV6B 5CPJD 3REKA 1P3KB 1ID3A 3B6FA 5AVCB 3AZID 5B32B 1P3AA 2BYMA 5B1LC 1TAFB 1F66D 5GT3B 3WA9D 5BS7A 3C1BD 1H3OA 4J8XD 3UT9D 1U35A 3AZJD 3W98D 3W97C 5GT0C 5AV6D 3NQUA 3O62D 3W97B 4J8UA 3AZMC 3AZLC 1BH9A 5B32G 2FJ7A 3AZKC 4H9QB 4ZBJB 3W96C 5B31A 1AOIC 3W96B 4J8WB 5B1LD 5AV5B 4Z5TA 4WU9C 1KX3B 5G49B 5CP6C 3X1VC 4WU9B 5B1MC 3W97D 3AZFA 4YS3C 1ZLAA 3AV2C 2YFVB 4NE6A 3AZMD 3AV2B 3AZLD 1M19C 3MVDA 3AYWA 3AZKD 1M19B 1KX5A 5DNNB 5JA4A 1P3BC 3W96D 2HUEB 1AOID 1TZYB 1B6WA 5BO0B 1M18A 4EO5B 3LZ0B 1P3LB 5CPJB 5B33C 4M6BA 4WU9D 5B33B 2F8NB 4ZUXC 4HGAC 5CP6D 3X1VD 5B1MD 4YS3D 2BYKA 3AZGA 3AV2D 4WU8C 1P3MC 3X1SB 5B24C 3X1TC 1P3MB 3WKJC 1M19D 3REJC 4H9OB 3X1UB 1BFMA 3X1TB 4KGCA 5AVBB 4Z2MG 1P3FB 5B0YC 1P3BD 1P3LD 3VH5T 3AN2C 5C3IB 5B0YB 5B40B 3MGPC 5JRGC 3AN2B 5B33D 2F8ND 5JRGB 5B0ZA 4H9NA 3LELA 3B6GC 4ZUXD 5B2JA 2NZDA 2AROB 1P3PA 3LJAA 3B6GB 3MGQA 3TU4A 5BNXA 4WU8D 1P3MD 5B24D 1P3OA 3X1TD 3WKJD 3REKC 3REJD 3AV1A 1ID3C 1JFIB 5B0YD 5B40D 4QLCA 3KUYB 4XZQA 3AN2D 5CPKA 4Z66B 5BS7C 5JRGD 3MGPD 1ULYA 1U35C 1HQ3B 4R8PB 3MNNA 3B6GD 4WNNA 3KWQC 2CV5B 5BNVB 3REIB 4H9PB 3W99B 4J8UC 3KWQB 3A6NC 3REKD 2FJ7C
chains in the Genus database with same CATH superfamily
1ID3D 5FUGB 3A6NB 3AZIB 3A1KA 3NQJA 5CPIA 4WZSB 4UUZA 4CAYA 1F66B 4AWLC 3WA9B 4Z5TC 3C1CA 4J8XB 1F1EA 4AWLB 1U35D 3AZJB 3AZHA 3REID 3W98B 3AZFC 3WTPC 2HIOB 3KXBA 1P34C 1BH8A 1ZLAC 3KWQD 3O62B 4J8UD 3WTPB 1P34B 5F99A 3MVDC 4YM6C 3AYWC 3A6ND 2FJ7D 1KX5C 4Z2MH 2Y2HA 4NFTA 4YM6B 5B2IA 5AV9C 1M18C 3P5JB 5B1LB 4LD9A 1M1AA 5AV9B 4CSRB 2DF4C 1A7WA 1PZRA 4Z5TD 3MGRC 5AY8A 2HIOD 3MGRB 3AZFD 3WTPD 1P34D 1ZLAD 5GT0B 1N1JA 3UTBA 3AZMB 3RELA 2YFWA 5KDMB 4DQYB 3EPJA 3AZLB 5GXQA 3LZ1A 3MVDD 4YM6D 3AYWD 3VH6T 3UTAA 1KX5D 3AZKB 3V9RA 3AZEA 2L5AA 1AOIB 3IP4C 3REHA 5AV9D 1M18D 1P3IA 3MGRD 3R45A 5B0ZC 3LELC 2NZDC 5B2JC 1P3GC 5CP6B 3X1VB 1P3PC 5GT0D 5B1MB 3LJAC 3MGQC 4JJNC 4YS3B 3TU4C 2DQNC 1P3GB 2Y2JA 1EQZC 3AFAA 4JJNB 4NE3A 1P3OC 3TU4B 2XD5A 1EQZB 1R4VA 3AV1C 1Z2CB 4G92C 4KUDA 1P3BB 4QLCC 3C1BA 4XZQC 3AZNA 3WAAA 4J8VA 1S32A 5CPKC 3B0BA 5GSUC 5B0ZD 5AV6A 3MNNC 4XUJC 2G5HC 2IO5C 5GSUB 2ZY2A 5B2JD 4ZUXB 4HGAB 3LELD 1P3GD 1P3KA 4KHAB 1P3PD 3LJAD 4XUJB 4X23C 3MGQD 4JJND 5AVCA 3TU4D 5DNMA 1EQZD 5B32A 4WU8B 4X23B 1P3OD 5B24B 5AV8C 3WKJB 3AV1D 1TAFA 3REJB 5GT3A 5AV8B 5BT1C 4QLCD 2F8NG 4XZQD 2NQBA 1WWIA 5CPKD 5E5AA 3MGPB 3C1CC 5CHLB 3W97A 5GSUD 3MNND 4XUJD 3AZHC 3KXBC 4X23D 4H9QA 3FDDA 5AV8D 3B6FC 3W96A 4J8WA 2RVQC 3REKB 4DRBA 5AV5A 1P3AC 5B2IC 1ID3B 3B6FB 4NE5A 1P3AB 2BYMB 5BT1D 1KX3A 5G49A 1KX4A 4WU9A 1M1AC 3C1CD 1H3OB 2YFVA 5AY8C 3AV2A 1U35B 4E45A 3AZHD 3KXBD 1M19A 3NQUB 5DNNA 4J8UB 3RELC 1TZYA 5GXQC 1BH9B 3B6FD 5BO0A 3RELB 3A1IA 2RVQD 3UTAC 2FJ7B 3LZ0A 5B31C 1P3LA 1P3AD 5B2ID 5B31B 2Y2GA 5B33A 2F8NA 1M1AD 2PYOA 4H9RA 4Z5TB 3X1SA 5AY8D 3B0DC 1P3MA 4H9OA 3X1UA 3AZFB 3X1TA 5AVBA 1ZLAB 3AFAC 2Y2MA 1P3FA 3RELD 5GXQD 3MVDB 5B0YA 3AYWB 5B40A 4G91C 4KUDC 3UTAD 5B31D 1KX5B 3AN2A 2Y2IA 5JA4B 5JRGA 3C1BC 2F8NH 3AZNC 3WAAC 4J8VC 1S32C 1M18B 2AROA 3B6GA 1KU5A 1Q9CA 2RIQA 3AZGC 1P3KC 3VH5A 3EPKA 5AVCC 5DNMC 2BYKB 3AZGB 5B32C 3AFAD 1JFIA 5DNMB 4KGCC 3KUYA 5GT3C 4KUDD 4KGCB 4Z66A 4H9SA 1HQ3A 4R8PA 3AZND 3WAAD 4J8VD 2NQBC 1S32D 5E5AC 2CV5A 5BNVA 3REIA 4H9PA 2NQBB 3W99A 3EG5B 3MGSA 5E5AB 3KWQA 5B0ZB 1WWSA 4H9NB 3LELB 2NZDB 5B2JB 2CWEA 3AZGD 5CPJA 1P3KD 1P3PB 3LJAB 5AVCD 4ZBJC 5FUGA 5DNMD 3A6NA 5B32D 5BNXB 3MGQB 3AZIA 3B0CW 1T3UA 2W8SA 1P3OB 4KGCD 2JSSA 4J8WC 3AV1B 3KFUG 5GT3D 1F66A 5AV5C 4WJ3C 4G92B 3WA9A 4J8XA 3VH5W 2F8NK 3UT9A 1KX3C 4QLCB 1KX4C 2Y2OA 3AZJA 4XZQB 2NQBD 3W98A 1KX4B 2HIOA 5CPKB 5E5AD 3O62A 1P34A 3WTPA 2Y2LA 3MNNB 2IO5B 4WNNB 4YM6A 4WV4B 5DNNC 3WTPE 2HUEC 1TZYC 2BG1A 4J8WD 4EO5C 5B1LA 3LZ0C 1P3LC 2UWXA 5AV5D 5AV9A 4CSRA 5CPIC 2VQRA 3NQJB 1KX3D 5CPIB 2LY8A 1B67A 4E44A 3MGRA 1KX4D 4UUZB 4CAYB 2PYOC 2Y2NA 3C1CB 5GT0A 3X1SC 2PYOB 4H9RB 3AZMA 5KDMA 3AZLA 3AL0C 3AZHB 3X1UC 3KXBB 5AVBC 1BH8B 3AZKA 3B0CT 5F99C 