5AV9C

Human nucleosome core particle
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
106
structure length
106
Chain Sequence
b'KAKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.1
publication title Intra- and inter-nucleosomal interactions of the histone H4 tail revealed with a human nucleosome core particle with genetically-incorporated H4 tetra-acetylation
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein/dna
total genus 32
structure length 106
sequence length 106
chains with identical sequence G
ec nomenclature
pdb deposition date 2015-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5av9C00
1TZYD 2JSSA 5B2ID 3LZ0B 1P3GA 4EO5C 3WTPE 1P3MC 3O62C 5AV8D 4H9NA 3UT9C 3AZFA 4WNNB 5CPIA 4J8UA 5AVCC 4KHAA 1BFMA 4E45A 1P3GD 5DNNC 3LJAA 3REJC 3AZFD 2CV5B 3AZLC 3B6FA 5B33A 2HIOC 5CPID 4J8UD 3UTBC 4EO5B 1P3MB 1P3OA 3LZ0A 3LJAD 1P3LC 5B1LC 5AVCB 2F8NH 4M6BA 4NFTA 3B6FD 5B33D 1KX4C 5FUGB 3REJB 4Z5TC 1P3OD 3LZ0D 3AZLB 5BT1D 3REIB 4Z66C 2HIOB 3UTBB 4WU8C 2CV5A 2NZDB 5CPKC 3X1TB 2RVQD 3AV2B 1M1AC 3WTPC 1P3MA 5BS7C 3AZJC 1KX4B 4WV4B 5AVCA 5GT3C 2CV5D 4G91B 3C1CC 5FUGA 5DNNA 3REJA 1HQ3B 1P3MD 3AZLA 5CPKB 3REIA 5B0YC 2HIOA 1KX5C 5BNXB 1TAFB 4HGAC 5AVCD 3WTPB 3UTBA 1P3BB 1M1AB 3AZJB 5DNND 3AV2A 1P3IC 3REJD 1P3LA 5B1LA 1KX3C 5GT3B 3AZLD 3AZMC 3REID 3C1CB 1KX4A 2PYOC 2HIOD 5DNMC 1ULYA 3UTBD 4H9PA 2CWEA 3AV2D 4UUZB 5B0ZC 1P3LD 5GSUB 5B0YB 1HQ3A 5B1LD 3MNNC 4HGAB 3X1UC 4WU8A 5CPKA 1A7WA 1KX4D 5BNXA 1TAFA 1M1AA 3WTPA 1B67A 1KX3B 3W96B 4KGCC 5BS7A 3AZJA 3AZMB 4X23C 1P3KC 2BYMB 2PYOB 1HQ3D 5DNMB 2L5AA 3VH5W 5GT3A 4WU8D 5B2IC 5CPKD 3C1CA 1M1AD 5B32C 3WTPD 3TU4C 3MNNB 3AZJD 4UUZA 4JJNB 3B0BA 5B0YA 1KX5A 5GT3D 3C1CD 1P3KB 3LELC 1P3IA 1KX3A 4H9SC 3W96A 5B2JC 2BYKB 5AV5C 5F99C 3AZMA 4Z2MH 2BYMA 2PYOA 5B0YD 1KX5D 5DNMA 4CAYA 5B32B 3TU4B 5B0ZA 1P3ID 1KX3D 3MNNA 5CPJC 3W96D 1WWIA 5C3IB 3X1UA 1BH8B 5B1MC 3AZMD 5AY8B 2PYOD 3AZHC 4JJNA 2IO5C 5DNMD 3LELB 5B2JB 4G92C 4KGCA 5F99B 5B0ZD 4X23A 1S32C 1P3KA 3MNND 1B6WA 3X1UD 2BYKA 5JRGC 4JJND 2F8NB 4H9RB 5B32A 3TU4A 5CPJB 4KGCD 3X1VB 1N1JB 3WA9C 5B1MB 1P3KD 4X23D 3AZHB 4J8XC 2IO5B 5CP6B 2CV5C 4YM6C 1BH8A 4G92B 5AY8A 4QLCB 4J8WB 1S32B 3LELA 5B32D 3TU4D 5G49B 5AVBC 3W99B 4H9SA 5B2JA 5AV5A 5F99A 5JRGB 3W97C 3KWQC 5AY8D 3WA9B 2F8NA 3LELD 4H9RA 4J8XB 3B6GC 3MGPB 5B2JD 5CPJA 2LY8A 5AV5D 1N1JA 4YM6B 5B1MA 5F99D 3REIC 3AZHA 1HTAA 5AVBB 3WAAC 2NZDC 3REHC 3X1TC 3AV2C 4QLCA 2F8ND 1S32A 4ZUXB 3W97B 5G49A 5CPJD 3W99A 3W98C 1M19C 5B1MD 3KWQB 5JRGA 4WNNA 5GT0B 3AZHD 3B6GB 3KUYC 4G91C 5CHLB 5AV6C 3WA9A 4QLCD 1S32D 1HQ3C 4J8XA 3W99D 3WAAB 4YM6A 3REHB 5GXQC 5JRGD 3AZKC 3X1SC 1P3BC 5AVBA 3W98B 1M19B 3WA9D 3W97A 4J8XD 1ZLAC 3KUYB 4YM6D 5AV6B 3KWQA 2NQBC 3VH5T 5AVBD 3B6GA 3AZEB 5E5AC 5GXQB 3AZKB 3X1SB 5GSUC 3W97D 3WAAA 4NE5A 2NZDA 3KWQD 3REHA 3X1TA 1BH9B 3B6GD 3W96C 1ZLAB 1M19A 3W98A 1EQZC 3MGRC 3AFAB 2NQBB 5BO0B 3WAAD 3KUYA 2NZDD 5AV6A 3REHD 3X1TD 1KU5A 5E5AB 3KXBC 3NQJB 1M19D 3W98D 5GXQA 4JJNC 3X1SA 3AZKA 1P3BA 3RELC 1P3PC 3KUYD 5AV6D 1EQZB 3MGRB 1BH9A 3AN2C 1WWSA 1R4VA 1ZLAA 5GXQD 3AZKD 3X1SD 1P34C 2NQBA 1P3BD 3A6NC 5BO0A 3KXBB 3AZGC 3MGQC 5E5AA 5GSUA 3RELB 1P3PB 3NQJA 5C3IC 1ZLAD 5AY8C 2NQBD 4XZQC 3VH6A 3AN2B 4AWLC 1EQZA 5E5AD 1P34B 3MGRA 5GSUD 3UTAC 3A6NB 3AZGB 3MGQB 4LD9B 1F1EA 4DRBA 1ID3B 3KXBA 4R8PB 3X1VC 1U35C 1EQZD 3MGRD 5CP6C 4XZQB 3RELA 1P3PA 4AWLB 5B24C 4QLCC 3MGSC 4J8WC 4J8VC 3R45B 4KUDC 3UTAB 3KXBD 3AN2A 3W99C 2YFWB 3AYWC 4YS3C 4DRAA 1P34A 1F66C 3RELD 1P3PD 3A6NA 3AZGA 1U35B 3MGQA 4LD9A 1ID3A 4XUJB 3AN2D 3MGPC 3C1BC 1P34D 5B24B 3MGSB 4J8VB 4KUDB 4XZQA 3A6ND 3AZGD 5B32G 3MGQD 4LD9D 3AYWB 3AZFB 2YFVB 4YS3B 1ID3D 1F66B 4ZUXC 3R45A 3UTAA 2YFWA 5GT0C 4XZQD 3X1VA 1U35A 3C1BB 4XUJA 3UTAD 5CP6A 2HUEB 5B24A 3MGSA 4J8WA 4J8VA 2F8NG 4KUDA 4E44A 3X1VD 1U35D 3AYWA 4YS3A 2YFVA 4WU9C 4XUJD 1F66A 5CP6D 5B24D 3MGSD 4J8VD 4J8WD 2F8NK 4KUDD 2AROC 3MGPA 3AYWD 4YS3D 3AZEC 3C1BA 1F66D 3O62B 4NE6A 3B0CT 2FJ7C 3UT9B 4WU9B 4ZUXA 3MGPD 1M18C 3AV1C 3C1BD 3B0DC 3AFAC 5GT0A 5DNNB 5AV9C 2AROB 4WZSB 3AZNC 3VH5A 4ZUXD 5GT0D 2FJ7B 1P3LB 5B1LB 3O62A 1M18B 3AV1B 3B0DB 3UT9A 4WU9A 5BNVB 5AV9B 1P3FC 4Z5TB 3AZNB 4H9PB 1Q9CA 3WKJC 4Z66B 2AROA 3O62D 5KDMB 4WU8B 3UT9D 3AZEA 4WU9D 3B0CW 4H9QB 5JA4B 3KSYA 2FJ7A 3MVDC 2AROD 1M18A 3AV1A 1P3FB 3AZED 1H3OB 3AFAA 5BNVA 5B31C 3LZ1C 3WKJB 5AV9A 4Z5TA 3AZNA 4LD9C 1ID3C 2FJ7D 4Z66A 4R8PC 1KX5B 3REKC 1M18D 3AV1D 1AOIC 5KDMA 3AFAD 3MVDB 5AV9D 1P3IB 4H9QA 4Z5TD 5JA4A 3AZND 3AZIC 4Z2MG 3NQUB 1P3AC 4H9OB 3V9RB 4Z66D 5B31B 3LZ1B 4CAYB 5B40C 1P3FA 1TZYC 1H3OA 5B0ZB 3WKJA 3REKB 1AOIB 5AV8C 3X1UB 4XUJC 1P3FD 3AZIB 3VH6T 1JFIB 4KGCB 1P3GC 1P3AB 3MVDA 4X23B 3WKJD 5B40B 3AZFC 1TZYB 3NQUA 5B2IB 4CSRB 4H9OA 3V9RA 5CPIC 5B31A 3LZ1A 4J8UC 4NE3A 4ZBJC 5AV8B 3MVDD 3LJAC 4R8PA 3REKA 1AOIA 3B6FC 5B33C 1P3GB 5B31D 3LZ1D 5B31G 1P3OC 3AZIA 2HUEC 1JFIA 4H9NB 5AV5B 3LZ0C 5BT1C 1P3AA 5CPIB 4R8PD 4J8UB 3REKD 5B40A 4KHAB 4ZBJB 1AOID 1TZYA 5B2IA 4CSRA 2RVQC 3LJAB 3AZID 5AV8A 3B6FB 5B33B 1P3AD 3VH6W 5B40D 1P3OB
