5AV9C

Human nucleosome core particle
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
106
structure length
106
Chain Sequence
KAKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.1
publication title Intra- and inter-nucleosomal interactions of the histone H4 tail revealed with a human nucleosome core particle with genetically-incorporated H4 tetra-acetylation
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein/dna
total genus 32
structure length 106
sequence length 106
chains with identical sequence G
ec nomenclature
pdb deposition date 2015-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5av9C00
1AOID 1KU5A 4J8WD 5B0ZC 4H9NA 4LD9C 5AV6A 2F8NH 4Z66D 5DNMC 3KUYA 3UTAB 3WAAB 1S32A 4X23B 3AZFD 3MGSA 3REKC 3TU4A 2NQBA 5B1LA 5CPKD 2FJ7B 3NQUB 3W98C 3RELC 3B0DC 2PYOB 3MNND 3KSYA 4J8XB 1TZYD 4XUJD 3UTBC 1M1AB 1JFIB 4HGAC 3AZMC 5B24D 3AZHC 3VH5T 4Z2MG 4QLCA 3A6NB 3AZNB 1A7WA 5AY8D 3AN2D 3W99A 4NFTA 5B31A 4YS3D 2L5AA 3KXBB 5F99D 1B6WA 3AZLC 3AV2C 3VH5W 2CWEA 5B32C 4H9NB 4J8WA 5GXQC 5AV6B 5AV9C 3AZGC 3KUYB 3AZKC 4Z66A 1N1JB 1S32B 1BH9A 3REID 3MGSB 3TU4B 1F66C 2HIOC 3AZFA 4G91C 4YM6D 1TAFA 1P3GC 1P3BC 3VH6A 4Z5TA 3MNNA 1TZYA 4XUJA 3KWQD 5B0YC 4QLCB 5GSUC 2AROD 1P3FB 5B31B 3AN2A 5AY8A 5B40D 4R8PD 5GT0B 2BYMA 1P3OD 4WU8A 5F99A 1AOIB 4J8WB 5C3IC 4Z66B 4ZUXC 3X1VD 1M18C 5JRGD 5B31G 1ZLAC 1H3OA 3REIA 3AZFB 3C1CC 5CPKB 1HQ3D 1P3LD 3AZEB 3LZ1D 3AZJD 3LJAC 1TAFB 3W97C 4YM6A 3LELC 4WU9D 5CP6C 3REHC 2NZDB 3UT9B 1ID3D 4XUJB 4J8VC 2IO5B 3B0BA 3WA9C 5B24B 3AFAD 5GT3C 4XZQC 4JJND 1P34D 2AROA 3AN2B 5AY8B 5CPJC 2BYMB 4YS3B 5AV5D 3X1TC 1P3OA 3MGRD 3MGPD 5B2JD 4CAYA 3O62D 3MVDD 3X1VA 1KX4C 5B2IC 3X1UD 1H3OB 5B0ZD 5JRGA 1P3MC 2JSSA 3MGQD 4J8UA 1P3LA 1HQ3A 3LZ1A 3AZJA 5B1LD 4YM6B 3W96C 3LZ0C 3X1SB 4AWLB 5AVCD 4WU9A 2RVQD 5E5AC 3RELD 4DRAA 5DNNB 1ID3A 3KWQB 5BS7C 1P3PC 3AFAA 3AYWD 2AROB 4NE6A 4JJNA 1P34A 5B40B 4R8PB 1P3ID 3W99D 5AV5A 3UTAC 3MGRA 2HUEB 3MGPA 4G92B 2CV5B 4WNNA 1P3KB 2FJ7C 5B2JA 3O62A 5AV8B 3X1VB 3C1BD 3AV2D 4KGCD 3MVDA 5JRGB 4H9SC 3AZID 3X1UA 5GXQD 5B0ZA 5AV9D 3AZGD 2PYOC 3WTPE 3AZKD 1HQ3B 4H9OA 3MGQA 4J8XC 3AZJB 1P3LB 1M1AC 5BO0A 2HIOD 3REKA 3B6GD 4E45A 1BH8A 5AVCA 3A6NC 3AZNC 2F8NK 5BNXA 2YFWA 1P3GD 3RELA 4Z5TD 3KXBC 3AFAB 3WTPD 3AYWA 5AV6C 3B6FB 5AVBB 3KUYC 5BNVA 3AZMA 3R45B 4ZBJB 3V9RA 5GSUD 5AV5B 3AZHA 3MGRB 1P3IA 1S32C 5BT1C 3MGPB 1KX3D 4WU8D 3MGSC 3TU4C 4WNNB 5B33D 5B2JB 3O62B 3MVDB 3C1BA 3AV2A 3X1UB 4KUDD 5B0ZB 4KGCA 5B32A 3AZIA 5GXQA 5AV9A 3MGQB 3AZGA 1P3AD 3AZKA 5BO0B 2NQBB 5B1LB 3REJD 1F66A 1BH8B 2HIOA 5AVCB 4QLCC 3LJAD 3B6GA 4EO5C 1P3FC 5B31C 5GT0C 1P3GA 4Z2MH 1AOIC 3AYWB 4H9RA 3WTPA 4J8WC 2F8ND 1P3IB 3W99B 3V9RB 4Z66C 4XZQD 5CPID 5GSUA 1KX3A 3AZFC 5B33A 4WZSB 5CPKC 3AZEC 3C1BB 4KGCB 3AZIB 4KUDA 2NZDC 1BH9B 4ZUXA 3UT9C 1P3AA 1KX4D 1WWIA 4XUJC 1U35D 4H9PA 1B67A 1P3MD 2IO5C 4J8UD 5B24C 3REJA 1KX5D 3B6GB 5AY8C 3LJAA 4YS3C 1P3GB 4Z5TB 5CP6A 3MNNB 3REHA 1EQZC 3WTPB 1TZYB 5E5AD 3WKJD 3AV1D 1F1EA 1M19D 2F8NA 1P3PD 5JA4A 5B1MD 4XZQA 1KX3B 5CPIA 4WU8B 5B33B 5F99B 3X1TA 4YM6C 5KDMA 4KUDB 3X1SC 4AWLC 1P3AB 5FUGA 3REIB 5DNNC 1KX4A 1Q9CA 3KWQC 3REJB 1U35A 4LD9D 5DNMD 1P3MA 2AROC 3LJAB 1KX5A 3REKD 5B40C 4R8PC 2LY8A 4UUZA 4H9QA 3AZND 3W98D 3WKJA 2HUEC 4G92C 5E5AA 2CV5C 3AV1A 1P3KC 2F8NB 3KXBD 1M19A 5AV8C 3X1VC 3UTBD 4XZQB 5BS7A 1P3PA 5JRGC 5CPIB 5G49A 2BYKA 5B1MA 4NE5A 3AZMD 3AZHD 1WWSA 1P3OB 4E44A 1P3LC 1HQ3C 3WAAC 3AZJC 4X23C 5KDMB 3UTAA 4CAYB 2F8NG 3AZLD 5B32D 3NQUA 1U35B 1P3MB 4LD9A 4J8UB 3AFAC 5DNMA 3LZ1B 1KX5B 1F66D 1JFIA 3B6FC 4WU9B 5AVBC 4ZBJC 5AV5C 3MGRC 3WKJB 3MGPC 1ID3B 1P3FD 3W98A 3AZNA 3AV1B 5B2JC 1P3BD 3O62C 1M19B 3KXBA 4JJNB 3MVDC 1P34B 1P3PB 5G49B 2BYKB 5B1MB 3X1UC 3UTBA 5B0YD 3MGQC 4KHAA 3VH5A 1N1JA 2NQBC 5B1LC 5AVCC 3AZED 4M6BA 3AZLA 2RVQC 2YFVA 4LD9B 4H9OB 4ZUXD 5DNMB 1M18D 2NZDD 3AYWC 3UT9D 1ZLAD 4WV4B 3REKB 3C1CD 1P3IC 3W99C 3NQJA 5BNXB 3W97D 2YFWB 3W98B 3RELB 3B0DB 3LELD 1P3FA 5CP6D 3REHD 5GT0A 1P3BA 1EQZD 3C1BC 3UTBB 4KGCC 3B0CT 4HGAB 4J8VD 1AOIA 3AZIC 3WA9D 3AZMB 5BNVB 3AZHB 5GT3D 4KHAB 5B0YA 5CPJD 3B0CW 3X1TD 3AZLB 3AV2B 3B6GC 5CPKA 3AZEA 5B32B 2YFVB 3VH6T 5GXQB 5AV9B 3X1SD 3AZGB 4Z5TC 3AZKB 3MNNC 1M18A 3WTPC 1TZYC 5B2ID 2NZDA 1F66B 5DNND 3UT9A 1ZLAA 3VH6W 2HIOB 3C1CA 3NQJB 5B24A 3AN2C 4G91B 5B32G 3W96D 3W97A 4EO5B 3LZ0D 1KX3C 4WU8C 3LELA 5B33C 5F99C 4YS3A 1P3BB 4H9RB 5CHLB 2CV5D 1EQZA 1HTAA 4KUDC 1P3KD 4J8VA 3WA9A 5B0YB 5GT3A 5GSUB 5AV8D 1P3AC 3REIC 5CPJA 3REJC 3UTAD 4CSRA 3WAAD 1BFMA 4X23D 2FJ7D 3X1SA 5C3IB 4ZUXB 1M18B 4H9PB 5B2IA 1ULYA 1ZLAB 5DNNA 2PYOD 3C1CB 3KWQA 4J8XD 1M1AD 3W97B 5CPIC 3W96A 3LZ0A 3LELB 1P3OC 3B6FD 5CP6B 3REHB 5AVBD 5B40A 4R8PA 3A6ND 1R4VA 1EQZB 4J8VB 2CV5A 3WA9B 5GT3B 5JA4B 1P3KA 5AV8A 5CPJB 5AV6D 1U35C 3KUYD 4J8UC 3X1TB 3LZ1C 4CSRB 1S32D 5BT1D 1KX5C 3MGSD 3TU4D 3WAAA 2NQBD 4X23A 4DRBA 4WU9C 2FJ7A 5FUGB 3WKJC 1KX4B 1ID3C 5B2IB 3AV1C 4H9SA 1M19C 2PYOA 4JJNC 1P34C 4J8XA 1M1AA 5B1MC 3W96B 3LZ0B 4UUZB 4QLCD 4H9QB 3B6FA 5AVBA 5E5AB 3A6NA 3R45A 5B31D 4NE3A 5GT0D