5DNND 1P3FC 1TZYD 5F99B 1AOIA 5C3IC 5B40C 3LZ0D 4DRAA 5B2IB 5CPID 1HTAA 4LD9C 5CP6A 3X1VA 2AROC 4LD9B 2PYOD 5B1MA 3VH6A 1M1AB 4YS3A 1P3GA 3EPHA 3X1SD 4JJNA 5AY8B 1EQZA 3X1UD 5AVBD 3UTBC 2JCHA 5F99D 1N1JB 3LZ1C 1P3FD 3UTBB 1P3BA 2YFWB 3KUYC 5GXQB 3LZ1B 3AZEC 4Z66C 3UTAB 3V9RB 3AZEB 3REHC 4H9SC 1HQ3C 4R8PC 4LD9D 1P3IC 3REHB 5GSUA 4ZUXA 2AROD 4KHAA 1P3IB 4XUJA 2CV5C 3REIC 3W99C 4WU8A 3MGSC 4X23A 3R45B 3KSYA 5B24A 2J8PA 3B0DB 3MGSB 5CPJC 3WKJA 3REJA 2G5IC 5AV8A 3UTBD 3AZIC 2Y2QA 3AFAB 3LZ1D 5B31G 3VH6W 2ZY4A 3KUYD 3AZED 1F66C 4G91B 4KUDB 4Z66D 3WA9C 3MGPA 4J8XC 3REHD 3UT9C 1HQ3D 3C1BB 4R8PD 3AZJC 1P3ID 2XD1A 3UT9B 3AZNB 4J8VB 3W98C 3WAAB 2HIOC 1S32B 1W2EA 2CV5D 5AV6C 3W99D 3O62C 2JE5A 3MGSD 5AV6B 3H0LC 5CPJD 3REKA 1P3KB 1ID3A 3B6FA 5AVCB 3AZID 5B32B 3H0MC 1P3AA 2BYMA 5B1LC 1TAFB 1F66D 5GT3B 3WA9D 5BS7A 3C1BD 1H3OA 4J8XD 3H0RC 3UT9D 1U35A 3AZJD 3W98D 3W97C 5GT0C 5AV6D 3NQUA 3O62D 3W97B 4J8UA 3AZMC 3AZLC 1BH9A 5B32G 2Y2KA 2FJ7A 3AZKC 4H9QB 4UPKA 4ZBJB 3W96C 5B31A 1AOIC 3W96B 4J8WB 5B1LD 2NZDD 5AV5B 4Z5TA 4WU9C 1KX3B 5G49B 5CP6C 3X1VC 4WU9B 2ZY3A 5B1MC 3F6TA 3AZFA 4YS3C 1ZLAA 3W97D 3AV2C 2YFVB 4NE6A 3AZMD 3AV2B 3AZLD 1M19C 3MVDA 3AYWA 3AZKD 1M19B 1KX5A 5DNNB 5JA4A 1P3BC 3W96D 2HUEB 1AOID 1TZYB 1B6WA 5BO0B 1M18A 4EO5B 2ZY5A 3LZ0B 1P3LB 2FFFB 5CPJB 5B33C 4M6BA 4WU9D 5B33B 2F8NB 4ZUXC 4HGAC 5CP6D 3X1VD 5B1MD 4YS3D 2BYKA 3AZGA 3AV2D 4WU8C 1P3MC 3X1SB 5B24C 3X1TC 1P3MB 3WKJC 1M19D 3REJC 4H9OB 3X1UB 1BFMA 3X1TB 4KGCA 5AVBB 4Z2MG 1P3FB 5B0YC 1P3BD 1P3LD 3VH5T 3AN2C 5C3IB 5B0YB 5B40B 3MGPC 5JRGC 3AN2B 5B33D 2F8ND 5JRGB 5B0ZA 4H9NA 3LELA 3B6GC 4ZUXD 5B2JA 2NZDA 2AROB 1P3PA 3LJAA 3B6GB 3MGQA 3TU4A 5BNXA 4WU8D 1P3MD 5B24D 1P3OA 3X1TD 3WKJD 3REKC 3REJD 3AV1A 1ID3C 2F2AC 2Y2PA 1JFIB 5B0YD 5B40D 4QLCA 3KUYB 4XZQA 3AN2D 5CPKA 4Z66B 5BS7C 5JRGD 3MGPD 1ULYA 1U35C 1HQ3B 4R8PB 3MNNA 3B6GD 3EPLA 4WNNA 3KWQC 2CV5B 5BNVB 3REIB 4H9PB 3W99B 4J8UC 3KWQB 2ZM5A 3A6NC 3REKD 2FJ7C
chains in the Genus database with same CATH topology
1ID3D 5FUGB 3A6NB 3AZIB 3A1KA 3NQJA 5CPIA 4WZSB 4UUZA 4CAYA 1F66B 4AWLC 3WA9B 4Z5TC 3C1CA 4J8XB 1F1EA 4AWLB 1U35D 3AZJB 3AZHA 3REID 3W98B 3AZFC 3WTPC 2HIOB 3KXBA 1P34C 1BH8A 1ZLAC 3KWQD 3O62B 4J8UD 3WTPB 1P34B 5F99A 3MVDC 4YM6C 3AYWC 3A6ND 2FJ7D 1KX5C 4Z2MH 2Y2HA 4NFTA 4YM6B 5B2IA 5AV9C 1M18C 3P5JB 5B1LB 4LD9A 1M1AA 5AV9B 4CSRB 2DF4C 1A7WA 1PZRA 4Z5TD 3MGRC 5AY8A 2HIOD 3MGRB 3AZFD 3WTPD 1P34D 1ZLAD 5GT0B 1N1JA 3UTBA 3AZMB 3RELA 2YFWA 5KDMB 4DQYB 3EPJA 3AZLB 5GXQA 3LZ1A 3MVDD 4YM6D 3AYWD 3VH6T 3UTAA 1KX5D 3AZKB 3V9RA 3AZEA 2L5AA 1AOIB 3IP4C 3REHA 5AV9D 1M18D 1P3IA 3MGRD 3R45A 5B0ZC 3LELC 2NZDC 5B2JC 1P3GC 5CP6B 3X1VB 1P3PC 5GT0D 5B1MB 3LJAC 3MGQC 4JJNC 4YS3B 3TU4C 2DQNC 1P3GB 2Y2JA 1EQZC 3AFAA 4JJNB 4NE3A 1P3OC 3TU4B 2XD5A 1EQZB 1R4VA 3AV1C 1Z2CB 4G92C 4KUDA 1P3BB 4QLCC 3C1BA 4XZQC 3AZNA 3WAAA 4J8VA 1S32A 5CPKC 3B0BA 5GSUC 5B0ZD 5AV6A 3MNNC 4XUJC 2G5HC 2IO5C 5GSUB 2ZY2A 5B2JD 4ZUXB 4HGAB 3LELD 1P3GD 1P3KA 4KHAB 1P3PD 3LJAD 4XUJB 4X23C 3MGQD 4JJND 5AVCA 3TU4D 5DNMA 1EQZD 5B32A 4WU8B 4X23B 1P3OD 5B24B 5AV8C 3WKJB 3AV1D 1TAFA 3REJB 5GT3A 5AV8B 5BT1C 4QLCD 2F8NG 4XZQD 2NQBA 1WWIA 5CPKD 5E5AA 3MGPB 3C1CC 5CHLB 3W97A 5GSUD 3MNND 4XUJD 3AZHC 3KXBC 4X23D 4H9QA 3FDDA 5AV8D 3B6FC 3W96A 4J8WA 2RVQC 3REKB 4DRBA 5AV5A 1P3AC 5B2IC 1ID3B 3B6FB 4NE5A 1P3AB 2BYMB 5BT1D 1KX3A 5G49A 1KX4A 4WU9A 1M1AC 3C1CD 1H3OB 2YFVA 5AY8C 3AV2A 1U35B 4E45A 3AZHD 3KXBD 1M19A 3NQUB 5DNNA 4J8UB 3RELC 1TZYA 5GXQC 1BH9B 3B6FD 5BO0A 3RELB 3A1IA 2RVQD 3UTAC 2FJ7B 3LZ0A 5B31C 1P3LA 1P3AD 5B2ID 5B31B 2Y2GA 5B33A 2F8NA 1M1AD 2PYOA 4H9RA 4Z5TB 3X1SA 5AY8D 3B0DC 1P3MA 4H9OA 3X1UA 3AZFB 3X1TA 5AVBA 1ZLAB 3AFAC 2Y2MA 1P3FA 3RELD 5GXQD 3MVDB 5B0YA 3AYWB 5B40A 4G91C 4KUDC 3UTAD 5B31D 1KX5B 3AN2A 2Y2IA 5JA4B 5JRGA 3C1BC 2F8NH 3AZNC 3WAAC 4J8VC 1S32C 1M18B 2AROA 3B6GA 1KU5A 1Q9CA 2RIQA 3AZGC 1P3KC 3VH5A 3EPKA 5AVCC 5DNMC 2BYKB 3AZGB 5B32C 3AFAD 1JFIA 5DNMB 