chains in the Genus database with same CATH superfamily
1TZYD 2JSSA 5B2ID 3LZ0B 1P3GA 4EO5C 3WTPE 1P3MC 3O62C 5AV8D 4H9NA 3UT9C 3AZFA 4WNNB 5CPIA 4J8UA 5AVCC 4KHAA 1BFMA 4E45A 1P3GD 5DNNC 3LJAA 3REJC 3AZFD 2CV5B 3AZLC 3B6FA 5B33A 2HIOC 5CPID 4J8UD 3UTBC 4EO5B 1P3MB 1P3OA 3EPHA 3LZ0A 3LJAD 1P3LC 5B1LC 5AVCB 2F8NH 4M6BA 4NFTA 3B6FD 5B33D 1KX4C 5FUGB 2XD5A 3REJB 4Z5TC 1P3OD 3IP4C 3LZ0D 3AZLB 5BT1D 3REIB 4Z66C 2HIOB 3UTBB 4WU8C 2CV5A 2NZDB 5CPKC 3X1TB 2RVQD 2Y2LA 3AV2B 3KFUG 1M1AC 2Y2NA 3WTPC 1P3MA 5BS7C 3AZJC 1KX4B 4WV4B 1Z2CB 5AVCA 5GT3C 2CV5D 4G91B 3C1CC 5FUGA 5DNNA 3REJA 1HQ3B 1P3MD 3AZLA 1T3UA 5CPKB 3REIA 5B0YC 2HIOA 1KX5C 5BNXB 1TAFB 4HGAC 5AVCD 3WTPB 3UTBA 1P3BB 1M1AB 3AZJB 5DNND 3AV2A 1P3IC 3REJD 1P3LA 3FDDA 5B1LA 1KX3C 5GT3B 3AZLD 3AZMC 3REID 3C1CB 1KX4A 3P5JB 2PYOC 2HIOD 5DNMC 1ULYA 3UTBD 2JE5A 4H9PA 2CWEA 2BG1A 3AV2D 4UUZB 5B0ZC 1P3LD 5GSUB 5B0YB 1HQ3A 5B1LD 3MNNC 4HGAB 3X1UC 4WU8A 5CPKA 1A7WA 1KX4D 2XD1A 5BNXA 1TAFA 1M1AA 3WTPA 1B67A 1KX3B 3W96B 4KGCC 5BS7A 3AZJA 3AZMB 4X23C 1P3KC 2BYMB 2PYOB 1HQ3D 5DNMB 2L5AA 3VH5W 5GT3A 4WU8D 5B2IC 5CPKD 3C1CA 1M1AD 5B32C 3WTPD 3TU4C 3MNNB 3AZJD 4UUZA 4JJNB 3B0BA 5B0YA 1KX5A 5GT3D 3C1CD 1P3KB 3LELC 1P3IA 1KX3A 4H9SC 3W96A 5B2JC 2BYKB 5AV5C 5F99C 3AZMA 4Z2MH 2BYMA 2PYOA 5B0YD 2G5HC 1KX5D 5DNMA 4CAYA 5B32B 3TU4B 2J8PA 5B0ZA 1P3ID 1KX3D 3MNNA 5CPJC 3W96D 1WWIA 5C3IB 3X1UA 1BH8B 5B1MC 3AZMD 5AY8B 2PYOD 3AZHC 4JJNA 2IO5C 5DNMD 3LELB 5B2JB 2Y2IA 4G92C 4KGCA 5F99B 5B0ZD 4X23A 1S32C 1P3KA 3MNND 1B6WA 3X1UD 2BYKA 5JRGC 4JJND 2F8NB 4H9RB 5B32A 3TU4A 5CPJB 4KGCD 3X1VB 1N1JB 3WA9C 5B1MB 1P3KD 4X23D 3AZHB 4J8XC 2IO5B 5CP6B 2CV5C 4YM6C 1BH8A 4G92B 5AY8A 4QLCB 4J8WB 1S32B 3LELA 5B32D 3TU4D 5G49B 5AVBC 3W99B 4H9SA 5B2JA 5AV5A 5F99A 5JRGB 3W97C 3KWQC 5AY8D 3WA9B 2F8NA 3LELD 4H9RA 4J8XB 3B6GC 3MGPB 5B2JD 5CPJA 2LY8A 5AV5D 1N1JA 4YM6B 5B1MA 5F99D 3REIC 3AZHA 1HTAA 5AVBB 3WAAC 2NZDC 3REHC 3X1TC 3AV2C 4QLCA 2F8ND 1S32A 4ZUXB 3W97B 1PZRA 2JCHA 5G49A 5CPJD 3W98C 1M19C 3W99A 5B1MD 3KWQB 5GT0B 4WNNA 5JRGA 3AZHD 3B6GB 3KUYC 4G91C 5CHLB 5AV6C 3WA9A 4QLCD 1S32D 1HQ3C 4J8XA 3W99D 2ZY5A 3WAAB 4YM6A 3REHB 5GXQC 5JRGD 3AZKC 3X1SC 1P3BC 5AVBA 3W98B 1M19B 3WA9D 3W97A 4J8XD 1ZLAC 3KUYB 2ZM5A 4YM6D 5AV6B 3KWQA 2NQBC 3VH5T 2G5IC 5AVBD 3B6GA 3AZEB 5E5AC 5GXQB 3AZKB 3X1SB 5GSUC 3W97D 3WAAA 4NE5A 2NZDA 3KWQD 3REHA 3X1TA 1BH9B 3B6GD 3W96C 1ZLAB 1M19A 3W98A 1EQZC 2Y2JA 3MGRC 3AFAB 2NQBB 3H0MC 5BO0B 3WAAD 3KUYA 2NZDD 5AV6A 3REHD 3X1TD 1KU5A 5E5AB 3KXBC 3NQJB 1M19D 3W98D 4WJ3C 5GXQA 4JJNC 3X1SA 3AZKA 1P3BA 3RELC 1P3PC 3KUYD 5AV6D 1EQZB 3MGRB 1BH9A 3AN2C 1WWSA 1R4VA 1ZLAA 5GXQD 3AZKD 3X1SD 1P34C 2NQBA 1P3BD 3A6NC 5BO0A 3KXBB 3AZGC 3MGQC 5E5AA 5GSUA 3RELB 1P3PB 3NQJA 5C3IC 1ZLAD 5AY8C 2FFFB 2NQBD 4XZQC 3VH6A 3AN2B 4AWLC 1EQZA 5E5AD 1P34B 3MGRA 5GSUD 3UTAC 3A6NB 3AZGB 3MGQB 3H0RC 4LD9B 1F1EA 4DRBA 1ID3B 2Y2MA 3KXBA 4R8PB 3X1VC 1U35C 3EG5B 1EQZD 3MGRD 5CP6C 4XZQB 2Y2KA 3RELA 1P3PA 4AWLB 5B24C 4QLCC 3MGSC 4J8WC 4J8VC 3R45B 4KUDC 3UTAB 3KXBD 3AN2A 3W99C 2YFWB 3AYWC 4YS3C 4DRAA 1P34A 1F66C 3RELD 1P3PD 3A6NA 3AZGA 4UPKA 1U35B 3MGQA 4LD9A 1ID3A 4XUJB 3AN2D 3MGPC 3C1BC 1P34D 5B24B 3MGSB 4J8VB 4KUDB 4XZQA 3A6ND 3AZGD 5B32G 3MGQD 4LD9D 3AYWB 3AZFB 2YFVB 4YS3B 1ID3D 1F66B 4ZUXC 3R45A 3UTAA 2YFWA 3A1KA 5GT0C 4XZQD 3X1VA 1U35A 3C1BB 3EPJA 4XUJA 3UTAD 5CP6A 2HUEB 5B24A 3MGSA 4J8WA 4J8VA 2F8NG 2ZY4A 4KUDA 4E44A 3X1VD 1U35D 3AYWA 4YS3A 2YFVA 4WU9C 4XUJD 1F66A 5CP6D 2ZY2A 5B24D 3MGSD 4J8VD 4J8WD 2F8NK 4KUDD 2AROC 3MGPA 3AYWD 4YS3D 3AZEC 3C1BA 1F66D 3O62B 4NE6A 3B0CT 2FJ7C 3UT9B 4WU9B 4ZUXA 3MGPD 1M18C 3AV1C 3C1BD 3B0DC 2DF4C 2ZY3A 5GT0A 3AFAC 5DNNB 3AL0C 5AV9C 2AROB 4WZSB 3AZNC 3VH5A 2W8SA 4ZUXD 3EPKA 5GT0D 2FJ7B 1P3LB 5B1LB 3O62A 1M18B 3AV1B 3B0DB 3UT9A 4WU9A 5BNVB 5AV9B 1P3FC 4Z5TB 3AZNB 4H9PB 1Q9CA 3WKJC 4Z66B 2AROA 3A1IA 