5AV9C

Human nucleosome core particle
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
106
structure length
106
Chain Sequence
KAKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein/dna
molecule keywords Histone H3.1
publication title Intra- and inter-nucleosomal interactions of the histone H4 tail revealed with a human nucleosome core particle with genetically-incorporated H4 tetra-acetylation
pubmed doi rcsb
source organism Homo sapiens
total genus 32
structure length 106
sequence length 106
chains with identical sequence G
ec nomenclature
pdb deposition date 2015-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5av9C00
5B32B 1P3LC 1P3GC 3LJAD 3RELA 5DNND 3C1BC 2BYKA 5GSUC 3AFAB 4UUZB 5AV9C 3X1SD 2BYMB 3UTAB 5AV6A 3REKC 2PYOD 3LZ1B 3WA9D 5FUGB 4DRAA 3AZGB 2YFWB 2LY8A 5CPJD 1M18B 3AZMB 5AV5A 3KXBB 5B2JD 3MGQC 1P3OB 3REJC 3WAAD 4YM6A 4H9PA 4J8VB 3VH5T 3VH5W 5AV6D 1AOIB 3AV2B 3B6FC 1P3FB 3LELA 1F1EA 3KUYC 1ID3D 1P3MB 3KWQD 3MGPC 4WNNA 5BO0B 5B32A 1A7WA 1EQZB 4M6BA 2JSSA 4YM6D 5B0YC 1P34D 3TU4A 4AWLB 3AFAA 3LELD 1B67A 4UUZA 5B1MB 5JRGB 2BYMA 3UTAA 4XUJC 3LZ1A 5B32D 4WU9D 1KX5B 5FUGA 1P3IC 4JJNB 1TAFB 3O62B 2YFWA 3AZGA 1HTAA 1M18A 3TU4D 4LD9C 3W99B 2AROB 3KXBA 1P3OA 4Z2MH 1P3AB 3UTAD 5E5AD 5B31C 4J8VA 5B0ZB 4E44A 1P3FA 1P3MA 3MGRC 5C3IB 1EQZA 1N1JB 3C1CC 2IO5B 5F99A 3W98B 5B33B 1M19B 3X1TB 4ZUXC 4J8XD 5B1MA 5CP6C 5DNMA 5JRGA 1P3KC 1P3MD 3AZND 4KUDC 1KX5A 1KX4C 4JJNA 1TAFA 3O62A 3AZLD 4J8UB 5F99D 3LZ0C 4X23B 3W99A 4YS3C 2AROA 4KGCC 1U35C 2RVQC 3X1UB 3AYWB 4WU8C 5DNMD 1P3AA 2F8NK 4Z5TA 5B0ZA 4J8WD 3UT9B 3AV1C 4G92B 5CPIA 3AZHB 5GXQB 5AVCB 5AVBD 4ZBJC 3B0DB 1N1JA 2CWEA 3W98A 5B33A 1M19A 4Z5TD 4Z66B 5B0ZD 3LJAC 1M1AD 5CPID 5DNNC 1JFIB 3X1SC 4H9OA 5AY8D 3VH6W 4J8UA 2PYOC 3WA9C 4X23A 3AZKB 5B2IB 2NZDD 4R8PB 3X1UA 5CPJC 3AYWA 4G91C 5B2JC 5GT0D 3MNNA 3UT9A 2NQBD 3WAAC 3AZHA 1BFMA 1F66D 5AV6C 4XZQD 5GXQA 3WKJD 2FJ7B 3AZFB 5AV8B 5CPKB 1ID3C 3UTBB 3KWQC 3MGSB 5B40D 1WWIA 1BH8B 3MNND 3AZJB 1KX3B 3R45B 3A6NB 4QLCB 3REHD 3MVDB 4YM6C 1P34C 1JFIA 3LELC 1HQ3B 4H9SA 3REID 1TZYB 5B32C 4WU9C 3B6GB 3AZKA 1ZLAB 5B2IA 3AZEA 3WA9A 4R8PA 1S32D 3TU4C 1P3LB 5BS7A 3RELD 1P3GB 3W97B 3AN2B 3UTAC 5E5AC 3C1BB 3AZKD 4WV4B 2F8NG 3AZED 2FJ7A 3AZFA 5AV9B 2F8NB 3MGSA 3REKB 3W96A 5B1LB 3KXBC 1KX3A 3R45A 3A6NA 5AV5D 4J8VC 4J8XC 1KU5A 1P3MC 3REJB 3AZNC 3B6GA 2HIOB 1ZLAA 3B6FB 3W96D 3AZLC 3KUYB 5F99C 3MGPB 1BH9B 2HUEC 1P3GA 3W97A 4NFTA 3AZMA 3AN2A 5DNMC 5B0YB 3C1BA 4J8WC 3AFAD 3X1VB 5AV9A 1AOIA 3LZ1D 3AV2A 4XUJB 5AVBC 2F8NA 3REKA 5B1LA 3AZGD 1P3IB 3W97D 1M18D 3AZIB 5BO0A 3AZMD 3KXBD 4Z5TC 5B0ZC 1P3OD 4LD9B 1M1AC 5CPIC 5B31G 4J8VD 1AOID 3REJA 4H9QB 3AV2D 5B31B 1P3FD 2HIOA 3B6FA 5B1LD 5AY8C 1H3OB 3KUYA 3MGPA 1BH9A 3MGRB 4NE3A 1EQZD 2NZDC 3C1CB 5B0YA 5GT0C 2NQBC 5B1MD 4ZUXB 5JRGD 3X1VA 1P3KB 1F66C 4J8UC 4XZQC 4XUJA 1KX5D 4KUDB 3WTPB 4JJND 3WKJC 3O62D 4NE5A 1R4VA 1P3IA 1KX4B 4CAYB 3AZIA 1P3PB 3LZ0B 3W99D 5B40C 2AROD 4LD9A 3MNNC 4EO5C 4KGCB 1U35B 4G92C 1P3AD 4H9RB 3REHC 3X1VD 4H9QA 3X1TA 5B31A 3AV1B 5BNVB 1H3OA 3REIC 3V9RB 3MGRA 4ZBJB 1P3BB 1S32C 3VH6T 3C1CA 3NQJB 2CV5B 3W98D 5B33D 1M19D 1B6WA 3X1TD 2F8NH 3RELC 2L5AA 4ZUXA 5G49B 4H9SC 3WTPA 3AZKC 3AZEC 1KX4A 5GT3B 3X1SB 4J8UD 5AVCA 1P3PA 4X23D 3LZ0A 3VH5A 4KGCA 3X1UD 1U35A 3AYWD 4H9RA 5CPJB 5AV5C 4Z66A 3UT9D 4HGAB 4G91B 5B2JB 3AV1A 3AZHD 5BNVA 3WAAB 5GXQD 5AVCD 3V9RA 1P3PD 4KHAB 3W96C 1P3BA 4WZSB 5B24B 2CV5A 3NQJA 1ID3B 3KWQB 4Z66D 3NQUB 5G49A 4YM6B 1P34B 3AFAC 1P3BD 5GT3A 5B32G 3X1SA 2CV5D 3LZ1C 5B2ID 4WU9B 5GSUB 3AZGC 5AV8A 5CPKA 4R8PD 3W97C 3UTBA 1M18C 3AZMC 3AN2C 5CPJA 3AZJA 1BH8A 3TU4B 1P3OC 4QLCA 5B2JA 3MVDA 5GT3D 1AOIC 3WAAA 3AV2C 5E5AB 1P3FC 4KHAA 3MGQB 1HQ3A 5B1LC 5AV8D 3AZFD 5CPKD 2FJ7D 5B24A 4H9NB 3UTBD 1TZYA 3MGSD 1ID3A 3KWQA 1EQZC 5BT1D 3AZJD 1KX3D 3NQUA 4QLCD 3A6ND 3MVDD 1P3LA 1P34A 4AWLC 2HIOC 3WTPE 5B1MC 1HQ3D 4J8XB 5JRGC 5B24D 1TZYD 1KX5C 3B6GD 3AZNB 1ZLAD 4WU9A 4JJNC 5GSUA 4CSRB 3O62C 3AZLB 1WWSA 5F99B 3W99C 1P3LD 2AROC 2HUEB 1P3GD 3AN2D 1P3AC 3X1VC 5DNMB 1ULYA 5JA4B 5E5AA 3C1BD 3MGQA 4J8WB 5GSUD 5AV9D 4H9NA 2F8ND 3AZIC 3REKD 5C3IC 5AVBB 2IO5C 3W98C 5B33C 1M19C 3X1TC 3B0CT 3B0CW 3VH6A 4Z5TB 3MGQD 1M1AB 4J8XA 5CPIB 3REJD 3KSYA 2HIOD 5BNXB 3AZNA 3B6FD 4E45A 4CSRA 5CP6B 2YFVB 3AZLA 3KUYD 5AY8B 3MGPD 4X23C 5CHLB 3X1UC 2NZDB 3AYWC 5JA4A 5B0YD 3UT9C 4YS3B 3WTPC 5GT0B 4J8WA 2NQBB 3AZHC 4WU8B 4H9OB 5GXQC 4XUJD 5AVCC 1P3PC 1F66B 3B0DC 4XZQB 5AVBA 1P3ID 3WKJB 3AZID 4Z66C 4LD9D 5B40B 3MNNB 4EO5B 1M1AA 3REHB 5B31D 5BNXA 3LJAB 1P3BC 5CP6A 2YFVA 4Z2MG 1P3KA 5AY8A 2CV5C 5DNNB 3MGRD 3REIB 4KUDA 5B2IC 4R8PC 5KDMB 2NZDA 4CAYA 3C1CD 1S32B 2PYOB 3WA9B 5BS7C 4YS3A 5GT0A 2NQBA 4ZUXD 3RELB 5GT3C 5CP6D 4NE6A 4WU8A 1P3KD 1F66A 4KUDD 4XZQA 3WTPD 2BYKB 3B0BA 1KX4D 2FJ7C 3AZFC 5AV8C 5CPKC 3WKJA 3AZEB 3UTBC 3MGSC 5AV6B 3LZ0D 5BT1C 3AZJC 5B40A 4HGAC 4YS3D 1KX3C 3A6NC 4QLCC 1U35D 2RVQD 4KGCD 3MVDC 4WU8D 3REHA 5AV5B 3LJAA 1HQ3C 3AV1D 5B24C 1TZYC 4H9PB 5DNNA 3REIA 3B6GC 1ZLAC 3LELB 3W96B 5KDMA 1Q9CA 1S32A 4DRBA 2PYOA 4WNNB