4KGCC 3KUYA 5GT3C 4KUDD 4KGCB 4Z66A 4H9SA 1HQ3A 4R8PA 3AZND 3WAAD 4J8VD 2NQBC 1S32D 5E5AC 2CV5A 5BNVA 3REIA 4H9PA 2NQBB 3W99A 3EG5B 3MGSA 5E5AB 3KWQA 5B0ZB 1WWSA 4H9NB 3LELB 2NZDB 5B2JB 2CWEA 3AZGD 5CPJA 1P3KD 1P3PB 3LJAB 5AVCD 4ZBJC 5FUGA 5DNMD 3A6NA 5B32D 5BNXB 3MGQB 3AZIA 3B0CW 1T3UA 2W8SA 1P3OB 4KGCD 2JSSA 4J8WC 3AV1B 3KFUG 5GT3D 1F66A 5AV5C 4WJ3C 4G92B 3WA9A 4J8XA 3VH5W 2F8NK 3UT9A 1KX3C 4QLCB 1KX4C 2Y2OA 3AZJA 4XZQB 2NQBD 3W98A 1KX4B 2HIOA 5CPKB 5E5AD 3O62A 1P34A 3WTPA 2Y2LA 3MNNB 2IO5B 4WNNB 4YM6A 4WV4B 5DNNC 3WTPE 2HUEC 1TZYC 2BG1A 4J8WD 4EO5C 5B1LA 3LZ0C 1P3LC 2UWXA 5AV5D 5AV9A 4CSRA 5CPIC 2VQRA 3NQJB 1KX3D 5CPIB 2LY8A 1B67A 4E44A 3MGRA 1KX4D 4UUZB 4CAYB 2PYOC 2Y2NA 3C1CB 5GT0A 3X1SC 2PYOB 4H9RB 3AZMA 5KDMA 3AZLA 3AL0C 3AZHB 3X1UC 3KXBB 5AVBC 1BH8B 3AZKA 3B0CT 5F99C 5DNND 1P3FC 1TZYD 5F99B 1AOIA 5C3IC 5B40C 3LZ0D 4DRAA 5B2IB 5CPID 1HTAA 4LD9C 5CP6A 3X1VA 2AROC 4LD9B 2PYOD 5B1MA 3VH6A 1M1AB 4YS3A 1P3GA 3EPHA 3X1SD 4JJNA 5AY8B 1EQZA 3X1UD 5AVBD 3UTBC 2JCHA 5F99D 1N1JB 3LZ1C 1P3FD 3UTBB 1P3BA 2YFWB 3KUYC 5GXQB 3LZ1B 3AZEC 4Z66C 3UTAB 3V9RB 3AZEB 3REHC 4H9SC 1HQ3C 4R8PC 4LD9D 1P3IC 3REHB 5GSUA 4ZUXA 2AROD 4KHAA 1P3IB 4XUJA 2CV5C 3REIC 3W99C 4WU8A 3MGSC 4X23A 3R45B 3KSYA 5B24A 2J8PA 3B0DB 3MGSB 5CPJC 3WKJA 3REJA 2G5IC 5AV8A 3UTBD 3AZIC 2Y2QA 3AFAB 3LZ1D 5B31G 3VH6W 2ZY4A 3KUYD 3AZED 1F66C 4G91B 4KUDB 4Z66D 3WA9C 3MGPA 4J8XC 3REHD 3UT9C 1HQ3D 3C1BB 4R8PD 3AZJC 1P3ID 2XD1A 3UT9B 3AZNB 4J8VB 3W98C 3WAAB 2HIOC 1S32B 1W2EA 2CV5D 5AV6C 3W99D 3O62C 2JE5A 3MGSD 5AV6B 3H0LC 5CPJD 3REKA 1P3KB 1ID3A 3B6FA 5AVCB 3AZID 5B32B 3H0MC 1P3AA 2BYMA 5B1LC 1TAFB 1F66D 5GT3B 3WA9D 5BS7A 3C1BD 1H3OA 4J8XD 3H0RC 3UT9D 1U35A 3AZJD 3W98D 3W97C 5GT0C 5AV6D 3NQUA 3O62D 3W97B 4J8UA 3AZMC 3AZLC 1BH9A 5B32G 2Y2KA 2FJ7A 3AZKC 4H9QB 4UPKA 4ZBJB 3W96C 5B31A 1AOIC 3W96B 4J8WB 5B1LD 2NZDD 5AV5B 4Z5TA 4WU9C 1KX3B 5G49B 5CP6C 3X1VC 4WU9B 2ZY3A 5B1MC 3F6TA 3AZFA 4YS3C 1ZLAA 3W97D 3AV2C 2YFVB 4NE6A 3AZMD 3AV2B 3AZLD 1M19C 3MVDA 3AYWA 3AZKD 1M19B 1KX5A 5DNNB 5JA4A 1P3BC 3W96D 2HUEB 1AOID 1TZYB 1B6WA 5BO0B 1M18A 4EO5B 2ZY5A 3LZ0B 1P3LB 2FFFB 5CPJB 5B33C 4M6BA 4WU9D 5B33B 2F8NB 4ZUXC 4HGAC 5CP6D 3X1VD 5B1MD 4YS3D 2BYKA 3AZGA 3AV2D 4WU8C 1P3MC 3X1SB 5B24C 3X1TC 1P3MB 3WKJC 1M19D 3REJC 4H9OB 3X1UB 1BFMA 3X1TB 4KGCA 5AVBB 4Z2MG 1P3FB 5B0YC 1P3BD 1P3LD 3VH5T 3AN2C 5C3IB 5B0YB 5B40B 3MGPC 5JRGC 3AN2B 5B33D 2F8ND 5JRGB 5B0ZA 4H9NA 3LELA 3B6GC 4ZUXD 5B2JA 2NZDA 2AROB 1P3PA 3LJAA 3B6GB 3MGQA 3TU4A 5BNXA 4WU8D 1P3MD 5B24D 1P3OA 3X1TD 3WKJD 3REKC 3REJD 3AV1A 1ID3C 2F2AC 2Y2PA 1JFIB 5B0YD 5B40D 4QLCA 3KUYB 4XZQA 3AN2D 5CPKA 4Z66B 5BS7C 5JRGD 3MGPD 1ULYA 1U35C 1HQ3B 4R8PB 3MNNA 3B6GD 3EPLA 4WNNA 3KWQC 2CV5B 5BNVB 3REIB 4H9PB 3W99B 4J8UC 3KWQB 2ZM5A 3A6NC 3REKD 2FJ7C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ID3 D;  5FUG B;  3A6N B;  3AZI B;  3NQJ A;  5CPI A;  4WZS B;  4UUZ A;  4CAY A;  1F66 B;  4AWL C;  3WA9 B;  4Z5T C;  3C1C A;  4J8X B;  1F1E A;  4AWL B;  1U35 D;  3AZJ B;  3AZH A;  3REI D;  3W98 B;  3AZF C;  3WTP C;  2HIO B;  3KXB A;  1P34 C;  1BH8 A;  1ZLA C;  3KWQ D;  3O62 B;  4J8U D;  3WTP B;  1P34 B;  5F99 A;  3MVD C;  4YM6 C;  3AYW C;  3A6N D;  2FJ7 D;  1KX5 C;  4Z2M H;  4NFT A;  4YM6 B;  5B2I A;  5AV9 C;  1M18 C;  5B1L B;  4LD9 A;  1M1A A;  5AV9 B;  4CSR B;  1A7W A;  4Z5T D;  3MGR C;  5AY8 A;  2HIO D;  3MGR B;  3AZF D;  3WTP D;  1P34 D;  1ZLA D;  5GT0 B;  1N1J A;  3UTB A;  3AZM B;  3REL A;  2YFW A;  5KDM B;  3AZL B;  5GXQ A;  3LZ1 A;  3MVD D;  4YM6 D;  3AYW D;  3VH6 T;  3UTA A;  1KX5 D;  3AZK B;  3V9R A;  3AZE A;  2L5A A;  1AOI B;  3REH A;  5AV9 D;  1M18 D;  1P3I A;  3MGR D;  3R45 A;  5B0Z C;  3LEL C;  2NZD C;  5B2J C;  1P3G C;  5CP6 B;  3X1V B;  1P3P C;  5GT0 D;  5B1M B;  3LJA C;  3MGQ C;  4JJN C;  4YS3 B;  3TU4 C;  1P3G B;  1EQZ C;  3AFA A;  4JJN B;  4NE3 A;  1P3O C;  3TU4 B;  1EQZ B;  1R4V A;  3AV1 C;  4G92 C;  4KUD A;  1P3B B;  4QLC