5AV9C

Human nucleosome core particle
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
106
structure length
106
Chain Sequence
KAKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.1
publication title Intra- and inter-nucleosomal interactions of the histone H4 tail revealed with a human nucleosome core particle with genetically-incorporated H4 tetra-acetylation
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein/dna
total genus 32
structure length 106
sequence length 106
chains with identical sequence G
ec nomenclature
pdb deposition date 2015-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5av9C00
4H9SC 3WAAA 3W96A 5AV6B 3KUYD 2LY8A 4XZQA 3AZFC 3X1UA 3X1VC 1P3FA 4H9NB 4WU8C 3REKD 3UTBA 5BT1D 2YFVB 5B2JD 4J8UD 3AYWD 3KXBC 3KUYA 4LD9C 1F66D 3MGSD 4HGAC 3WTPE 3REKA 5B2JA 4J8UA 3AYWA 3A6NB 4J8VD 1F66A 3WKJD 3AV1D 3MGSA 2F8NB 3LZ1B 1A7WA 1S32D 1TAFB 5B33B 1P3LB 5GSUC 2BYKA 3NQJB 2HUEB 4J8VA 4YM6C 1ID3D 3WKJA 4KGCB 5B2IC 3AV1A 3MVDB 4G91C 1S32A 4H9PB 4X23B 2AROB 3UT9C 1KX5D 1AOIC 4KUDD 1JFIB 3AV2B 1M1AC 1P3GD 5B0YC 4CSRB 1ID3A 1KX5A 2FJ7D 4KUDA 1HTAA 5B40C 4YS3C 1P3GA 2F8NH 3WAAB 3W96B 3AFAD 3AZED 4XZQB 4Z66C 1KX3C 5B31C 4QLCD 3X1UB 2F8NK 3AZMD 2FJ7A 1P3FB 3LZ0C 3UTBB 4ZUXC 4XUJC 3KUYB 5DNMD 1M19D 3AFAA 3C1BD 3AZIC 3AZEA 1EQZC 1P3MC 4QLCA 5C3IB 3AZMA 4CAYA 3REKB 1P34D 5B2JB 3AZGC 4J8UB 3AYWB 2IO5B 5DNMA 5KDMA 2BYMA 3AZHD 1M19A 5B1LD 3C1BA 1F66B 5DNND 5B24D 3MGSB 5GT3D 5BS7A 3UTAD 1P34A 4J8XC 3MGPC 2BYKB 3AZHA 4J8VB 2L5AA 5BNXA 5B1LA 3TU4C 3AZLC 3WKJB 5DNNA 5B24A 3AV1B 3AZKD 1S32B 3UTAA 3REHD 1P3AC 3X1SD 4NE6A 3WTPD 3B0DC 1ID3B 1P3PC 3AZKA 1HQ3C 1KX5B 4KUDB 5E5AC 3REHA 5F99D 5AV5C 3X1SA 5CPJD 2HIOC 3AZND 1P3GB 3WTPA 5CPKD 1TZYC 4KHAA 3VH5A 2FJ7B 4JJND 4G92C 4H9QA 5F99A 3AZNA 5CPJA 4ZBJB 3LJAD 5AV8C 3WA9D 3REJC 5AV9D 5CPKA 5B32G 3AFAB 3AZEB 4QLCB 3AZMB 4JJNA 1M18D 5CPIC 2NQBD 4UUZA 4CAYB 3W98D 3LJAA 3WA9A 5AV9A 5KDMB 2BYMB 5B0ZC 5DNMB 1M19B 3C1BB 3AZJC 4WU9C 3AZFD 1M18A 2NQBA 3W98A 3VH6W 4Z2MG 5AV6C 1P34B 4WU8D 4R8PC 4H9SA 3MGQC 4EO5C 3AZHB 5B1LB 5BNXB 5BO0A 4LD9D 5DNNB 5B24B 3AZFA 5GT3B 3UTAB 4WU8A 3VH5T 4LD9A 3AZKB 1P3BD 3REHB 3X1SB 3WTPB 5B32C 4KHAB 1BH9A 5JA4A 4YM6D 4J8WC 1P3BA 4H9QB 5F99B 3C1CC 3AZNB 5CPJB 5B31G 3MGRC 1M1AD 4KGCC 3MVDC 4DRBA 5CPKB 4YM6A 5BNVA 1F1EA 2RVQC 4JJNB 4UUZB 1KX4C 5GXQC 3LJAB 1M1AA 5B40D 3WA9B 5AV9B 1KX3D 1M18B 3V9RA 2NQBB 3WAAC 3W98B 3LZ0D 5B40A 4XZQC 5BO0B 4AWLC 2YFWA 3AZID 1WWIA 1EQZD 1KX3A 3AN2D 3UTBC 2NZDC 3AZFB 3LZ0A 4WU8B 3AZGD 4H9OA 1EQZA 3AZIA 3REKC 3W97C 4LD9B 3AN2A 3X1TC 4HGAB 3AYWC 1ZLAD 2IO5C 5AY8C 3MNNC 4Z5TD 3AZGA 1P3KC 3MGSC 3MGPD 3TU4D 1BH9B 5JA4B 3AZLD 5AVBC 1ZLAA 1P3BB 3NQUA 4Z5TA 1P3AD 3MGPA 1S32C 3TU4A 4YM6B 5BNVB 3AZLA 1P3PD 5AVCC 4G91B 2JSSA 5E5AD 1P3ID 1P3AA 1M1AB 3RELC 3LELC 1TZYD 1P3PA 5B1MC 3V9RB 5E5AA 2PYOD 5GT3A 1H3OA 1P3IA 1P3OC 5B40B 3REID 5AV8D 5CP6C 5GT0C 3REJD 1TZYA 2YFWB 4NFTA 1KX3B 4ZBJC 3O62C 5JRGD 1B67A 2PYOA 5CPID 3B6GC 3LZ0B 3VH6A 3REIA 1U35D 3AZEC 5AV8A 3REJA 4H9OB 1EQZB 3AZIB 3AZJD 3AN2B 1P3MB 3B6FD 5JRGA 2CV5D 5CPIA 1U35A 3AZGB 1B6WA 4R8PD 3MGQD 3KSYA 3AZJA 1P34C 2F8NG 3B6FA 1ZLAB 2CV5A 3AZHC 3NQUB 5FUGA 4Z5TB 4R8PA 3MGPB 3KWQD 3MGQA 3TU4B 4WZSB 3AZLB 3W99C 1P3AB 3X1VD 3KWQA 5B32D 3KXBD 1P3PB 4H9RA 3VH6T 3WTPC 4J8WD 5E5AB 1P3IB 1H3OB 4E45A 3C1CD 3X1VA 3MGRD 5B32A 3KXBA 1TZYB 4J8WA 1Q9CA 4G92B 2PYOB 3C1CA 1KX4D 3B0CW 3REIB 5GXQD 3A6NC 5AV8B 3MGRA 3REJB 4JJNC 5GSUD 5CHLB 4E44A 3LZ1C 3LJAC 5JRGB 3B0CT 5B33C 1P3LC 5B2ID 5CPIB 3B0BA 1WWSA 3UT9D 5GXQA 1U35B 1KX4A 1AOID 2HUEC 5GSUA 5B0YD 3AZJB 1BH8A 2AROC 4X23C 3B6FB 2NZDD 2CWEA 2CV5B 5B2IA 3AV2C 1AOIA 3UT9A 1BFMA 4NE3A 5FUGB 4R8PB 1KU5A 4YS3D 3MGQB 4EO5B 5B0YA 3W97D 2NZDA 4WNNA 3X1TD 4Z66D 5B31D 3R45A 3W96C 5AY8D 3MNND 3KWQB 4YS3A 1P3KD 4ZUXD 4XUJD 4H9RB 3X1UC 3W97A 1P3FC 3X1TA 5AVBD 4Z66A 5B31A 1P3MD 3X1VB 5AY8A 3MNNA 3KUYC 1P3KA 5B32B 4ZUXA 4XUJA 3KXBB 1P3BC 5C3IC 5AVCD 5AVBA 4J8WB 5BT1C 1P3MA 5B2JC 3C1CB 4J8UC 4M6BA 3MGRB 4J8XD 3RELD 1F66C 3LELD 5AVCA 5B1MD 1KX4B 5GXQB 4J8VC 4J8XA 1P3OD 3RELA 3WKJC 5CP6D 5GSUB 5G49A 5GT0D 3AV1C 3LELA 1BH8B 5B1MA 5B2IB 3O62D 1HQ3D 1AOIB 3UT9B 3B6GD 1P3OA 5AV5D 1ID3C 2HIOD 5CP6A 5GT0A 5B0YB 4AWLB 1KX5C 4KUDC 2NZDB 4WNNB 1N1JA 3O62A 1HQ3A 1P3GC 3B6GA 3R45B 4DRAA 5AV5A 4Z2MH 2HIOA 3AN2C 4YS3B 4WV4B 2FJ7C 3W97B 1ULYA 3X1TB 4Z66B 5B31B 5AY8B 3MNNB 1P3KB 3AFAC 4ZUXB 1ZLAC 4XUJB 4QLCC 3AZMC 5B0ZD 4Z5TC 3W99D 5AVBB 4WU9D 5DNMC 1M19C 5AV6D 3C1BC 5B0ZA 5BS7C 5AVCB 3W99A 1R4VA 4WU9A 4NE5A 5AV6A 5B1LC 4J8XB 3RELB 5DNNC 5G49B 5B24C 3LELB 5GT3C 1P3IC 3UTAC 5B1MB 4H9NA 2YFVA 1P3OB 3A6ND 5CP6B 5GT0B 3AZKC 2PYOC 2F8ND 3B0DB 3LZ1D 3REHC 3REIC 1N1JB 3O62B 3X1SC 1HQ3B 5B33D 1P3LD 3B6GB 5AV5B 3A6NA 2HIOB 5JRGC 4KGCD 2F8NA 3MVDD 3LZ1A 1U35C 4X23D 2AROD 5F99C 1TAFA 3AZNC 5CPJC 5B33A 1P3LA 3AV2D 2RVQD 5CPKC 3NQJA 3B6FC 2CV5C 4KGCA 3MVDA 4H9PA 4X23A 2AROA 1JFIA 3AV2A 3WA9C 5AV9C 4CSRA 3WAAD 3W96D 3VH5W 4XZQD 5B0ZB 1M18C 3X1UD 2NQBC 3W98C 1P3FD 3W99B 3KWQC 3UTBD 4WU9B