3O62D 5KDMB 4WU8B 3UT9D 3AZEA 2Y2QA 4WU9D 3B0CW 4H9QB 5JA4B 3KSYA 2FJ7A 2F2AC 3MVDC 1W2EA 2AROD 1M18A 3AV1A 1P3FB 3AZED 1H3OB 3AFAA 3EPLA 5BNVA 5B31C 3LZ1C 3WKJB 5AV9A 3H0LC 4Z5TA 3AZNA 4LD9C 1ID3C 2FJ7D 2Y2PA 4Z66A 4R8PC 1KX5B 3REKC 1M18D 3AV1D 1AOIC 5KDMA 3AFAD 3MVDB 5AV9D 1P3IB 4H9QA 4Z5TD 5JA4A 3AZND 3AZIC 4Z2MG 3NQUB 1P3AC 4H9OB 3V9RB 4Z66D 5B31B 3LZ1B 4CAYB 5B40C 1P3FA 1TZYC 1H3OA 4DQYB 5B0ZB 3WKJA 3REKB 1AOIB 5AV8C 3X1UB 4XUJC 1P3FD 3AZIB 3VH6T 1JFIB 4KGCB 2RIQA 1P3AB 3MVDA 4X23B 1P3GC 3WKJD 2Y2OA 2Y2HA 5B40B 3F6TA 3AZFC 1TZYB 2UWXA 3NQUA 2DQNC 5B2IB 4CSRB 4H9OA 3V9RA 5CPIC 5B31A 3LZ1A 4J8UC 2Y2GA 4NE3A 4ZBJC 5AV8B 3MVDD 3LJAC 4R8PA 3REKA 1AOIA 3B6FC 5B33C 2VQRA 1P3GB 5B31D 3LZ1D 5B31G 1P3OC 3AZIA 2HUEC 1JFIA 4H9NB 5AV5B 3LZ0C 5BT1C 1P3AA 5CPIB 4R8PD 4J8UB 3REKD 5B40A 4KHAB 4ZBJB 1AOID 1TZYA 5B2IA 4CSRA 2RVQC 3LJAB 3AZID 5AV8A 3B6FB 5B33B 1P3AD 3VH6W 5B40D 1P3OB
chains in the Genus database with same CATH topology
1TZYD 2JSSA 5B2ID 3LZ0B 1P3GA 4EO5C 3WTPE 1P3MC 3O62C 5AV8D 4H9NA 3UT9C 3AZFA 4WNNB 5CPIA 4J8UA 5AVCC 4KHAA 1BFMA 4E45A 1P3GD 5DNNC 3LJAA 3REJC 3AZFD 2CV5B 3AZLC 3B6FA 5B33A 2HIOC 5CPID 4J8UD 3UTBC 4EO5B 1P3MB 1P3OA 3EPHA 3LZ0A 3LJAD 1P3LC 5B1LC 5AVCB 2F8NH 4M6BA 4NFTA 3B6FD 5B33D 1KX4C 5FUGB 2XD5A 3REJB 4Z5TC 1P3OD 3IP4C 3LZ0D 3AZLB 5BT1D 3REIB 4Z66C 2HIOB 3UTBB 4WU8C 2CV5A 2NZDB 5CPKC 3X1TB 2RVQD 2Y2LA 3AV2B 3KFUG 1M1AC 2Y2NA 3WTPC 1P3MA 5BS7C 3AZJC 1KX4B 4WV4B 1Z2CB 5AVCA 5GT3C 2CV5D 4G91B 3C1CC 5FUGA 5DNNA 3REJA 1HQ3B 1P3MD 3AZLA 1T3UA 5CPKB 3REIA 5B0YC 2HIOA 1KX5C 5BNXB 1TAFB 4HGAC 5AVCD 3WTPB 3UTBA 1P3BB 1M1AB 3AZJB 5DNND 3AV2A 1P3IC 3REJD 1P3LA 3FDDA 5B1LA 1KX3C 5GT3B 3AZLD 3AZMC 3REID 3C1CB 1KX4A 3P5JB 2PYOC 2HIOD 5DNMC 1ULYA 3UTBD 2JE5A 4H9PA 2CWEA 2BG1A 3AV2D 4UUZB 5B0ZC 1P3LD 5GSUB 5B0YB 1HQ3A 5B1LD 3MNNC 4HGAB 3X1UC 4WU8A 5CPKA 1A7WA 1KX4D 2XD1A 5BNXA 1TAFA 1M1AA 3WTPA 1B67A 1KX3B 3W96B 4KGCC 5BS7A 3AZJA 3AZMB 4X23C 1P3KC 2BYMB 2PYOB 1HQ3D 5DNMB 2L5AA 3VH5W 5GT3A 4WU8D 5B2IC 5CPKD 3C1CA 1M1AD 5B32C 3WTPD 3TU4C 3MNNB 3AZJD 4UUZA 4JJNB 3B0BA 5B0YA 1KX5A 5GT3D 3C1CD 1P3KB 3LELC 1P3IA 1KX3A 4H9SC 3W96A 5B2JC 2BYKB 5AV5C 5F99C 3AZMA 4Z2MH 2BYMA 2PYOA 5B0YD 2G5HC 1KX5D 5DNMA 4CAYA 5B32B 3TU4B 2J8PA 5B0ZA 1P3ID 1KX3D 3MNNA 5CPJC 3W96D 1WWIA 5C3IB 3X1UA 1BH8B 5B1MC 3AZMD 5AY8B 2PYOD 3AZHC 4JJNA 2IO5C 5DNMD 3LELB 5B2JB 2Y2IA 4G92C 4KGCA 5F99B 5B0ZD 4X23A 1S32C 1P3KA 3MNND 1B6WA 3X1UD 2BYKA 5JRGC 4JJND 2F8NB 4H9RB 5B32A 3TU4A 5CPJB 4KGCD 3X1VB 1N1JB 3WA9C 5B1MB 1P3KD 4X23D 3AZHB 4J8XC 2IO5B 5CP6B 2CV5C 4YM6C 1BH8A 4G92B 5AY8A 4QLCB 4J8WB 1S32B 3LELA 5B32D 3TU4D 5G49B 5AVBC 3W99B 4H9SA 5B2JA 5AV5A 5F99A 5JRGB 3W97C 3KWQC 5AY8D 3WA9B 2F8NA 3LELD 4H9RA 4J8XB 3B6GC 3MGPB 5B2JD 5CPJA 2LY8A 5AV5D 1N1JA 4YM6B 5B1MA 5F99D 3REIC 3AZHA 1HTAA 5AVBB 3WAAC 2NZDC 3REHC 3X1TC 3AV2C 4QLCA 2F8ND 1S32A 4ZUXB 3W97B 1PZRA 2JCHA 5G49A 5CPJD 3W98C 1M19C 3W99A 5B1MD 3KWQB 5GT0B 4WNNA 5JRGA 3AZHD 3B6GB 3KUYC 4G91C 5CHLB 5AV6C 3WA9A 4QLCD 1S32D 1HQ3C 4J8XA 3W99D 2ZY5A 3WAAB 4YM6A 3REHB 5GXQC 5JRGD 3AZKC 3X1SC 1P3BC 5AVBA 3W98B 1M19B 3WA9D 3W97A 4J8XD 1ZLAC 3KUYB 2ZM5A 4YM6D 5AV6B 3KWQA 2NQBC 3VH5T 2G5IC 5AVBD 3B6GA 3AZEB 5E5AC 5GXQB 3AZKB 3X1SB 5GSUC 3W97D 3WAAA 4NE5A 2NZDA 3KWQD 3REHA 3X1TA 1BH9B 3B6GD 3W96C 1ZLAB 1M19A 3W98A 1EQZC 2Y2JA 3MGRC 3AFAB 2NQBB 3H0MC 5BO0B 3WAAD 3KUYA 2NZDD 5AV6A 3REHD 3X1TD 1KU5A 5E5AB 3KXBC 3NQJB 1M19D 3W98D 4WJ3C 5GXQA 4JJNC 3X1SA 3AZKA 1P3BA 3RELC 1P3PC 3KUYD 5AV6D 1EQZB 3MGRB 1BH9A 3AN2C 1WWSA 1R4VA 1ZLAA 5GXQD 3AZKD 3X1SD 1P34C 2NQBA 1P3BD 3A6NC 5BO0A 3KXBB 3AZGC 3MGQC 5E5AA 5GSUA 3RELB 1P3PB 3NQJA 5C3IC 1ZLAD 5AY8C 2FFFB 2NQBD 4XZQC 3VH6A 3AN2B 4AWLC 1EQZA 5E5AD 1P34B 3MGRA 5GSUD 3UTAC 3A6NB 3AZGB 3MGQB 3H0RC 4LD9B 1F1EA 4DRBA 1ID3B 2Y2MA 3KXBA 4R8PB 3X1VC 1U35C 3EG5B 1EQZD 3MGRD 5CP6C 4XZQB 2Y2KA 3RELA 1P3PA 4AWLB 5B24C 4QLCC 3MGSC 4J8WC 4J8VC 3R45B 4KUDC 3UTAB 3KXBD 3AN2A 3W99C 2YFWB 3AYWC 4YS3C 4DRAA 1P34A 1F66C 3RELD 1P3PD 3A6NA 3AZGA 4UPKA 1U35B 3MGQA 4LD9A 1ID3A 4XUJB 3AN2D 3MGPC 3C1BC 1P34D 5B24B 3MGSB 4J8VB 4KUDB 4XZQA 3A6ND 3AZGD 5B32G 3MGQD 4LD9D 3AYWB 3AZFB 2YFVB 4YS3B 1ID3D 1F66B 4ZUXC 3R45A 3UTAA 2YFWA 3A1KA 5GT0C 4XZQD 3X1VA 1U35A 3C1BB 3EPJA 4XUJA 3UTAD 5CP6A 2HUEB 5B24A 3MGSA 4J8WA 4J8VA 2F8NG 2ZY4A 4KUDA 4E44A 3X1VD 1U35D 3AYWA 4YS3A 2YFVA 4WU9C 4XUJD 1F66A 5CP6D 2ZY2A 5B24D 3MGSD 4J8VD 4J8WD 2F8NK 4KUDD 2AROC 