C;  3C1B A;  4XZQ C;  3AZN A;  3WAA A;  4J8V A;  1S32 A;  5CPK C;  3B0B A;  5GSU C;  5B0Z D;  5AV6 A;  3MNN C;  4XUJ C;  2IO5 C;  3LEL D;  5GSU B;  5B2J D;  4ZUX B;  1P3G D;  4HGA B;  2NZD D;  1P3K A;  4KHA B;  1P3P D;  3LJA D;  4XUJ B;  4X23 C;  3MGQ D;  4JJN D;  5AVC A;  3TU4 D;  5DNM A;  1EQZ D;  5B32 A;  4WU8 B;  4X23 B;  1P3O D;  5B24 B;  5AV8 C;  3WKJ B;  3AV1 D;  1TAF A;  3REJ B;  5GT3 A;  5AV8 B;  5BT1 C;  4QLC D;  2F8N G;  4XZQ D;  2NQB A;  1WWI A;  5CPK D;  5E5A A;  3MGP B;  3C1C C;  5CHL B;  3W97 A;  5GSU D;  3MNN D;  4XUJ D;  3AZH C;  3KXB C;  4X23 D;  4H9Q A;  5AV8 D;  3B6F C;  3W96 A;  4J8W A;  2RVQ C;  3REK B;  4DRB A;  5AV5 A;  1P3A C;  5B2I C;  1ID3 B;  3B6F B;  4NE5 A;  1P3A B;  2BYM B;  5BT1 D;  1KX3 A;  5G49 A;  1KX4 A;  4WU9 A;  1M1A C;  3C1C D;  1H3O B;  2YFV A;  5AY8 C;  3AV2 A;  1U35 B;  4E45 A;  3AZH D;  3KXB D;  1M19 A;  3NQU B;  5DNN A;  4J8U B;  3REL C;  1TZY A;  5GXQ C;  1BH9 B;  3B6F D;  5BO0 A;  3REL B;  2RVQ D;  3UTA C;  2FJ7 B;  3LZ0 A;  5B31 C;  1P3L A;  1P3A D;  5B2I D;  5B31 B;  5B33 A;  2F8N A;  1M1A D;  2PYO A;  4H9R A;  4Z5T B;  3X1S A;  5AY8 D;  3B0D C;  1P3M A;  4H9O A;  3X1U A;  3AZF B;  3X1T A;  5AVB A;  1ZLA B;  3AFA C;  1P3F A;  3REL D;  5GXQ D;  3MVD B;  5B0Y A;  3AYW B;  5B40 A;  4G91 C;  4KUD C;  3UTA D;  5B31 D;  1KX5 B;  3AN2 A;  5JA4 B;  5JRG A;  3C1B C;  2F8N H;  3AZN C;  3WAA C;  4J8V C;  1S32 C;  1M18 B;  2ARO A;  3B6G A;  1KU5 A;  1Q9C A;  3AZG C;  1P3K C;  3VH5 A;  5AVC C;  5DNM C;  2BYK B;  3AZG B;  5B32 C;  3AFA D;  1JFI A;  5DNM B;  4KGC C;  3KUY A;  5GT3 C;  4KUD D;  4KGC B;  4Z66 A;  4H9S A;  1HQ3 A;  4R8P A;  3AZN D;  3WAA D;  4J8V D;  2NQB C;  1S32 D;  5E5A C;  2CV5 A;  5BNV A;  3REI A;  4H9P A;  2NQB B;  3W99 A;  3MGS A;  5E5A B;  3KWQ A;  5B0Z B;  1WWS A;  4H9N B;  3LEL B;  2NZD B;  5B2J B;  2CWE A;  3AZG D;  5CPJ A;  1P3K D;  1P3P B;  3LJA B;  5AVC D;  4ZBJ C;  5FUG A;  5DNM D;  3A6N A;  5B32 D;  5BNX B;  3MGQ B;  3AZI A;  3B0C W;  1P3O B;  4KGC D;  2JSS A;  4J8W C;  3AV1 B;  5GT3 D;  1F66 A;  5AV5 C;  4G92 B;  3WA9 A;  4J8X A;  3VH5 W;  2F8N K;  3UT9 A;  1KX3 C;  4QLC B;  1KX4 C;  3AZJ A;  4XZQ B;  2NQB D;  3W98 A;  1KX4 B;  2HIO A;  5CPK B;  5E5A D;  3O62 A;  1P34 A;  3WTP A;  3MNN B;  2IO5 B;  4WNN B;  4YM6 A;  4WV4 B;  5DNN C;  3WTP E;  2HUE C;  1TZY C;  4J8W D;  4EO5 C;  5B1L A;  3LZ0 C;  1P3L C;  5AV5 D;  5AV9 A;  4CSR A;  5CPI C;  3NQJ B;  1KX3 D;  5CPI B;  2LY8 A;  1B67 A;  4E44 A;  3MGR A;  1KX4 D;  4UUZ B;  4CAY B;  2PYO C;  3C1C B;  5GT0 A;  3X1S C;  2PYO B;  4H9R B;  3AZM A;  5KDM A;  3AZL A;  3AZH B;  3X1U C;  3KXB B;  5AVB C;  1BH8 B;  3AZK A;  3B0C T;  5F99 C;  5DNN D;  1P3F C;  1TZY D;  5F99 B;  1AOI A;  5C3I C;  5B40 C;  3LZ0 D;  4DRA A;  5B2I B;  5CPI D;  1HTA A;  4LD9 C;  5CP6 A;  3X1V A;  2ARO C;  4LD9 B;  2PYO D;  5B1M A;  3VH6 A;  1M1A B;  4YS3 A;  1P3G A;  3X1S D;  4JJN A;  5AY8 B;  1EQZ A;  3X1U D;  5AVB D;  3UTB C;  5F99 D;  1N1J B;  3LZ1 C;  1P3F D;  3UTB B;  1P3B A;  2YFW B;  3KUY C;  5GXQ B;  3LZ1 B;  3AZE C;  4Z66 C;  3UTA B;  3V9R B;  3AZE B;  3REH C;  4H9S C;  1HQ3 C;  4R8P C;  4LD9 D;  1P3I C;  3REH B;  5GSU A;  4ZUX A;  2ARO D;  4KHA A;  1P3I B;  4XUJ A;  2CV5 C;  3REI C;  3W99 C;  4WU8 A;  3MGS C;  4X23 A;  3R45 B;  3KSY A;  5B24 A;  3B0D B;  3MGS B;  5CPJ C;  3WKJ A;  3REJ A;  5AV8 A;  3UTB D;  3AZI C;  3AFA B;  3LZ1 D;  5B31 G;  3VH6 W;  3KUY D;  3AZE D;  1F66 C;  4G91 B;  4KUD B;  4Z66 D;  3WA9 C;  3MGP A;  4J8X C;  3REH D;  3UT9 C;  1HQ3 D;  3C1B B;  4R8P D;  3AZJ C;  1P3I D;  3UT9 B;  3AZN B;  4J8V B;  3W98 C;  3WAA B;  2HIO C;  1S32 B;  2CV5 D;  5AV6 C;  3W99 D;  3O62 C;  3MGS D;  5AV6 B;  5CPJ D;  3REK A;  1P3K B;  1ID3 A;  3B6F A;  5AVC B;  3AZI D;  5B32 B;  1P3A A;  2BYM A;  5B1L C;  1TAF B;  1F66 D;  5GT3 B;  3WA9 D;  5BS7 A;  3C1B D;  1H3O A;  4J8X D;  3UT9 D;  1U35 A;  3AZJ D;  3W98 D;  3W97 