chains in the Genus database with same CATH superfamily
2JE5A 1AOID 2RIQA 1KU5A 2FFFB 5B0ZC 4J8WD 4H9NA 4LD9C 5AV6A 2F8NH 4Z66D 5DNMC 3KUYA 2Y2PA 3UTAB 3WAAB 1S32A 4X23B 3AZFD 3MGSA 3REKC 3TU4A 2NQBA 5B1LA 5CPKD 2DF4C 2FJ7B 3NQUB 3W98C 3RELC 3B0DC 2PYOB 3MNND 3KSYA 4J8XB 2Y2IA 1TZYD 4XUJD 3UTBC 1M1AB 1JFIB 4HGAC 3AZMC 5B24D 3AZHC 3VH5T 4Z2MG 4QLCA 3A6NB 3AZNB 1A7WA 5AY8D 3AN2D 3W99A 4NFTA 5B31A 4YS3D 2L5AA 3KXBB 5F99D 1B6WA 3AZLC 2DQNC 3AV2C 3VH5W 2CWEA 5B32C 4H9NB 4J8WA 5GXQC 5AV6B 5AV9C 3AZGC 3KUYB 3AZKC 4Z66A 1N1JB 3H0LC 1S32B 4WJ3C 1BH9A 2ZY4A 3MGSB 3REID 3TU4B 1F66C 2HIOC 3AZFA 4G91C 4YM6D 1TAFA 2ZM5A 1P3GC 1P3BC 3VH6A 4Z5TA 2Y2HA 3MNNA 2Y2QA 1TZYA 4XUJA 3KWQD 5B0YC 4QLCB 5GSUC 2AROD 1P3FB 5B31B 3AN2A 5AY8A 5B40D 4R8PD 5GT0B 2BYMA 1P3OD 4WU8A 5F99A 1AOIB 4J8WB 5C3IC 4Z66B 4ZUXC 3X1VD 1M18C 5JRGD 5B31G 1ZLAC 1H3OA 3REIA 3AZFB 3C1CC 5CPKB 1HQ3D 1P3LD 3AZEB 3LZ1D 3AZJD 3LJAC 1TAFB 3W97C 4YM6A 3LELC 4WU9D 5CP6C 3REHC 2Y2LA 2NZDB 3UT9B 1ID3D 4XUJB 4J8VC 2IO5B 3B0BA 3WA9C 5B24B 3AFAD 5GT3C 4XZQC 4JJND 1P34D 2AROA 3AN2B 5AY8B 5CPJC 2Y2KA 2BYMB 4YS3B 5AV5D 3X1TC 1P3OA 3MGRD 3MGPD 5B2JD 4CAYA 3O62D 3MVDD 3X1VA 1KX4C 5B2IC 3X1UD 1H3OB 5B0ZD 5JRGA 1P3MC 2JSSA 3EG5B 3MGQD 4J8UA 1P3LA 1HQ3A 3LZ1A 3AZJA 5B1LD 4YM6B 3W96C 3LZ0C 3X1SB 4AWLB 5AVCD 4WU9A 2RVQD 5E5AC 3RELD 4DRAA 5DNNB 1ID3A 3KWQB 1Z2CB 5BS7C 1P3PC 3AFAA 3AYWD 2AROB 4NE6A 4JJNA 1P34A 5B40B 4R8PB 1P3ID 3W99D 5AV5A 3UTAC 3MGRA 2HUEB 3MGPA 4G92B 2XD1A 2CV5B 4WNNA 1P3KB 2FJ7C 5B2JA 3O62A 5AV8B 3X1VB 3C1BD 3AV2D 4KGCD 3MVDA 5JRGB 4H9SC 2Y2JA 3AZID 3X1UA 5GXQD 5B0ZA 5AV9D 3AZGD 2VQRA 2PYOC 1W2EA 3WTPE 3AZKD 1HQ3B 4H9OA 3MGQA 4J8XC 3AZJB 1P3LB 1M1AC 5BO0A 2HIOD 3REKA 3B6GD 4E45A 1BH8A 5AVCA 3A6NC 3AZNC 2F8NK 5BNXA 2YFWA 1P3GD 3RELA 4Z5TD 3KXBC 3AFAB 3WTPD 3AYWA 5AV6C 3B6FB 5AVBB 3KUYC 5BNVA 3AZMA 3R45B 4ZBJB 3V9RA 5GSUD 5AV5B 3AZHA 3MGRB 1P3IA 1S32C 5BT1C 3MGPB 1KX3D 2Y2GA 4WU8D 3MGSC 3TU4C 4WNNB 5B33D 5B2JB 3O62B 3FDDA 3MVDB 3C1BA 3AV2A 3X1UB 4KUDD 5B0ZB 4KGCA 5B32A 3AZIA 5GXQA 5AV9A 3MGQB 3AZGA 1P3AD 3AZKA 5BO0B 2NQBB 5B1LB 3REJD 1F66A 1BH8B 2HIOA 5AVCB 4QLCC 3LJAD 3B6GA 4EO5C 1P3FC 5B31C 5GT0C 1P3GA 4Z2MH 1AOIC 3AYWB 4H9RA 3WTPA 4J8WC 2F8ND 3KFUG 1P3IB 3EPJA 3W99B 3V9RB 4Z66C 4XZQD 5CPID 5GSUA 1KX3A 3AZFC 5B33A 4WZSB 5CPKC 3AZEC 3C1BB 4KGCB 1PZRA 3AZIB 2JCHA 4KUDA 2NZDC 1BH9B 4ZUXA 3UT9C 1P3AA 1KX4D 1WWIA 4XUJC 1U35D 4H9PA 1B67A 1P3MD 2IO5C 4J8UD 5B24C 3REJA 1KX5D 3B6GB 5AY8C 3LJAA 2W8SA 4YS3C 1P3GB 4Z5TB 5CP6A 3MNNB 3REHA 1EQZC 3WTPB 1TZYB 5E5AD 3WKJD 3AV1D 1F1EA 1M19D 2F8NA 1P3PD 5JA4A 5B1MD 4XZQA 1KX3B 5CPIA 4WU8B 5B33B 5F99B 3X1TA 4YM6C 5KDMA 4KUDB 3X1SC 4AWLC 1P3AB 1T3UA 5FUGA 3REIB 5DNNC 1KX4A 3H0MC 1Q9CA 3KWQC 3REJB 1U35A 4LD9D 5DNMD 1P3MA 2AROC 3LJAB 1KX5A 3REKD 5B40C 2Y2MA 2G5IC 4R8PC 2LY8A 3A1IA 4UUZA 4H9QA 3AZND 3W98D 3WKJA 2HUEC 4G92C 5E5AA 2CV5C 3AV1A 1P3KC 2F8NB 3KXBD 1M19A 3F6TA 5AV8C 3X1VC 3UTBD 4XZQB 5BS7A 1P3PA 5JRGC 5CPIB 5G49A 2BYKA 5B1MA 4NE5A 3AZMD 3AZHD 1WWSA 1P3OB 4E44A 1P3LC 1HQ3C 3WAAC 3AZJC 4X23C 5KDMB 3UTAA 4CAYB 2F8NG 3AZLD 5B32D 3NQUA 3IP4C 1U35B 1P3MB 4LD9A 4J8UB 3AFAC 5DNMA 3LZ1B 3P5JB 1KX5B 3EPKA 1F66D 1JFIA 3B6FC 4WU9B 5AVBC 3EPHA 4ZBJC 5AV5C 3MGRC 3WKJB 3MGPC 1ID3B 1P3FD 3W98A 3AZNA 3AV1B 4DQYB 2ZY2A 5B2JC 1P3BD 3O62C 1M19B 3KXBA 4JJNB 3MVDC 1P34B 1P3PB 5G49B 2BYKB 5B1MB 3X1UC 3UTBA 5B0YD 3MGQC 4KHAA 3VH5A 1N1JA 2NQBC 5B1LC 5AVCC 3AZED 4M6BA 3AZLA 2RVQC 2YFVA 4LD9B 4H9OB 4ZUXD 5DNMB 1M18D 2NZDD 3AYWC 3UT9D 1ZLAD 5GT0D 3REKB 3C1CD 1P3IC 3W99C 3NQJA 5BNXB 3W97D 2YFWB 3W98B 3RELB 3B0DB 3A1KA 3LELD 1P3FA 5CP6D 3REHD 5GT0A 1P3BA 1EQZD 3C1BC 3UTBB 4KGCC 3B0CT 4HGAB 4J8VD 1AOIA 3AZIC 3WA9D 3AZMB 5BNVB 3AZHB 5GT3D 4KHAB 5B0YA 2Y2NA 2Y2OA 5CPJD 3B0CW 3X1TD 3AZLB 3AV2B 3B6GC 5CPKA 3AZEA 5B32B 2YFVB 3VH6T 5GXQB 5AV9B 3X1SD 3AZGB 4Z5TC 