chains in the Genus database with same CATH superfamily
5B32B 1P3LC 1P3GC 3LJAD 3RELA 5DNND 3C1BC 2BYKA 5GSUC 3AFAB 3KFUG 4UUZB 5AV9C 3X1SD 2BYMB 3UTAB 5AV6A 3REKC 2PYOD 3LZ1B 2Y2PA 3WA9D 5FUGB 2F2AC 4DRAA 3H0MC 3AZGB 2YFWB 2LY8A 5CPJD 1M18B 3AZMB 2Y2NA 5AV5A 3KXBB 5B2JD 3MGQC 1P3OB 2Y2QA 3REJC 3WAAD 4YM6A 4H9PA 4J8VB 3VH5T 3VH5W 5AV6D 1AOIB 3AV2B 3B6FC 1P3FB 2XD5A 3LELA 1F1EA 3KUYC 1ID3D 1P3MB 3KWQD 3MGPC 4WNNA 5BO0B 5B32A 1A7WA 1EQZB 4M6BA 2JSSA 4YM6D 5B0YC 1P34D 3TU4A 4AWLB 3AFAA 3LELD 1B67A 4UUZA 5B1MB 5JRGB 2BYMA 3UTAA 4XUJC 3LZ1A 5B32D 4WU9D 2G5HC 1KX5B 5FUGA 1P3IC 4JJNB 1TAFB 3O62B 2YFWA 3AZGA 1HTAA 1M18A 3TU4D 4LD9C 3W99B 2AROB 3KXBA 1P3OA 4Z2MH 1P3AB 3UTAD 5E5AD 5B31C 4J8VA 5B0ZB 4E44A 1P3FA 1P3MA 3MGRC 5C3IB 1EQZA 1N1JB 3C1CC 2IO5B 3AL0C 5F99A 3W98B 5B33B 1M19B 3X1TB 2DQNC 4ZUXC 4J8XD 5B1MA 1PZRA 5CP6C 5DNMA 5JRGA 1P3KC 1P3MD 3AZND 4KUDC 3A1KA 1KX5A 1KX4C 4JJNA 1TAFA 3O62A 3AZLD 2Y2HA 4J8UB 5F99D 3LZ0C 4X23B 3W99A 4YS3C 2AROA 4KGCC 1U35C 2RVQC 3X1UB 3AYWB 4WU8C 5DNMD 1P3AA 2F8NK 4Z5TA 5B0ZA 4J8WD 3UT9B 3AV1C 4G92B 5CPIA 3AZHB 5GXQB 5AVCB 5AVBD 4ZBJC 3B0DB 2RIQA 1N1JA 2ZY5A 2ZY3A 2CWEA 2Y2IA 3W98A 5B33A 1M19A 4Z5TD 4Z66B 5B0ZD 3LJAC 1M1AD 5CPID 5DNNC 1JFIB 4DQYB 3X1SC 4H9OA 5AY8D 3VH6W 4J8UA 2PYOC 3WA9C 4X23A 3AZKB 5B2IB 2NZDD 4R8PB 3X1UA 5CPJC 3AYWA 4G91C 5B2JC 5GT0D 3MNNA 3UT9A 2NQBD 3WAAC 3AZHA 1BFMA 2DF4C 1F66D 5AV6C 4XZQD 5GXQA 3WKJD 2FJ7B 3AZFB 5AV8B 5CPKB 1ID3C 3UTBB 4WJ3C 3KWQC 3MGSB 5B40D 1WWIA 1BH8B 3MNND 3AZJB 1KX3B 3R45B 3A6NB 4QLCB 3REHD 3MVDB 4YM6C 1P34C 1JFIA 3LELC 1HQ3B 4H9SA 3REID 1TZYB 5B32C 4WU9C 3B6GB 3AZKA 1ZLAB 5B2IA 3A1IA 3AZEA 3WA9A 4R8PA 1S32D 3TU4C 1P3LB 5BS7A 3RELD 1P3GB 3W97B 3AN2B 3UTAC 5E5AC 3C1BB 3AZKD 4WV4B 2XD1A 2F8NG 3AZED 2FJ7A 3AZFA 2JCHA 5AV9B 2F8NB 3MGSA 3REKB 3W96A 5B1LB 3KXBC 1KX3A 3R45A 3A6NA 5AV5D 4J8VC 4J8XC 1KU5A 1P3MC 3REJB 3AZNC 3B6GA 2HIOB 1ZLAA 3B6FB 3W96D 3AZLC 2Y2OA 3KUYB 5F99C 3MGPB 1BH9B 2HUEC 1P3GA 3W97A 4NFTA 3AZMA 3AN2A 5DNMC 5B0YB 3C1BA 4J8WC 3AFAD 3X1VB 5AV9A 1AOIA 3LZ1D 3AV2A 4XUJB 5AVBC 2F8NA 3REKA 5B1LA 3AZGD 1P3IB 3W97D 1M18D 3AZIB 5BO0A 3AZMD 2VQRA 3KXBD 4Z5TC 5B0ZC 1P3OD 4LD9B 1M1AC 5CPIC 5B31G 4J8VD 1AOID 3REJA 2Y2MA 4H9QB 3AV2D 5B31B 1P3FD 2HIOA 3B6FA 5B1LD 5AY8C 1H3OB 3KUYA 3MGPA 1BH9A 3MGRB 4NE3A 1EQZD 2NZDC 3C1CB 3IP4C 5B0YA 5GT0C 2Y2KA 2NQBC 5B1MD 4ZUXB 5JRGD 3FDDA 3X1VA 1P3KB 1F66C 4J8UC 4XZQC 4XUJA 1KX5D 2ZY2A 4KUDB 3WTPB 3EPKA 4JJND 3WKJC 3O62D 4NE5A 1R4VA 1P3IA 1KX4B 4CAYB 3AZIA 1P3PB 3LZ0B 3W99D 5B40C 2AROD 4LD9A 3MNNC 4EO5C 4KGCB 1U35B 4G92C 1P3AD 4H9RB 3REHC 3X1VD 4H9QA 3EPLA 3X1TA 5B31A 3AV1B 5BNVB 1H3OA 3REIC 3V9RB 3MGRA 4ZBJB 1P3BB 1S32C 3VH6T 3C1CA 3NQJB 2CV5B 3W98D 5B33D 1M19D 1B6WA 3X1TD 2F8NH 3RELC 2L5AA 4ZUXA 5G49B 4H9SC 3WTPA 3AZKC 3AZEC 1KX4A 5GT3B 3X1SB 1Z2CB 4J8UD 5AVCA 1P3PA 2FFFB 4X23D 3LZ0A 3VH5A 4KGCA 3X1UD 1U35A 3AYWD 4H9RA 5CPJB 5AV5C 4Z66A 3UT9D 4HGAB 4G91B 5B2JB 3AV1A 3AZHD 5BNVA 3WAAB 5GXQD 5AVCD 3V9RA 1P3PD 4KHAB 3W96C 1P3BA 4WZSB 5B24B 2CV5A 3NQJA 1ID3B 3KWQB 4Z66D 3NQUB 1W2EA 5G49A 3EPJA 4UPKA 4YM6B 1P34B 3EPHA 3AFAC 2ZM5A 1P3BD 5GT3A 5B32G 3X1SA 2CV5D 3LZ1C 5B2ID 4WU9B 5GSUB 2Y2GA 5AV8A 3AZGC 4R8PD 5CPKA 3W97C 3UTBA 1M18C 3AZMC 3AN2C 5CPJA 3AZJA 1BH8A 3TU4B 1P3OC 4QLCA 5B2JA 3MVDA 5GT3D 1AOIC 3WAAA 3AV2C 5E5AB 1P3FC 4KHAA 3MGQB 1HQ3A 5B1LC 5AV8D 3AZFD 5CPKD 2FJ7D 5B24A 4H9NB 3UTBD 1TZYA 3MGSD 1ID3A 3KWQA 3P5JB 5BT1D 1EQZC 3AZJD 1KX3D 3NQUA 4QLCD 3H0LC 2W8SA 3A6ND 3MVDD 1P3LA 1P34A 4AWLC 2HIOC 3WTPE 5B1MC 1HQ3D 4J8XB 5JRGC 5B24D 1TZYD 1KX5C 3B6GD 3AZNB 1ZLAD 4WU9A 4JJNC 5GSUA 4CSRB 3O62C 2ZY4A 3AZLB 1WWSA 5F99B 3W99C 1P3LD 2AROC 2HUEB 1P3GD 3AN2D 1P3AC 3X1VC 5DNMB 1ULYA 5JA4B 2Y2LA 5E5AA 3C1BD 3MGQA 4J8WB 5GSUD 5AV9D 4H9NA 2F8ND 3AZIC 3REKD 5C3IC 5AVBB 2IO5C 3W98C 2UWXA 5B33C 1M19C 3H0RC 