C;  5GT0 C;  5AV6 D;  3NQU A;  3O62 D;  3W97 B;  4J8U A;  3AZM C;  3AZL C;  1BH9 A;  5B32 G;  2FJ7 A;  3AZK C;  4H9Q B;  4ZBJ B;  3W96 C;  5B31 A;  1AOI C;  3W96 B;  4J8W B;  5B1L D;  5AV5 B;  4Z5T A;  4WU9 C;  1KX3 B;  5G49 B;  5CP6 C;  3X1V C;  4WU9 B;  5B1M C;  3W97 D;  3AZF A;  4YS3 C;  1ZLA A;  3AV2 C;  2YFV B;  4NE6 A;  3AZM D;  3AV2 B;  3AZL D;  1M19 C;  3MVD A;  3AYW A;  3AZK D;  1M19 B;  1KX5 A;  5DNN B;  5JA4 A;  1P3B C;  3W96 D;  2HUE B;  1AOI D;  1TZY B;  1B6W A;  5BO0 B;  1M18 A;  4EO5 B;  3LZ0 B;  1P3L B;  5CPJ B;  5B33 C;  4M6B A;  4WU9 D;  5B33 B;  2F8N B;  4ZUX C;  4HGA C;  5CP6 D;  3X1V D;  5B1M D;  4YS3 D;  2BYK A;  3AZG A;  3AV2 D;  4WU8 C;  1P3M C;  3X1S B;  5B24 C;  3X1T C;  1P3M B;  3WKJ C;  1M19 D;  3REJ C;  4H9O B;  3X1U B;  1BFM A;  3X1T B;  4KGC A;  5AVB B;  4Z2M G;  1P3F B;  5B0Y C;  1P3B D;  1P3L D;  3VH5 T;  3AN2 C;  5C3I B;  5B0Y B;  5B40 B;  3MGP C;  5JRG C;  3AN2 B;  5B33 D;  2F8N D;  5JRG B;  5B0Z A;  4H9N A;  3LEL A;  3B6G C;  4ZUX D;  5B2J A;  2NZD A;  2ARO B;  1P3P A;  3LJA A;  3B6G B;  3MGQ A;  3TU4 A;  5BNX A;  4WU8 D;  1P3M D;  5B24 D;  1P3O A;  3X1T D;  3WKJ D;  3REK C;  3REJ D;  3AV1 A;  1ID3 C;  1JFI B;  5B0Y D;  5B40 D;  4QLC A;  3KUY B;  4XZQ A;  3AN2 D;  5CPK A;  4Z66 B;  5BS7 C;  5JRG D;  3MGP D;  1ULY A;  1U35 C;  1HQ3 B;  4R8P B;  3MNN A;  3B6G D;  4WNN A;  3KWQ C;  2CV5 B;  5BNV B;  3REI B;  4H9P B;  3W99 B;  4J8U C;  3KWQ B;  3A6N C;  3REK D;  2FJ7 C; 
#chains in the Genus database with same CATH topology
 1ID3 D;  5FUG B;  3A6N B;  3AZI B;  3A1K A;  3NQJ A;  5CPI A;  4WZS B;  4UUZ A;  4CAY A;  1F66 B;  4AWL C;  3WA9 B;  4Z5T C;  3C1C A;  4J8X B;  1F1E A;  4AWL B;  1U35 D;  3AZJ B;  3AZH A;  3REI D;  3W98 B;  3AZF C;  3WTP C;  2HIO B;  3KXB A;  1P34 C;  1BH8 A;  1ZLA C;  3KWQ D;  3O62 B;  4J8U D;  3WTP B;  1P34 B;  5F99 A;  3MVD C;  4YM6 C;  3AYW C;  3A6N D;  2FJ7 D;  1KX5 C;  4Z2M H;  2Y2H A;  4NFT A;  4YM6 B;  5B2I A;  5AV9 C;  1M18 C;  3P5J B;  5B1L B;  4LD9 A;  1M1A A;  5AV9 B;  4CSR B;  2DF4 C;  1A7W A;  1PZR A;  4Z5T D;  3MGR C;  5AY8 A;  2HIO D;  3MGR B;  3AZF D;  3WTP D;  1P34 D;  1ZLA D;  5GT0 B;  1N1J A;  3UTB A;  3AZM B;  3REL A;  2YFW A;  5KDM B;  4DQY B;  3EPJ A;  3AZL B;  5GXQ A;  3LZ1 A;  3MVD D;  4YM6 D;  3AYW D;  3VH6 T;  3UTA A;  1KX5 D;  3AZK B;  3V9R A;  3AZE A;  2L5A A;  1AOI B;  3IP4 C;  3REH A;  5AV9 D;  1M18 D;  1P3I A;  3MGR D;  3R45 A;  5B0Z C;  3LEL C;  2NZD C;  5B2J C;  1P3G C;  5CP6 B;  3X1V B;  1P3P C;  5GT0 D;  5B1M B;  3LJA C;  3MGQ C;  4JJN C;  4YS3 B;  3TU4 C;  2DQN C;  1P3G B;  2Y2J A;  1EQZ C;  3AFA A;  4JJN B;  4NE3 A;  1P3O C;  3TU4 B;  2XD5 A;  1EQZ B;  1R4V A;  3AV1 C;  1Z2C B;  4G92 C;  4KUD A;  1P3B B;  4QLC C;  3C1B A;  4XZQ C;  3AZN A;  3WAA A;  4J8V A;  1S32 A;  5CPK C;  3B0B A;  5GSU C;  5B0Z D;  5AV6 A;  3MNN C;  4XUJ C;  2G5H C;  2IO5 C;  5GSU B;  2ZY2 A;  5B2J D;  4ZUX B;  4HGA B;  3LEL D;  1P3G D;  1P3K A;  4KHA B;  1P3P D;  3LJA D;  4XUJ B;  4X23 C;  3MGQ D;  4JJN D;  5AVC A;  3TU4 D;  5DNM A;  1EQZ D;  5B32 A;  4WU8 B;  4X23 B;  1P3O D;  5B24 B;  5AV8 C;  3WKJ B;  3AV1 D;  1TAF A;  3REJ B;  5GT3 A;  5AV8 B;  5BT1 C;  4QLC D;  2F8N G;  4XZQ D;  2NQB A;  1WWI A;  5CPK D;  5E5A A;  3MGP B;  3C1C C;  5CHL B;  3W97 A;  5GSU D;  3MNN D;  4XUJ D;  3AZH C;  3KXB C;  4X23 D;  4H9Q A;  3FDD A;  5AV8 D;  3B6F C;  3W96 A;  4J8W A;  2RVQ C;  3REK B;  4DRB A;  5AV5 A;  1P3A C;  5B2I C;  1ID3 B;  3B6F B;  4NE5 A;  1P3A B;  2BYM B;  5BT1 D;  1KX3 A;  5G49 A;  1KX4 A;  4WU9 A;  1M1A C;  3C1C D;  1H3O B;  2YFV A;  5AY8 C;  3AV2 A;  1U35 B;  4E45 A;  3AZH D;  3KXB D;  1M19 A;  3NQU B;  5DNN A;  4J8U B;  3REL C;  1TZY A;  5GXQ C;  1BH9 B;  3B6F D;  5BO0 A;  3REL B;  3A1I A;  2RVQ D;  3UTA C;  2FJ7 B;  3LZ0 A;  5B31 C;  1P3L A;  1P3A D;  5B2I D;  5B31 B;  2Y2G A;  5B33 A;  2F8N A;  1M1A D;  2PYO A;  4H9R A;  4Z5T B;  3X1S