3MGPA 3AYWD 4YS3D 3AZEC 3C1BA 1F66D 3O62B 4NE6A 3B0CT 2FJ7C 3UT9B 4WU9B 4ZUXA 3MGPD 1M18C 3AV1C 3C1BD 3B0DC 2DF4C 2ZY3A 5GT0A 3AFAC 5DNNB 3AL0C 5AV9C 2AROB 4WZSB 3AZNC 3VH5A 2W8SA 4ZUXD 3EPKA 5GT0D 2FJ7B 1P3LB 5B1LB 3O62A 1M18B 3AV1B 3B0DB 3UT9A 4WU9A 5BNVB 5AV9B 1P3FC 4Z5TB 3AZNB 4H9PB 1Q9CA 3WKJC 4Z66B 2AROA 3A1IA 3O62D 5KDMB 4WU8B 3UT9D 3AZEA 2Y2QA 4WU9D 3B0CW 4H9QB 5JA4B 3KSYA 2FJ7A 2F2AC 3MVDC 1W2EA 2AROD 1M18A 3AV1A 1P3FB 3AZED 1H3OB 3AFAA 3EPLA 5BNVA 5B31C 3LZ1C 3WKJB 5AV9A 3H0LC 4Z5TA 3AZNA 4LD9C 1ID3C 2FJ7D 2Y2PA 4Z66A 4R8PC 1KX5B 3REKC 1M18D 3AV1D 1AOIC 5KDMA 3AFAD 3MVDB 5AV9D 1P3IB 4H9QA 4Z5TD 5JA4A 3AZND 3AZIC 4Z2MG 3NQUB 1P3AC 4H9OB 3V9RB 4Z66D 5B31B 3LZ1B 4CAYB 5B40C 1P3FA 1TZYC 1H3OA 4DQYB 5B0ZB 3WKJA 3REKB 1AOIB 5AV8C 3X1UB 4XUJC 1P3FD 3AZIB 3VH6T 1JFIB 4KGCB 2RIQA 1P3AB 3MVDA 4X23B 1P3GC 3WKJD 2Y2OA 2Y2HA 5B40B 3F6TA 3AZFC 1TZYB 2UWXA 3NQUA 2DQNC 5B2IB 4CSRB 4H9OA 3V9RA 5CPIC 5B31A 3LZ1A 4J8UC 2Y2GA 4NE3A 4ZBJC 5AV8B 3MVDD 3LJAC 4R8PA 3REKA 1AOIA 3B6FC 5B33C 2VQRA 1P3GB 5B31D 3LZ1D 5B31G 1P3OC 3AZIA 2HUEC 1JFIA 4H9NB 5AV5B 3LZ0C 5BT1C 1P3AA 5CPIB 4R8PD 4J8UB 3REKD 5B40A 4KHAB 4ZBJB 1AOID 1TZYA 5B2IA 4CSRA 2RVQC 3LJAB 3AZID 5AV8A 3B6FB 5B33B 1P3AD 3VH6W 5B40D 1P3OB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TZY D;  2JSS A;  5B2I D;  3LZ0 B;  1P3G A;  4EO5 C;  3WTP E;  1P3M C;  3O62 C;  5AV8 D;  4H9N A;  3UT9 C;  3AZF A;  4WNN B;  5CPI A;  4J8U A;  5AVC C;  4KHA A;  1BFM A;  4E45 A;  1P3G D;  5DNN C;  3LJA A;  3REJ C;  3AZF D;  2CV5 B;  3AZL C;  3B6F A;  5B33 A;  2HIO C;  5CPI D;  4J8U D;  3UTB C;  4EO5 B;  1P3M B;  1P3O A;  3LZ0 A;  3LJA D;  1P3L C;  5B1L C;  5AVC B;  2F8N H;  4M6B A;  4NFT A;  3B6F D;  5B33 D;  1KX4 C;  5FUG B;  3REJ B;  4Z5T C;  1P3O D;  3LZ0 D;  3AZL B;  5BT1 D;  3REI B;  4Z66 C;  2HIO B;  3UTB B;  4WU8 C;  2CV5 A;  2NZD B;  5CPK C;  3X1T B;  2RVQ D;  3AV2 B;  1M1A C;  3WTP C;  1P3M A;  5BS7 C;  3AZJ C;  1KX4 B;  4WV4 B;  5AVC A;  5GT3 C;  2CV5 D;  4G91 B;  3C1C C;  5FUG A;  5DNN A;  3REJ A;  1HQ3 B;  1P3M D;  3AZL A;  5CPK B;  3REI A;  5B0Y C;  2HIO A;  1KX5 C;  5BNX B;  1TAF B;  4HGA C;  5AVC D;  3WTP B;  3UTB A;  1P3B B;  1M1A B;  3AZJ B;  5DNN D;  3AV2 A;  1P3I C;  3REJ D;  1P3L A;  5B1L A;  1KX3 C;  5GT3 B;  3AZL D;  3AZM C;  3REI D;  3C1C B;  1KX4 A;  2PYO C;  2HIO D;  5DNM C;  1ULY A;  3UTB D;  4H9P A;  2CWE A;  3AV2 D;  4UUZ B;  5B0Z C;  1P3L D;  5GSU B;  5B0Y B;  1HQ3 A;  5B1L D;  3MNN C;  4HGA B;  3X1U C;  4WU8 A;  5CPK A;  1A7W A;  1KX4 D;  5BNX A;  1TAF A;  1M1A A;  3WTP A;  1B67 A;  1KX3 B;  3W96 B;  4KGC C;  5BS7 A;  3AZJ A;  3AZM B;  4X23 C;  1P3K C;  2BYM B;  2PYO B;  1HQ3 D;  5DNM B;  2L5A A;  3VH5 W;  5GT3 A;  4WU8 D;  5B2I C;  5CPK D;  3C1C A;  1M1A D;  5B32 C;  3WTP D;  3TU4 C;  3MNN B;  3AZJ D;  4UUZ A;  4JJN B;  3B0B A;  5B0Y A;  1KX5 A;  5GT3 D;  3C1C D;  1P3K B;  3LEL C;  1P3I A;  1KX3 A;  4H9S C;  3W96 A;  5B2J C;  2BYK B;  5AV5 C;  5F99 C;  3AZM A;  4Z2M H;  2BYM A;  2PYO A;  5B0Y D;  1KX5 D;  5DNM A;  4CAY A;  5B32 B;  3TU4 B;  5B0Z A;  1P3I D;  1KX3 D;  3MNN A;  5CPJ C;  3W96 D;  1WWI A;  5C3I B;  3X1U A;  1BH8 B;  5B1M C;  3AZM D;  5AY8 B;  2PYO D;  3AZH C;  4JJN A;  2IO5 C;  5DNM D;  3LEL B;  5B2J B;  4G92 C;  4KGC A;  5F99 B;  5B0Z D;  4X23 A;  1S32 C;  1P3K A;  3MNN D;  1B6W A;  3X1U D;  2BYK A;  5JRG C;  4JJN D;  2F8N B;  4H9R B;  5B32 A;  3TU4 A;  5CPJ B;  4KGC D;  3X1V B;  1N1J B;  3WA9 C;  5B1M B;  1P3K D;  4X23 D;  3AZH B;  4J8X C;  2IO5 B;  5CP6 B;  2CV5 C;  4YM6 C;  1BH8 A;  4G92 B;  5AY8 A;  4QLC B;  4J8W B;  1S32 B;  3LEL A;  5B32 D;  3TU4 D;  5G49 B;  5AVB C;  3W99 B;  4H9S A;  5B2J A;  5AV5 A;  5F99 A;  5JRG B;  3W97 C;  3KWQ C;  5AY8 D;  3WA9 B;  2F8N A;  3LEL D;  4H9R A;  4J8X B;  3B6G C;  3MGP B;  5B2J D;  5CPJ A;  2LY8 A;  5AV5 D;  1N1J A;  4YM6 B;  5B1M A;  5F99 D;  3REI C;  3AZH A;  1HTA A;  5AVB B;  3WAA C;  2NZD C;  3REH C;  3X1T C;  3AV2 C;  4QLC A;  2F8N D;  1S32 A;  4ZUX B;  3W97 B;  5G49 A;  5CPJ D;  3W99 A;  3W98 C;  1M19 C;  5B1M D;  3KWQ B;  5JRG A;  4WNN A;  5GT0 B;  3AZH D;  3B6G B;  3KUY C;  4G91 C;  5CHL B;  5AV6 C;  3WA9 A;  4QLC D;  1S32 D;  1HQ3 C;  4J8X A;  3W99 D;  3WAA B;  4YM6 A;  3REH B;  5GXQ C;  5JRG D;  3AZK C;  3X1S C;  1P3B C;  5AVB A;  3W98 B;  1M19 B;  3WA9 D;  3W97 A;  4J8X D;  1ZLA C;  3KUY B;  4YM6 D;  5AV6 B;  3KWQ A;  2NQB C;  