chains in the Genus database with same CATH superfamily
4H9SC 3WAAA 3W96A 5AV6B 3KUYD 2LY8A 4XZQA 3AZFC 3X1UA 3X1VC 1P3FA 4H9NB 4WU8C 3REKD 3UTBA 5BT1D 2YFVB 5B2JD 4J8UD 3AYWD 3KXBC 3KUYA 3EPHA 4LD9C 1F66D 3MGSD 4HGAC 3WTPE 3REKA 3P5JB 5B2JA 4J8UA 3AYWA 1PZRA 3A6NB 4J8VD 1F66A 3WKJD 3AV1D 3MGSA 2F8NB 3LZ1B 1A7WA 1S32D 1TAFB 5B33B 1P3LB 5GSUC 2BYKA 3NQJB 2HUEB 4J8VA 4YM6C 1ID3D 3WKJA 4KGCB 5B2IC 3AV1A 3MVDB 4G91C 1S32A 4H9PB 4X23B 2AROB 3UT9C 1KX5D 1AOIC 4KUDD 1JFIB 3AV2B 1M1AC 1P3GD 5B0YC 4CSRB 3AL0C 1ID3A 1KX5A 2FJ7D 4KUDA 1HTAA 5B40C 4YS3C 1P3GA 2F8NH 3WAAB 3W96B 3AFAD 3AZED 4XZQB 4Z66C 1KX3C 5B31C 4QLCD 3X1UB 2F8NK 3AZMD 2FJ7A 1P3FB 3LZ0C 3UTBB 4ZUXC 4XUJC 3KUYB 5DNMD 1M19D 3AFAA 3C1BD 3AZIC 3AZEA 1EQZC 1P3MC 4QLCA 5C3IB 3AZMA 4CAYA 3REKB 1P34D 5B2JB 3AZGC 4J8UB 3AYWB 2IO5B 5DNMA 5KDMA 2BYMA 3AZHD 1M19A 5B1LD 3C1BA 1F66B 5DNND 5B24D 3MGSB 1T3UA 5BS7A 5GT3D 3UTAD 1P34A 4J8XC 2BG1A 3MGPC 2BYKB 3AZHA 4J8VB 2L5AA 5BNXA 5B1LA 3TU4C 3AZLC 3WKJB 5DNNA 5B24A 3AV1B 3AZKD 1S32B 3UTAA 3REHD 1P3AC 3X1SD 4DQYB 4NE6A 3H0LC 3WTPD 3B0DC 3F6TA 1ID3B 1P3PC 3AZKA 1HQ3C 1KX5B 4KUDB 5E5AC 3REHA 5F99D 5AV5C 3X1SA 5CPJD 2HIOC 3EPLA 3AZND 1P3GB 3WTPA 5CPKD 1TZYC 4KHAA 3VH5A 2FJ7B 4JJND 4G92C 4H9QA 5F99A 3AZNA 5CPJA 4ZBJB 3LJAD 5AV8C 3WA9D 3REJC 5AV9D 5CPKA 5B32G 3AFAB 3AZEB 4QLCB 3AZMB 4JJNA 2Y2OA 1M18D 5CPIC 2NQBD 4UUZA 4CAYB 3W98D 3LJAA 3WA9A 5AV9A 5KDMB 2BYMB 5B0ZC 5DNMB 1M19B 3C1BB 3AZJC 4WU9C 3AZFD 1M18A 2NQBA 3W98A 3VH6W 4Z2MG 5AV6C 1P34B 4WU8D 4R8PC 4H9SA 3MGQC 4EO5C 3AZHB 5B1LB 5BNXB 5BO0A 4LD9D 5DNNB 5B24B 3AZFA 5GT3B 3UTAB 4WU8A 2ZY4A 3VH5T 4LD9A 3AZKB 1P3BD 3REHB 3X1SB 2Y2PA 3WTPB 5B32C 4KHAB 1BH9A 5JA4A 4YM6D 4J8WC 1P3BA 4H9QB 5F99B 3C1CC 3AZNB 5CPJB 5B31G 3MGRC 1M1AD 4KGCC 3MVDC 4DRBA 5CPKB 4YM6A 5BNVA 1F1EA 2RVQC 4JJNB 2Y2MA 4UUZB 1KX4C 5GXQC 3LJAB 1M1AA 5B40D 3WA9B 5AV9B 1KX3D 1M18B 3V9RA 2NQBB 3WAAC 3W98B 2ZM5A 3LZ0D 5B40A 4XZQC 5BO0B 4AWLC 2YFWA 3AZID 1WWIA 1EQZD 1KX3A 3AN2D 3UTBC 2NZDC 3AZFB 3LZ0A 4WU8B 3AZGD 4H9OA 1EQZA 3AZIA 2Y2GA 3REKC 3W97C 3AN2A 3X1TC 4LD9B 4HGAB 3AYWC 1ZLAD 2IO5C 5AY8C 3MNNC 4Z5TD 3AZGA 1P3KC 2JCHA 3MGSC 3MGPD 4UPKA 3TU4D 1BH9B 3H0MC 5JA4B 3AZLD 5AVBC 1ZLAA 1P3BB 3NQUA 4Z5TA 1P3AD 3MGPA 1S32C 3TU4A 4YM6B 5BNVB 3AZLA 1P3PD 4WJ3C 5AVCC 4G91B 2JSSA 5E5AD 1P3ID 1P3AA 1M1AB 2ZY3A 1Z2CB 3RELC 3LELC 1TZYD 1P3PA 5B1MC 3V9RB 5E5AA 2PYOD 5GT3A 1H3OA 1P3IA 1P3OC 5B40B 3REID 3KFUG 5AV8D 5CP6C 5GT0C 3REJD 1TZYA 2YFWB 4NFTA 1KX3B 4ZBJC 2Y2JA 3O62C 5JRGD 1B67A 2PYOA 5CPID 3B6GC 2F2AC 3LZ0B 3VH6A 3REIA 1U35D 3AZEC 5AV8A 3REJA 4H9OB 1EQZB 3AZIB 3AZJD 2DF4C 3AN2B 1P3MB 3B6FD 5JRGA 2CV5D 5CPIA 1U35A 3AZGB 1B6WA 4R8PD 3MGQD 2W8SA 3KSYA 3AZJA 1P34C 2G5HC 2F8NG 3B6FA 1ZLAB 2CV5A 3AZHC 3A1IA 3NQUB 5FUGA 4Z5TB 4R8PA 3MGPB 3KWQD 3MGQA 3TU4B 4WZSB 3AZLB 2DQNC 3W99C 1P3AB 3X1VD 3KWQA 5B32D 2Y2LA 3KXBD 1P3PB 4H9RA 2Y2IA 3VH6T 3WTPC 4J8WD 5E5AB 1P3IB 1H3OB 4E45A 3C1CD 3X1VA 3MGRD 5B32A 3KXBA 1TZYB 2Y2NA 4J8WA 1Q9CA 4G92B 2PYOB 3C1CA 2Y2HA 3B0CW 3REIB 5GXQD 1KX4D 3A6NC 5AV8B 3MGRA 2XD5A 3REJB 4JJNC 5GSUD 5CHLB 4E44A 3LZ1C 3LJAC 5JRGB 3B0CT 5B33C 1P3LC 5B2ID 5CPIB 3B0BA 1WWSA 3UT9D 5GXQA 1U35B 1KX4A 1AOID 2HUEC 2RIQA 5GSUA 5B0YD 3AZJB 2Y2KA 1BH8A 2AROC 4X23C 3B6FB 2NZDD 2CWEA 2CV5B 5B2IA 3AV2C 1AOIA 3UT9A 1BFMA 2XD1A 4NE3A 5FUGB 4R8PB 1KU5A 4YS3D 3MGQB 2ZY2A 4EO5B 5B0YA 3FDDA 3W97D 2UWXA 2NZDA 4WNNA 3X1TD 4Z66D 5B31D 3R45A 3W96C 5AY8D 3MNND 2Y2QA 3KWQB 4YS3A 1P3KD 4ZUXD 4XUJD 4H9RB 3X1UC 3W97A 1P3FC 3X1TA 5AVBD 2VQRA 4Z66A 5B31A 1P3MD 3X1VB 5AY8A 3MNNA 3KUYC 1P3KA 5B32B 4ZUXA 4XUJA 3KXBB 1P3BC 5C3IC 5AVCD 5AVBA 4J8WB 5BT1C 1P3MA 5B2JC 3C1CB 4J8UC 4M6BA 3MGRB 4J8XD 3RELD 1F66C 3LELD 5AVCA 5B1MD 3IP4C 1KX4B 5GXQB 4J8VC 4J8XA 1P3OD 3RELA 3WKJC 5CP6D 5GSUB 5G49A 5GT0D 3AV1C 3LELA 1BH8B 5B1MA 5B2IB 3O62D 1HQ3D 1AOIB 3UT9B 