A;  5AY8 D;  3B0D C;  1P3M A;  4H9O A;  3X1U A;  3AZF B;  3X1T A;  5AVB A;  1ZLA B;  3AFA C;  2Y2M A;  1P3F A;  3REL D;  5GXQ D;  3MVD B;  5B0Y A;  3AYW B;  5B40 A;  4G91 C;  4KUD C;  3UTA D;  5B31 D;  1KX5 B;  3AN2 A;  2Y2I A;  5JA4 B;  5JRG A;  3C1B C;  2F8N H;  3AZN C;  3WAA C;  4J8V C;  1S32 C;  1M18 B;  2ARO A;  3B6G A;  1KU5 A;  1Q9C A;  2RIQ A;  3AZG C;  1P3K C;  3VH5 A;  3EPK A;  5AVC C;  5DNM C;  2BYK B;  3AZG B;  5B32 C;  3AFA D;  1JFI A;  5DNM B;  4KGC C;  3KUY A;  5GT3 C;  4KUD D;  4KGC B;  4Z66 A;  4H9S A;  1HQ3 A;  4R8P A;  3AZN D;  3WAA D;  4J8V D;  2NQB C;  1S32 D;  5E5A C;  2CV5 A;  5BNV A;  3REI A;  4H9P A;  2NQB B;  3W99 A;  3EG5 B;  3MGS A;  5E5A B;  3KWQ A;  5B0Z B;  1WWS A;  4H9N B;  3LEL B;  2NZD B;  5B2J B;  2CWE A;  3AZG D;  5CPJ A;  1P3K D;  1P3P B;  3LJA B;  5AVC D;  4ZBJ C;  5FUG A;  5DNM D;  3A6N A;  5B32 D;  5BNX B;  3MGQ B;  3AZI A;  3B0C W;  1T3U A;  2W8S A;  1P3O B;  4KGC D;  2JSS A;  4J8W C;  3AV1 B;  3KFU G;  5GT3 D;  1F66 A;  5AV5 C;  4WJ3 C;  4G92 B;  3WA9 A;  4J8X A;  3VH5 W;  2F8N K;  3UT9 A;  1KX3 C;  4QLC B;  1KX4 C;  2Y2O A;  3AZJ A;  4XZQ B;  2NQB D;  3W98 A;  1KX4 B;  2HIO A;  5CPK B;  5E5A D;  3O62 A;  1P34 A;  3WTP A;  2Y2L A;  3MNN B;  2IO5 B;  4WNN B;  4YM6 A;  4WV4 B;  5DNN C;  3WTP E;  2HUE C;  1TZY C;  2BG1 A;  4J8W D;  4EO5 C;  5B1L A;  3LZ0 C;  1P3L C;  2UWX A;  5AV5 D;  5AV9 A;  4CSR A;  5CPI C;  2VQR A;  3NQJ B;  1KX3 D;  5CPI B;  2LY8 A;  1B67 A;  4E44 A;  3MGR A;  1KX4 D;  4UUZ B;  4CAY B;  2PYO C;  2Y2N A;  3C1C B;  5GT0 A;  3X1S C;  2PYO B;  4H9R B;  3AZM A;  5KDM A;  3AZL A;  3AL0 C;  3AZH B;  3X1U C;  3KXB B;  5AVB C;  1BH8 B;  3AZK A;  3B0C T;  5F99 C;  5DNN D;  1P3F C;  1TZY D;  5F99 B;  1AOI A;  5C3I C;  5B40 C;  3LZ0 D;  4DRA A;  5B2I B;  5CPI D;  1HTA A;  4LD9 C;  5CP6 A;  3X1V A;  2ARO C;  4LD9 B;  2PYO D;  5B1M A;  3VH6 A;  1M1A B;  4YS3 A;  1P3G A;  3EPH A;  3X1S D;  4JJN A;  5AY8 B;  1EQZ A;  3X1U D;  5AVB D;  3UTB C;  2JCH A;  5F99 D;  1N1J B;  3LZ1 C;  1P3F D;  3UTB B;  1P3B A;  2YFW B;  3KUY C;  5GXQ B;  3LZ1 B;  3AZE C;  4Z66 C;  3UTA B;  3V9R B;  3AZE B;  3REH C;  4H9S C;  1HQ3 C;  4R8P C;  4LD9 D;  1P3I C;  3REH B;  5GSU A;  4ZUX A;  2ARO D;  4KHA A;  1P3I B;  4XUJ A;  2CV5 C;  3REI C;  3W99 C;  4WU8 A;  3MGS C;  4X23 A;  3R45 B;  3KSY A;  5B24 A;  2J8P A;  3B0D B;  3MGS B;  5CPJ C;  3WKJ A;  3REJ A;  2G5I C;  5AV8 A;  3UTB D;  3AZI C;  2Y2Q A;  3AFA B;  3LZ1 D;  5B31 G;  3VH6 W;  2ZY4 A;  3KUY D;  3AZE D;  1F66 C;  4G91 B;  4KUD B;  4Z66 D;  3WA9 C;  3MGP A;  4J8X C;  3REH D;  3UT9 C;  1HQ3 D;  3C1B B;  4R8P D;  3AZJ C;  1P3I D;  2XD1 A;  3UT9 B;  3AZN B;  4J8V B;  3W98 C;  3WAA B;  2HIO C;  1S32 B;  1W2E A;  2CV5 D;  5AV6 C;  3W99 D;  3O62 C;  2JE5 A;  3MGS D;  5AV6 B;  3H0L C;  5CPJ D;  3REK A;  1P3K B;  1ID3 A;  3B6F A;  5AVC B;  3AZI D;  5B32 B;  3H0M C;  1P3A A;  2BYM A;  5B1L C;  1TAF B;  1F66 D;  5GT3 B;  3WA9 D;  5BS7 A;  3C1B D;  1H3O A;  4J8X D;  3H0R C;  3UT9 D;  1U35 A;  3AZJ D;  3W98 D;  3W97 C;  5GT0 C;  5AV6 D;  3NQU A;  3O62 D;  3W97 B;  4J8U A;  3AZM C;  3AZL C;  1BH9 A;  5B32 G;  2Y2K A;  2FJ7 A;  3AZK C;  4H9Q B;  4UPK A;  4ZBJ B;  3W96 C;  5B31 A;  1AOI C;  3W96 B;  4J8W B;  5B1L D;  2NZD D;  5AV5 B;  4Z5T A;  4WU9 C;  1KX3 B;  5G49 B;  5CP6 C;  3X1V C;  4WU9 B;  2ZY3 A;  5B1M C;  3F6T A;  3AZF A;  4YS3 C;  1ZLA A;  3W97 D;  3AV2 C;  2YFV B;  4NE6 A;  3AZM D;  3AV2 B;  3AZL D;  1M19 C;  3MVD A;  3AYW A;  3AZK D;  1M19 B;  1KX5 A;  5DNN B;  5JA4 A;  1P3B C;  3W96 D;  2HUE B;  1AOI D;  1TZY B;  1B6W A;  5BO0 B;  1M18 A;  4EO5 B;  2ZY5 A;  3LZ0 B;  1P3L B;  2FFF B;  5CPJ B;  5B33 C;  4M6B A;  4WU9 D;  5B33 B;  2F8N B;  4ZUX C;  4HGA C;  5CP6 D;  3X1V D;  5B1M D;  4YS3 D;  2BYK A;  3AZG A;  3AV2 D;  4WU8 C;  1P3M C;  3X1S B;  5B24 C;  3X1T C;  1P3M B;  3WKJ C;  1M19 D;  3REJ C;  4H9O B;  3X1U B;  1BFM A;  3X1T