3X1TC 3B0CT 3B0CW 3VH6A 4Z5TB 3MGQD 1M1AB 4J8XA 5CPIB 3REJD 2J8PA 3KSYA 2HIOD 5BNXB 3AZNA 3B6FD 4E45A 4CSRA 5CP6B 2YFVB 3AZLA 3KUYD 5AY8B 3MGPD 4X23C 5CHLB 3X1UC 2NZDB 1T3UA 3AYWC 5JA4A 5B0YD 3UT9C 4YS3B 3WTPC 2JE5A 5GT0B 4J8WA 2NQBB 3AZHC 4WU8B 4H9OB 5GXQC 4XUJD 5AVCC 1P3PC 1F66B 3B0DC 4XZQB 5AVBA 1P3ID 3WKJB 3AZID 4Z66C 4LD9D 5B40B 3MNNB 4EO5B 1M1AA 3REHB 5B31D 5BNXA 3LJAB 1P3BC 5CP6A 2YFVA 4Z2MG 1P3KA 5AY8A 2CV5C 5DNNB 3MGRD 3REIB 4KUDA 5B2IC 4R8PC 5KDMB 2NZDA 4CAYA 3C1CD 1S32B 2PYOB 3WA9B 5BS7C 4YS3A 2BG1A 5GT0A 2NQBA 4ZUXD 3RELB 5GT3C 5CP6D 4NE6A 4WU8A 1P3KD 1F66A 4KUDD 4XZQA 3WTPD 2BYKB 3B0BA 1KX4D 2FJ7C 3AZFC 5AV8C 5CPKC 3EG5B 3WKJA 3AZEB 3UTBC 3MGSC 5AV6B 3LZ0D 5BT1C 3AZJC 5B40A 4HGAC 4YS3D 1KX3C 3A6NC 4QLCC 1U35D 2RVQD 4KGCD 3MVDC 2Y2JA 4WU8D 3REHA 5AV5B 3F6TA 3LJAA 1HQ3C 3AV1D 5B24C 1TZYC 2G5IC 4H9PB 5DNNA 3REIA 3B6GC 1ZLAC 3LELB 3W96B 5KDMA 1Q9CA 1S32A 4DRBA 2PYOA 4WNNB
chains in the Genus database with same CATH topology
5B32B 1P3LC 1P3GC 3LJAD 3RELA 5DNND 3C1BC 2BYKA 5GSUC 3AFAB 3KFUG 4UUZB 5AV9C 3X1SD 2BYMB 3UTAB 5AV6A 3REKC 2PYOD 3LZ1B 2Y2PA 3WA9D 5FUGB 2F2AC 4DRAA 3H0MC 3AZGB 2YFWB 2LY8A 5CPJD 1M18B 3AZMB 2Y2NA 5AV5A 3KXBB 5B2JD 3MGQC 1P3OB 2Y2QA 3REJC 3WAAD 4YM6A 4H9PA 4J8VB 3VH5T 3VH5W 5AV6D 1AOIB 3AV2B 3B6FC 1P3FB 2XD5A 3LELA 1F1EA 3KUYC 1ID3D 1P3MB 3KWQD 3MGPC 4WNNA 5BO0B 5B32A 1A7WA 1EQZB 4M6BA 2JSSA 4YM6D 5B0YC 1P34D 3TU4A 4AWLB 3AFAA 3LELD 1B67A 4UUZA 5B1MB 5JRGB 2BYMA 3UTAA 4XUJC 3LZ1A 5B32D 4WU9D 2G5HC 1KX5B 5FUGA 1P3IC 4JJNB 1TAFB 3O62B 2YFWA 3AZGA 1HTAA 1M18A 3TU4D 4LD9C 3W99B 2AROB 3KXBA 1P3OA 4Z2MH 1P3AB 3UTAD 5E5AD 5B31C 4J8VA 5B0ZB 4E44A 1P3FA 1P3MA 3MGRC 5C3IB 1EQZA 1N1JB 3C1CC 2IO5B 3AL0C 5F99A 3W98B 5B33B 1M19B 3X1TB 2DQNC 4ZUXC 4J8XD 5B1MA 1PZRA 5CP6C 5DNMA 5JRGA 1P3KC 1P3MD 3AZND 4KUDC 3A1KA 1KX5A 1KX4C 4JJNA 1TAFA 3O62A 3AZLD 2Y2HA 4J8UB 5F99D 3LZ0C 4X23B 3W99A 4YS3C 2AROA 4KGCC 1U35C 2RVQC 3X1UB 3AYWB 4WU8C 5DNMD 1P3AA 2F8NK 4Z5TA 5B0ZA 4J8WD 3UT9B 3AV1C 4G92B 5CPIA 3AZHB 5GXQB 5AVCB 5AVBD 4ZBJC 3B0DB 2RIQA 1N1JA 2ZY5A 2ZY3A 2CWEA 2Y2IA 3W98A 5B33A 1M19A 4Z5TD 4Z66B 5B0ZD 3LJAC 1M1AD 5CPID 5DNNC 1JFIB 4DQYB 3X1SC 4H9OA 5AY8D 3VH6W 4J8UA 2PYOC 3WA9C 4X23A 3AZKB 5B2IB 2NZDD 4R8PB 3X1UA 5CPJC 3AYWA 4G91C 5B2JC 5GT0D 3MNNA 3UT9A 2NQBD 3WAAC 3AZHA 1BFMA 2DF4C 1F66D 5AV6C 4XZQD 5GXQA 3WKJD 2FJ7B 3AZFB 5AV8B 5CPKB 1ID3C 3UTBB 4WJ3C 3KWQC 3MGSB 5B40D 1WWIA 1BH8B 3MNND 3AZJB 1KX3B 3R45B 3A6NB 4QLCB 3REHD 3MVDB 4YM6C 1P34C 1JFIA 3LELC 1HQ3B 4H9SA 3REID 1TZYB 5B32C 4WU9C 3B6GB 3AZKA 1ZLAB 5B2IA 3A1IA 3AZEA 3WA9A 4R8PA 1S32D 3TU4C 1P3LB 5BS7A 3RELD 1P3GB 3W97B 3AN2B 3UTAC 5E5AC 3C1BB 3AZKD 4WV4B 2XD1A 2F8NG 3AZED 2FJ7A 3AZFA 2JCHA 5AV9B 2F8NB 3MGSA 3REKB 3W96A 5B1LB 3KXBC 1KX3A 3R45A 3A6NA 5AV5D 4J8VC 4J8XC 1KU5A 1P3MC 3REJB 3AZNC 3B6GA 2HIOB 1ZLAA 3B6FB 3W96D 3AZLC 2Y2OA 3KUYB 5F99C 3MGPB 1BH9B 2HUEC 1P3GA 3W97A 4NFTA 3AZMA 3AN2A 5DNMC 5B0YB 3C1BA 4J8WC 3AFAD 3X1VB 5AV9A 1AOIA 3LZ1D 3AV2A 4XUJB 5AVBC 2F8NA 3REKA 5B1LA 3AZGD 1P3IB 3W97D 1M18D 3AZIB 5BO0A 3AZMD 2VQRA 3KXBD 4Z5TC 5B0ZC 1P3OD 4LD9B 1M1AC 5CPIC 5B31G 4J8VD 1AOID 3REJA 2Y2MA 4H9QB 3AV2D 5B31B 1P3FD 2HIOA 3B6FA 5B1LD 5AY8C 1H3OB 3KUYA 3MGPA 1BH9A 3MGRB 4NE3A 1EQZD 2NZDC 3C1CB 3IP4C 5B0YA 5GT0C 2Y2KA 2NQBC 5B1MD 4ZUXB 5JRGD 3FDDA 3X1VA 1P3KB 1F66C 4J8UC 4XZQC 4XUJA 1KX5D 2ZY2A 4KUDB 3WTPB 3EPKA 4JJND 3WKJC 3O62D 4NE5A 1R4VA 1P3IA 1KX4B 4CAYB 3AZIA 1P3PB 3LZ0B 3W99D 5B40C 2AROD 4LD9A 3MNNC 4EO5C 4KGCB 1U35B 4G92C 1P3AD 4H9RB 3REHC 3X1VD 4H9QA 3EPLA 3X1TA 5B31A 3AV1B 5BNVB 1H3OA 3REIC 3V9RB 3MGRA 4ZBJB 1P3BB 1S32C 3VH6T 3C1CA 3NQJB 2CV5B 3W98D 5B33D 1M19D 1B6WA 3X1TD 2F8NH 3RELC 2L5AA 4ZUXA 5G49B 4H9SC 3WTPA 3AZKC 3AZEC 1KX4A 5GT3B 3X1SB 1Z2CB 4J8UD 5AVCA 1P3PA 2FFFB 4X23D 3LZ0A 3VH5A 4KGCA 3X1UD 1U35A 3AYWD 4H9RA 5CPJB 5AV5C 4Z66A 3UT9D 4HGAB 4G91B 5B2JB 3AV1A 3AZHD 5BNVA 3WAAB 5GXQD 5AVCD 3V9RA 1P3PD 4KHAB 3W96C 1P3BA 4WZSB 5B24B 2CV5A 3NQJA 1ID3B 3KWQB 4Z66D 3NQUB 1W2EA 5G49A 3EPJA 4UPKA 4YM6B 1P34B 3EPHA 3AFAC 2ZM5A 1P3BD 5GT3A 5B32G 3X1SA 2CV5D 3LZ1C 5B2ID 4WU9B 5GSUB 2Y2GA 5AV8A 3AZGC 4R8PD 5CPKA 3W97C 3UTBA 1M18C 3AZMC 3AN2C 5CPJA 3AZJA 1BH8A 3TU4B 1P3OC 4QLCA 5B2JA 3MVDA 5GT3D 1AOIC 3WAAA 3AV2C 5E5AB 1P3FC 4KHAA 3MGQB 1HQ3A 5B1LC 5AV8D 3AZFD 5CPKD 2FJ7D 5B24A 4H9NB 3UTBD 1TZYA 3MGSD 1ID3A 3KWQA 3P5JB 5BT1D 1EQZC 3AZJD 1KX3D 3NQUA 4QLCD 3H0LC 2W8SA 3A6ND 3MVDD 1P3LA 