3AZKB 3MNNC 1M18A 3WTPC 1TZYC 5B2ID 2NZDA 1F66B 5DNND 3UT9A 1ZLAA 3VH6W 2HIOB 3C1CA 2J8PA 3NQJB 5B24A 3AN2C 4G91B 2BG1A 5B32G 3W96D 3W97A 4EO5B 3LZ0D 1KX3C 4WU8C 3EPLA 3LELA 5B33C 5F99C 4YS3A 1P3BB 4H9RB 5CHLB 2CV5D 1EQZA 1HTAA 4KUDC 1P3KD 4J8VA 3WA9A 2ZY3A 5B0YB 5GT3A 5GSUB 5AV8D 1P3AC 3REIC 5CPJA 3REJC 3UTAD 4CSRA 3WAAD 1BFMA 4X23D 2FJ7D 3X1SA 5C3IB 4ZUXB 1M18B 4H9PB 2F2AC 3H0RC 5B2IA 1ULYA 1ZLAB 5DNNA 2PYOD 3C1CB 3KWQA 4J8XD 1M1AD 3W97B 5CPIC 3W96A 3LZ0A 3LELB 1P3OC 3B6FD 5CP6B 3REHB 5AVBD 5B40A 4R8PA 3A6ND 1R4VA 1EQZB 2XD5A 2G5HC 4J8VB 2CV5A 3WA9B 5GT3B 5JA4B 1P3KA 5AV8A 5CPJB 5AV6D 1U35C 3KUYD 4J8UC 3X1TB 3LZ1C 4CSRB 1S32D 5BT1D 1KX5C 3MGSD 3TU4D 3WAAA 2NQBD 4X23A 4DRBA 4WU9C 2FJ7A 5FUGB 3WKJC 1KX4B 1ID3C 5B2IB 3AV1C 4UPKA 4H9SA 1M19C 2PYOA 2ZY5A 3AL0C 4JJNC 1P34C 4J8XA 1M1AA 5B1MC 3W96B 3LZ0B 4UUZB 4QLCD 4H9QB 3B6FA 5AVBA 5E5AB 3A6NA 3R45A 5B31D 4NE3A 2UWXA 4WV4B
chains in the Genus database with same CATH topology
2JE5A 1AOID 2RIQA 1KU5A 2FFFB 5B0ZC 4J8WD 4H9NA 4LD9C 5AV6A 2F8NH 4Z66D 5DNMC 3KUYA 2Y2PA 3UTAB 3WAAB 1S32A 4X23B 3AZFD 3MGSA 3REKC 3TU4A 2NQBA 5B1LA 5CPKD 2DF4C 2FJ7B 3NQUB 3W98C 3RELC 3B0DC 2PYOB 3MNND 3KSYA 4J8XB 2Y2IA 1TZYD 4XUJD 3UTBC 1M1AB 1JFIB 4HGAC 3AZMC 5B24D 3AZHC 3VH5T 4Z2MG 4QLCA 3A6NB 3AZNB 1A7WA 5AY8D 3AN2D 3W99A 4NFTA 5B31A 4YS3D 2L5AA 3KXBB 5F99D 1B6WA 3AZLC 2DQNC 3AV2C 3VH5W 2CWEA 5B32C 4H9NB 4J8WA 5GXQC 5AV6B 5AV9C 3AZGC 3KUYB 3AZKC 4Z66A 1N1JB 3H0LC 1S32B 4WJ3C 1BH9A 2ZY4A 3MGSB 3REID 3TU4B 1F66C 2HIOC 3AZFA 4G91C 4YM6D 1TAFA 2ZM5A 1P3GC 1P3BC 3VH6A 4Z5TA 2Y2HA 3MNNA 2Y2QA 1TZYA 4XUJA 3KWQD 5B0YC 4QLCB 5GSUC 2AROD 1P3FB 5B31B 3AN2A 5AY8A 5B40D 4R8PD 5GT0B 2BYMA 1P3OD 4WU8A 5F99A 1AOIB 4J8WB 5C3IC 4Z66B 4ZUXC 3X1VD 1M18C 5JRGD 5B31G 1ZLAC 1H3OA 3REIA 3AZFB 3C1CC 5CPKB 1HQ3D 1P3LD 3AZEB 3LZ1D 3AZJD 3LJAC 1TAFB 3W97C 4YM6A 3LELC 4WU9D 5CP6C 3REHC 2Y2LA 2NZDB 3UT9B 1ID3D 4XUJB 4J8VC 2IO5B 3B0BA 3WA9C 5B24B 3AFAD 5GT3C 4XZQC 4JJND 1P34D 2AROA 3AN2B 5AY8B 5CPJC 2Y2KA 2BYMB 4YS3B 5AV5D 3X1TC 1P3OA 3MGRD 3MGPD 5B2JD 4CAYA 3O62D 3MVDD 3X1VA 1KX4C 5B2IC 3X1UD 1H3OB 5B0ZD 5JRGA 1P3MC 2JSSA 3EG5B 3MGQD 4J8UA 1P3LA 1HQ3A 3LZ1A 3AZJA 5B1LD 4YM6B 3W96C 3LZ0C 3X1SB 4AWLB 5AVCD 4WU9A 2RVQD 5E5AC 3RELD 4DRAA 5DNNB 1ID3A 3KWQB 1Z2CB 5BS7C 1P3PC 3AFAA 3AYWD 2AROB 4NE6A 4JJNA 1P34A 5B40B 4R8PB 1P3ID 3W99D 5AV5A 3UTAC 3MGRA 2HUEB 3MGPA 4G92B 2XD1A 2CV5B 4WNNA 1P3KB 2FJ7C 5B2JA 3O62A 5AV8B 3X1VB 3C1BD 3AV2D 4KGCD 3MVDA 5JRGB 4H9SC 2Y2JA 3AZID 3X1UA 5GXQD 5B0ZA 5AV9D 3AZGD 2VQRA 2PYOC 1W2EA 3WTPE 3AZKD 1HQ3B 4H9OA 3MGQA 4J8XC 3AZJB 1P3LB 1M1AC 5BO0A 2HIOD 3REKA 3B6GD 4E45A 1BH8A 5AVCA 3A6NC 3AZNC 2F8NK 5BNXA 2YFWA 1P3GD 3RELA 4Z5TD 3KXBC 3AFAB 3WTPD 3AYWA 5AV6C 3B6FB 5AVBB 3KUYC 5BNVA 3AZMA 3R45B 4ZBJB 3V9RA 5GSUD 5AV5B 3AZHA 3MGRB 1P3IA 1S32C 5BT1C 3MGPB 1KX3D 2Y2GA 4WU8D 3MGSC 3TU4C 4WNNB 5B33D 5B2JB 3O62B 3FDDA 3MVDB 3C1BA 3AV2A 3X1UB 4KUDD 5B0ZB 4KGCA 5B32A 3AZIA 5GXQA 5AV9A 3MGQB 3AZGA 1P3AD 3AZKA 5BO0B 2NQBB 5B1LB 3REJD 1F66A 1BH8B 2HIOA 5AVCB 4QLCC 3LJAD 3B6GA 4EO5C 1P3FC 5B31C 5GT0C 1P3GA 4Z2MH 1AOIC 3AYWB 4H9RA 3WTPA 4J8WC 2F8ND 3KFUG 1P3IB 3EPJA 3W99B 3V9RB 4Z66C 4XZQD 5CPID 5GSUA 1KX3A 3AZFC 5B33A 4WZSB 5CPKC 3AZEC 3C1BB 4KGCB 1PZRA 3AZIB 2JCHA 4KUDA 2NZDC 1BH9B 4ZUXA 3UT9C 1P3AA 1KX4D 1WWIA 4XUJC 1U35D 4H9PA 1B67A 1P3MD 2IO5C 4J8UD 5B24C 3REJA 1KX5D 3B6GB 5AY8C 3LJAA 2W8SA 4YS3C 1P3GB 4Z5TB 5CP6A 3MNNB 3REHA 1EQZC 3WTPB 1TZYB 5E5AD 3WKJD 3AV1D 1F1EA 1M19D 2F8NA 1P3PD 5JA4A 5B1MD 4XZQA 1KX3B 5CPIA 4WU8B 5B33B 5F99B 3X1TA 4YM6C 5KDMA 4KUDB 3X1SC 4AWLC 1P3AB 1T3UA 5FUGA 3REIB 5DNNC 1KX4A 3H0MC 1Q9CA 3KWQC 3REJB 1U35A 4LD9D 5DNMD 1P3MA 2AROC 3LJAB 1KX5A 3REKD 5B40C 2Y2MA 2G5IC 4R8PC 2LY8A 3A1IA 4UUZA 4H9QA 3AZND 3W98D 3WKJA 2HUEC 4G92C 5E5AA 2CV5C 3AV1A 1P3KC 2F8NB 3KXBD 1M19A 3F6TA 5AV8C 3X1VC 3UTBD 4XZQB 5BS7A 1P3PA 5JRGC 5CPIB 5G49A 2BYKA 5B1MA 4NE5A 3AZMD 3AZHD 1WWSA 1P3OB 4E44A 1P3LC 1HQ3C 3WAAC 3AZJC 4X23C 5KDMB 3UTAA 4CAYB 2F8NG 3AZLD 5B32D 3NQUA 3IP4C 1U35B 1P3MB 4LD9A 4J8UB 3AFAC 5DNMA 3LZ1B 3P5JB 1KX5B 3EPKA 1F66D 1JFIA 3B6FC 4WU9B 5AVBC 3EPHA 4ZBJC 5AV5C 3MGRC 3WKJB 3MGPC 1ID3B 1P3FD 3W98A 3AZNA 3AV1B 4DQYB 2ZY2A 5B2JC 1P3BD 3O62C 1M19B 3KXBA 4JJNB 3MVDC 1P34B 1P3PB 5G49B 2BYKB 5B1MB 3X1UC 3UTBA 5B0YD 3MGQC 4KHAA 3VH5A 1N1JA 2NQBC 5B1LC 5AVCC 3AZED 4M6BA 3AZLA 2RVQC 2YFVA 4LD9B 4H9OB 4ZUXD 5DNMB 1M18D 2NZDD 3AYWC 3UT9D 1ZLAD 