3B6GD 1P3OA 5AV5D 1ID3C 2HIOD 5CP6A 5GT0A 5B0YB 4AWLB 1KX5C 4KUDC 2NZDB 4WNNB 1N1JA 3O62A 1HQ3A 1P3GC 3B6GA 3R45B 4DRAA 5AV5A 4Z2MH 2HIOA 3AN2C 4YS3B 4WV4B 2FJ7C 3W97B 1ULYA 3EPJA 3X1TB 4Z66B 5B31B 2FFFB 5AY8B 3MNNB 1P3KB 3AFAC 4ZUXB 1ZLAC 4XUJB 4QLCC 3AZMC 2ZY5A 5B0ZD 4Z5TC 3W99D 5AVBB 4WU9D 5DNMC 1M19C 5AV6D 3C1BC 3EG5B 5B0ZA 5BS7C 5AVCB 3W99A 1R4VA 4WU9A 4NE5A 5AV6A 5B1LC 4J8XB 3RELB 5DNNC 5G49B 5B24C 3LELB 3H0RC 5GT3C 1P3IC 3UTAC 5B1MB 4H9NA 2YFVA 1P3OB 3A6ND 5CP6B 5GT0B 3AZKC 2PYOC 2F8ND 3B0DB 3LZ1D 3REHC 3REIC 1N1JB 3O62B 3X1SC 1HQ3B 5B33D 1P3LD 3B6GB 5AV5B 3A6NA 3EPKA 2HIOB 5JRGC 4KGCD 2F8NA 3MVDD 3LZ1A 1U35C 4X23D 2AROD 5F99C 1TAFA 3AZNC 5CPJC 5B33A 1P3LA 1W2EA 2G5IC 2RVQD 3AV2D 3A1KA 5CPKC 3NQJA 3B6FC 2CV5C 4KGCA 3MVDA 4H9PA 4X23A 2AROA 1JFIA 3AV2A 3WA9C 5AV9C 4CSRA 3WAAD 3W96D 3VH5W 4XZQD 5B0ZB 1M18C 3X1UD 2J8PA 2NQBC 3W98C 1P3FD 3W99B 2JE5A 3KWQC 3UTBD 4WU9B
chains in the Genus database with same CATH topology
4H9SC 3WAAA 3W96A 5AV6B 3KUYD 2LY8A 4XZQA 3AZFC 3X1UA 3X1VC 1P3FA 4H9NB 4WU8C 3REKD 3UTBA 5BT1D 2YFVB 5B2JD 4J8UD 3AYWD 3KXBC 3KUYA 3EPHA 4LD9C 1F66D 3MGSD 4HGAC 3WTPE 3REKA 3P5JB 5B2JA 4J8UA 3AYWA 1PZRA 3A6NB 4J8VD 1F66A 3WKJD 3AV1D 3MGSA 2F8NB 3LZ1B 1A7WA 1S32D 1TAFB 5B33B 1P3LB 5GSUC 2BYKA 3NQJB 2HUEB 4J8VA 4YM6C 1ID3D 3WKJA 4KGCB 5B2IC 3AV1A 3MVDB 4G91C 1S32A 4H9PB 4X23B 2AROB 3UT9C 1KX5D 1AOIC 4KUDD 1JFIB 3AV2B 1M1AC 1P3GD 5B0YC 4CSRB 3AL0C 1ID3A 1KX5A 2FJ7D 4KUDA 1HTAA 5B40C 4YS3C 1P3GA 2F8NH 3WAAB 3W96B 3AFAD 3AZED 4XZQB 4Z66C 1KX3C 5B31C 4QLCD 3X1UB 2F8NK 3AZMD 2FJ7A 1P3FB 3LZ0C 3UTBB 4ZUXC 4XUJC 3KUYB 5DNMD 1M19D 3AFAA 3C1BD 3AZIC 3AZEA 1EQZC 1P3MC 4QLCA 5C3IB 3AZMA 4CAYA 3REKB 1P34D 5B2JB 3AZGC 4J8UB 3AYWB 2IO5B 5DNMA 5KDMA 2BYMA 3AZHD 1M19A 5B1LD 3C1BA 1F66B 5DNND 5B24D 3MGSB 1T3UA 5BS7A 5GT3D 3UTAD 1P34A 4J8XC 2BG1A 3MGPC 2BYKB 3AZHA 4J8VB 2L5AA 5BNXA 5B1LA 3TU4C 3AZLC 3WKJB 5DNNA 5B24A 3AV1B 3AZKD 1S32B 3UTAA 3REHD 1P3AC 3X1SD 4DQYB 4NE6A 3H0LC 3WTPD 3B0DC 3F6TA 1ID3B 1P3PC 3AZKA 1HQ3C 1KX5B 4KUDB 5E5AC 3REHA 5F99D 5AV5C 3X1SA 5CPJD 2HIOC 3EPLA 3AZND 1P3GB 3WTPA 5CPKD 1TZYC 4KHAA 3VH5A 2FJ7B 4JJND 4G92C 4H9QA 5F99A 3AZNA 5CPJA 4ZBJB 3LJAD 5AV8C 3WA9D 3REJC 5AV9D 5CPKA 5B32G 3AFAB 3AZEB 4QLCB 3AZMB 4JJNA 2Y2OA 1M18D 5CPIC 2NQBD 4UUZA 4CAYB 3W98D 3LJAA 3WA9A 5AV9A 5KDMB 2BYMB 5B0ZC 5DNMB 1M19B 3C1BB 3AZJC 4WU9C 3AZFD 1M18A 2NQBA 3W98A 3VH6W 4Z2MG 5AV6C 1P34B 4WU8D 4R8PC 4H9SA 3MGQC 4EO5C 3AZHB 5B1LB 5BNXB 5BO0A 4LD9D 5DNNB 5B24B 3AZFA 5GT3B 3UTAB 4WU8A 2ZY4A 3VH5T 4LD9A 3AZKB 1P3BD 3REHB 3X1SB 2Y2PA 3WTPB 5B32C 4KHAB 1BH9A 5JA4A 4YM6D 4J8WC 1P3BA 4H9QB 5F99B 3C1CC 3AZNB 5CPJB 5B31G 3MGRC 1M1AD 4KGCC 3MVDC 4DRBA 5CPKB 4YM6A 5BNVA 1F1EA 2RVQC 4JJNB 2Y2MA 4UUZB 1KX4C 5GXQC 3LJAB 1M1AA 5B40D 3WA9B 5AV9B 1KX3D 1M18B 3V9RA 2NQBB 3WAAC 3W98B 2ZM5A 3LZ0D 5B40A 4XZQC 5BO0B 4AWLC 2YFWA 3AZID 1WWIA 1EQZD 1KX3A 3AN2D 3UTBC 2NZDC 3AZFB 3LZ0A 4WU8B 3AZGD 4H9OA 1EQZA 3AZIA 2Y2GA 3REKC 3W97C 3AN2A 3X1TC 4LD9B 4HGAB 3AYWC 1ZLAD 2IO5C 5AY8C 3MNNC 4Z5TD 3AZGA 1P3KC 2JCHA 3MGSC 3MGPD 4UPKA 3TU4D 1BH9B 3H0MC 5JA4B 3AZLD 5AVBC 1ZLAA 1P3BB 3NQUA 4Z5TA 1P3AD 3MGPA 1S32C 3TU4A 4YM6B 5BNVB 3AZLA 1P3PD 4WJ3C 5AVCC 4G91B 2JSSA 5E5AD 1P3ID 1P3AA 1M1AB 2ZY3A 1Z2CB 3RELC 3LELC 1TZYD 1P3PA 5B1MC 3V9RB 5E5AA 2PYOD 5GT3A 1H3OA 1P3IA 1P3OC 5B40B 3REID 3KFUG 5AV8D 5CP6C 5GT0C 3REJD 1TZYA 2YFWB 4NFTA 1KX3B 4ZBJC 2Y2JA 3O62C 5JRGD 1B67A 2PYOA 5CPID 3B6GC 2F2AC 3LZ0B 3VH6A 3REIA 1U35D 3AZEC 5AV8A 3REJA 4H9OB 1EQZB 3AZIB 3AZJD 2DF4C 3AN2B 1P3MB 3B6FD 5JRGA 2CV5D 5CPIA 1U35A 3AZGB 1B6WA 4R8PD 3MGQD 2W8SA 3KSYA 3AZJA 1P34C 2G5HC 2F8NG 3B6FA 1ZLAB 2CV5A 3AZHC 3A1IA 3NQUB 5FUGA 4Z5TB 4R8PA 3MGPB 3KWQD 3MGQA 3TU4B 4WZSB 3AZLB 2DQNC 3W99C 1P3AB 3X1VD 3KWQA 5B32D 2Y2LA 3KXBD 1P3PB 4H9RA 2Y2IA 3VH6T 3WTPC 4J8WD 5E5AB 1P3IB 1H3OB 4E45A 3C1CD 3X1VA 3MGRD 5B32A 3KXBA 1TZYB 2Y2NA 4J8WA 1Q9CA 4G92B 2PYOB 3C1CA 2Y2HA 3B0CW 3REIB 5GXQD 1KX4D 3A6NC 5AV8B 3MGRA 2XD5A 3REJB 4JJNC 5GSUD 5CHLB 4E44A 3LZ1C 3LJAC 5JRGB 3B0CT 5B33C 1P3LC 5B2ID 5CPIB 3B0BA 1WWSA 3UT9D 5GXQA 1U35B 1KX4A 1AOID 2HUEC 2RIQA 5GSUA 5B0YD 3AZJB 2Y2KA 1BH8A 2AROC 4X23C 3B6FB 2NZDD 2CWEA 2CV5B 5B2IA 3AV2C 1AOIA 3UT9A 1BFMA 2XD1A 4NE3A 5FUGB 4R8PB 1KU5A 4YS3D 3MGQB 2ZY2A 4EO5B 5B0YA 3FDDA 3W97D 2UWXA 2NZDA 4WNNA 3X1TD 4Z66D 5B31D 3R45A 3W96C 5AY8D 3MNND 2Y2QA 3KWQB 4YS3A 1P3KD 4ZUXD 4XUJD 4H9RB 3X1UC 3W97A 1P3FC 3X1TA 