1P34A 4AWLC 2HIOC 3WTPE 5B1MC 1HQ3D 4J8XB 5JRGC 5B24D 1TZYD 1KX5C 3B6GD 3AZNB 1ZLAD 4WU9A 4JJNC 5GSUA 4CSRB 3O62C 2ZY4A 3AZLB 1WWSA 5F99B 3W99C 1P3LD 2AROC 2HUEB 1P3GD 3AN2D 1P3AC 3X1VC 5DNMB 1ULYA 5JA4B 2Y2LA 5E5AA 3C1BD 3MGQA 4J8WB 5GSUD 5AV9D 4H9NA 2F8ND 3AZIC 3REKD 5C3IC 5AVBB 2IO5C 3W98C 2UWXA 5B33C 1M19C 3H0RC 3X1TC 3B0CT 3B0CW 3VH6A 4Z5TB 3MGQD 1M1AB 4J8XA 5CPIB 3REJD 2J8PA 3KSYA 2HIOD 5BNXB 3AZNA 3B6FD 4E45A 4CSRA 5CP6B 2YFVB 3AZLA 3KUYD 5AY8B 3MGPD 4X23C 5CHLB 3X1UC 2NZDB 1T3UA 3AYWC 5JA4A 5B0YD 3UT9C 4YS3B 3WTPC 2JE5A 5GT0B 4J8WA 2NQBB 3AZHC 4WU8B 4H9OB 5GXQC 4XUJD 5AVCC 1P3PC 1F66B 3B0DC 4XZQB 5AVBA 1P3ID 3WKJB 3AZID 4Z66C 4LD9D 5B40B 3MNNB 4EO5B 1M1AA 3REHB 5B31D 5BNXA 3LJAB 1P3BC 5CP6A 2YFVA 4Z2MG 1P3KA 5AY8A 2CV5C 5DNNB 3MGRD 3REIB 4KUDA 5B2IC 4R8PC 5KDMB 2NZDA 4CAYA 3C1CD 1S32B 2PYOB 3WA9B 5BS7C 4YS3A 2BG1A 5GT0A 2NQBA 4ZUXD 3RELB 5GT3C 5CP6D 4NE6A 4WU8A 1P3KD 1F66A 4KUDD 4XZQA 3WTPD 2BYKB 3B0BA 1KX4D 2FJ7C 3AZFC 5AV8C 5CPKC 3EG5B 3WKJA 3AZEB 3UTBC 3MGSC 5AV6B 3LZ0D 5BT1C 3AZJC 5B40A 4HGAC 4YS3D 1KX3C 3A6NC 4QLCC 1U35D 2RVQD 4KGCD 3MVDC 2Y2JA 4WU8D 3REHA 5AV5B 3F6TA 3LJAA 1HQ3C 3AV1D 5B24C 1TZYC 2G5IC 4H9PB 5DNNA 3REIA 3B6GC 1ZLAC 3LELB 3W96B 5KDMA 1Q9CA 1S32A 4DRBA 2PYOA 4WNNB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5B32 B;  1P3L C;  1P3G C;  3LJA D;  3REL A;  5DNN D;  3C1B C;  2BYK A;  5GSU C;  3AFA B;  4UUZ B;  5AV9 C;  3X1S D;  2BYM B;  3UTA B;  5AV6 A;  3REK C;  2PYO D;  3LZ1 B;  3WA9 D;  5FUG B;  4DRA A;  3AZG B;  2YFW B;  2LY8 A;  5CPJ D;  1M18 B;  3AZM B;  5AV5 A;  3KXB B;  5B2J D;  3MGQ C;  1P3O B;  3REJ C;  3WAA D;  4YM6 A;  4H9P A;  4J8V B;  3VH5 T;  3VH5 W;  5AV6 D;  1AOI B;  3AV2 B;  3B6F C;  1P3F B;  3LEL A;  1F1E A;  3KUY C;  1ID3 D;  1P3M B;  3KWQ D;  3MGP C;  4WNN A;  5BO0 B;  5B32 A;  1A7W A;  1EQZ B;  4M6B A;  2JSS A;  4YM6 D;  5B0Y C;  1P34 D;  3TU4 A;  4AWL B;  3AFA A;  3LEL D;  1B67 A;  4UUZ A;  5B1M B;  5JRG B;  2BYM A;  3UTA A;  4XUJ C;  3LZ1 A;  5B32 D;  4WU9 D;  1KX5 B;  5FUG A;  1P3I C;  4JJN B;  1TAF B;  3O62 B;  2YFW A;  3AZG A;  1HTA A;  1M18 A;  3TU4 D;  4LD9 C;  3W99 B;  2ARO B;  3KXB A;  1P3O A;  4Z2M H;  1P3A B;  3UTA D;  5E5A D;  5B31 C;  4J8V A;  5B0Z B;  4E44 A;  1P3F A;  1P3M A;  3MGR C;  5C3I B;  1EQZ A;  1N1J B;  3C1C C;  2IO5 B;  5F99 A;  3W98 B;  5B33 B;  1M19 B;  3X1T B;  4ZUX C;  4J8X D;  5B1M A;  5CP6 C;  5DNM A;  5JRG A;  1P3K C;  1P3M D;  3AZN D;  4KUD C;  1KX5 A;  1KX4 C;  4JJN A;  1TAF A;  3O62 A;  3AZL D;  4J8U B;  5F99 D;  3LZ0 C;  4X23 B;  3W99 A;  4YS3 C;  2ARO A;  4KGC C;  1U35 C;  2RVQ C;  3X1U B;  3AYW B;  4WU8 C;  5DNM D;  1P3A A;  2F8N K;  4Z5T A;  5B0Z A;  4J8W D;  3UT9 B;  3AV1 C;  4G92 B;  5CPI A;  3AZH B;  5GXQ B;  5AVC B;  5AVB D;  4ZBJ C;  3B0D B;  1N1J A;  2CWE A;  3W98 A;  5B33 A;  1M19 A;  4Z5T D;  4Z66 B;  5B0Z D;  3LJA C;  1M1A D;  5CPI D;  5DNN C;  1JFI B;  3X1S C;  4H9O A;  5AY8 D;  3VH6 W;  4J8U A;  2PYO C;  3WA9 C;  4X23 A;  3AZK B;  5B2I B;  2NZD D;  4R8P B;  3X1U A;  5CPJ C;  3AYW A;  4G91 C;  5B2J C;  5GT0 D;  3MNN A;  3UT9 A;  2NQB D;  3WAA C;  3AZH A;  1BFM A;  1F66 D;  5AV6 C;  4XZQ D;  5GXQ A;  3WKJ D;  2FJ7 B;  3AZF B;  5AV8 B;  5CPK B;  1ID3 C;  3UTB B;  3KWQ C;  3MGS B;  5B40 D;  1WWI A;  1BH8 B;  3MNN D;  3AZJ B;  1KX3 B;  3R45 B;  3A6N B;  4QLC B;  3REH D;  3MVD B;  4YM6 C;  1P34 C;  1JFI A;  3LEL C;  1HQ3 B;  4H9S A;  3REI D;  1TZY B;  5B32 C;  4WU9 C;  3B6G B;  3AZK A;  1ZLA B;  5B2I A;  3AZE A;  3WA9 A;  4R8P A;  1S32 D;  3TU4 C;  1P3L B;  5BS7 A;  3REL D;  1P3G B;  3W97 B;  3AN2 B;  3UTA C;  5E5A C;  3C1B B;  3AZK D;  4WV4 B;  2F8N G;  3AZE D;  2FJ7 A;  3AZF A;  5AV9 B;  2F8N B;  3MGS A;  3REK B;  3W96 A;  5B1L B;  3KXB C;  1KX3 A;  3R45 A;  3A6N A;  5AV5 D;  4J8V C;  4J8X C;  1KU5 A;  1P3M C;  3REJ B;  3AZN C;  3B6G A;  2HIO B;  1ZLA A;  3B6F B;  3W96 D;  3AZL C;  3KUY B;  5F99 C;  3MGP B;  1BH9 B;  2HUE C;  1P3G A;  3W97 A;  4NFT A;  3AZM A;  3AN2 A;  5DNM C;  5B0Y B;  3C1B A;  4J8W C;  3AFA D;  3X1V B;  5AV9 A;  1AOI A;  3LZ1 D;  3AV2 A;  4XUJ B;  5AVB C;  2F8N A;  3REK A;  5B1L A;  3AZG D;  1P3I B;  3W97 D;  1M18 D;  3AZI B;  5BO0 A;  3AZM D;  3KXB D;  4Z5T C;  5B0Z C;  1P3O D;  4LD9 B;  1M1A C;  5CPI C;  5B31 G;  4J8V D;  1AOI D;  3REJ A;  4H9Q B;  3AV2 D;  5B31 B;  1P3F D;  2HIO A;  3B6F A;  5B1L D;  5AY8 C;  1H3O B;  3KUY A;  3MGP A;  