5GT0D 3REKB 3C1CD 1P3IC 3W99C 3NQJA 5BNXB 3W97D 2YFWB 3W98B 3RELB 3B0DB 3A1KA 3LELD 1P3FA 5CP6D 3REHD 5GT0A 1P3BA 1EQZD 3C1BC 3UTBB 4KGCC 3B0CT 4HGAB 4J8VD 1AOIA 3AZIC 3WA9D 3AZMB 5BNVB 3AZHB 5GT3D 4KHAB 5B0YA 2Y2NA 2Y2OA 5CPJD 3B0CW 3X1TD 3AZLB 3AV2B 3B6GC 5CPKA 3AZEA 5B32B 2YFVB 3VH6T 5GXQB 5AV9B 3X1SD 3AZGB 4Z5TC 3AZKB 3MNNC 1M18A 3WTPC 1TZYC 5B2ID 2NZDA 1F66B 5DNND 3UT9A 1ZLAA 3VH6W 2HIOB 3C1CA 2J8PA 3NQJB 5B24A 3AN2C 4G91B 2BG1A 5B32G 3W96D 3W97A 4EO5B 3LZ0D 1KX3C 4WU8C 3EPLA 3LELA 5B33C 5F99C 4YS3A 1P3BB 4H9RB 5CHLB 2CV5D 1EQZA 1HTAA 4KUDC 1P3KD 4J8VA 3WA9A 2ZY3A 5B0YB 5GT3A 5GSUB 5AV8D 1P3AC 3REIC 5CPJA 3REJC 3UTAD 4CSRA 3WAAD 1BFMA 4X23D 2FJ7D 3X1SA 5C3IB 4ZUXB 1M18B 4H9PB 2F2AC 3H0RC 5B2IA 1ULYA 1ZLAB 5DNNA 2PYOD 3C1CB 3KWQA 4J8XD 1M1AD 3W97B 5CPIC 3W96A 3LZ0A 3LELB 1P3OC 3B6FD 5CP6B 3REHB 5AVBD 5B40A 4R8PA 3A6ND 1R4VA 1EQZB 2XD5A 2G5HC 4J8VB 2CV5A 3WA9B 5GT3B 5JA4B 1P3KA 5AV8A 5CPJB 5AV6D 1U35C 3KUYD 4J8UC 3X1TB 3LZ1C 4CSRB 1S32D 5BT1D 1KX5C 3MGSD 3TU4D 3WAAA 2NQBD 4X23A 4DRBA 4WU9C 2FJ7A 5FUGB 3WKJC 1KX4B 1ID3C 5B2IB 3AV1C 4UPKA 4H9SA 1M19C 2PYOA 2ZY5A 3AL0C 4JJNC 1P34C 4J8XA 1M1AA 5B1MC 3W96B 3LZ0B 4UUZB 4QLCD 4H9QB 3B6FA 5AVBA 5E5AB 3A6NA 3R45A 5B31D 4NE3A 2UWXA 4WV4B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AOI D;  1KU5 A;  4J8W D;  5B0Z C;  4H9N A;  4LD9 C;  5AV6 A;  2F8N H;  4Z66 D;  5DNM C;  3KUY A;  3UTA B;  3WAA B;  1S32 A;  4X23 B;  3AZF D;  3MGS A;  3REK C;  3TU4 A;  2NQB A;  5B1L A;  5CPK D;  2FJ7 B;  3NQU B;  3W98 C;  3REL C;  3B0D C;  2PYO B;  3MNN D;  3KSY A;  4J8X B;  1TZY D;  4XUJ D;  3UTB C;  1M1A B;  1JFI B;  4HGA C;  3AZM C;  5B24 D;  3AZH C;  3VH5 T;  4Z2M G;  4QLC A;  3A6N B;  3AZN B;  1A7W A;  5AY8 D;  3AN2 D;  3W99 A;  4NFT A;  5B31 A;  4YS3 D;  2L5A A;  3KXB B;  5F99 D;  1B6W A;  3AZL C;  3AV2 C;  3VH5 W;  2CWE A;  5B32 C;  4H9N B;  4J8W A;  5GXQ C;  5AV6 B;  5AV9 C;  3AZG C;  3KUY B;  3AZK C;  4Z66 A;  1N1J B;  1S32 B;  1BH9 A;  3REI D;  3MGS B;  3TU4 B;  1F66 C;  2HIO C;  3AZF A;  4G91 C;  4YM6 D;  1TAF A;  1P3G C;  1P3B C;  3VH6 A;  4Z5T A;  3MNN A;  1TZY A;  4XUJ A;  3KWQ D;  5B0Y C;  4QLC B;  5GSU C;  2ARO D;  1P3F B;  5B31 B;  3AN2 A;  5AY8 A;  5B40 D;  4R8P D;  5GT0 B;  2BYM A;  1P3O D;  4WU8 A;  5F99 A;  1AOI B;  4J8W B;  5C3I C;  4Z66 B;  4ZUX C;  3X1V D;  1M18 C;  5JRG D;  5B31 G;  1ZLA C;  1H3O A;  3REI A;  3AZF B;  3C1C C;  5CPK B;  1HQ3 D;  1P3L D;  3AZE B;  3LZ1 D;  3AZJ D;  3LJA C;  1TAF B;  3W97 C;  4YM6 A;  3LEL C;  4WU9 D;  5CP6 C;  3REH C;  2NZD B;  3UT9 B;  1ID3 D;  4XUJ B;  4J8V C;  2IO5 B;  3B0B A;  3WA9 C;  5B24 B;  3AFA D;  5GT3 C;  4XZQ C;  4JJN D;  1P34 D;  2ARO A;  3AN2 B;  5AY8 B;  5CPJ C;  2BYM B;  4YS3 B;  5AV5 D;  3X1T C;  1P3O A;  3MGR D;  3MGP D;  5B2J D;  4CAY A;  3O62 D;  3MVD D;  3X1V A;  1KX4 C;  5B2I C;  3X1U D;  1H3O B;  5B0Z D;  5JRG A;  1P3M C;  2JSS A;  3MGQ D;  4J8U A;  1P3L A;  1HQ3 A;  3LZ1 A;  3AZJ A;  5B1L D;  4YM6 B;  3W96 C;  3LZ0 C;  3X1S B;  4AWL B;  5AVC D;  4WU9 A;  2RVQ D;  5E5A C;  3REL D;  4DRA A;  5DNN B;  1ID3 A;  3KWQ B;  5BS7 C;  1P3P C;  3AFA A;  3AYW D;  2ARO B;  4NE6 A;  4JJN A;  1P34 A;  5B40 B;  4R8P B;  1P3I D;  3W99 D;  5AV5 A;  3UTA C;  3MGR A;  2HUE B;  3MGP A;  4G92 B;  2CV5 B;  4WNN A;  1P3K B;  2FJ7 C;  5B2J A;  3O62 A;  5AV8 B;  3X1V B;  3C1B D;  3AV2 D;  4KGC D;  3MVD A;  5JRG B;  4H9S C;  3AZI D;  3X1U A;  5GXQ D;  5B0Z A;  5AV9 D;  3AZG D;  2PYO C;  3WTP E;  3AZK D;  1HQ3 B;  4H9O A;  3MGQ A;  4J8X C;  3AZJ B;  1P3L B;  1M1A C;  5BO0 A;  2HIO D;  3REK A;  3B6G D;  4E45 A;  1BH8 A;  5AVC A;  3A6N C;  3AZN C;  2F8N K;  5BNX A;  2YFW A;  1P3G D;  3REL A;  4Z5T D;  3KXB C;  3AFA B;  3WTP D;  3AYW A;  5AV6 C;  3B6F B;  5AVB B;  3KUY C;  5BNV A;  3AZM A;  3R45 B;  4ZBJ B;  3V9R A;  5GSU D;  5AV5 B;  3AZH A;  3MGR B;  1P3I A;  1S32 C;  5BT1 C;  3MGP B;  1KX3 D;  4WU8 D;  3MGS C;  3TU4 C;  4WNN B;  5B33 D;  5B2J B;  3O62 B;  3MVD B;  3C1B A;  3AV2 A;  3X1U B;  4KUD D;  5B0Z B;  4KGC A;  5B32 A;  3AZI A;  5GXQ A;  5AV9 A;  3MGQ B;  3AZG A;  1P3A D;  3AZK A;  5BO0 B;  2NQB B;  5B1L B;  3REJ D;  1F66 A;  1BH8 B;  2HIO A;  5AVC B;  4QLC C;  3LJA D;  3B6G A;  4EO5 C;  1P3F C;  5B31 C;  5GT0 C;  1P3G A;  4Z2M H;  1AOI C;  3AYW B;  4H9R A;  3WTP A;  4J8W C;  2F8N D;  1P3I B;  3W99 B;  3V9R B;  4Z66 C;  4XZQ D;  5CPI D;  5GSU A;  1KX3 A;  3AZF C;  