B;  4KGC A;  5AVB B;  4Z2M G;  1P3F B;  5B0Y C;  1P3B D;  1P3L D;  3VH5 T;  3AN2 C;  5C3I B;  5B0Y B;  5B40 B;  3MGP C;  5JRG C;  3AN2 B;  5B33 D;  2F8N D;  5JRG B;  5B0Z A;  4H9N A;  3LEL A;  3B6G C;  4ZUX D;  5B2J A;  2NZD A;  2ARO B;  1P3P A;  3LJA A;  3B6G B;  3MGQ A;  3TU4 A;  5BNX A;  4WU8 D;  1P3M D;  5B24 D;  1P3O A;  3X1T D;  3WKJ D;  3REK C;  3REJ D;  3AV1 A;  1ID3 C;  2F2A C;  2Y2P A;  1JFI B;  5B0Y D;  5B40 D;  4QLC A;  3KUY B;  4XZQ A;  3AN2 D;  5CPK A;  4Z66 B;  5BS7 C;  5JRG D;  3MGP D;  1ULY A;  1U35 C;  1HQ3 B;  4R8P B;  3MNN A;  3B6G D;  3EPL A;  4WNN A;  3KWQ C;  2CV5 B;  5BNV B;  3REI B;  4H9P B;  3W99 B;  4J8U C;  3KWQ B;  2ZM5 A;  3A6N C;  3REK D;  2FJ7 C; 
#chains in the Genus database with same CATH homology
 1ID3 D;  5FUG B;  3A6N B;  3AZI B;  3A1K A;  3NQJ A;  5CPI A;  4WZS B;  4UUZ A;  4CAY A;  1F66 B;  4AWL C;  3WA9 B;  4Z5T C;  3C1C A;  4J8X B;  1F1E A;  4AWL B;  1U35 D;  3AZJ B;  3AZH A;  3REI D;  3W98 B;  3AZF C;  3WTP C;  2HIO B;  3KXB A;  1P34 C;  1BH8 A;  1ZLA C;  3KWQ D;  3O62 B;  4J8U D;  3WTP B;  1P34 B;  5F99 A;  3MVD C;  4YM6 C;  3AYW C;  3A6N D;  2FJ7 D;  1KX5 C;  4Z2M H;  2Y2H A;  4NFT A;  4YM6 B;  5B2I A;  5AV9 C;  1M18 C;  3P5J B;  5B1L B;  4LD9 A;  1M1A A;  5AV9 B;  4CSR B;  2DF4 C;  1A7W A;  1PZR A;  4Z5T D;  3MGR C;  5AY8 A;  2HIO D;  3MGR B;  3AZF D;  3WTP D;  1P34 D;  1ZLA D;  5GT0 B;  1N1J A;  3UTB A;  3AZM B;  3REL A;  2YFW A;  5KDM B;  4DQY B;  3EPJ A;  3AZL B;  5GXQ A;  3LZ1 A;  3MVD D;  4YM6 D;  3AYW D;  3VH6 T;  3UTA A;  1KX5 D;  3AZK B;  3V9R A;  3AZE A;  2L5A A;  1AOI B;  3IP4 C;  3REH A;  5AV9 D;  1M18 D;  1P3I A;  3MGR D;  3R45 A;  5B0Z C;  3LEL C;  2NZD C;  5B2J C;  1P3G C;  5CP6 B;  3X1V B;  1P3P C;  5GT0 D;  5B1M B;  3LJA C;  3MGQ C;  4JJN C;  4YS3 B;  3TU4 C;  2DQN C;  1P3G B;  2Y2J A;  1EQZ C;  3AFA A;  4JJN B;  4NE3 A;  1P3O C;  3TU4 B;  2XD5 A;  1EQZ B;  1R4V A;  3AV1 C;  1Z2C B;  4G92 C;  4KUD A;  1P3B B;  4QLC C;  3C1B A;  4XZQ C;  3AZN A;  3WAA A;  4J8V A;  1S32 A;  5CPK C;  3B0B A;  5GSU C;  5B0Z D;  5AV6 A;  3MNN C;  4XUJ C;  2G5H C;  2IO5 C;  5GSU B;  2ZY2 A;  5B2J D;  4ZUX B;  4HGA B;  3LEL D;  1P3G D;  1P3K A;  4KHA B;  1P3P D;  3LJA D;  4XUJ B;  4X23 C;  3MGQ D;  4JJN D;  5AVC A;  3TU4 D;  5DNM A;  1EQZ D;  5B32 A;  4WU8 B;  4X23 B;  1P3O D;  5B24 B;  5AV8 C;  3WKJ B;  3AV1 D;  1TAF A;  3REJ B;  5GT3 A;  5AV8 B;  5BT1 C;  4QLC D;  2F8N G;  4XZQ D;  2NQB A;  1WWI A;  5CPK D;  5E5A A;  3MGP B;  3C1C C;  5CHL B;  3W97 A;  5GSU D;  3MNN D;  4XUJ D;  3AZH C;  3KXB C;  4X23 D;  4H9Q A;  3FDD A;  5AV8 D;  3B6F C;  3W96 A;  4J8W A;  2RVQ C;  3REK B;  4DRB A;  5AV5 A;  1P3A C;  5B2I C;  1ID3 B;  3B6F B;  4NE5 A;  1P3A B;  2BYM B;  5BT1 D;  1KX3 A;  5G49 A;  1KX4 A;  4WU9 A;  1M1A C;  3C1C D;  1H3O B;  2YFV A;  5AY8 C;  3AV2 A;  1U35 B;  4E45 A;  3AZH D;  3KXB D;  1M19 A;  3NQU B;  5DNN A;  4J8U B;  3REL C;  1TZY A;  5GXQ C;  1BH9 B;  3B6F D;  5BO0 A;  3REL B;  3A1I A;  2RVQ D;  3UTA C;  2FJ7 B;  3LZ0 A;  5B31 C;  1P3L A;  1P3A D;  5B2I D;  5B31 B;  2Y2G A;  5B33 A;  2F8N A;  1M1A D;  2PYO A;  4H9R A;  4Z5T B;  3X1S A;  5AY8 D;  3B0D C;  1P3M A;  4H9O A;  3X1U A;  3AZF B;  3X1T A;  5AVB A;  1ZLA B;  3AFA C;  2Y2M A;  1P3F A;  3REL D;  5GXQ D;  3MVD B;  5B0Y A;  3AYW B;  5B40 A;  4G91 C;  4KUD C;  3UTA D;  5B31 D;  1KX5 B;  3AN2 A;  2Y2I A;  5JA4 B;  5JRG A;  3C1B C;  2F8N H;  3AZN C;  3WAA C;  4J8V C;  1S32 C;  1M18 B;  2ARO A;  3B6G A;  1KU5 A;  1Q9C A;  2RIQ A;  3AZG C;  1P3K C;  3VH5 A;  3EPK A;  5AVC C;  5DNM C;  2BYK B;  3AZG B;  5B32 C;  3AFA D;  1JFI A;  5DNM B;  4KGC C;  3KUY A;  5GT3 C;  4KUD D;  4KGC B;  4Z66 A;  4H9S A;  1HQ3 A;  4R8P A;  3AZN D;  3WAA D;  4J8V D;  2NQB C;  1S32 D;  5E5A C;  2CV5 A;  5BNV A;  3REI A;  4H9P A;  2NQB B;  3W99 A;  3EG5 B;  3MGS A;  5E5A B;  3KWQ A;  5B0Z B;  1WWS A;  4H9N B;  3LEL B;  2NZD B;  5B2J