1BH9 A;  3MGR B;  4NE3 A;  1EQZ D;  2NZD C;  3C1C B;  5B0Y A;  5GT0 C;  2NQB C;  5B1M D;  4ZUX B;  5JRG D;  3X1V A;  1P3K B;  1F66 C;  4J8U C;  4XZQ C;  4XUJ A;  1KX5 D;  4KUD B;  3WTP B;  4JJN D;  3WKJ C;  3O62 D;  4NE5 A;  1R4V A;  1P3I A;  1KX4 B;  4CAY B;  3AZI A;  1P3P B;  3LZ0 B;  3W99 D;  5B40 C;  2ARO D;  4LD9 A;  3MNN C;  4EO5 C;  4KGC B;  1U35 B;  4G92 C;  1P3A D;  4H9R B;  3REH C;  3X1V D;  4H9Q A;  3X1T A;  5B31 A;  3AV1 B;  5BNV B;  1H3O A;  3REI C;  3V9R B;  3MGR A;  4ZBJ B;  1P3B B;  1S32 C;  3VH6 T;  3C1C A;  3NQJ B;  2CV5 B;  3W98 D;  5B33 D;  1M19 D;  1B6W A;  3X1T D;  2F8N H;  3REL C;  2L5A A;  4ZUX A;  5G49 B;  4H9S C;  3WTP A;  3AZK C;  3AZE C;  1KX4 A;  5GT3 B;  3X1S B;  4J8U D;  5AVC A;  1P3P A;  4X23 D;  3LZ0 A;  3VH5 A;  4KGC A;  3X1U D;  1U35 A;  3AYW D;  4H9R A;  5CPJ B;  5AV5 C;  4Z66 A;  3UT9 D;  4HGA B;  4G91 B;  5B2J B;  3AV1 A;  3AZH D;  5BNV A;  3WAA B;  5GXQ D;  5AVC D;  3V9R A;  1P3P D;  4KHA B;  3W96 C;  1P3B A;  4WZS B;  5B24 B;  2CV5 A;  3NQJ A;  1ID3 B;  3KWQ B;  4Z66 D;  3NQU B;  5G49 A;  4YM6 B;  1P34 B;  3AFA C;  1P3B D;  5GT3 A;  5B32 G;  3X1S A;  2CV5 D;  3LZ1 C;  5B2I D;  4WU9 B;  5GSU B;  3AZG C;  5AV8 A;  5CPK A;  4R8P D;  3W97 C;  3UTB A;  1M18 C;  3AZM C;  3AN2 C;  5CPJ A;  3AZJ A;  1BH8 A;  3TU4 B;  1P3O C;  4QLC A;  5B2J A;  3MVD A;  5GT3 D;  1AOI C;  3WAA A;  3AV2 C;  5E5A B;  1P3F C;  4KHA A;  3MGQ B;  1HQ3 A;  5B1L C;  5AV8 D;  3AZF D;  5CPK D;  2FJ7 D;  5B24 A;  4H9N B;  3UTB D;  1TZY A;  3MGS D;  1ID3 A;  3KWQ A;  1EQZ C;  5BT1 D;  3AZJ D;  1KX3 D;  3NQU A;  4QLC D;  3A6N D;  3MVD D;  1P3L A;  1P34 A;  4AWL C;  2HIO C;  3WTP E;  5B1M C;  1HQ3 D;  4J8X B;  5JRG C;  5B24 D;  1TZY D;  1KX5 C;  3B6G D;  3AZN B;  1ZLA D;  4WU9 A;  4JJN C;  5GSU A;  4CSR B;  3O62 C;  3AZL B;  1WWS A;  5F99 B;  3W99 C;  1P3L D;  2ARO C;  2HUE B;  1P3G D;  3AN2 D;  1P3A C;  3X1V C;  5DNM B;  1ULY A;  5JA4 B;  5E5A A;  3C1B D;  3MGQ A;  4J8W B;  5GSU D;  5AV9 D;  4H9N A;  2F8N D;  3AZI C;  3REK D;  5C3I C;  5AVB B;  2IO5 C;  3W98 C;  5B33 C;  1M19 C;  3X1T C;  3B0C T;  3B0C W;  3VH6 A;  4Z5T B;  3MGQ D;  1M1A B;  4J8X A;  5CPI B;  3REJ D;  3KSY A;  2HIO D;  5BNX B;  3AZN A;  3B6F D;  4E45 A;  4CSR A;  5CP6 B;  2YFV B;  3AZL A;  3KUY D;  5AY8 B;  3MGP D;  4X23 C;  5CHL B;  3X1U C;  2NZD B;  3AYW C;  5JA4 A;  5B0Y D;  3UT9 C;  4YS3 B;  3WTP C;  5GT0 B;  4J8W A;  2NQB B;  3AZH C;  4WU8 B;  4H9O B;  5GXQ C;  4XUJ D;  5AVC C;  1P3P C;  1F66 B;  3B0D C;  4XZQ B;  5AVB A;  1P3I D;  3WKJ B;  3AZI D;  4Z66 C;  4LD9 D;  5B40 B;  3MNN B;  4EO5 B;  1M1A A;  3REH B;  5B31 D;  5BNX A;  3LJA B;  1P3B C;  5CP6 A;  2YFV A;  4Z2M G;  1P3K A;  5AY8 A;  2CV5 C;  5DNN B;  3MGR D;  3REI B;  4KUD A;  5B2I C;  4R8P C;  5KDM B;  2NZD A;  4CAY A;  3C1C D;  1S32 B;  2PYO B;  3WA9 B;  5BS7 C;  4YS3 A;  5GT0 A;  2NQB A;  4ZUX D;  3REL B;  5GT3 C;  5CP6 D;  4NE6 A;  4WU8 A;  1P3K D;  1F66 A;  4KUD D;  4XZQ A;  3WTP D;  2BYK B;  3B0B A;  1KX4 D;  2FJ7 C;  3AZF C;  5AV8 C;  5CPK C;  3WKJ A;  3AZE B;  3UTB C;  3MGS C;  5AV6 B;  3LZ0 D;  5BT1 C;  3AZJ C;  5B40 A;  4HGA C;  4YS3 D;  1KX3 C;  3A6N C;  4QLC C;  1U35 D;  2RVQ D;  4KGC D;  3MVD C;  4WU8 D;  3REH A;  5AV5 B;  3LJA A;  1HQ3 C;  3AV1 D;  5B24 C;  1TZY C;  4H9P B;  5DNN A;  3REI A;  3B6G C;  1ZLA C;  3LEL B;  3W96 B;  5KDM A;  1Q9C A;  1S32 A;  4DRB A;  2PYO A;  4WNN B; 
#chains in the Genus database with same CATH topology
 5B32 B;  1P3L C;  1P3G C;  3LJA D;  3REL A;  5DNN D;  3C1B C;  2BYK A;  5GSU C;  3AFA B;  3KFU G;  4UUZ B;  5AV9 C;  3X1S D;  2BYM B;  3UTA B;  5AV6 A;  3REK C;  2PYO D;  3LZ1 B;  2Y2P A;  3WA9 D;  5FUG B;  2F2A C;  4DRA A;  3H0M C;  3AZG B;  2YFW B;  2LY8 A;  5CPJ D;  1M18 B;  3AZM B;  2Y2N A;  5AV5 A;  3KXB B;  5B2J D;  3MGQ C;  1P3O B;  2Y2Q A;  3REJ C;  3WAA D;  4YM6 A;  4H9P A;  4J8V B;  3VH5 T;  3VH5 W;  5AV6 D;  1AOI B;  3AV2 B;  3B6F C;  1P3F B;  2XD5 A;  3LEL A;  1F1E A;  3KUY C;  1ID3 D;  1P3M B;  3KWQ D;  3MGP C;  4WNN A;  5BO0 B;  5B32 A;  1A7W A;  1EQZ B;  4M6B A;  2JSS A;  4YM6 D;  5B0Y C;  1P34 D;  3TU4 A;  4AWL B;  3AFA A;  3LEL D;  1B67 A;  4UUZ A;  5B1M B;  5JRG B;  2BYM A;  3UTA A;  4XUJ C;  3LZ1 A;  5B32 D;  4WU9 D;  2G5H C;  1KX5 B;  5FUG A;  1P3I C;  4JJN B;  1TAF B;  3O62 B;  2YFW A;  3AZG A;  1HTA A;  1M18 A;  3TU4 D;  4LD9 C;  3W99 B;  2ARO B;  3KXB A;  1P3O A;  