5B33 A;  4WZS B;  5CPK C;  3AZE C;  3C1B B;  4KGC B;  3AZI B;  4KUD A;  2NZD C;  1BH9 B;  4ZUX A;  3UT9 C;  1P3A A;  1KX4 D;  1WWI A;  4XUJ C;  1U35 D;  4H9P A;  1B67 A;  1P3M D;  2IO5 C;  4J8U D;  5B24 C;  3REJ A;  1KX5 D;  3B6G B;  5AY8 C;  3LJA A;  4YS3 C;  1P3G B;  4Z5T B;  5CP6 A;  3MNN B;  3REH A;  1EQZ C;  3WTP B;  1TZY B;  5E5A D;  3WKJ D;  3AV1 D;  1F1E A;  1M19 D;  2F8N A;  1P3P D;  5JA4 A;  5B1M D;  4XZQ A;  1KX3 B;  5CPI A;  4WU8 B;  5B33 B;  5F99 B;  3X1T A;  4YM6 C;  5KDM A;  4KUD B;  3X1S C;  4AWL C;  1P3A B;  5FUG A;  3REI B;  5DNN C;  1KX4 A;  1Q9C A;  3KWQ C;  3REJ B;  1U35 A;  4LD9 D;  5DNM D;  1P3M A;  2ARO C;  3LJA B;  1KX5 A;  3REK D;  5B40 C;  4R8P C;  2LY8 A;  4UUZ A;  4H9Q A;  3AZN D;  3W98 D;  3WKJ A;  2HUE C;  4G92 C;  5E5A A;  2CV5 C;  3AV1 A;  1P3K C;  2F8N B;  3KXB D;  1M19 A;  5AV8 C;  3X1V C;  3UTB D;  4XZQ B;  5BS7 A;  1P3P A;  5JRG C;  5CPI B;  5G49 A;  2BYK A;  5B1M A;  4NE5 A;  3AZM D;  3AZH D;  1WWS A;  1P3O B;  4E44 A;  1P3L C;  1HQ3 C;  3WAA C;  3AZJ C;  4X23 C;  5KDM B;  3UTA A;  4CAY B;  2F8N G;  3AZL D;  5B32 D;  3NQU A;  1U35 B;  1P3M B;  4LD9 A;  4J8U B;  3AFA C;  5DNM A;  3LZ1 B;  1KX5 B;  1F66 D;  1JFI A;  3B6F C;  4WU9 B;  5AVB C;  4ZBJ C;  5AV5 C;  3MGR C;  3WKJ B;  3MGP C;  1ID3 B;  1P3F D;  3W98 A;  3AZN A;  3AV1 B;  5B2J C;  1P3B D;  3O62 C;  1M19 B;  3KXB A;  4JJN B;  3MVD C;  1P34 B;  1P3P B;  5G49 B;  2BYK B;  5B1M B;  3X1U C;  3UTB A;  5B0Y D;  3MGQ C;  4KHA A;  3VH5 A;  1N1J A;  2NQB C;  5B1L C;  5AVC C;  3AZE D;  4M6B A;  3AZL A;  2RVQ C;  2YFV A;  4LD9 B;  4H9O B;  4ZUX D;  5DNM B;  1M18 D;  2NZD D;  3AYW C;  3UT9 D;  1ZLA D;  4WV4 B;  3REK B;  3C1C D;  1P3I C;  3W99 C;  3NQJ A;  5BNX B;  3W97 D;  2YFW B;  3W98 B;  3REL B;  3B0D B;  3LEL D;  1P3F A;  5CP6 D;  3REH D;  5GT0 A;  1P3B A;  1EQZ D;  3C1B C;  3UTB B;  4KGC C;  3B0C T;  4HGA B;  4J8V D;  1AOI A;  3AZI C;  3WA9 D;  3AZM B;  5BNV B;  3AZH B;  5GT3 D;  4KHA B;  5B0Y A;  5CPJ D;  3B0C W;  3X1T D;  3AZL B;  3AV2 B;  3B6G C;  5CPK A;  3AZE A;  5B32 B;  2YFV B;  3VH6 T;  5GXQ B;  5AV9 B;  3X1S D;  3AZG B;  4Z5T C;  3AZK B;  3MNN C;  1M18 A;  3WTP C;  1TZY C;  5B2I D;  2NZD A;  1F66 B;  5DNN D;  3UT9 A;  1ZLA A;  3VH6 W;  2HIO B;  3C1C A;  3NQJ B;  5B24 A;  3AN2 C;  4G91 B;  5B32 G;  3W96 D;  3W97 A;  4EO5 B;  3LZ0 D;  1KX3 C;  4WU8 C;  3LEL A;  5B33 C;  5F99 C;  4YS3 A;  1P3B B;  4H9R B;  5CHL B;  2CV5 D;  1EQZ A;  1HTA A;  4KUD C;  1P3K D;  4J8V A;  3WA9 A;  5B0Y B;  5GT3 A;  5GSU B;  5AV8 D;  1P3A C;  3REI C;  5CPJ A;  3REJ C;  3UTA D;  4CSR A;  3WAA D;  1BFM A;  4X23 D;  2FJ7 D;  3X1S A;  5C3I B;  4ZUX B;  1M18 B;  4H9P B;  5B2I A;  1ULY A;  1ZLA B;  5DNN A;  2PYO D;  3C1C B;  3KWQ A;  4J8X D;  1M1A D;  3W97 B;  5CPI C;  3W96 A;  3LZ0 A;  3LEL B;  1P3O C;  3B6F D;  5CP6 B;  3REH B;  5AVB D;  5B40 A;  4R8P A;  3A6N D;  1R4V A;  1EQZ B;  4J8V B;  2CV5 A;  3WA9 B;  5GT3 B;  5JA4 B;  1P3K A;  5AV8 A;  5CPJ B;  5AV6 D;  1U35 C;  3KUY D;  4J8U C;  3X1T B;  3LZ1 C;  4CSR B;  1S32 D;  5BT1 D;  1KX5 C;  3MGS D;  3TU4 D;  3WAA A;  2NQB D;  4X23 A;  4DRB A;  4WU9 C;  2FJ7 A;  5FUG B;  3WKJ C;  1KX4 B;  1ID3 C;  5B2I B;  3AV1 C;  4H9S A;  1M19 C;  2PYO A;  4JJN C;  1P34 C;  4J8X A;  1M1A A;  5B1M C;  3W96 B;  3LZ0 B;  4UUZ B;  4QLC D;  4H9Q B;  3B6F A;  5AVB A;  5E5A B;  3A6N A;  3R45 A;  5B31 D;  4NE3 A;  5GT0 D; 
#chains in the Genus database with same CATH topology
 2JE5 A;  1AOI D;  2RIQ A;  1KU5 A;  2FFF B;  5B0Z C;  4J8W D;  4H9N A;  4LD9 C;  5AV6 A;  2F8N H;  4Z66 D;  5DNM C;  3KUY A;  2Y2P A;  3UTA B;  3WAA B;  1S32 A;  4X23 B;  3AZF D;  3MGS A;  3REK C;  3TU4 A;  2NQB A;  5B1L A;  5CPK D;  2DF4 C;  2FJ7 B;  3NQU B;  3W98 C;  3REL C;  3B0D C;  2PYO B;  3MNN D;  3KSY A;  4J8X B;  2Y2I A;  1TZY D;  4XUJ D;  3UTB C;  1M1A B;  1JFI B;  4HGA C;  3AZM C;  5B24 D;  3AZH C;  3VH5 T;  4Z2M G;  4QLC A;  3A6N B;  3AZN B;  1A7W A;  5AY8 D;  3AN2 D;  3W99 A;  4NFT A;  5B31 A;  4YS3 D;  2L5A A;  3KXB B;  5F99 D;  1B6W A;  3AZL C;  2DQN C;  3AV2 C;  3VH5 W;  2CWE A;  5B32 C;  4H9N B;  4J8W A;  5GXQ C;  5AV6 B;  5AV9 C;  3AZG C;  3KUY B;  3AZK C;  4Z66 A;  1N1J B;  3H0L C;  1S32 B;  4WJ3 C;  1BH9 A;  2ZY4 A;  3MGS B;  3REI D;  3TU4 B;  1F66 C;  2HIO C;  3AZF A;  4G91 C;  4YM6 D;  1TAF A;  2ZM5 A;  1P3G C;  1P3B C;  3VH6 A;  4Z5T A;  2Y2H A;  3MNN A;  2Y2Q A;  1TZY