5AVBD 2VQRA 4Z66A 5B31A 1P3MD 3X1VB 5AY8A 3MNNA 3KUYC 1P3KA 5B32B 4ZUXA 4XUJA 3KXBB 1P3BC 5C3IC 5AVCD 5AVBA 4J8WB 5BT1C 1P3MA 5B2JC 3C1CB 4J8UC 4M6BA 3MGRB 4J8XD 3RELD 1F66C 3LELD 5AVCA 5B1MD 3IP4C 1KX4B 5GXQB 4J8VC 4J8XA 1P3OD 3RELA 3WKJC 5CP6D 5GSUB 5G49A 5GT0D 3AV1C 3LELA 1BH8B 5B1MA 5B2IB 3O62D 1HQ3D 1AOIB 3UT9B 3B6GD 1P3OA 5AV5D 1ID3C 2HIOD 5CP6A 5GT0A 5B0YB 4AWLB 1KX5C 4KUDC 2NZDB 4WNNB 1N1JA 3O62A 1HQ3A 1P3GC 3B6GA 3R45B 4DRAA 5AV5A 4Z2MH 2HIOA 3AN2C 4YS3B 4WV4B 2FJ7C 3W97B 1ULYA 3EPJA 3X1TB 4Z66B 5B31B 2FFFB 5AY8B 3MNNB 1P3KB 3AFAC 4ZUXB 1ZLAC 4XUJB 4QLCC 3AZMC 2ZY5A 5B0ZD 4Z5TC 3W99D 5AVBB 4WU9D 5DNMC 1M19C 5AV6D 3C1BC 3EG5B 5B0ZA 5BS7C 5AVCB 3W99A 1R4VA 4WU9A 4NE5A 5AV6A 5B1LC 4J8XB 3RELB 5DNNC 5G49B 5B24C 3LELB 3H0RC 5GT3C 1P3IC 3UTAC 5B1MB 4H9NA 2YFVA 1P3OB 3A6ND 5CP6B 5GT0B 3AZKC 2PYOC 2F8ND 3B0DB 3LZ1D 3REHC 3REIC 1N1JB 3O62B 3X1SC 1HQ3B 5B33D 1P3LD 3B6GB 5AV5B 3A6NA 3EPKA 2HIOB 5JRGC 4KGCD 2F8NA 3MVDD 3LZ1A 1U35C 4X23D 2AROD 5F99C 1TAFA 3AZNC 5CPJC 5B33A 1P3LA 1W2EA 2G5IC 2RVQD 3AV2D 3A1KA 5CPKC 3NQJA 3B6FC 2CV5C 4KGCA 3MVDA 4H9PA 4X23A 2AROA 1JFIA 3AV2A 3WA9C 5AV9C 4CSRA 3WAAD 3W96D 3VH5W 4XZQD 5B0ZB 1M18C 3X1UD 2J8PA 2NQBC 3W98C 1P3FD 3W99B 2JE5A 3KWQC 3UTBD 4WU9B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4H9S C;  3WAA A;  3W96 A;  5AV6 B;  3KUY D;  2LY8 A;  4XZQ A;  3AZF C;  3X1U A;  3X1V C;  1P3F A;  4H9N B;  4WU8 C;  3REK D;  3UTB A;  5BT1 D;  2YFV B;  5B2J D;  4J8U D;  3AYW D;  3KXB C;  3KUY A;  4LD9 C;  1F66 D;  3MGS D;  4HGA C;  3WTP E;  3REK A;  5B2J A;  4J8U A;  3AYW A;  3A6N B;  4J8V D;  1F66 A;  3WKJ D;  3AV1 D;  3MGS A;  2F8N B;  3LZ1 B;  1A7W A;  1S32 D;  1TAF B;  5B33 B;  1P3L B;  5GSU C;  2BYK A;  3NQJ B;  2HUE B;  4J8V A;  4YM6 C;  1ID3 D;  3WKJ A;  4KGC B;  5B2I C;  3AV1 A;  3MVD B;  4G91 C;  1S32 A;  4H9P B;  4X23 B;  2ARO B;  3UT9 C;  1KX5 D;  1AOI C;  4KUD D;  1JFI B;  3AV2 B;  1M1A C;  1P3G D;  5B0Y C;  4CSR B;  1ID3 A;  1KX5 A;  2FJ7 D;  4KUD A;  1HTA A;  5B40 C;  4YS3 C;  1P3G A;  2F8N H;  3WAA B;  3W96 B;  3AFA D;  3AZE D;  4XZQ B;  4Z66 C;  1KX3 C;  5B31 C;  4QLC D;  3X1U B;  2F8N K;  3AZM D;  2FJ7 A;  1P3F B;  3LZ0 C;  3UTB B;  4ZUX C;  4XUJ C;  3KUY B;  5DNM D;  1M19 D;  3AFA A;  3C1B D;  3AZI C;  3AZE A;  1EQZ C;  1P3M C;  4QLC A;  5C3I B;  3AZM A;  4CAY A;  3REK B;  1P34 D;  5B2J B;  3AZG C;  4J8U B;  3AYW B;  2IO5 B;  5DNM A;  5KDM A;  2BYM A;  3AZH D;  1M19 A;  5B1L D;  3C1B A;  1F66 B;  5DNN D;  5B24 D;  3MGS B;  5GT3 D;  5BS7 A;  3UTA D;  1P34 A;  4J8X C;  3MGP C;  2BYK B;  3AZH A;  4J8V B;  2L5A A;  5BNX A;  5B1L A;  3TU4 C;  3AZL C;  3WKJ B;  5DNN A;  5B24 A;  3AV1 B;  3AZK D;  1S32 B;  3UTA A;  3REH D;  1P3A C;  3X1S D;  4NE6 A;  3WTP D;  3B0D C;  1ID3 B;  1P3P C;  3AZK A;  1HQ3 C;  1KX5 B;  4KUD B;  5E5A C;  3REH A;  5F99 D;  5AV5 C;  3X1S A;  5CPJ D;  2HIO C;  3AZN D;  1P3G B;  3WTP A;  5CPK D;  1TZY C;  4KHA A;  3VH5 A;  2FJ7 B;  4JJN D;  4G92 C;  4H9Q A;  5F99 A;  3AZN A;  5CPJ A;  4ZBJ B;  3LJA D;  5AV8 C;  3WA9 D;  3REJ C;  5AV9 D;  5CPK A;  5B32 G;  3AFA B;  3AZE B;  4QLC B;  3AZM B;  4JJN A;  1M18 D;  5CPI C;  2NQB D;  4UUZ A;  4CAY B;  3W98 D;  3LJA A;  3WA9 A;  5AV9 A;  5KDM B;  2BYM B;  5B0Z C;  5DNM B;  1M19 B;  3C1B B;  3AZJ C;  4WU9 C;  3AZF D;  1M18 A;  2NQB A;  3W98 A;  3VH6 W;  4Z2M G;  5AV6 C;  1P34 B;  4WU8 D;  4R8P C;  4H9S A;  3MGQ C;  4EO5 C;  3AZH B;  5B1L B;  5BNX B;  5BO0 A;  4LD9 D;  5DNN B;  5B24 B;  3AZF A;  5GT3 B;  3UTA B;  4WU8 A;  3VH5 T;  4LD9 A;  3AZK B;  1P3B D;  3REH B;  3X1S B;  3WTP B;  5B32 C;  4KHA B;  1BH9 A;  5JA4 A;  4YM6 D;  4J8W C;  1P3B A;  4H9Q B;  5F99 B;  3C1C C;  3AZN B;  5CPJ B;  5B31 G;  3MGR C;  1M1A D;  4KGC C;  3MVD C;  4DRB A;  5CPK B;  4YM6 A;  5BNV A;  1F1E A;  2RVQ C;  4JJN B;  4UUZ B;  1KX4 C;  5GXQ C;  3LJA B;  1M1A A;  5B40 D;  3WA9 B;  5AV9 B;  1KX3 D;  1M18 B;  3V9R A;  2NQB B;  3WAA C;  3W98 B;  3LZ0 D;  5B40 A;  4XZQ C;  5BO0 B;  4AWL C;  2YFW A;  3AZI D;  1WWI A;  1EQZ D;  1KX3 A;  3AN2 D;  3UTB C;  2NZD C;  3AZF B;  3LZ0 A;  4WU8 B;  3AZG D;  4H9O A;  1EQZ A;  3AZI A;  3REK C;  3W97 C;  4LD9 B;  3AN2 A;  3X1T C;  4HGA B;  3AYW C;  1ZLA D;  2IO5 C;  5AY8 C;  3MNN C;  4Z5T D;  3AZG A;  1P3K C;  3MGS C;  3MGP D;  3TU4 D;  1BH9 B;  5JA4 B;  3AZL D;  5AVB C;  1ZLA A;  1P3B B;  3NQU A;  4Z5T A;  1P3A D;  3MGP A;  1S32 C;  3TU4 A;  