4Z2M H;  1P3A B;  3UTA D;  5E5A D;  5B31 C;  4J8V A;  5B0Z B;  4E44 A;  1P3F A;  1P3M A;  3MGR C;  5C3I B;  1EQZ A;  1N1J B;  3C1C C;  2IO5 B;  3AL0 C;  5F99 A;  3W98 B;  5B33 B;  1M19 B;  3X1T B;  2DQN C;  4ZUX C;  4J8X D;  5B1M A;  1PZR A;  5CP6 C;  5DNM A;  5JRG A;  1P3K C;  1P3M D;  3AZN D;  4KUD C;  3A1K A;  1KX5 A;  1KX4 C;  4JJN A;  1TAF A;  3O62 A;  3AZL D;  2Y2H A;  4J8U B;  5F99 D;  3LZ0 C;  4X23 B;  3W99 A;  4YS3 C;  2ARO A;  4KGC C;  1U35 C;  2RVQ C;  3X1U B;  3AYW B;  4WU8 C;  5DNM D;  1P3A A;  2F8N K;  4Z5T A;  5B0Z A;  4J8W D;  3UT9 B;  3AV1 C;  4G92 B;  5CPI A;  3AZH B;  5GXQ B;  5AVC B;  5AVB D;  4ZBJ C;  3B0D B;  2RIQ A;  1N1J A;  2ZY5 A;  2ZY3 A;  2CWE A;  2Y2I A;  3W98 A;  5B33 A;  1M19 A;  4Z5T D;  4Z66 B;  5B0Z D;  3LJA C;  1M1A D;  5CPI D;  5DNN C;  1JFI B;  4DQY B;  3X1S C;  4H9O A;  5AY8 D;  3VH6 W;  4J8U A;  2PYO C;  3WA9 C;  4X23 A;  3AZK B;  5B2I B;  2NZD D;  4R8P B;  3X1U A;  5CPJ C;  3AYW A;  4G91 C;  5B2J C;  5GT0 D;  3MNN A;  3UT9 A;  2NQB D;  3WAA C;  3AZH A;  1BFM A;  2DF4 C;  1F66 D;  5AV6 C;  4XZQ D;  5GXQ A;  3WKJ D;  2FJ7 B;  3AZF B;  5AV8 B;  5CPK B;  1ID3 C;  3UTB B;  4WJ3 C;  3KWQ C;  3MGS B;  5B40 D;  1WWI A;  1BH8 B;  3MNN D;  3AZJ B;  1KX3 B;  3R45 B;  3A6N B;  4QLC B;  3REH D;  3MVD B;  4YM6 C;  1P34 C;  1JFI A;  3LEL C;  1HQ3 B;  4H9S A;  3REI D;  1TZY B;  5B32 C;  4WU9 C;  3B6G B;  3AZK A;  1ZLA B;  5B2I A;  3A1I A;  3AZE A;  3WA9 A;  4R8P A;  1S32 D;  3TU4 C;  1P3L B;  5BS7 A;  3REL D;  1P3G B;  3W97 B;  3AN2 B;  3UTA C;  5E5A C;  3C1B B;  3AZK D;  4WV4 B;  2XD1 A;  2F8N G;  3AZE D;  2FJ7 A;  3AZF A;  2JCH A;  5AV9 B;  2F8N B;  3MGS A;  3REK B;  3W96 A;  5B1L B;  3KXB C;  1KX3 A;  3R45 A;  3A6N A;  5AV5 D;  4J8V C;  4J8X C;  1KU5 A;  1P3M C;  3REJ B;  3AZN C;  3B6G A;  2HIO B;  1ZLA A;  3B6F B;  3W96 D;  3AZL C;  2Y2O A;  3KUY B;  5F99 C;  3MGP B;  1BH9 B;  2HUE C;  1P3G A;  3W97 A;  4NFT A;  3AZM A;  3AN2 A;  5DNM C;  5B0Y B;  3C1B A;  4J8W C;  3AFA D;  3X1V B;  5AV9 A;  1AOI A;  3LZ1 D;  3AV2 A;  4XUJ B;  5AVB C;  2F8N A;  3REK A;  5B1L A;  3AZG D;  1P3I B;  3W97 D;  1M18 D;  3AZI B;  5BO0 A;  3AZM D;  2VQR A;  3KXB D;  4Z5T C;  5B0Z C;  1P3O D;  4LD9 B;  1M1A C;  5CPI C;  5B31 G;  4J8V D;  1AOI D;  3REJ A;  2Y2M A;  4H9Q B;  3AV2 D;  5B31 B;  1P3F D;  2HIO A;  3B6F A;  5B1L D;  5AY8 C;  1H3O B;  3KUY A;  3MGP A;  1BH9 A;  3MGR B;  4NE3 A;  1EQZ D;  2NZD C;  3C1C B;  3IP4 C;  5B0Y A;  5GT0 C;  2Y2K A;  2NQB C;  5B1M D;  4ZUX B;  5JRG D;  3FDD A;  3X1V A;  1P3K B;  1F66 C;  4J8U C;  4XZQ C;  4XUJ A;  1KX5 D;  2ZY2 A;  4KUD B;  3WTP B;  3EPK A;  4JJN D;  3WKJ C;  3O62 D;  4NE5 A;  1R4V A;  1P3I A;  1KX4 B;  4CAY B;  3AZI A;  1P3P B;  3LZ0 B;  3W99 D;  5B40 C;  2ARO D;  4LD9 A;  3MNN C;  4EO5 C;  4KGC B;  1U35 B;  4G92 C;  1P3A D;  4H9R B;  3REH C;  3X1V D;  4H9Q A;  3EPL A;  3X1T A;  5B31 A;  3AV1 B;  5BNV B;  1H3O A;  3REI C;  3V9R B;  3MGR A;  4ZBJ B;  1P3B B;  1S32 C;  3VH6 T;  3C1C A;  3NQJ B;  2CV5 B;  3W98 D;  5B33 D;  1M19 D;  1B6W A;  3X1T D;  2F8N H;  3REL C;  2L5A A;  4ZUX A;  5G49 B;  4H9S C;  3WTP A;  3AZK C;  3AZE C;  1KX4 A;  5GT3 B;  3X1S B;  1Z2C B;  4J8U D;  5AVC A;  1P3P A;  2FFF B;  4X23 D;  3LZ0 A;  3VH5 A;  4KGC A;  3X1U D;  1U35 A;  3AYW D;  4H9R A;  5CPJ B;  5AV5 C;  4Z66 A;  3UT9 D;  4HGA B;  4G91 B;  5B2J B;  3AV1 A;  3AZH D;  5BNV A;  3WAA B;  5GXQ D;  5AVC D;  3V9R A;  1P3P D;  4KHA B;  3W96 C;  1P3B A;  4WZS B;  5B24 B;  2CV5 A;  3NQJ A;  1ID3 B;  3KWQ B;  4Z66 D;  3NQU B;  1W2E A;  5G49 A;  3EPJ A;  4UPK A;  4YM6 B;  1P34 B;  3EPH A;  3AFA C;  2ZM5 A;  1P3B D;  5GT3 A;  5B32 G;  3X1S A;  2CV5 D;  3LZ1 C;  5B2I D;  4WU9 B;  5GSU B;  2Y2G A;  5AV8 A;  3AZG C;  4R8P D;  5CPK A;  3W97 C;  3UTB A;  1M18 C;  3AZM C;  3AN2 C;  5CPJ A;  3AZJ A;  1BH8 A;  3TU4 B;  1P3O C;  4QLC A;  5B2J A;  3MVD A;  5GT3 D;  1AOI C;  3WAA A;  3AV2 C;  5E5A B;  1P3F C;  4KHA A;  3MGQ B;  1HQ3 A;  5B1L C;  5AV8 D;  3AZF D;  5CPK D;  2FJ7 D;  5B24 A;  4H9N B;  3UTB D;  1TZY A;  3MGS D;  1ID3 A;  3KWQ A;  3P5J B;  5BT1 D;  1EQZ C;  3AZJ D;  1KX3 D;  3NQU A;  4QLC D;  3H0L C;  2W8S A;  3A6N D;  3MVD D;  1P3L A;  1P34 A;  4AWL C;  2HIO C;  3WTP E;  5B1M C;  1HQ3 D;  4J8X B;  5JRG C;  5B24 D;  1TZY D;  1KX5 C;  3B6G D;  3AZN B;  1ZLA D;  4WU9 A;  4JJN C;  5GSU A;  4CSR B;  3O62 C;  2ZY4 A;  3AZL B;  1WWS A;  5F99 