A;  4XUJ A;  3KWQ D;  5B0Y C;  4QLC B;  5GSU C;  2ARO D;  1P3F B;  5B31 B;  3AN2 A;  5AY8 A;  5B40 D;  4R8P D;  5GT0 B;  2BYM A;  1P3O D;  4WU8 A;  5F99 A;  1AOI B;  4J8W B;  5C3I C;  4Z66 B;  4ZUX C;  3X1V D;  1M18 C;  5JRG D;  5B31 G;  1ZLA C;  1H3O A;  3REI A;  3AZF B;  3C1C C;  5CPK B;  1HQ3 D;  1P3L D;  3AZE B;  3LZ1 D;  3AZJ D;  3LJA C;  1TAF B;  3W97 C;  4YM6 A;  3LEL C;  4WU9 D;  5CP6 C;  3REH C;  2Y2L A;  2NZD B;  3UT9 B;  1ID3 D;  4XUJ B;  4J8V C;  2IO5 B;  3B0B A;  3WA9 C;  5B24 B;  3AFA D;  5GT3 C;  4XZQ C;  4JJN D;  1P34 D;  2ARO A;  3AN2 B;  5AY8 B;  5CPJ C;  2Y2K A;  2BYM B;  4YS3 B;  5AV5 D;  3X1T C;  1P3O A;  3MGR D;  3MGP D;  5B2J D;  4CAY A;  3O62 D;  3MVD D;  3X1V A;  1KX4 C;  5B2I C;  3X1U D;  1H3O B;  5B0Z D;  5JRG A;  1P3M C;  2JSS A;  3EG5 B;  3MGQ D;  4J8U A;  1P3L A;  1HQ3 A;  3LZ1 A;  3AZJ A;  5B1L D;  4YM6 B;  3W96 C;  3LZ0 C;  3X1S B;  4AWL B;  5AVC D;  4WU9 A;  2RVQ D;  5E5A C;  3REL D;  4DRA A;  5DNN B;  1ID3 A;  3KWQ B;  1Z2C B;  5BS7 C;  1P3P C;  3AFA A;  3AYW D;  2ARO B;  4NE6 A;  4JJN A;  1P34 A;  5B40 B;  4R8P B;  1P3I D;  3W99 D;  5AV5 A;  3UTA C;  3MGR A;  2HUE B;  3MGP A;  4G92 B;  2XD1 A;  2CV5 B;  4WNN A;  1P3K B;  2FJ7 C;  5B2J A;  3O62 A;  5AV8 B;  3X1V B;  3C1B D;  3AV2 D;  4KGC D;  3MVD A;  5JRG B;  4H9S C;  2Y2J A;  3AZI D;  3X1U A;  5GXQ D;  5B0Z A;  5AV9 D;  3AZG D;  2VQR A;  2PYO C;  1W2E A;  3WTP E;  3AZK D;  1HQ3 B;  4H9O A;  3MGQ A;  4J8X C;  3AZJ B;  1P3L B;  1M1A C;  5BO0 A;  2HIO D;  3REK A;  3B6G D;  4E45 A;  1BH8 A;  5AVC A;  3A6N C;  3AZN C;  2F8N K;  5BNX A;  2YFW A;  1P3G D;  3REL A;  4Z5T D;  3KXB C;  3AFA B;  3WTP D;  3AYW A;  5AV6 C;  3B6F B;  5AVB B;  3KUY C;  5BNV A;  3AZM A;  3R45 B;  4ZBJ B;  3V9R A;  5GSU D;  5AV5 B;  3AZH A;  3MGR B;  1P3I A;  1S32 C;  5BT1 C;  3MGP B;  1KX3 D;  2Y2G A;  4WU8 D;  3MGS C;  3TU4 C;  4WNN B;  5B33 D;  5B2J B;  3O62 B;  3FDD A;  3MVD B;  3C1B A;  3AV2 A;  3X1U B;  4KUD D;  5B0Z B;  4KGC A;  5B32 A;  3AZI A;  5GXQ A;  5AV9 A;  3MGQ B;  3AZG A;  1P3A D;  3AZK A;  5BO0 B;  2NQB B;  5B1L B;  3REJ D;  1F66 A;  1BH8 B;  2HIO A;  5AVC B;  4QLC C;  3LJA D;  3B6G A;  4EO5 C;  1P3F C;  5B31 C;  5GT0 C;  1P3G A;  4Z2M H;  1AOI C;  3AYW B;  4H9R A;  3WTP A;  4J8W C;  2F8N D;  3KFU G;  1P3I B;  3EPJ A;  3W99 B;  3V9R B;  4Z66 C;  4XZQ D;  5CPI D;  5GSU A;  1KX3 A;  3AZF C;  5B33 A;  4WZS B;  5CPK C;  3AZE C;  3C1B B;  4KGC B;  1PZR A;  3AZI B;  2JCH A;  4KUD A;  2NZD C;  1BH9 B;  4ZUX A;  3UT9 C;  1P3A A;  1KX4 D;  1WWI A;  4XUJ C;  1U35 D;  4H9P A;  1B67 A;  1P3M D;  2IO5 C;  4J8U D;  5B24 C;  3REJ A;  1KX5 D;  3B6G B;  5AY8 C;  3LJA A;  2W8S A;  4YS3 C;  1P3G B;  4Z5T B;  5CP6 A;  3MNN B;  3REH A;  1EQZ C;  3WTP B;  1TZY B;  5E5A D;  3WKJ D;  3AV1 D;  1F1E A;  1M19 D;  2F8N A;  1P3P D;  5JA4 A;  5B1M D;  4XZQ A;  1KX3 B;  5CPI A;  4WU8 B;  5B33 B;  5F99 B;  3X1T A;  4YM6 C;  5KDM A;  4KUD B;  3X1S C;  4AWL C;  1P3A B;  1T3U A;  5FUG A;  3REI B;  5DNN C;  1KX4 A;  3H0M C;  1Q9C A;  3KWQ C;  3REJ B;  1U35 A;  4LD9 D;  5DNM D;  1P3M A;  2ARO C;  3LJA B;  1KX5 A;  3REK D;  5B40 C;  2Y2M A;  2G5I C;  4R8P C;  2LY8 A;  3A1I A;  4UUZ A;  4H9Q A;  3AZN D;  3W98 D;  3WKJ A;  2HUE C;  4G92 C;  5E5A A;  2CV5 C;  3AV1 A;  1P3K C;  2F8N B;  3KXB D;  1M19 A;  3F6T A;  5AV8 C;  3X1V C;  3UTB D;  4XZQ B;  5BS7 A;  1P3P A;  5JRG C;  5CPI B;  5G49 A;  2BYK A;  5B1M A;  4NE5 A;  3AZM D;  3AZH D;  1WWS A;  1P3O B;  4E44 A;  1P3L C;  1HQ3 C;  3WAA C;  3AZJ C;  4X23 C;  5KDM B;  3UTA A;  4CAY B;  2F8N G;  3AZL D;  5B32 D;  3NQU A;  3IP4 C;  1U35 B;  1P3M B;  4LD9 A;  4J8U B;  3AFA C;  5DNM A;  3LZ1 B;  3P5J B;  1KX5 B;  3EPK A;  1F66 D;  1JFI A;  3B6F C;  4WU9 B;  5AVB C;  3EPH A;  4ZBJ C;  5AV5 C;  3MGR C;  3WKJ B;  3MGP C;  1ID3 B;  1P3F D;  3W98 A;  3AZN A;  3AV1 B;  4DQY B;  2ZY2 A;  5B2J C;  1P3B D;  3O62 C;  1M19 B;  3KXB A;  4JJN B;  3MVD C;  1P34 B;  1P3P B;  5G49 B;  2BYK B;  5B1M B;  3X1U C;  3UTB A;  5B0Y D;  3MGQ C;  4KHA A;  3VH5 A;  1N1J A;  2NQB C;  5B1L C;  5AVC C;  3AZE D;  4M6B A;  3AZL A;  2RVQ C;  2YFV A;  4LD9 B;  4H9O B;  4ZUX D;  5DNM B;  1M18 D;  2NZD D;  3AYW C;  3UT9 D;  1ZLA D;  5GT0 D;  3REK B;  3C1C D;  1P3I C;  3W99 C;  3NQJ A;  5BNX B;  3W97 D;  2YFW B;  3W98 B;  3REL B;  3B0D B;  3A1K A;  3LEL D;  1P3F A;  5CP6 D;  3REH D;  5GT0 A;  1P3B A;  1EQZ D;  3C1B C;  