3VH5 T;  5AVB D;  3B6G A;  3AZE B;  5E5A C;  5GXQ B;  3AZK B;  3X1S B;  5GSU C;  3W97 D;  3WAA A;  4NE5 A;  2NZD A;  3KWQ D;  3REH A;  3X1T A;  1BH9 B;  3B6G D;  3W96 C;  1ZLA B;  1M19 A;  3W98 A;  1EQZ C;  3MGR C;  3AFA B;  2NQB B;  5BO0 B;  3WAA D;  3KUY A;  2NZD D;  5AV6 A;  3REH D;  3X1T D;  1KU5 A;  5E5A B;  3KXB C;  3NQJ B;  1M19 D;  3W98 D;  5GXQ A;  4JJN C;  3X1S A;  3AZK A;  1P3B A;  3REL C;  1P3P C;  3KUY D;  5AV6 D;  1EQZ B;  3MGR B;  1BH9 A;  3AN2 C;  1WWS A;  1R4V A;  1ZLA A;  5GXQ D;  3AZK D;  3X1S D;  1P34 C;  2NQB A;  1P3B D;  3A6N C;  5BO0 A;  3KXB B;  3AZG C;  3MGQ C;  5E5A A;  5GSU A;  3REL B;  1P3P B;  3NQJ A;  5C3I C;  1ZLA D;  5AY8 C;  2NQB D;  4XZQ C;  3VH6 A;  3AN2 B;  4AWL C;  1EQZ A;  5E5A D;  1P34 B;  3MGR A;  5GSU D;  3UTA C;  3A6N B;  3AZG B;  3MGQ B;  4LD9 B;  1F1E A;  4DRB A;  1ID3 B;  3KXB A;  4R8P B;  3X1V C;  1U35 C;  1EQZ D;  3MGR D;  5CP6 C;  4XZQ B;  3REL A;  1P3P A;  4AWL B;  5B24 C;  4QLC C;  3MGS C;  4J8W C;  4J8V C;  3R45 B;  4KUD C;  3UTA B;  3KXB D;  3AN2 A;  3W99 C;  2YFW B;  3AYW C;  4YS3 C;  4DRA A;  1P34 A;  1F66 C;  3REL D;  1P3P D;  3A6N A;  3AZG A;  1U35 B;  3MGQ A;  4LD9 A;  1ID3 A;  4XUJ B;  3AN2 D;  3MGP C;  3C1B C;  1P34 D;  5B24 B;  3MGS B;  4J8V B;  4KUD B;  4XZQ A;  3A6N D;  3AZG D;  5B32 G;  3MGQ D;  4LD9 D;  3AYW B;  3AZF B;  2YFV B;  4YS3 B;  1ID3 D;  1F66 B;  4ZUX C;  3R45 A;  3UTA A;  2YFW A;  5GT0 C;  4XZQ D;  3X1V A;  1U35 A;  3C1B B;  4XUJ A;  3UTA D;  5CP6 A;  2HUE B;  5B24 A;  3MGS A;  4J8W A;  4J8V A;  2F8N G;  4KUD A;  4E44 A;  3X1V D;  1U35 D;  3AYW A;  4YS3 A;  2YFV A;  4WU9 C;  4XUJ D;  1F66 A;  5CP6 D;  5B24 D;  3MGS D;  4J8V D;  4J8W D;  2F8N K;  4KUD D;  2ARO C;  3MGP A;  3AYW D;  4YS3 D;  3AZE C;  3C1B A;  1F66 D;  3O62 B;  4NE6 A;  3B0C T;  2FJ7 C;  3UT9 B;  4WU9 B;  4ZUX A;  3MGP D;  1M18 C;  3AV1 C;  3C1B D;  3B0D C;  3AFA C;  5GT0 A;  5DNN B;  5AV9 C;  2ARO B;  4WZS B;  3AZN C;  3VH5 A;  4ZUX D;  5GT0 D;  2FJ7 B;  1P3L B;  5B1L B;  3O62 A;  1M18 B;  3AV1 B;  3B0D B;  3UT9 A;  4WU9 A;  5BNV B;  5AV9 B;  1P3F C;  4Z5T B;  3AZN B;  4H9P B;  1Q9C A;  3WKJ C;  4Z66 B;  2ARO A;  3O62 D;  5KDM B;  4WU8 B;  3UT9 D;  3AZE A;  4WU9 D;  3B0C W;  4H9Q B;  5JA4 B;  3KSY A;  2FJ7 A;  3MVD C;  2ARO D;  1M18 A;  3AV1 A;  1P3F B;  3AZE D;  1H3O B;  3AFA A;  5BNV A;  5B31 C;  3LZ1 C;  3WKJ B;  5AV9 A;  4Z5T A;  3AZN A;  4LD9 C;  1ID3 C;  2FJ7 D;  4Z66 A;  4R8P C;  1KX5 B;  3REK C;  1M18 D;  3AV1 D;  1AOI C;  5KDM A;  3AFA D;  3MVD B;  5AV9 D;  1P3I B;  4H9Q A;  4Z5T D;  5JA4 A;  3AZN D;  3AZI C;  4Z2M G;  3NQU B;  1P3A C;  4H9O B;  3V9R B;  4Z66 D;  5B31 B;  3LZ1 B;  4CAY B;  5B40 C;  1P3F A;  1TZY C;  1H3O A;  5B0Z B;  3WKJ A;  3REK B;  1AOI B;  5AV8 C;  3X1U B;  4XUJ C;  1P3F D;  3AZI B;  3VH6 T;  1JFI B;  4KGC B;  1P3G C;  1P3A B;  3MVD A;  4X23 B;  3WKJ D;  5B40 B;  3AZF C;  1TZY B;  3NQU A;  5B2I B;  4CSR B;  4H9O A;  3V9R A;  5CPI C;  5B31 A;  3LZ1 A;  4J8U C;  4NE3 A;  4ZBJ C;  5AV8 B;  3MVD D;  3LJA C;  4R8P A;  3REK A;  1AOI A;  3B6F C;  5B33 C;  1P3G B;  5B31 D;  3LZ1 D;  5B31 G;  1P3O C;  3AZI A;  2HUE C;  1JFI A;  4H9N B;  5AV5 B;  3LZ0 C;  5BT1 C;  1P3A A;  5CPI B;  4R8P D;  4J8U B;  3REK D;  5B40 A;  4KHA B;  4ZBJ B;  1AOI D;  1TZY A;  5B2I A;  4CSR A;  2RVQ C;  3LJA B;  3AZI D;  5AV8 A;  3B6F B;  5B33 B;  1P3A D;  3VH6 W;  5B40 D;  1P3O B; 
#chains in the Genus database with same CATH topology
 1TZY D;  2JSS A;  5B2I D;  3LZ0 B;  1P3G A;  4EO5 C;  3WTP E;  1P3M C;  3O62 C;  5AV8 D;  4H9N A;  3UT9 C;  3AZF A;  4WNN B;  5CPI A;  4J8U A;  5AVC C;  4KHA A;  1BFM A;  4E45 A;  1P3G D;  5DNN C;  3LJA A;  3REJ C;  3AZF D;  2CV5 B;  3AZL C;  3B6F A;  5B33 A;  2HIO C;  5CPI D;  4J8U D;  3UTB C;  4EO5 B;  1P3M B;  1P3O A;  3EPH A;  3LZ0 A;  3LJA D;  1P3L C;  5B1L C;  5AVC B;  2F8N H;  4M6B A;  4NFT A;  3B6F D;  5B33 D;  1KX4 C;  5FUG B;  2XD5 A;  3REJ B;  4Z5T C;  1P3O D;  3IP4 C;  3LZ0 D;  3AZL B;  5BT1 D;  3REI B;  4Z66 C;  2HIO B;  3UTB B;  4WU8 C;  2CV5 A;  2NZD B;  5CPK C;  3X1T B;  2RVQ D;  2Y2L A;  3AV2 B;  3KFU G;  1M1A C;  2Y2N A;  3WTP C;  1P3M A;  5BS7 C;  3AZJ C;  1KX4 B;  4WV4 B;  1Z2C B;  5AVC A;  5GT3 C;  2CV5 D;  4G91 B;  3C1C C;  5FUG A;  5DNN A;  3REJ A;  1HQ3 B;  1P3M D;  3AZL A;  1T3U A;  5CPK B;  3REI A;  5B0Y C;  2HIO A;  1KX5 C;  5BNX B;  1TAF B;  4HGA C;  5AVC D;  3WTP