B;  3W99 C;  1P3L D;  2ARO C;  2HUE B;  1P3G D;  3AN2 D;  1P3A C;  3X1V C;  5DNM B;  1ULY A;  5JA4 B;  2Y2L A;  5E5A A;  3C1B D;  3MGQ A;  4J8W B;  5GSU D;  5AV9 D;  4H9N A;  2F8N D;  3AZI C;  3REK D;  5C3I C;  5AVB B;  2IO5 C;  3W98 C;  2UWX A;  5B33 C;  1M19 C;  3H0R C;  3X1T C;  3B0C T;  3B0C W;  3VH6 A;  4Z5T B;  3MGQ D;  1M1A B;  4J8X A;  5CPI B;  3REJ D;  2J8P A;  3KSY A;  2HIO D;  5BNX B;  3AZN A;  3B6F D;  4E45 A;  4CSR A;  5CP6 B;  2YFV B;  3AZL A;  3KUY D;  5AY8 B;  3MGP D;  4X23 C;  5CHL B;  3X1U C;  2NZD B;  1T3U A;  3AYW C;  5JA4 A;  5B0Y D;  3UT9 C;  4YS3 B;  3WTP C;  2JE5 A;  5GT0 B;  4J8W A;  2NQB B;  3AZH C;  4WU8 B;  4H9O B;  5GXQ C;  4XUJ D;  5AVC C;  1P3P C;  1F66 B;  3B0D C;  4XZQ B;  5AVB A;  1P3I D;  3WKJ B;  3AZI D;  4Z66 C;  4LD9 D;  5B40 B;  3MNN B;  4EO5 B;  1M1A A;  3REH B;  5B31 D;  5BNX A;  3LJA B;  1P3B C;  5CP6 A;  2YFV A;  4Z2M G;  1P3K A;  5AY8 A;  2CV5 C;  5DNN B;  3MGR D;  3REI B;  4KUD A;  5B2I C;  4R8P C;  5KDM B;  2NZD A;  4CAY A;  3C1C D;  1S32 B;  2PYO B;  3WA9 B;  5BS7 C;  4YS3 A;  2BG1 A;  5GT0 A;  2NQB A;  4ZUX D;  3REL B;  5GT3 C;  5CP6 D;  4NE6 A;  4WU8 A;  1P3K D;  1F66 A;  4KUD D;  4XZQ A;  3WTP D;  2BYK B;  3B0B A;  1KX4 D;  2FJ7 C;  3AZF C;  5AV8 C;  5CPK C;  3EG5 B;  3WKJ A;  3AZE B;  3UTB C;  3MGS C;  5AV6 B;  3LZ0 D;  5BT1 C;  3AZJ C;  5B40 A;  4HGA C;  4YS3 D;  1KX3 C;  3A6N C;  4QLC C;  1U35 D;  2RVQ D;  4KGC D;  3MVD C;  2Y2J A;  4WU8 D;  3REH A;  5AV5 B;  3F6T A;  3LJA A;  1HQ3 C;  3AV1 D;  5B24 C;  1TZY C;  2G5I C;  4H9P B;  5DNN A;  3REI A;  3B6G C;  1ZLA C;  3LEL B;  3W96 B;  5KDM A;  1Q9C A;  1S32 A;  4DRB A;  2PYO A;  4WNN B; 
#chains in the Genus database with same CATH homology
 5B32 B;  1P3L C;  1P3G C;  3LJA D;  3REL A;  5DNN D;  3C1B C;  2BYK A;  5GSU C;  3AFA B;  3KFU G;  4UUZ B;  5AV9 C;  3X1S D;  2BYM B;  3UTA B;  5AV6 A;  3REK C;  2PYO D;  3LZ1 B;  2Y2P A;  3WA9 D;  5FUG B;  2F2A C;  4DRA A;  3H0M C;  3AZG B;  2YFW B;  2LY8 A;  5CPJ D;  1M18 B;  3AZM B;  2Y2N A;  5AV5 A;  3KXB B;  5B2J D;  3MGQ C;  1P3O B;  2Y2Q A;  3REJ C;  3WAA D;  4YM6 A;  4H9P A;  4J8V B;  3VH5 T;  3VH5 W;  5AV6 D;  1AOI B;  3AV2 B;  3B6F C;  1P3F B;  2XD5 A;  3LEL A;  1F1E A;  3KUY C;  1ID3 D;  1P3M B;  3KWQ D;  3MGP C;  4WNN A;  5BO0 B;  5B32 A;  1A7W A;  1EQZ B;  4M6B A;  2JSS A;  4YM6 D;  5B0Y C;  1P34 D;  3TU4 A;  4AWL B;  3AFA A;  3LEL D;  1B67 A;  4UUZ A;  5B1M B;  5JRG B;  2BYM A;  3UTA A;  4XUJ C;  3LZ1 A;  5B32 D;  4WU9 D;  2G5H C;  1KX5 B;  5FUG A;  1P3I C;  4JJN B;  1TAF B;  3O62 B;  2YFW A;  3AZG A;  1HTA A;  1M18 A;  3TU4 D;  4LD9 C;  3W99 B;  2ARO B;  3KXB A;  1P3O A;  4Z2M H;  1P3A B;  3UTA D;  5E5A D;  5B31 C;  4J8V A;  5B0Z B;  4E44 A;  1P3F A;  1P3M A;  3MGR C;  5C3I B;  1EQZ A;  1N1J B;  3C1C C;  2IO5 B;  3AL0 C;  5F99 A;  3W98 B;  5B33 B;  1M19 B;  3X1T B;  2DQN C;  4ZUX C;  4J8X D;  5B1M A;  1PZR A;  5CP6 C;  5DNM A;  5JRG A;  1P3K C;  1P3M D;  3AZN D;  4KUD C;  3A1K A;  1KX5 A;  1KX4 C;  4JJN A;  1TAF A;  3O62 A;  3AZL D;  2Y2H A;  4J8U B;  5F99 D;  3LZ0 C;  4X23 B;  3W99 A;  4YS3 C;  2ARO A;  4KGC C;  1U35 C;  2RVQ C;  3X1U B;  3AYW B;  4WU8 C;  5DNM D;  1P3A A;  2F8N K;  4Z5T A;  5B0Z A;  4J8W D;  3UT9 B;  3AV1 C;  4G92 B;  5CPI A;  3AZH B;  5GXQ B;  5AVC B;  5AVB D;  4ZBJ C;  3B0D B;  2RIQ A;  1N1J A;  2ZY5 A;  2ZY3 A;  2CWE A;  2Y2I A;  3W98 A;  5B33 A;  1M19 A;  4Z5T D;  4Z66 B;  5B0Z D;  3LJA C;  1M1A D;  5CPI D;  5DNN C;  1JFI B;  4DQY B;  3X1S C;  4H9O A;  5AY8 D;  3VH6 W;  4J8U A;  2PYO C;  3WA9 C;  4X23 A;  3AZK B;  5B2I B;  2NZD D;  4R8P B;  3X1U A;  5CPJ C;  3AYW A;  4G91 C;  5B2J C;  5GT0 D;  3MNN A;  3UT9 A;  2NQB D;  3WAA C;  3AZH A;  1BFM A;  2DF4 C;  1F66 D;  5AV6 C;  4XZQ D;  5GXQ A;  3WKJ D;  2FJ7 B;  3AZF B;  5AV8 B;  5CPK B;  1ID3 C;  3UTB B;  4WJ3 C;  3KWQ C;  3MGS B;  5B40 D;  1WWI A;  1BH8 B;  3MNN D;  3AZJ B;  1KX3 B;  3R45 B;  3A6N B;  4QLC B;  3REH D;  3MVD B;  4YM6 C;  1P34 C;  1JFI A;  3LEL C;  1HQ3 B;  4H9S A;  3REI D;  1TZY B;  5B32 C;  4WU9 C;  3B6G B;  3AZK A;  1ZLA B;  5B2I A;  3A1I A;  3AZE A;  3WA9 A;  4R8P A;  1S32 D;  3TU4 C;  1P3L B;  5BS7 A;  3REL D;  1P3G B;  3W97 B;  3AN2 B;  3UTA C;  5E5A C;  3C1B B;  3AZK D;  4WV4 B;  2XD1 A;  2F8N G;  3AZE D;  2FJ7 A;  3AZF A;  2JCH A;  5AV9 B;  2F8N B;  3MGS A;  3REK B;  3W96 A;  5B1L B;  3KXB C;  1KX3 A;  3R45 A;  