4YM6 B;  5BNV B;  3AZL A;  1P3P D;  5AVC C;  4G91 B;  2JSS A;  5E5A D;  1P3I D;  1P3A A;  1M1A B;  3REL C;  3LEL C;  1TZY D;  1P3P A;  5B1M C;  3V9R B;  5E5A A;  2PYO D;  5GT3 A;  1H3O A;  1P3I A;  1P3O C;  5B40 B;  3REI D;  5AV8 D;  5CP6 C;  5GT0 C;  3REJ D;  1TZY A;  2YFW B;  4NFT A;  1KX3 B;  4ZBJ C;  3O62 C;  5JRG D;  1B67 A;  2PYO A;  5CPI D;  3B6G C;  3LZ0 B;  3VH6 A;  3REI A;  1U35 D;  3AZE C;  5AV8 A;  3REJ A;  4H9O B;  1EQZ B;  3AZI B;  3AZJ D;  3AN2 B;  1P3M B;  3B6F D;  5JRG A;  2CV5 D;  5CPI A;  1U35 A;  3AZG B;  1B6W A;  4R8P D;  3MGQ D;  3KSY A;  3AZJ A;  1P34 C;  2F8N G;  3B6F A;  1ZLA B;  2CV5 A;  3AZH C;  3NQU B;  5FUG A;  4Z5T B;  4R8P A;  3MGP B;  3KWQ D;  3MGQ A;  3TU4 B;  4WZS B;  3AZL B;  3W99 C;  1P3A B;  3X1V D;  3KWQ A;  5B32 D;  3KXB D;  1P3P B;  4H9R A;  3VH6 T;  3WTP C;  4J8W D;  5E5A B;  1P3I B;  1H3O B;  4E45 A;  3C1C D;  3X1V A;  3MGR D;  5B32 A;  3KXB A;  1TZY B;  4J8W A;  1Q9C A;  4G92 B;  2PYO B;  3C1C A;  1KX4 D;  3B0C W;  3REI B;  5GXQ D;  3A6N C;  5AV8 B;  3MGR A;  3REJ B;  4JJN C;  5GSU D;  5CHL B;  4E44 A;  3LZ1 C;  3LJA C;  5JRG B;  3B0C T;  5B33 C;  1P3L C;  5B2I D;  5CPI B;  3B0B A;  1WWS A;  3UT9 D;  5GXQ A;  1U35 B;  1KX4 A;  1AOI D;  2HUE C;  5GSU A;  5B0Y D;  3AZJ B;  1BH8 A;  2ARO C;  4X23 C;  3B6F B;  2NZD D;  2CWE A;  2CV5 B;  5B2I A;  3AV2 C;  1AOI A;  3UT9 A;  1BFM A;  4NE3 A;  5FUG B;  4R8P B;  1KU5 A;  4YS3 D;  3MGQ B;  4EO5 B;  5B0Y A;  3W97 D;  2NZD A;  4WNN A;  3X1T D;  4Z66 D;  5B31 D;  3R45 A;  3W96 C;  5AY8 D;  3MNN D;  3KWQ B;  4YS3 A;  1P3K D;  4ZUX D;  4XUJ D;  4H9R B;  3X1U C;  3W97 A;  1P3F C;  3X1T A;  5AVB D;  4Z66 A;  5B31 A;  1P3M D;  3X1V B;  5AY8 A;  3MNN A;  3KUY C;  1P3K A;  5B32 B;  4ZUX A;  4XUJ A;  3KXB B;  1P3B C;  5C3I C;  5AVC D;  5AVB A;  4J8W B;  5BT1 C;  1P3M A;  5B2J C;  3C1C B;  4J8U C;  4M6B A;  3MGR B;  4J8X D;  3REL D;  1F66 C;  3LEL D;  5AVC A;  5B1M D;  1KX4 B;  5GXQ B;  4J8V C;  4J8X A;  1P3O D;  3REL A;  3WKJ C;  5CP6 D;  5GSU B;  5G49 A;  5GT0 D;  3AV1 C;  3LEL A;  1BH8 B;  5B1M A;  5B2I B;  3O62 D;  1HQ3 D;  1AOI B;  3UT9 B;  3B6G D;  1P3O A;  5AV5 D;  1ID3 C;  2HIO D;  5CP6 A;  5GT0 A;  5B0Y B;  4AWL B;  1KX5 C;  4KUD C;  2NZD B;  4WNN B;  1N1J A;  3O62 A;  1HQ3 A;  1P3G C;  3B6G A;  3R45 B;  4DRA A;  5AV5 A;  4Z2M H;  2HIO A;  3AN2 C;  4YS3 B;  4WV4 B;  2FJ7 C;  3W97 B;  1ULY A;  3X1T B;  4Z66 B;  5B31 B;  5AY8 B;  3MNN B;  1P3K B;  3AFA C;  4ZUX B;  1ZLA C;  4XUJ B;  4QLC C;  3AZM C;  5B0Z D;  4Z5T C;  3W99 D;  5AVB B;  4WU9 D;  5DNM C;  1M19 C;  5AV6 D;  3C1B C;  5B0Z A;  5BS7 C;  5AVC B;  3W99 A;  1R4V A;  4WU9 A;  4NE5 A;  5AV6 A;  5B1L C;  4J8X B;  3REL B;  5DNN C;  5G49 B;  5B24 C;  3LEL B;  5GT3 C;  1P3I C;  3UTA C;  5B1M B;  4H9N A;  2YFV A;  1P3O B;  3A6N D;  5CP6 B;  5GT0 B;  3AZK C;  2PYO C;  2F8N D;  3B0D B;  3LZ1 D;  3REH C;  3REI C;  1N1J B;  3O62 B;  3X1S C;  1HQ3 B;  5B33 D;  1P3L D;  3B6G B;  5AV5 B;  3A6N A;  2HIO B;  5JRG C;  4KGC D;  2F8N A;  3MVD D;  3LZ1 A;  1U35 C;  4X23 D;  2ARO D;  5F99 C;  1TAF A;  3AZN C;  5CPJ C;  5B33 A;  1P3L A;  3AV2 D;  2RVQ D;  5CPK C;  3NQJ A;  3B6F C;  2CV5 C;  4KGC A;  3MVD A;  4H9P A;  4X23 A;  2ARO A;  1JFI A;  3AV2 A;  3WA9 C;  5AV9 C;  4CSR A;  3WAA D;  3W96 D;  3VH5 W;  4XZQ D;  5B0Z B;  1M18 C;  3X1U D;  2NQB C;  3W98 C;  1P3F D;  3W99 B;  3KWQ C;  3UTB D;  4WU9 B; 
#chains in the Genus database with same CATH topology
 4H9S C;  3WAA A;  3W96 A;  5AV6 B;  3KUY D;  2LY8 A;  4XZQ A;  3AZF C;  3X1U A;  3X1V C;  1P3F A;  4H9N B;  4WU8 C;  3REK D;  3UTB A;  5BT1 D;  2YFV B;  5B2J D;  4J8U D;  3AYW D;  3KXB C;  3KUY A;  3EPH A;  4LD9 C;  1F66 D;  3MGS D;  4HGA C;  3WTP E;  3REK A;  3P5J B;  5B2J A;  4J8U A;  3AYW A;  1PZR A;  3A6N B;  4J8V D;  1F66 A;  3WKJ D;  3AV1 D;  3MGS A;  2F8N B;  3LZ1 B;  1A7W A;  1S32 D;  1TAF B;  5B33 B;  1P3L B;  5GSU C;  2BYK A;  3NQJ B;  2HUE B;  4J8V A;  4YM6 C;  1ID3 D;  3WKJ A;  4KGC B;  5B2I C;  3AV1 A;  3MVD B;  4G91 C;  1S32 A;  4H9P B;  4X23 B;  2ARO B;  3UT9 C;  1KX5 D;  1AOI C;  4KUD D;  1JFI B;  3AV2 B;  1M1A C;  1P3G D;  5B0Y C;  4CSR B;  3AL0 C;  1ID3 A;  1KX5 A;  2FJ7 D;  4KUD A;  1HTA A;  5B40 C;  4YS3 C;  1P3G A;  2F8N H;  3WAA B;  3W96 B;  3AFA D;  3AZE D;  4XZQ B;  4Z66 C;  1KX3 C;  5B31 C;  4QLC D;  3X1U B;  2F8N K;  3AZM D;  2FJ7 A;  1P3F B;  3LZ0 C;  3UTB B;  4ZUX