B;  3UTB A;  1P3B B;  1M1A B;  3AZJ B;  5DNN D;  3AV2 A;  1P3I C;  3REJ D;  1P3L A;  3FDD A;  5B1L A;  1KX3 C;  5GT3 B;  3AZL D;  3AZM C;  3REI D;  3C1C B;  1KX4 A;  3P5J B;  2PYO C;  2HIO D;  5DNM C;  1ULY A;  3UTB D;  2JE5 A;  4H9P A;  2CWE A;  2BG1 A;  3AV2 D;  4UUZ B;  5B0Z C;  1P3L D;  5GSU B;  5B0Y B;  1HQ3 A;  5B1L D;  3MNN C;  4HGA B;  3X1U C;  4WU8 A;  5CPK A;  1A7W A;  1KX4 D;  2XD1 A;  5BNX A;  1TAF A;  1M1A A;  3WTP A;  1B67 A;  1KX3 B;  3W96 B;  4KGC C;  5BS7 A;  3AZJ A;  3AZM B;  4X23 C;  1P3K C;  2BYM B;  2PYO B;  1HQ3 D;  5DNM B;  2L5A A;  3VH5 W;  5GT3 A;  4WU8 D;  5B2I C;  5CPK D;  3C1C A;  1M1A D;  5B32 C;  3WTP D;  3TU4 C;  3MNN B;  3AZJ D;  4UUZ A;  4JJN B;  3B0B A;  5B0Y A;  1KX5 A;  5GT3 D;  3C1C D;  1P3K B;  3LEL C;  1P3I A;  1KX3 A;  4H9S C;  3W96 A;  5B2J C;  2BYK B;  5AV5 C;  5F99 C;  3AZM A;  4Z2M H;  2BYM A;  2PYO A;  5B0Y D;  2G5H C;  1KX5 D;  5DNM A;  4CAY A;  5B32 B;  3TU4 B;  2J8P A;  5B0Z A;  1P3I D;  1KX3 D;  3MNN A;  5CPJ C;  3W96 D;  1WWI A;  5C3I B;  3X1U A;  1BH8 B;  5B1M C;  3AZM D;  5AY8 B;  2PYO D;  3AZH C;  4JJN A;  2IO5 C;  5DNM D;  3LEL B;  5B2J B;  2Y2I A;  4G92 C;  4KGC A;  5F99 B;  5B0Z D;  4X23 A;  1S32 C;  1P3K A;  3MNN D;  1B6W A;  3X1U D;  2BYK A;  5JRG C;  4JJN D;  2F8N B;  4H9R B;  5B32 A;  3TU4 A;  5CPJ B;  4KGC D;  3X1V B;  1N1J B;  3WA9 C;  5B1M B;  1P3K D;  4X23 D;  3AZH B;  4J8X C;  2IO5 B;  5CP6 B;  2CV5 C;  4YM6 C;  1BH8 A;  4G92 B;  5AY8 A;  4QLC B;  4J8W B;  1S32 B;  3LEL A;  5B32 D;  3TU4 D;  5G49 B;  5AVB C;  3W99 B;  4H9S A;  5B2J A;  5AV5 A;  5F99 A;  5JRG B;  3W97 C;  3KWQ C;  5AY8 D;  3WA9 B;  2F8N A;  3LEL D;  4H9R A;  4J8X B;  3B6G C;  3MGP B;  5B2J D;  5CPJ A;  2LY8 A;  5AV5 D;  1N1J A;  4YM6 B;  5B1M A;  5F99 D;  3REI C;  3AZH A;  1HTA A;  5AVB B;  3WAA C;  2NZD C;  3REH C;  3X1T C;  3AV2 C;  4QLC A;  2F8N D;  1S32 A;  4ZUX B;  3W97 B;  1PZR A;  2JCH A;  5G49 A;  5CPJ D;  3W98 C;  1M19 C;  3W99 A;  5B1M D;  3KWQ B;  5GT0 B;  4WNN A;  5JRG A;  3AZH D;  3B6G B;  3KUY C;  4G91 C;  5CHL B;  5AV6 C;  3WA9 A;  4QLC D;  1S32 D;  1HQ3 C;  4J8X A;  3W99 D;  2ZY5 A;  3WAA B;  4YM6 A;  3REH B;  5GXQ C;  5JRG D;  3AZK C;  3X1S C;  1P3B C;  5AVB A;  3W98 B;  1M19 B;  3WA9 D;  3W97 A;  4J8X D;  1ZLA C;  3KUY B;  2ZM5 A;  4YM6 D;  5AV6 B;  3KWQ A;  2NQB C;  3VH5 T;  2G5I C;  5AVB D;  3B6G A;  3AZE B;  5E5A C;  5GXQ B;  3AZK B;  3X1S B;  5GSU C;  3W97 D;  3WAA A;  4NE5 A;  2NZD A;  3KWQ D;  3REH A;  3X1T A;  1BH9 B;  3B6G D;  3W96 C;  1ZLA B;  1M19 A;  3W98 A;  1EQZ C;  2Y2J A;  3MGR C;  3AFA B;  2NQB B;  3H0M C;  5BO0 B;  3WAA D;  3KUY A;  2NZD D;  5AV6 A;  3REH D;  3X1T D;  1KU5 A;  5E5A B;  3KXB C;  3NQJ B;  1M19 D;  3W98 D;  4WJ3 C;  5GXQ A;  4JJN C;  3X1S A;  3AZK A;  1P3B A;  3REL C;  1P3P C;  3KUY D;  5AV6 D;  1EQZ B;  3MGR B;  1BH9 A;  3AN2 C;  1WWS A;  1R4V A;  1ZLA A;  5GXQ D;  3AZK D;  3X1S D;  1P34 C;  2NQB A;  1P3B D;  3A6N C;  5BO0 A;  3KXB B;  3AZG C;  3MGQ C;  5E5A A;  5GSU A;  3REL B;  1P3P B;  3NQJ A;  5C3I C;  1ZLA D;  5AY8 C;  2FFF B;  2NQB D;  4XZQ C;  3VH6 A;  3AN2 B;  4AWL C;  1EQZ A;  5E5A D;  1P34 B;  3MGR A;  5GSU D;  3UTA C;  3A6N B;  3AZG B;  3MGQ B;  3H0R C;  4LD9 B;  1F1E A;  4DRB A;  1ID3 B;  2Y2M A;  3KXB A;  4R8P B;  3X1V C;  1U35 C;  3EG5 B;  1EQZ D;  3MGR D;  5CP6 C;  4XZQ B;  2Y2K A;  3REL A;  1P3P A;  4AWL B;  5B24 C;  4QLC C;  3MGS C;  4J8W C;  4J8V C;  3R45 B;  4KUD C;  3UTA B;  3KXB D;  3AN2 A;  3W99 C;  2YFW B;  3AYW C;  4YS3 C;  4DRA A;  1P34 A;  1F66 C;  3REL D;  1P3P D;  3A6N A;  3AZG A;  4UPK A;  1U35 B;  3MGQ A;  4LD9 A;  1ID3 A;  4XUJ B;  3AN2 D;  3MGP C;  3C1B C;  1P34 D;  5B24 B;  3MGS B;  4J8V B;  4KUD B;  4XZQ A;  3A6N D;  3AZG D;  5B32 G;  3MGQ D;  4LD9 D;  3AYW B;  3AZF B;  2YFV B;  4YS3 B;  1ID3 D;  1F66 B;  4ZUX C;  3R45 A;  3UTA A;  2YFW A;  3A1K A;  5GT0 C;  4XZQ D;  3X1V A;  1U35 A;  3C1B B;  3EPJ A;  4XUJ A;  3UTA D;  5CP6 A;  2HUE B;  5B24 A;  3MGS A;  4J8W A;  4J8V A;  2F8N G;  2ZY4 A;  4KUD A;  4E44 A;  3X1V D;  1U35 D;  3AYW A;  4YS3 A;  2YFV A;  4WU9 C;  4XUJ D;  1F66 A;  5CP6 D;  2ZY2 A;  5B24 D;  3MGS D;  4J8V D;  4J8W D;  2F8N K;  4KUD D;  2ARO C;  3MGP A;  3AYW D;  4YS3 D;  3AZE C;  3C1B A;  1F66 D;  3O62 B;  4NE6 A;  3B0C T;  2FJ7 C;  3UT9 B;  4WU9 B;  4ZUX A;  3MGP D;  1M18 C;  3AV1 C;  3C1B D;  3B0D C;  2DF4 C;  2ZY3 A;  5GT0 A;  