3A6N A;  5AV5 D;  4J8V C;  4J8X C;  1KU5 A;  1P3M C;  3REJ B;  3AZN C;  3B6G A;  2HIO B;  1ZLA A;  3B6F B;  3W96 D;  3AZL C;  2Y2O A;  3KUY B;  5F99 C;  3MGP B;  1BH9 B;  2HUE C;  1P3G A;  3W97 A;  4NFT A;  3AZM A;  3AN2 A;  5DNM C;  5B0Y B;  3C1B A;  4J8W C;  3AFA D;  3X1V B;  5AV9 A;  1AOI A;  3LZ1 D;  3AV2 A;  4XUJ B;  5AVB C;  2F8N A;  3REK A;  5B1L A;  3AZG D;  1P3I B;  3W97 D;  1M18 D;  3AZI B;  5BO0 A;  3AZM D;  2VQR A;  3KXB D;  4Z5T C;  5B0Z C;  1P3O D;  4LD9 B;  1M1A C;  5CPI C;  5B31 G;  4J8V D;  1AOI D;  3REJ A;  2Y2M A;  4H9Q B;  3AV2 D;  5B31 B;  1P3F D;  2HIO A;  3B6F A;  5B1L D;  5AY8 C;  1H3O B;  3KUY A;  3MGP A;  1BH9 A;  3MGR B;  4NE3 A;  1EQZ D;  2NZD C;  3C1C B;  3IP4 C;  5B0Y A;  5GT0 C;  2Y2K A;  2NQB C;  5B1M D;  4ZUX B;  5JRG D;  3FDD A;  3X1V A;  1P3K B;  1F66 C;  4J8U C;  4XZQ C;  4XUJ A;  1KX5 D;  2ZY2 A;  4KUD B;  3WTP B;  3EPK A;  4JJN D;  3WKJ C;  3O62 D;  4NE5 A;  1R4V A;  1P3I A;  1KX4 B;  4CAY B;  3AZI A;  1P3P B;  3LZ0 B;  3W99 D;  5B40 C;  2ARO D;  4LD9 A;  3MNN C;  4EO5 C;  4KGC B;  1U35 B;  4G92 C;  1P3A D;  4H9R B;  3REH C;  3X1V D;  4H9Q A;  3EPL A;  3X1T A;  5B31 A;  3AV1 B;  5BNV B;  1H3O A;  3REI C;  3V9R B;  3MGR A;  4ZBJ B;  1P3B B;  1S32 C;  3VH6 T;  3C1C A;  3NQJ B;  2CV5 B;  3W98 D;  5B33 D;  1M19 D;  1B6W A;  3X1T D;  2F8N H;  3REL C;  2L5A A;  4ZUX A;  5G49 B;  4H9S C;  3WTP A;  3AZK C;  3AZE C;  1KX4 A;  5GT3 B;  3X1S B;  1Z2C B;  4J8U D;  5AVC A;  1P3P A;  2FFF B;  4X23 D;  3LZ0 A;  3VH5 A;  4KGC A;  3X1U D;  1U35 A;  3AYW D;  4H9R A;  5CPJ B;  5AV5 C;  4Z66 A;  3UT9 D;  4HGA B;  4G91 B;  5B2J B;  3AV1 A;  3AZH D;  5BNV A;  3WAA B;  5GXQ D;  5AVC D;  3V9R A;  1P3P D;  4KHA B;  3W96 C;  1P3B A;  4WZS B;  5B24 B;  2CV5 A;  3NQJ A;  1ID3 B;  3KWQ B;  4Z66 D;  3NQU B;  1W2E A;  5G49 A;  3EPJ A;  4UPK A;  4YM6 B;  1P34 B;  3EPH A;  3AFA C;  2ZM5 A;  1P3B D;  5GT3 A;  5B32 G;  3X1S A;  2CV5 D;  3LZ1 C;  5B2I D;  4WU9 B;  5GSU B;  2Y2G A;  5AV8 A;  3AZG C;  4R8P D;  5CPK A;  3W97 C;  3UTB A;  1M18 C;  3AZM C;  3AN2 C;  5CPJ A;  3AZJ A;  1BH8 A;  3TU4 B;  1P3O C;  4QLC A;  5B2J A;  3MVD A;  5GT3 D;  1AOI C;  3WAA A;  3AV2 C;  5E5A B;  1P3F C;  4KHA A;  3MGQ B;  1HQ3 A;  5B1L C;  5AV8 D;  3AZF D;  5CPK D;  2FJ7 D;  5B24 A;  4H9N B;  3UTB D;  1TZY A;  3MGS D;  1ID3 A;  3KWQ A;  3P5J B;  5BT1 D;  1EQZ C;  3AZJ D;  1KX3 D;  3NQU A;  4QLC D;  3H0L C;  2W8S A;  3A6N D;  3MVD D;  1P3L A;  1P34 A;  4AWL C;  2HIO C;  3WTP E;  5B1M C;  1HQ3 D;  4J8X B;  5JRG C;  5B24 D;  1TZY D;  1KX5 C;  3B6G D;  3AZN B;  1ZLA D;  4WU9 A;  4JJN C;  5GSU A;  4CSR B;  3O62 C;  2ZY4 A;  3AZL B;  1WWS A;  5F99 B;  3W99 C;  1P3L D;  2ARO C;  2HUE B;  1P3G D;  3AN2 D;  1P3A C;  3X1V C;  5DNM B;  1ULY A;  5JA4 B;  2Y2L A;  5E5A A;  3C1B D;  3MGQ A;  4J8W B;  5GSU D;  5AV9 D;  4H9N A;  2F8N D;  3AZI C;  3REK D;  5C3I C;  5AVB B;  2IO5 C;  3W98 C;  2UWX A;  5B33 C;  1M19 C;  3H0R C;  3X1T C;  3B0C T;  3B0C W;  3VH6 A;  4Z5T B;  3MGQ D;  1M1A B;  4J8X A;  5CPI B;  3REJ D;  2J8P A;  3KSY A;  2HIO D;  5BNX B;  3AZN A;  3B6F D;  4E45 A;  4CSR A;  5CP6 B;  2YFV B;  3AZL A;  3KUY D;  5AY8 B;  3MGP D;  4X23 C;  5CHL B;  3X1U C;  2NZD B;  1T3U A;  3AYW C;  5JA4 A;  5B0Y D;  3UT9 C;  4YS3 B;  3WTP C;  2JE5 A;  5GT0 B;  4J8W A;  2NQB B;  3AZH C;  4WU8 B;  4H9O B;  5GXQ C;  4XUJ D;  5AVC C;  1P3P C;  1F66 B;  3B0D C;  4XZQ B;  5AVB A;  1P3I D;  3WKJ B;  3AZI D;  4Z66 C;  4LD9 D;  5B40 B;  3MNN B;  4EO5 B;  1M1A A;  3REH B;  5B31 D;  5BNX A;  3LJA B;  1P3B C;  5CP6 A;  2YFV A;  4Z2M G;  1P3K A;  5AY8 A;  2CV5 C;  5DNN B;  3MGR D;  3REI B;  4KUD A;  5B2I C;  4R8P C;  5KDM B;  2NZD A;  4CAY A;  3C1C D;  1S32 B;  2PYO B;  3WA9 B;  5BS7 C;  4YS3 A;  2BG1 A;  5GT0 A;  2NQB A;  4ZUX D;  3REL B;  5GT3 C;  5CP6 D;  4NE6 A;  4WU8 A;  1P3K D;  1F66 A;  4KUD D;  4XZQ A;  3WTP D;  2BYK B;  3B0B A;  1KX4 D;  2FJ7 C;  3AZF C;  5AV8 C;  5CPK C;  3EG5 B;  3WKJ A;  3AZE B;  3UTB C;  3MGS C;  5AV6 B;  3LZ0 D;  5BT1 C;  3AZJ C;  5B40 A;  4HGA C;  4YS3 D;  1KX3 C;  3A6N C;  4QLC C;  1U35 D;  2RVQ D;  4KGC D;  3MVD C;  2Y2J A;  4WU8 D;  3REH A;  5AV5 B;  3F6T A;  3LJA A;  1HQ3 C;  3AV1 D;  5B24 C;  1TZY C;  2G5I C;  4H9P B;  5DNN A;  3REI A;  3B6G C;  1ZLA C;  3LEL B;  3W96 B;  5KDM A;  1Q9C A;  1S32 A;  4DRB A;  2PYO A;  4WNN B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...