B;  2CWE A;  3AZG D;  5CPJ A;  1P3K D;  1P3P B;  3LJA B;  5AVC D;  4ZBJ C;  5FUG A;  5DNM D;  3A6N A;  5B32 D;  5BNX B;  3MGQ B;  3AZI A;  3B0C W;  1T3U A;  2W8S A;  1P3O B;  4KGC D;  2JSS A;  4J8W C;  3AV1 B;  3KFU G;  5GT3 D;  1F66 A;  5AV5 C;  4WJ3 C;  4G92 B;  3WA9 A;  4J8X A;  3VH5 W;  2F8N K;  3UT9 A;  1KX3 C;  4QLC B;  1KX4 C;  2Y2O A;  3AZJ A;  4XZQ B;  2NQB D;  3W98 A;  1KX4 B;  2HIO A;  5CPK B;  5E5A D;  3O62 A;  1P34 A;  3WTP A;  2Y2L A;  3MNN B;  2IO5 B;  4WNN B;  4YM6 A;  4WV4 B;  5DNN C;  3WTP E;  2HUE C;  1TZY C;  2BG1 A;  4J8W D;  4EO5 C;  5B1L A;  3LZ0 C;  1P3L C;  2UWX A;  5AV5 D;  5AV9 A;  4CSR A;  5CPI C;  2VQR A;  3NQJ B;  1KX3 D;  5CPI B;  2LY8 A;  1B67 A;  4E44 A;  3MGR A;  1KX4 D;  4UUZ B;  4CAY B;  2PYO C;  2Y2N A;  3C1C B;  5GT0 A;  3X1S C;  2PYO B;  4H9R B;  3AZM A;  5KDM A;  3AZL A;  3AL0 C;  3AZH B;  3X1U C;  3KXB B;  5AVB C;  1BH8 B;  3AZK A;  3B0C T;  5F99 C;  5DNN D;  1P3F C;  1TZY D;  5F99 B;  1AOI A;  5C3I C;  5B40 C;  3LZ0 D;  4DRA A;  5B2I B;  5CPI D;  1HTA A;  4LD9 C;  5CP6 A;  3X1V A;  2ARO C;  4LD9 B;  2PYO D;  5B1M A;  3VH6 A;  1M1A B;  4YS3 A;  1P3G A;  3EPH A;  3X1S D;  4JJN A;  5AY8 B;  1EQZ A;  3X1U D;  5AVB D;  3UTB C;  2JCH A;  5F99 D;  1N1J B;  3LZ1 C;  1P3F D;  3UTB B;  1P3B A;  2YFW B;  3KUY C;  5GXQ B;  3LZ1 B;  3AZE C;  4Z66 C;  3UTA B;  3V9R B;  3AZE B;  3REH C;  4H9S C;  1HQ3 C;  4R8P C;  4LD9 D;  1P3I C;  3REH B;  5GSU A;  4ZUX A;  2ARO D;  4KHA A;  1P3I B;  4XUJ A;  2CV5 C;  3REI C;  3W99 C;  4WU8 A;  3MGS C;  4X23 A;  3R45 B;  3KSY A;  5B24 A;  2J8P A;  3B0D B;  3MGS B;  5CPJ C;  3WKJ A;  3REJ A;  2G5I C;  5AV8 A;  3UTB D;  3AZI C;  2Y2Q A;  3AFA B;  3LZ1 D;  5B31 G;  3VH6 W;  2ZY4 A;  3KUY D;  3AZE D;  1F66 C;  4G91 B;  4KUD B;  4Z66 D;  3WA9 C;  3MGP A;  4J8X C;  3REH D;  3UT9 C;  1HQ3 D;  3C1B B;  4R8P D;  3AZJ C;  1P3I D;  2XD1 A;  3UT9 B;  3AZN B;  4J8V B;  3W98 C;  3WAA B;  2HIO C;  1S32 B;  1W2E A;  2CV5 D;  5AV6 C;  3W99 D;  3O62 C;  2JE5 A;  3MGS D;  5AV6 B;  3H0L C;  5CPJ D;  3REK A;  1P3K B;  1ID3 A;  3B6F A;  5AVC B;  3AZI D;  5B32 B;  3H0M C;  1P3A A;  2BYM A;  5B1L C;  1TAF B;  1F66 D;  5GT3 B;  3WA9 D;  5BS7 A;  3C1B D;  1H3O A;  4J8X D;  3H0R C;  3UT9 D;  1U35 A;  3AZJ D;  3W98 D;  3W97 C;  5GT0 C;  5AV6 D;  3NQU A;  3O62 D;  3W97 B;  4J8U A;  3AZM C;  3AZL C;  1BH9 A;  5B32 G;  2Y2K A;  2FJ7 A;  3AZK C;  4H9Q B;  4UPK A;  4ZBJ B;  3W96 C;  5B31 A;  1AOI C;  3W96 B;  4J8W B;  5B1L D;  2NZD D;  5AV5 B;  4Z5T A;  4WU9 C;  1KX3 B;  5G49 B;  5CP6 C;  3X1V C;  4WU9 B;  2ZY3 A;  5B1M C;  3F6T A;  3AZF A;  4YS3 C;  1ZLA A;  3W97 D;  3AV2 C;  2YFV B;  4NE6 A;  3AZM D;  3AV2 B;  3AZL D;  1M19 C;  3MVD A;  3AYW A;  3AZK D;  1M19 B;  1KX5 A;  5DNN B;  5JA4 A;  1P3B C;  3W96 D;  2HUE B;  1AOI D;  1TZY B;  1B6W A;  5BO0 B;  1M18 A;  4EO5 B;  2ZY5 A;  3LZ0 B;  1P3L B;  2FFF B;  5CPJ B;  5B33 C;  4M6B A;  4WU9 D;  5B33 B;  2F8N B;  4ZUX C;  4HGA C;  5CP6 D;  3X1V D;  5B1M D;  4YS3 D;  2BYK A;  3AZG A;  3AV2 D;  4WU8 C;  1P3M C;  3X1S B;  5B24 C;  3X1T C;  1P3M B;  3WKJ C;  1M19 D;  3REJ C;  4H9O B;  3X1U B;  1BFM A;  3X1T B;  4KGC A;  5AVB B;  4Z2M G;  1P3F B;  5B0Y C;  1P3B D;  1P3L D;  3VH5 T;  3AN2 C;  5C3I B;  5B0Y B;  5B40 B;  3MGP C;  5JRG C;  3AN2 B;  5B33 D;  2F8N D;  5JRG B;  5B0Z A;  4H9N A;  3LEL A;  3B6G C;  4ZUX D;  5B2J A;  2NZD A;  2ARO B;  1P3P A;  3LJA A;  3B6G B;  3MGQ A;  3TU4 A;  5BNX A;  4WU8 D;  1P3M D;  5B24 D;  1P3O A;  3X1T D;  3WKJ D;  3REK C;  3REJ D;  3AV1 A;  1ID3 C;  2F2A C;  2Y2P A;  1JFI B;  5B0Y D;  5B40 D;  4QLC A;  3KUY B;  4XZQ A;  3AN2 D;  5CPK A;  4Z66 B;  5BS7 C;  5JRG D;  3MGP D;  1ULY A;  1U35 C;  1HQ3 B;  4R8P B;  3MNN A;  3B6G D;  3EPL A;  4WNN A;  3KWQ C;  2CV5 B;  5BNV B;  3REI B;  4H9P B;  3W99 B;  4J8U C;  3KWQ B;  2ZM5 A;  3A6N C;  3REK D;  2FJ7 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...