3AFA C;  5DNN B;  3AL0 C;  5AV9 C;  2ARO B;  4WZS B;  3AZN C;  3VH5 A;  2W8S A;  4ZUX D;  3EPK A;  5GT0 D;  2FJ7 B;  1P3L B;  5B1L B;  3O62 A;  1M18 B;  3AV1 B;  3B0D B;  3UT9 A;  4WU9 A;  5BNV B;  5AV9 B;  1P3F C;  4Z5T B;  3AZN B;  4H9P B;  1Q9C A;  3WKJ C;  4Z66 B;  2ARO A;  3A1I A;  3O62 D;  5KDM B;  4WU8 B;  3UT9 D;  3AZE A;  2Y2Q A;  4WU9 D;  3B0C W;  4H9Q B;  5JA4 B;  3KSY A;  2FJ7 A;  2F2A C;  3MVD C;  1W2E A;  2ARO D;  1M18 A;  3AV1 A;  1P3F B;  3AZE D;  1H3O B;  3AFA A;  3EPL A;  5BNV A;  5B31 C;  3LZ1 C;  3WKJ B;  5AV9 A;  3H0L C;  4Z5T A;  3AZN A;  4LD9 C;  1ID3 C;  2FJ7 D;  2Y2P A;  4Z66 A;  4R8P C;  1KX5 B;  3REK C;  1M18 D;  3AV1 D;  1AOI C;  5KDM A;  3AFA D;  3MVD B;  5AV9 D;  1P3I B;  4H9Q A;  4Z5T D;  5JA4 A;  3AZN D;  3AZI C;  4Z2M G;  3NQU B;  1P3A C;  4H9O B;  3V9R B;  4Z66 D;  5B31 B;  3LZ1 B;  4CAY B;  5B40 C;  1P3F A;  1TZY C;  1H3O A;  4DQY B;  5B0Z B;  3WKJ A;  3REK B;  1AOI B;  5AV8 C;  3X1U B;  4XUJ C;  1P3F D;  3AZI B;  3VH6 T;  1JFI B;  4KGC B;  2RIQ A;  1P3A B;  3MVD A;  4X23 B;  1P3G C;  3WKJ D;  2Y2O A;  2Y2H A;  5B40 B;  3F6T A;  3AZF C;  1TZY B;  2UWX A;  3NQU A;  2DQN C;  5B2I B;  4CSR B;  4H9O A;  3V9R A;  5CPI C;  5B31 A;  3LZ1 A;  4J8U C;  2Y2G A;  4NE3 A;  4ZBJ C;  5AV8 B;  3MVD D;  3LJA C;  4R8P A;  3REK A;  1AOI A;  3B6F C;  5B33 C;  2VQR A;  1P3G B;  5B31 D;  3LZ1 D;  5B31 G;  1P3O C;  3AZI A;  2HUE C;  1JFI A;  4H9N B;  5AV5 B;  3LZ0 C;  5BT1 C;  1P3A A;  5CPI B;  4R8P D;  4J8U B;  3REK D;  5B40 A;  4KHA B;  4ZBJ B;  1AOI D;  1TZY A;  5B2I A;  4CSR A;  2RVQ C;  3LJA B;  3AZI D;  5AV8 A;  3B6F B;  5B33 B;  1P3A D;  3VH6 W;  5B40 D;  1P3O B; 
#chains in the Genus database with same CATH homology
 1TZY D;  2JSS A;  5B2I D;  3LZ0 B;  1P3G A;  4EO5 C;  3WTP E;  1P3M C;  3O62 C;  5AV8 D;  4H9N A;  3UT9 C;  3AZF A;  4WNN B;  5CPI A;  4J8U A;  5AVC C;  4KHA A;  1BFM A;  4E45 A;  1P3G D;  5DNN C;  3LJA A;  3REJ C;  3AZF D;  2CV5 B;  3AZL C;  3B6F A;  5B33 A;  2HIO C;  5CPI D;  4J8U D;  3UTB C;  4EO5 B;  1P3M B;  1P3O A;  3EPH A;  3LZ0 A;  3LJA D;  1P3L C;  5B1L C;  5AVC B;  2F8N H;  4M6B A;  4NFT A;  3B6F D;  5B33 D;  1KX4 C;  5FUG B;  2XD5 A;  3REJ B;  4Z5T C;  1P3O D;  3IP4 C;  3LZ0 D;  3AZL B;  5BT1 D;  3REI B;  4Z66 C;  2HIO B;  3UTB B;  4WU8 C;  2CV5 A;  2NZD B;  5CPK C;  3X1T B;  2RVQ D;  2Y2L A;  3AV2 B;  3KFU G;  1M1A C;  2Y2N A;  3WTP C;  1P3M A;  5BS7 C;  3AZJ C;  1KX4 B;  4WV4 B;  1Z2C B;  5AVC A;  5GT3 C;  2CV5 D;  4G91 B;  3C1C C;  5FUG A;  5DNN A;  3REJ A;  1HQ3 B;  1P3M D;  3AZL A;  1T3U A;  5CPK B;  3REI A;  5B0Y C;  2HIO A;  1KX5 C;  5BNX B;  1TAF B;  4HGA C;  5AVC D;  3WTP B;  3UTB A;  1P3B B;  1M1A B;  3AZJ B;  5DNN D;  3AV2 A;  1P3I C;  3REJ D;  1P3L A;  3FDD A;  5B1L A;  1KX3 C;  5GT3 B;  3AZL D;  3AZM C;  3REI D;  3C1C B;  1KX4 A;  3P5J B;  2PYO C;  2HIO D;  5DNM C;  1ULY A;  3UTB D;  2JE5 A;  4H9P A;  2CWE A;  2BG1 A;  3AV2 D;  4UUZ B;  5B0Z C;  1P3L D;  5GSU B;  5B0Y B;  1HQ3 A;  5B1L D;  3MNN C;  4HGA B;  3X1U C;  4WU8 A;  5CPK A;  1A7W A;  1KX4 D;  2XD1 A;  5BNX A;  1TAF A;  1M1A A;  3WTP A;  1B67 A;  1KX3 B;  3W96 B;  4KGC C;  5BS7 A;  3AZJ A;  3AZM B;  4X23 C;  1P3K C;  2BYM B;  2PYO B;  1HQ3 D;  5DNM B;  2L5A A;  3VH5 W;  5GT3 A;  4WU8 D;  5B2I C;  5CPK D;  3C1C A;  1M1A D;  5B32 C;  3WTP D;  3TU4 C;  3MNN B;  3AZJ D;  4UUZ A;  4JJN B;  3B0B A;  5B0Y A;  1KX5 A;  5GT3 D;  3C1C D;  1P3K B;  3LEL C;  1P3I A;  1KX3 A;  4H9S C;  3W96 A;  5B2J C;  2BYK B;  5AV5 C;  5F99 C;  3AZM A;  4Z2M H;  2BYM A;  2PYO A;  5B0Y D;  2G5H C;  1KX5 D;  5DNM A;  4CAY A;  5B32 B;  3TU4 B;  2J8P A;  5B0Z A;  1P3I D;  1KX3 D;  3MNN A;  5CPJ C;  3W96 D;  1WWI A;  5C3I B;  3X1U A;  1BH8 B;  5B1M C;  3AZM D;  5AY8 B;  2PYO D;  3AZH C;  4JJN A;  2IO5 C;  5DNM D;  3LEL B;  5B2J B;  2Y2I A;  4G92 C;  4KGC A;  5F99 B;  5B0Z D;  4X23 A;  1S32 C;  1P3K A;  3MNN D;  1B6W A;  3X1U D;  2BYK A;  5JRG C;  4JJN D;  2F8N B;  4H9R B;  5B32 A;  3TU4 A;  5CPJ B;  4KGC D;  3X1V B;  1N1J B;  3WA9 C;  5B1M B;  1P3K D;  4X23 D;  3AZH B;  4J8X C;  2IO5 B;  5CP6 B;  2CV5 C;  4YM6 C;  1BH8 A;  4G92 B;  5AY8 A;  4QLC B;  4J8W B;  1S32 B;  3LEL A;  5B32 D;  3TU4 D;  5G49 B;  5AVB C;  3W99 B;  4H9S A;  5B2J A;  5AV5 A;  5F99 A;  5JRG B;  3W97 C;  3KWQ C;  5AY8 D;  3WA9 B;  2F8N A;  3LEL D;  4H9R A;  4J8X B;  3B6G C;  3MGP B;  5B2J D;  5CPJ A;  2LY8 