3UTB B;  4KGC C;  3B0C T;  4HGA B;  4J8V D;  1AOI A;  3AZI C;  3WA9 D;  3AZM B;  5BNV B;  3AZH B;  5GT3 D;  4KHA B;  5B0Y A;  2Y2N A;  2Y2O A;  5CPJ D;  3B0C W;  3X1T D;  3AZL B;  3AV2 B;  3B6G C;  5CPK A;  3AZE A;  5B32 B;  2YFV B;  3VH6 T;  5GXQ B;  5AV9 B;  3X1S D;  3AZG B;  4Z5T C;  3AZK B;  3MNN C;  1M18 A;  3WTP C;  1TZY C;  5B2I D;  2NZD A;  1F66 B;  5DNN D;  3UT9 A;  1ZLA A;  3VH6 W;  2HIO B;  3C1C A;  2J8P A;  3NQJ B;  5B24 A;  3AN2 C;  4G91 B;  2BG1 A;  5B32 G;  3W96 D;  3W97 A;  4EO5 B;  3LZ0 D;  1KX3 C;  4WU8 C;  3EPL A;  3LEL A;  5B33 C;  5F99 C;  4YS3 A;  1P3B B;  4H9R B;  5CHL B;  2CV5 D;  1EQZ A;  1HTA A;  4KUD C;  1P3K D;  4J8V A;  3WA9 A;  2ZY3 A;  5B0Y B;  5GT3 A;  5GSU B;  5AV8 D;  1P3A C;  3REI C;  5CPJ A;  3REJ C;  3UTA D;  4CSR A;  3WAA D;  1BFM A;  4X23 D;  2FJ7 D;  3X1S A;  5C3I B;  4ZUX B;  1M18 B;  4H9P B;  2F2A C;  3H0R C;  5B2I A;  1ULY A;  1ZLA B;  5DNN A;  2PYO D;  3C1C B;  3KWQ A;  4J8X D;  1M1A D;  3W97 B;  5CPI C;  3W96 A;  3LZ0 A;  3LEL B;  1P3O C;  3B6F D;  5CP6 B;  3REH B;  5AVB D;  5B40 A;  4R8P A;  3A6N D;  1R4V A;  1EQZ B;  2XD5 A;  2G5H C;  4J8V B;  2CV5 A;  3WA9 B;  5GT3 B;  5JA4 B;  1P3K A;  5AV8 A;  5CPJ B;  5AV6 D;  1U35 C;  3KUY D;  4J8U C;  3X1T B;  3LZ1 C;  4CSR B;  1S32 D;  5BT1 D;  1KX5 C;  3MGS D;  3TU4 D;  3WAA A;  2NQB D;  4X23 A;  4DRB A;  4WU9 C;  2FJ7 A;  5FUG B;  3WKJ C;  1KX4 B;  1ID3 C;  5B2I B;  3AV1 C;  4UPK A;  4H9S A;  1M19 C;  2PYO A;  2ZY5 A;  3AL0 C;  4JJN C;  1P34 C;  4J8X A;  1M1A A;  5B1M C;  3W96 B;  3LZ0 B;  4UUZ B;  4QLC D;  4H9Q B;  3B6F A;  5AVB A;  5E5A B;  3A6N A;  3R45 A;  5B31 D;  4NE3 A;  2UWX A;  4WV4 B; 
#chains in the Genus database with same CATH homology
 2JE5 A;  1AOI D;  2RIQ A;  1KU5 A;  2FFF B;  5B0Z C;  4J8W D;  4H9N A;  4LD9 C;  5AV6 A;  2F8N H;  4Z66 D;  5DNM C;  3KUY A;  2Y2P A;  3UTA B;  3WAA B;  1S32 A;  4X23 B;  3AZF D;  3MGS A;  3REK C;  3TU4 A;  2NQB A;  5B1L A;  5CPK D;  2DF4 C;  2FJ7 B;  3NQU B;  3W98 C;  3REL C;  3B0D C;  2PYO B;  3MNN D;  3KSY A;  4J8X B;  2Y2I A;  1TZY D;  4XUJ D;  3UTB C;  1M1A B;  1JFI B;  4HGA C;  3AZM C;  5B24 D;  3AZH C;  3VH5 T;  4Z2M G;  4QLC A;  3A6N B;  3AZN B;  1A7W A;  5AY8 D;  3AN2 D;  3W99 A;  4NFT A;  5B31 A;  4YS3 D;  2L5A A;  3KXB B;  5F99 D;  1B6W A;  3AZL C;  2DQN C;  3AV2 C;  3VH5 W;  2CWE A;  5B32 C;  4H9N B;  4J8W A;  5GXQ C;  5AV6 B;  5AV9 C;  3AZG C;  3KUY B;  3AZK C;  4Z66 A;  1N1J B;  3H0L C;  1S32 B;  4WJ3 C;  1BH9 A;  2ZY4 A;  3MGS B;  3REI D;  3TU4 B;  1F66 C;  2HIO C;  3AZF A;  4G91 C;  4YM6 D;  1TAF A;  2ZM5 A;  1P3G C;  1P3B C;  3VH6 A;  4Z5T A;  2Y2H A;  3MNN A;  2Y2Q A;  1TZY A;  4XUJ A;  3KWQ D;  5B0Y C;  4QLC B;  5GSU C;  2ARO D;  1P3F B;  5B31 B;  3AN2 A;  5AY8 A;  5B40 D;  4R8P D;  5GT0 B;  2BYM A;  1P3O D;  4WU8 A;  5F99 A;  1AOI B;  4J8W B;  5C3I C;  4Z66 B;  4ZUX C;  3X1V D;  1M18 C;  5JRG D;  5B31 G;  1ZLA C;  1H3O A;  3REI A;  3AZF B;  3C1C C;  5CPK B;  1HQ3 D;  1P3L D;  3AZE B;  3LZ1 D;  3AZJ D;  3LJA C;  1TAF B;  3W97 C;  4YM6 A;  3LEL C;  4WU9 D;  5CP6 C;  3REH C;  2Y2L A;  2NZD B;  3UT9 B;  1ID3 D;  4XUJ B;  4J8V C;  2IO5 B;  3B0B A;  3WA9 C;  5B24 B;  3AFA D;  5GT3 C;  4XZQ C;  4JJN D;  1P34 D;  2ARO A;  3AN2 B;  5AY8 B;  5CPJ C;  2Y2K A;  2BYM B;  4YS3 B;  5AV5 D;  3X1T C;  1P3O A;  3MGR D;  3MGP D;  5B2J D;  4CAY A;  3O62 D;  3MVD D;  3X1V A;  1KX4 C;  5B2I C;  3X1U D;  1H3O B;  5B0Z D;  5JRG A;  1P3M C;  2JSS A;  3EG5 B;  3MGQ D;  4J8U A;  1P3L A;  1HQ3 A;  3LZ1 A;  3AZJ A;  5B1L D;  4YM6 B;  3W96 C;  3LZ0 C;  3X1S B;  4AWL B;  5AVC D;  4WU9 A;  2RVQ D;  5E5A C;  3REL D;  4DRA A;  5DNN B;  1ID3 A;  3KWQ B;  1Z2C B;  5BS7 C;  1P3P C;  3AFA A;  3AYW D;  2ARO B;  4NE6 A;  4JJN A;  1P34 A;  5B40 B;  4R8P B;  1P3I D;  3W99 D;  5AV5 A;  3UTA C;  3MGR A;  2HUE B;  3MGP A;  4G92 B;  2XD1 A;  2CV5 B;  4WNN A;  1P3K B;  2FJ7 C;  5B2J A;  3O62 A;  5AV8 B;  3X1V B;  3C1B D;  3AV2 D;  4KGC D;  3MVD A;  5JRG B;  4H9S C;  2Y2J A;  3AZI D;  3X1U A;  5GXQ D;  5B0Z A;  5AV9 D;  3AZG D;  2VQR A;  2PYO C;  1W2E A;  3WTP E;  3AZK D;  1HQ3 B;  4H9O A;  3MGQ A;  4J8X C;  3AZJ B;  1P3L B;  1M1A C;  5BO0 A;  2HIO D;  3REK A;  3B6G D;  4E45 A;  1BH8 A;  5AVC A;  3A6N C;  3AZN C;  2F8N K;  5BNX A;  2YFW A;  1P3G D;  3REL A;  4Z5T D;  3KXB C;  3AFA B;  3WTP D;  3AYW A;  5AV6 C;  3B6F B;  5AVB B;  3KUY C;  5BNV A;  3AZM