C;  4XUJ C;  3KUY B;  5DNM D;  1M19 D;  3AFA A;  3C1B D;  3AZI C;  3AZE A;  1EQZ C;  1P3M C;  4QLC A;  5C3I B;  3AZM A;  4CAY A;  3REK B;  1P34 D;  5B2J B;  3AZG C;  4J8U B;  3AYW B;  2IO5 B;  5DNM A;  5KDM A;  2BYM A;  3AZH D;  1M19 A;  5B1L D;  3C1B A;  1F66 B;  5DNN D;  5B24 D;  3MGS B;  1T3U A;  5BS7 A;  5GT3 D;  3UTA D;  1P34 A;  4J8X C;  2BG1 A;  3MGP C;  2BYK B;  3AZH A;  4J8V B;  2L5A A;  5BNX A;  5B1L A;  3TU4 C;  3AZL C;  3WKJ B;  5DNN A;  5B24 A;  3AV1 B;  3AZK D;  1S32 B;  3UTA A;  3REH D;  1P3A C;  3X1S D;  4DQY B;  4NE6 A;  3H0L C;  3WTP D;  3B0D C;  3F6T A;  1ID3 B;  1P3P C;  3AZK A;  1HQ3 C;  1KX5 B;  4KUD B;  5E5A C;  3REH A;  5F99 D;  5AV5 C;  3X1S A;  5CPJ D;  2HIO C;  3EPL A;  3AZN D;  1P3G B;  3WTP A;  5CPK D;  1TZY C;  4KHA A;  3VH5 A;  2FJ7 B;  4JJN D;  4G92 C;  4H9Q A;  5F99 A;  3AZN A;  5CPJ A;  4ZBJ B;  3LJA D;  5AV8 C;  3WA9 D;  3REJ C;  5AV9 D;  5CPK A;  5B32 G;  3AFA B;  3AZE B;  4QLC B;  3AZM B;  4JJN A;  2Y2O A;  1M18 D;  5CPI C;  2NQB D;  4UUZ A;  4CAY B;  3W98 D;  3LJA A;  3WA9 A;  5AV9 A;  5KDM B;  2BYM B;  5B0Z C;  5DNM B;  1M19 B;  3C1B B;  3AZJ C;  4WU9 C;  3AZF D;  1M18 A;  2NQB A;  3W98 A;  3VH6 W;  4Z2M G;  5AV6 C;  1P34 B;  4WU8 D;  4R8P C;  4H9S A;  3MGQ C;  4EO5 C;  3AZH B;  5B1L B;  5BNX B;  5BO0 A;  4LD9 D;  5DNN B;  5B24 B;  3AZF A;  5GT3 B;  3UTA B;  4WU8 A;  2ZY4 A;  3VH5 T;  4LD9 A;  3AZK B;  1P3B D;  3REH B;  3X1S B;  2Y2P A;  3WTP B;  5B32 C;  4KHA B;  1BH9 A;  5JA4 A;  4YM6 D;  4J8W C;  1P3B A;  4H9Q B;  5F99 B;  3C1C C;  3AZN B;  5CPJ B;  5B31 G;  3MGR C;  1M1A D;  4KGC C;  3MVD C;  4DRB A;  5CPK B;  4YM6 A;  5BNV A;  1F1E A;  2RVQ C;  4JJN B;  2Y2M A;  4UUZ B;  1KX4 C;  5GXQ C;  3LJA B;  1M1A A;  5B40 D;  3WA9 B;  5AV9 B;  1KX3 D;  1M18 B;  3V9R A;  2NQB B;  3WAA C;  3W98 B;  2ZM5 A;  3LZ0 D;  5B40 A;  4XZQ C;  5BO0 B;  4AWL C;  2YFW A;  3AZI D;  1WWI A;  1EQZ D;  1KX3 A;  3AN2 D;  3UTB C;  2NZD C;  3AZF B;  3LZ0 A;  4WU8 B;  3AZG D;  4H9O A;  1EQZ A;  3AZI A;  2Y2G A;  3REK C;  3W97 C;  3AN2 A;  3X1T C;  4LD9 B;  4HGA B;  3AYW C;  1ZLA D;  2IO5 C;  5AY8 C;  3MNN C;  4Z5T D;  3AZG A;  1P3K C;  2JCH A;  3MGS C;  3MGP D;  4UPK A;  3TU4 D;  1BH9 B;  3H0M C;  5JA4 B;  3AZL D;  5AVB C;  1ZLA A;  1P3B B;  3NQU A;  4Z5T A;  1P3A D;  3MGP A;  1S32 C;  3TU4 A;  4YM6 B;  5BNV B;  3AZL A;  1P3P D;  4WJ3 C;  5AVC C;  4G91 B;  2JSS A;  5E5A D;  1P3I D;  1P3A A;  1M1A B;  2ZY3 A;  1Z2C B;  3REL C;  3LEL C;  1TZY D;  1P3P A;  5B1M C;  3V9R B;  5E5A A;  2PYO D;  5GT3 A;  1H3O A;  1P3I A;  1P3O C;  5B40 B;  3REI D;  3KFU G;  5AV8 D;  5CP6 C;  5GT0 C;  3REJ D;  1TZY A;  2YFW B;  4NFT A;  1KX3 B;  4ZBJ C;  2Y2J A;  3O62 C;  5JRG D;  1B67 A;  2PYO A;  5CPI D;  3B6G C;  2F2A C;  3LZ0 B;  3VH6 A;  3REI A;  1U35 D;  3AZE C;  5AV8 A;  3REJ A;  4H9O B;  1EQZ B;  3AZI B;  3AZJ D;  2DF4 C;  3AN2 B;  1P3M B;  3B6F D;  5JRG A;  2CV5 D;  5CPI A;  1U35 A;  3AZG B;  1B6W A;  4R8P D;  3MGQ D;  2W8S A;  3KSY A;  3AZJ A;  1P34 C;  2G5H C;  2F8N G;  3B6F A;  1ZLA B;  2CV5 A;  3AZH C;  3A1I A;  3NQU B;  5FUG A;  4Z5T B;  4R8P A;  3MGP B;  3KWQ D;  3MGQ A;  3TU4 B;  4WZS B;  3AZL B;  2DQN C;  3W99 C;  1P3A B;  3X1V D;  3KWQ A;  5B32 D;  2Y2L A;  3KXB D;  1P3P B;  4H9R A;  2Y2I A;  3VH6 T;  3WTP C;  4J8W D;  5E5A B;  1P3I B;  1H3O B;  4E45 A;  3C1C D;  3X1V A;  3MGR D;  5B32 A;  3KXB A;  1TZY B;  2Y2N A;  4J8W A;  1Q9C A;  4G92 B;  2PYO B;  3C1C A;  2Y2H A;  3B0C W;  3REI B;  5GXQ D;  1KX4 D;  3A6N C;  5AV8 B;  3MGR A;  2XD5 A;  3REJ B;  4JJN C;  5GSU D;  5CHL B;  4E44 A;  3LZ1 C;  3LJA C;  5JRG B;  3B0C T;  5B33 C;  1P3L C;  5B2I D;  5CPI B;  3B0B A;  1WWS A;  3UT9 D;  5GXQ A;  1U35 B;  1KX4 A;  1AOI D;  2HUE C;  2RIQ A;  5GSU A;  5B0Y D;  3AZJ B;  2Y2K A;  1BH8 A;  2ARO C;  4X23 C;  3B6F B;  2NZD D;  2CWE A;  2CV5 B;  5B2I A;  3AV2 C;  1AOI A;  3UT9 A;  1BFM A;  2XD1 A;  4NE3 A;  5FUG B;  4R8P B;  1KU5 A;  4YS3 D;  3MGQ B;  2ZY2 A;  4EO5 B;  5B0Y A;  3FDD A;  3W97 D;  2UWX A;  2NZD A;  4WNN A;  3X1T D;  4Z66 D;  5B31 D;  3R45 A;  3W96 C;  5AY8 D;  3MNN D;  2Y2Q A;  3KWQ B;  4YS3 A;  1P3K D;  4ZUX D;  4XUJ D;  4H9R B;  3X1U C;  3W97 A;  1P3F C;  3X1T A;  5AVB D;  2VQR A;  4Z66 A;  5B31 A;  1P3M D;  3X1V B;  5AY8 A;  3MNN A;  3KUY C;  1P3K A;  5B32 B;  4ZUX A;  4XUJ A;  3KXB B;  1P3B C;  5C3I C;  5AVC D;  5AVB A;  4J8W B;  5BT1 C;  1P3M A;  