A;  5AV5 D;  1N1J A;  4YM6 B;  5B1M A;  5F99 D;  3REI C;  3AZH A;  1HTA A;  5AVB B;  3WAA C;  2NZD C;  3REH C;  3X1T C;  3AV2 C;  4QLC A;  2F8N D;  1S32 A;  4ZUX B;  3W97 B;  1PZR A;  2JCH A;  5G49 A;  5CPJ D;  3W98 C;  1M19 C;  3W99 A;  5B1M D;  3KWQ B;  5GT0 B;  4WNN A;  5JRG A;  3AZH D;  3B6G B;  3KUY C;  4G91 C;  5CHL B;  5AV6 C;  3WA9 A;  4QLC D;  1S32 D;  1HQ3 C;  4J8X A;  3W99 D;  2ZY5 A;  3WAA B;  4YM6 A;  3REH B;  5GXQ C;  5JRG D;  3AZK C;  3X1S C;  1P3B C;  5AVB A;  3W98 B;  1M19 B;  3WA9 D;  3W97 A;  4J8X D;  1ZLA C;  3KUY B;  2ZM5 A;  4YM6 D;  5AV6 B;  3KWQ A;  2NQB C;  3VH5 T;  2G5I C;  5AVB D;  3B6G A;  3AZE B;  5E5A C;  5GXQ B;  3AZK B;  3X1S B;  5GSU C;  3W97 D;  3WAA A;  4NE5 A;  2NZD A;  3KWQ D;  3REH A;  3X1T A;  1BH9 B;  3B6G D;  3W96 C;  1ZLA B;  1M19 A;  3W98 A;  1EQZ C;  2Y2J A;  3MGR C;  3AFA B;  2NQB B;  3H0M C;  5BO0 B;  3WAA D;  3KUY A;  2NZD D;  5AV6 A;  3REH D;  3X1T D;  1KU5 A;  5E5A B;  3KXB C;  3NQJ B;  1M19 D;  3W98 D;  4WJ3 C;  5GXQ A;  4JJN C;  3X1S A;  3AZK A;  1P3B A;  3REL C;  1P3P C;  3KUY D;  5AV6 D;  1EQZ B;  3MGR B;  1BH9 A;  3AN2 C;  1WWS A;  1R4V A;  1ZLA A;  5GXQ D;  3AZK D;  3X1S D;  1P34 C;  2NQB A;  1P3B D;  3A6N C;  5BO0 A;  3KXB B;  3AZG C;  3MGQ C;  5E5A A;  5GSU A;  3REL B;  1P3P B;  3NQJ A;  5C3I C;  1ZLA D;  5AY8 C;  2FFF B;  2NQB D;  4XZQ C;  3VH6 A;  3AN2 B;  4AWL C;  1EQZ A;  5E5A D;  1P34 B;  3MGR A;  5GSU D;  3UTA C;  3A6N B;  3AZG B;  3MGQ B;  3H0R C;  4LD9 B;  1F1E A;  4DRB A;  1ID3 B;  2Y2M A;  3KXB A;  4R8P B;  3X1V C;  1U35 C;  3EG5 B;  1EQZ D;  3MGR D;  5CP6 C;  4XZQ B;  2Y2K A;  3REL A;  1P3P A;  4AWL B;  5B24 C;  4QLC C;  3MGS C;  4J8W C;  4J8V C;  3R45 B;  4KUD C;  3UTA B;  3KXB D;  3AN2 A;  3W99 C;  2YFW B;  3AYW C;  4YS3 C;  4DRA A;  1P34 A;  1F66 C;  3REL D;  1P3P D;  3A6N A;  3AZG A;  4UPK A;  1U35 B;  3MGQ A;  4LD9 A;  1ID3 A;  4XUJ B;  3AN2 D;  3MGP C;  3C1B C;  1P34 D;  5B24 B;  3MGS B;  4J8V B;  4KUD B;  4XZQ A;  3A6N D;  3AZG D;  5B32 G;  3MGQ D;  4LD9 D;  3AYW B;  3AZF B;  2YFV B;  4YS3 B;  1ID3 D;  1F66 B;  4ZUX C;  3R45 A;  3UTA A;  2YFW A;  3A1K A;  5GT0 C;  4XZQ D;  3X1V A;  1U35 A;  3C1B B;  3EPJ A;  4XUJ A;  3UTA D;  5CP6 A;  2HUE B;  5B24 A;  3MGS A;  4J8W A;  4J8V A;  2F8N G;  2ZY4 A;  4KUD A;  4E44 A;  3X1V D;  1U35 D;  3AYW A;  4YS3 A;  2YFV A;  4WU9 C;  4XUJ D;  1F66 A;  5CP6 D;  2ZY2 A;  5B24 D;  3MGS D;  4J8V D;  4J8W D;  2F8N K;  4KUD D;  2ARO C;  3MGP A;  3AYW D;  4YS3 D;  3AZE C;  3C1B A;  1F66 D;  3O62 B;  4NE6 A;  3B0C T;  2FJ7 C;  3UT9 B;  4WU9 B;  4ZUX A;  3MGP D;  1M18 C;  3AV1 C;  3C1B D;  3B0D C;  2DF4 C;  2ZY3 A;  5GT0 A;  3AFA C;  5DNN B;  3AL0 C;  5AV9 C;  2ARO B;  4WZS B;  3AZN C;  3VH5 A;  2W8S A;  4ZUX D;  3EPK A;  5GT0 D;  2FJ7 B;  1P3L B;  5B1L B;  3O62 A;  1M18 B;  3AV1 B;  3B0D B;  3UT9 A;  4WU9 A;  5BNV B;  5AV9 B;  1P3F C;  4Z5T B;  3AZN B;  4H9P B;  1Q9C A;  3WKJ C;  4Z66 B;  2ARO A;  3A1I A;  3O62 D;  5KDM B;  4WU8 B;  3UT9 D;  3AZE A;  2Y2Q A;  4WU9 D;  3B0C W;  4H9Q B;  5JA4 B;  3KSY A;  2FJ7 A;  2F2A C;  3MVD C;  1W2E A;  2ARO D;  1M18 A;  3AV1 A;  1P3F B;  3AZE D;  1H3O B;  3AFA A;  3EPL A;  5BNV A;  5B31 C;  3LZ1 C;  3WKJ B;  5AV9 A;  3H0L C;  4Z5T A;  3AZN A;  4LD9 C;  1ID3 C;  2FJ7 D;  2Y2P A;  4Z66 A;  4R8P C;  1KX5 B;  3REK C;  1M18 D;  3AV1 D;  1AOI C;  5KDM A;  3AFA D;  3MVD B;  5AV9 D;  1P3I B;  4H9Q A;  4Z5T D;  5JA4 A;  3AZN D;  3AZI C;  4Z2M G;  3NQU B;  1P3A C;  4H9O B;  3V9R B;  4Z66 D;  5B31 B;  3LZ1 B;  4CAY B;  5B40 C;  1P3F A;  1TZY C;  1H3O A;  4DQY B;  5B0Z B;  3WKJ A;  3REK B;  1AOI B;  5AV8 C;  3X1U B;  4XUJ C;  1P3F D;  3AZI B;  3VH6 T;  1JFI B;  4KGC B;  2RIQ A;  1P3A B;  3MVD A;  4X23 B;  1P3G C;  3WKJ D;  2Y2O A;  2Y2H A;  5B40 B;  3F6T A;  3AZF C;  1TZY B;  2UWX A;  3NQU A;  2DQN C;  5B2I B;  4CSR B;  4H9O A;  3V9R A;  5CPI C;  5B31 A;  3LZ1 A;  4J8U C;  2Y2G A;  4NE3 A;  4ZBJ C;  5AV8 B;  3MVD D;  3LJA C;  4R8P A;  3REK A;  1AOI A;  3B6F C;  5B33 C;  2VQR A;  1P3G B;  5B31 D;  3LZ1 D;  5B31 G;  1P3O C;  3AZI A;  2HUE C;  1JFI A;  4H9N B;  5AV5 B;  3LZ0 C;  5BT1 C;  1P3A A;  5CPI B;  4R8P D;  4J8U B;  3REK D;  5B40 A;  4KHA B;  4ZBJ B;  1AOI D;  1TZY A;  5B2I A;  4CSR A;  2RVQ C;  3LJA B;  3AZI D;  5AV8 A;  3B6F B;  5B33 B;  1P3A D;  3VH6 W;  5B40 D;  1P3O B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...