A;  3R45 B;  4ZBJ B;  3V9R A;  5GSU D;  5AV5 B;  3AZH A;  3MGR B;  1P3I A;  1S32 C;  5BT1 C;  3MGP B;  1KX3 D;  2Y2G A;  4WU8 D;  3MGS C;  3TU4 C;  4WNN B;  5B33 D;  5B2J B;  3O62 B;  3FDD A;  3MVD B;  3C1B A;  3AV2 A;  3X1U B;  4KUD D;  5B0Z B;  4KGC A;  5B32 A;  3AZI A;  5GXQ A;  5AV9 A;  3MGQ B;  3AZG A;  1P3A D;  3AZK A;  5BO0 B;  2NQB B;  5B1L B;  3REJ D;  1F66 A;  1BH8 B;  2HIO A;  5AVC B;  4QLC C;  3LJA D;  3B6G A;  4EO5 C;  1P3F C;  5B31 C;  5GT0 C;  1P3G A;  4Z2M H;  1AOI C;  3AYW B;  4H9R A;  3WTP A;  4J8W C;  2F8N D;  3KFU G;  1P3I B;  3EPJ A;  3W99 B;  3V9R B;  4Z66 C;  4XZQ D;  5CPI D;  5GSU A;  1KX3 A;  3AZF C;  5B33 A;  4WZS B;  5CPK C;  3AZE C;  3C1B B;  4KGC B;  1PZR A;  3AZI B;  2JCH A;  4KUD A;  2NZD C;  1BH9 B;  4ZUX A;  3UT9 C;  1P3A A;  1KX4 D;  1WWI A;  4XUJ C;  1U35 D;  4H9P A;  1B67 A;  1P3M D;  2IO5 C;  4J8U D;  5B24 C;  3REJ A;  1KX5 D;  3B6G B;  5AY8 C;  3LJA A;  2W8S A;  4YS3 C;  1P3G B;  4Z5T B;  5CP6 A;  3MNN B;  3REH A;  1EQZ C;  3WTP B;  1TZY B;  5E5A D;  3WKJ D;  3AV1 D;  1F1E A;  1M19 D;  2F8N A;  1P3P D;  5JA4 A;  5B1M D;  4XZQ A;  1KX3 B;  5CPI A;  4WU8 B;  5B33 B;  5F99 B;  3X1T A;  4YM6 C;  5KDM A;  4KUD B;  3X1S C;  4AWL C;  1P3A B;  1T3U A;  5FUG A;  3REI B;  5DNN C;  1KX4 A;  3H0M C;  1Q9C A;  3KWQ C;  3REJ B;  1U35 A;  4LD9 D;  5DNM D;  1P3M A;  2ARO C;  3LJA B;  1KX5 A;  3REK D;  5B40 C;  2Y2M A;  2G5I C;  4R8P C;  2LY8 A;  3A1I A;  4UUZ A;  4H9Q A;  3AZN D;  3W98 D;  3WKJ A;  2HUE C;  4G92 C;  5E5A A;  2CV5 C;  3AV1 A;  1P3K C;  2F8N B;  3KXB D;  1M19 A;  3F6T A;  5AV8 C;  3X1V C;  3UTB D;  4XZQ B;  5BS7 A;  1P3P A;  5JRG C;  5CPI B;  5G49 A;  2BYK A;  5B1M A;  4NE5 A;  3AZM D;  3AZH D;  1WWS A;  1P3O B;  4E44 A;  1P3L C;  1HQ3 C;  3WAA C;  3AZJ C;  4X23 C;  5KDM B;  3UTA A;  4CAY B;  2F8N G;  3AZL D;  5B32 D;  3NQU A;  3IP4 C;  1U35 B;  1P3M B;  4LD9 A;  4J8U B;  3AFA C;  5DNM A;  3LZ1 B;  3P5J B;  1KX5 B;  3EPK A;  1F66 D;  1JFI A;  3B6F C;  4WU9 B;  5AVB C;  3EPH A;  4ZBJ C;  5AV5 C;  3MGR C;  3WKJ B;  3MGP C;  1ID3 B;  1P3F D;  3W98 A;  3AZN A;  3AV1 B;  4DQY B;  2ZY2 A;  5B2J C;  1P3B D;  3O62 C;  1M19 B;  3KXB A;  4JJN B;  3MVD C;  1P34 B;  1P3P B;  5G49 B;  2BYK B;  5B1M B;  3X1U C;  3UTB A;  5B0Y D;  3MGQ C;  4KHA A;  3VH5 A;  1N1J A;  2NQB C;  5B1L C;  5AVC C;  3AZE D;  4M6B A;  3AZL A;  2RVQ C;  2YFV A;  4LD9 B;  4H9O B;  4ZUX D;  5DNM B;  1M18 D;  2NZD D;  3AYW C;  3UT9 D;  1ZLA D;  5GT0 D;  3REK B;  3C1C D;  1P3I C;  3W99 C;  3NQJ A;  5BNX B;  3W97 D;  2YFW B;  3W98 B;  3REL B;  3B0D B;  3A1K A;  3LEL D;  1P3F A;  5CP6 D;  3REH D;  5GT0 A;  1P3B A;  1EQZ D;  3C1B C;  3UTB B;  4KGC C;  3B0C T;  4HGA B;  4J8V D;  1AOI A;  3AZI C;  3WA9 D;  3AZM B;  5BNV B;  3AZH B;  5GT3 D;  4KHA B;  5B0Y A;  2Y2N A;  2Y2O A;  5CPJ D;  3B0C W;  3X1T D;  3AZL B;  3AV2 B;  3B6G C;  5CPK A;  3AZE A;  5B32 B;  2YFV B;  3VH6 T;  5GXQ B;  5AV9 B;  3X1S D;  3AZG B;  4Z5T C;  3AZK B;  3MNN C;  1M18 A;  3WTP C;  1TZY C;  5B2I D;  2NZD A;  1F66 B;  5DNN D;  3UT9 A;  1ZLA A;  3VH6 W;  2HIO B;  3C1C A;  2J8P A;  3NQJ B;  5B24 A;  3AN2 C;  4G91 B;  2BG1 A;  5B32 G;  3W96 D;  3W97 A;  4EO5 B;  3LZ0 D;  1KX3 C;  4WU8 C;  3EPL A;  3LEL A;  5B33 C;  5F99 C;  4YS3 A;  1P3B B;  4H9R B;  5CHL B;  2CV5 D;  1EQZ A;  1HTA A;  4KUD C;  1P3K D;  4J8V A;  3WA9 A;  2ZY3 A;  5B0Y B;  5GT3 A;  5GSU B;  5AV8 D;  1P3A C;  3REI C;  5CPJ A;  3REJ C;  3UTA D;  4CSR A;  3WAA D;  1BFM A;  4X23 D;  2FJ7 D;  3X1S A;  5C3I B;  4ZUX B;  1M18 B;  4H9P B;  2F2A C;  3H0R C;  5B2I A;  1ULY A;  1ZLA B;  5DNN A;  2PYO D;  3C1C B;  3KWQ A;  4J8X D;  1M1A D;  3W97 B;  5CPI C;  3W96 A;  3LZ0 A;  3LEL B;  1P3O C;  3B6F D;  5CP6 B;  3REH B;  5AVB D;  5B40 A;  4R8P A;  3A6N D;  1R4V A;  1EQZ B;  2XD5 A;  2G5H C;  4J8V B;  2CV5 A;  3WA9 B;  5GT3 B;  5JA4 B;  1P3K A;  5AV8 A;  5CPJ B;  5AV6 D;  1U35 C;  3KUY D;  4J8U C;  3X1T B;  3LZ1 C;  4CSR B;  1S32 D;  5BT1 D;  1KX5 C;  3MGS D;  3TU4 D;  3WAA A;  2NQB D;  4X23 A;  4DRB A;  4WU9 C;  2FJ7 A;  5FUG B;  3WKJ C;  1KX4 B;  1ID3 C;  5B2I B;  3AV1 C;  4UPK A;  4H9S A;  1M19 C;  2PYO A;  2ZY5 A;  3AL0 C;  4JJN C;  1P34 C;  4J8X A;  1M1A A;  5B1M C;  3W96 B;  3LZ0 B;  4UUZ B;  4QLC D;  4H9Q B;  3B6F A;  5AVB A;  5E5A B;  3A6N A;  3R45 A;  5B31 D;  4NE3 A;  2UWX A;  4WV4 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...