5B2J C;  3C1C B;  4J8U C;  4M6B A;  3MGR B;  4J8X D;  3REL D;  1F66 C;  3LEL D;  5AVC A;  5B1M D;  3IP4 C;  1KX4 B;  5GXQ B;  4J8V C;  4J8X A;  1P3O D;  3REL A;  3WKJ C;  5CP6 D;  5GSU B;  5G49 A;  5GT0 D;  3AV1 C;  3LEL A;  1BH8 B;  5B1M A;  5B2I B;  3O62 D;  1HQ3 D;  1AOI B;  3UT9 B;  3B6G D;  1P3O A;  5AV5 D;  1ID3 C;  2HIO D;  5CP6 A;  5GT0 A;  5B0Y B;  4AWL B;  1KX5 C;  4KUD C;  2NZD B;  4WNN B;  1N1J A;  3O62 A;  1HQ3 A;  1P3G C;  3B6G A;  3R45 B;  4DRA A;  5AV5 A;  4Z2M H;  2HIO A;  3AN2 C;  4YS3 B;  4WV4 B;  2FJ7 C;  3W97 B;  1ULY A;  3EPJ A;  3X1T B;  4Z66 B;  5B31 B;  2FFF B;  5AY8 B;  3MNN B;  1P3K B;  3AFA C;  4ZUX B;  1ZLA C;  4XUJ B;  4QLC C;  3AZM C;  2ZY5 A;  5B0Z D;  4Z5T C;  3W99 D;  5AVB B;  4WU9 D;  5DNM C;  1M19 C;  5AV6 D;  3C1B C;  3EG5 B;  5B0Z A;  5BS7 C;  5AVC B;  3W99 A;  1R4V A;  4WU9 A;  4NE5 A;  5AV6 A;  5B1L C;  4J8X B;  3REL B;  5DNN C;  5G49 B;  5B24 C;  3LEL B;  3H0R C;  5GT3 C;  1P3I C;  3UTA C;  5B1M B;  4H9N A;  2YFV A;  1P3O B;  3A6N D;  5CP6 B;  5GT0 B;  3AZK C;  2PYO C;  2F8N D;  3B0D B;  3LZ1 D;  3REH C;  3REI C;  1N1J B;  3O62 B;  3X1S C;  1HQ3 B;  5B33 D;  1P3L D;  3B6G B;  5AV5 B;  3A6N A;  3EPK A;  2HIO B;  5JRG C;  4KGC D;  2F8N A;  3MVD D;  3LZ1 A;  1U35 C;  4X23 D;  2ARO D;  5F99 C;  1TAF A;  3AZN C;  5CPJ C;  5B33 A;  1P3L A;  1W2E A;  2G5I C;  2RVQ D;  3AV2 D;  3A1K A;  5CPK C;  3NQJ A;  3B6F C;  2CV5 C;  4KGC A;  3MVD A;  4H9P A;  4X23 A;  2ARO A;  1JFI A;  3AV2 A;  3WA9 C;  5AV9 C;  4CSR A;  3WAA D;  3W96 D;  3VH5 W;  4XZQ D;  5B0Z B;  1M18 C;  3X1U D;  2J8P A;  2NQB C;  3W98 C;  1P3F D;  3W99 B;  2JE5 A;  3KWQ C;  3UTB D;  4WU9 B; 
#chains in the Genus database with same CATH homology
 4H9S C;  3WAA A;  3W96 A;  5AV6 B;  3KUY D;  2LY8 A;  4XZQ A;  3AZF C;  3X1U A;  3X1V C;  1P3F A;  4H9N B;  4WU8 C;  3REK D;  3UTB A;  5BT1 D;  2YFV B;  5B2J D;  4J8U D;  3AYW D;  3KXB C;  3KUY A;  3EPH A;  4LD9 C;  1F66 D;  3MGS D;  4HGA C;  3WTP E;  3REK A;  3P5J B;  5B2J A;  4J8U A;  3AYW A;  1PZR A;  3A6N B;  4J8V D;  1F66 A;  3WKJ D;  3AV1 D;  3MGS A;  2F8N B;  3LZ1 B;  1A7W A;  1S32 D;  1TAF B;  5B33 B;  1P3L B;  5GSU C;  2BYK A;  3NQJ B;  2HUE B;  4J8V A;  4YM6 C;  1ID3 D;  3WKJ A;  4KGC B;  5B2I C;  3AV1 A;  3MVD B;  4G91 C;  1S32 A;  4H9P B;  4X23 B;  2ARO B;  3UT9 C;  1KX5 D;  1AOI C;  4KUD D;  1JFI B;  3AV2 B;  1M1A C;  1P3G D;  5B0Y C;  4CSR B;  3AL0 C;  1ID3 A;  1KX5 A;  2FJ7 D;  4KUD A;  1HTA A;  5B40 C;  4YS3 C;  1P3G A;  2F8N H;  3WAA B;  3W96 B;  3AFA D;  3AZE D;  4XZQ B;  4Z66 C;  1KX3 C;  5B31 C;  4QLC D;  3X1U B;  2F8N K;  3AZM D;  2FJ7 A;  1P3F B;  3LZ0 C;  3UTB B;  4ZUX C;  4XUJ C;  3KUY B;  5DNM D;  1M19 D;  3AFA A;  3C1B D;  3AZI C;  3AZE A;  1EQZ C;  1P3M C;  4QLC A;  5C3I B;  3AZM A;  4CAY A;  3REK B;  1P34 D;  5B2J B;  3AZG C;  4J8U B;  3AYW B;  2IO5 B;  5DNM A;  5KDM A;  2BYM A;  3AZH D;  1M19 A;  5B1L D;  3C1B A;  1F66 B;  5DNN D;  5B24 D;  3MGS B;  1T3U A;  5BS7 A;  5GT3 D;  3UTA D;  1P34 A;  4J8X C;  2BG1 A;  3MGP C;  2BYK B;  3AZH A;  4J8V B;  2L5A A;  5BNX A;  5B1L A;  3TU4 C;  3AZL C;  3WKJ B;  5DNN A;  5B24 A;  3AV1 B;  3AZK D;  1S32 B;  3UTA A;  3REH D;  1P3A C;  3X1S D;  4DQY B;  4NE6 A;  3H0L C;  3WTP D;  3B0D C;  3F6T A;  1ID3 B;  1P3P C;  3AZK A;  1HQ3 C;  1KX5 B;  4KUD B;  5E5A C;  3REH A;  5F99 D;  5AV5 C;  3X1S A;  5CPJ D;  2HIO C;  3EPL A;  3AZN D;  1P3G B;  3WTP A;  5CPK D;  1TZY C;  4KHA A;  3VH5 A;  2FJ7 B;  4JJN D;  4G92 C;  4H9Q A;  5F99 A;  3AZN A;  5CPJ A;  4ZBJ B;  3LJA D;  5AV8 C;  3WA9 D;  3REJ C;  5AV9 D;  5CPK A;  5B32 G;  3AFA B;  3AZE B;  4QLC B;  3AZM B;  4JJN A;  2Y2O A;  1M18 D;  5CPI C;  2NQB D;  4UUZ A;  4CAY B;  3W98 D;  3LJA A;  3WA9 A;  5AV9 A;  5KDM B;  2BYM B;  5B0Z C;  5DNM B;  1M19 B;  3C1B B;  3AZJ C;  4WU9 C;  3AZF D;  1M18 A;  2NQB A;  3W98 A;  3VH6 W;  4Z2M G;  5AV6 C;  1P34 B;  4WU8 D;  4R8P C;  4H9S A;  3MGQ C;  4EO5 C;  3AZH B;  5B1L B;  5BNX B;  5BO0 A;  4LD9 D;  5DNN B;  5B24 B;  3AZF A;  5GT3 B;  3UTA B;  4WU8 A;  2ZY4 A;  3VH5 T;  4LD9 A;  3AZK B;  1P3B D;  3REH B;  3X1S B;  2Y2P A;  3WTP B;  5B32 C;  4KHA B;  1BH9 A;  5JA4 A;  4YM6 D;  4J8W C;  1P3B A;  4H9Q B;  5F99 B;  3C1C C;  3AZN B;  5CPJ B;  5B31 G;  3MGR C;  1M1A D;  4KGC C;  3MVD C;  4DRB A;  5CPK B;  4YM6 A;  5BNV A;  1F1E A;  2RVQ C;  4JJN B;  2Y2M A;  4UUZ B;  1KX4 C;  5GXQ C;  3LJA B;  1M1A A;  5B40 D;  3WA9 B;  5AV9 B;  1KX3 D;  1M18 B;  3V9R A;  2NQB B;  3WAA C;  3W98 B;  2ZM5 A;  3LZ0 D;  5B40 A;  4XZQ C;  5BO0 B;  4AWL C;  2YFW A;  3AZI D;  1WWI A;  1EQZ D;  1KX3 A;  3AN2 D;  3UTB C;  2NZD C;  3AZF B;  3LZ0 A;  4WU8 B;  3AZG D;  4H9O A;  1EQZ A;  3AZI A;  2Y2G A;  3REK C;  3W97 C;  3AN2 A;  3X1T C;  4LD9 B;  4HGA B;  3AYW C;  1ZLA D;  2IO5 C;  5AY8 C;  3MNN C;  4Z5T D;  3AZG A;  1P3K C;  2JCH A;  3MGS C;  3MGP D;  4UPK A;  3TU4 D;  1BH9 B;  3H0M C;  5JA4 B;  3AZL D;  5AVB C;  1ZLA A;  1P3B B;  3NQU A;  4Z5T A;  1P3A D;  3MGP A;  1S32 C;  3TU4 A;  4YM6 B;  5BNV B;  3AZL A;  1P3P D;  4WJ3 C;  5AVC C;  4G91 B;  2JSS A;  5E5A D;  1P3I D;  1P3A A;  1M1A B;  2ZY3 A;  1Z2C B;  3REL C;  3LEL C;  1TZY D;  1P3P A;  5B1M C;  3V9R B;  5E5A A;  2PYO D;  5GT3 A;  1H3O A;  1P3I A;  1P3O C;  5B40 B;  3REI D;  3KFU G;  5AV8 D;  5CP6 C;  5GT0 C;  3REJ D;  1TZY A;  2YFW B;  4NFT A;  1KX3 B;  4ZBJ C;  2Y2J A;  3O62 C;  5JRG D;  1B67 A;  2PYO A;  5CPI D;  3B6G C;  2F2A C;  3LZ0 B;  3VH6 A;  3REI A;  1U35 D;  3AZE C;  5AV8 A;  3REJ A;  4H9O B;  1EQZ B;  3AZI B;  3AZJ D;  2DF4 C;  3AN2 B;  1P3M B;  3B6F D;  5JRG A;  2CV5 D;  5CPI A;  1U35 A;  3AZG B;  1B6W A;  4R8P D;  3MGQ D;  2W8S A;  3KSY A;  3AZJ A;  1P34 C;  2G5H C;  2F8N G;  3B6F A;  1ZLA B;  2CV5 A;  3AZH C;  3A1I A;  3NQU B;  5FUG A;  4Z5T B;  4R8P A;  3MGP B;  3KWQ D;  3MGQ A;  3TU4 B;  4WZS B;  3AZL B;  2DQN C;  3W99 C;  1P3A B;  3X1V D;  3KWQ A;  5B32 D;  2Y2L A;  3KXB D;  1P3P B;  4H9R A;  2Y2I A;  3VH6 T;  3WTP C;  4J8W D;  5E5A B;  1P3I B;  1H3O B;  4E45 A;  3C1C D;  3X1V A;  3MGR D;  5B32 A;  3KXB A;  1TZY B;  2Y2N A;  4J8W A;  1Q9C A;  4G92 B;  2PYO B;  3C1C A;  2Y2H A;  3B0C W;  3REI B;  5GXQ D;  1KX4 D;  3A6N C;  5AV8 B;  3MGR A;  2XD5 A;  3REJ B;  4JJN C;  5GSU D;  5CHL B;  4E44 A;  3LZ1 C;  3LJA C;  5JRG B;  3B0C T;  5B33 C;  1P3L C;  5B2I D;  5CPI B;  3B0B A;  1WWS A;  3UT9 D;  5GXQ A;  1U35 B;  1KX4 A;  1AOI D;  2HUE C;  2RIQ A;  5GSU A;  5B0Y D;  3AZJ B;  2Y2K A;  1BH8 A;  2ARO C;  4X23 C;  3B6F B;  2NZD D;  2CWE A;  2CV5 B;  5B2I A;  3AV2 C;  1AOI A;  3UT9 A;  1BFM A;  2XD1 A;  4NE3 A;  5FUG B;  4R8P B;  1KU5 A;  4YS3 D;  3MGQ B;  2ZY2 A;  4EO5 B;  5B0Y A;  3FDD A;  3W97 D;  2UWX A;  2NZD A;  4WNN A;  3X1T D;  4Z66 D;  5B31 D;  3R45 A;  3W96 C;  5AY8 D;  3MNN D;  2Y2Q A;  3KWQ B;  4YS3 A;  1P3K D;  4ZUX D;  4XUJ D;  4H9R B;  3X1U C;  3W97 A;  1P3F C;  3X1T A;  5AVB D;  2VQR A;  4Z66 A;  5B31 A;  1P3M D;  3X1V B;  5AY8 A;  3MNN A;  3KUY C;  1P3K A;  5B32 B;  4ZUX A;  4XUJ A;  3KXB B;  1P3B C;  5C3I C;  5AVC D;  5AVB A;  4J8W B;  5BT1 C;  1P3M A;  5B2J C;  3C1C B;  4J8U C;  4M6B A;  3MGR B;  4J8X D;  3REL D;  1F66 C;  3LEL D;  5AVC A;  5B1M D;  3IP4 C;  1KX4 B;  5GXQ B;  4J8V C;  4J8X A;  1P3O D;  3REL A;  3WKJ C;  5CP6 D;  5GSU B;  5G49 A;  5GT0 D;  3AV1 C;  3LEL A;  1BH8 B;  5B1M A;  5B2I B;  3O62 D;  1HQ3 D;  1AOI B;  3UT9 B;  3B6G D;  1P3O A;  5AV5 D;  1ID3 C;  2HIO D;  5CP6 A;  5GT0 A;  5B0Y B;  4AWL B;  1KX5 C;  4KUD C;  2NZD B;  4WNN B;  1N1J A;  3O62 A;  1HQ3 A;  1P3G C;  3B6G A;  3R45 B;  4DRA A;  5AV5 A;  4Z2M H;  2HIO A;  3AN2 C;  4YS3 B;  4WV4 B;  2FJ7 C;  3W97 B;  1ULY A;  3EPJ A;  3X1T B;  4Z66 B;  5B31 B;  2FFF B;  5AY8 B;  3MNN B;  1P3K B;  3AFA C;  4ZUX B;  1ZLA C;  4XUJ B;  4QLC C;  3AZM C;  2ZY5 A;  5B0Z D;  4Z5T C;  3W99 D;  5AVB B;  4WU9 D;  5DNM C;  1M19 C;  5AV6 D;  3C1B C;  3EG5 B;  5B0Z A;  5BS7 C;  5AVC B;  3W99 A;  1R4V A;  4WU9 A;  4NE5 A;  5AV6 A;  5B1L C;  4J8X B;  3REL B;  5DNN C;  5G49 B;  5B24 C;  3LEL B;  3H0R C;  5GT3 C;  1P3I C;  3UTA C;  5B1M B;  4H9N A;  2YFV A;  1P3O B;  3A6N D;  5CP6 B;  5GT0 B;  3AZK C;  2PYO C;  2F8N D;  3B0D B;  3LZ1 D;  3REH C;  3REI C;  1N1J B;  3O62 B;  3X1S C;  1HQ3 B;  5B33 D;  1P3L D;  3B6G B;  5AV5 B;  3A6N A;  3EPK A;  2HIO B;  5JRG C;  4KGC D;  2F8N A;  3MVD D;  3LZ1 A;  1U35 C;  4X23 D;  2ARO D;  5F99 C;  1TAF A;  3AZN C;  5CPJ C;  5B33 A;  1P3L A;  1W2E A;  2G5I C;  2RVQ D;  3AV2 D;  3A1K A;  5CPK C;  3NQJ A;  3B6F C;  2CV5 C;  4KGC A;  3MVD A;  4H9P A;  4X23 A;  2ARO A;  1JFI A;  3AV2 A;  3WA9 C;  5AV9 C;  4CSR A;  3WAA D;  3W96 D;  3VH5 W;  4XZQ D;  5B0Z B;  1M18 C;  3X1U D;  2J8P A;  2NQB C;  3W98 C;  1P3F D;  3W99 B;  2JE5 A;  3KWQ C;  3UTB D;  4WU9 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...