4WU9D

Structure of cisptnap-ncp145
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
95
structure length
95
Chain Sequence
KTRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Stereochemical control of nucleosome targeting by platinum-intercalator antitumor agents.
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Structural protein/dna
molecule keywords Histone H3.2
total genus 37
structure length 95
sequence length 95
chains with identical sequence H
ec nomenclature
pdb deposition date 2014-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4wu9D00
4Z66D 3REKB 4Z2MG 4YS3D 4ZUXB 3AYWA 2PYOD 2F8NA 3KWQC 5B1MC 1P3LA 3UTAA 2F8NG 2L5AA 1Q9CA 3W96A 5B33D 5JRGC 3VH5T 4WU8C 1M1AD 4J8UD 1KX4C 3AZLC 5B32D 3AYWD 4WU9B 2PYOA 5F99C 3LZ1B 3X1TC 3B6FC 3O62B 3W98D 5GSUC 3KWQB 5CPKA 1M19D 4E44A 1ID3A 3MGQC 3REHB 3WKJD 5GT0C 3C1BC 4H9PB 3AN2D 1M18A 5B0YA 3NQJB 1P3KB 3LZ0C 3AV1C 4J8WC 3AZHC 4CAYA 1HQ3D 4WNNA 2IO5B 3A6NA 4M6BA 3AFAD 4ZBJB 4XUJB 5GT0D 3C1BD 3AN2C 1P3MD 5BT1D 1P3IA 4H9QB 5AV9A 5B0ZB 1HQ3B 4H9NB 1ID3C 5DNNC 3C1CA 3UTBD 3W99D 5CPID 1U35C 3R45A 5GT3B 3AYWC 4XZQB 4HGAB 3WKJC 4KUDA 3TU4B 1F66C 3B6GD 5B1MA 3WAAC 3MNND 4H9SA 1S32B 3A6NC 1P3LC 1KX5C 3VH5W 3X1TA 3B6FA 3W96C 5GSUA 5B31B 3AN2A 3LELB 1M18D 5G49A 3WA9C 5B31C 1P3OA 1AOIC 4QLCC 1BH8A 5B32C 2YFWA 3AZIC 1P3GD 1P3LB 1P3BA 5B32G 3MGRB 5JA4A 3B0DB 3TU4C 1F66B 1P34A 1KX3A 3MGQA 3B0CW 3AZJA 4J8VC 3C1CD 3X1VB 3AZNB 5AV9C 1KX4A 4ZBJC 4XUJC 5BNVB 3O62A 5B31G 5AV9B 5BNXA 3AV2B 4YS3A 3MNNB 3AZNC 3R45B 4H9PA 3X1VC 3WTPE 3AFAA 1BH9B 3TU4A 5CPIB 5B1LD 1P3KC 5GT0A 3C1BA 1M18C 1N1JB 5AVCC 4KGCA 3KUYB 1HTAA 4ZUXA 3WAAD 5AV5D 3UTAB 3WKJB 3AZLB 5B2IA 1M1AB 4KGCD 1EQZA 2CV5B 4WU9D 3AYWB 3MGSB 5AV8C 4ZUXC 2NQBC 4Z2MH 1ZLAC 1P3FA 5C3IC 1P3PA 1P3OB 2FJ7A 5GT3D 5AY8A 5AV6C 2AROC 5B24C 5GSUD 3V9RB 3REIB 4Z5TB 5B24B 5GT0B 3C1BB 5AVBC 3AZLD 3X1VA 4R8PB 3W96B 4YM6D 4G92C 3WTPD 3AZJC 1P3KA 1F1EA 3LJAA 3X1UC 1KX4B 1ZLAB 3A6NB 4EO5C 2YFVA 3AZMC 5B2JD 3O62C 4WU8B 1TAFB 2PYOC 4YS3C 3AZFD 3B6GA 1ZLAD 4H9NA 4G92B 3KWQA 3AZND 4J8WA 3AZHA 2NQBA 3REHD 4X23D 3AZKB 1HQ3A 3LJAC 3W97B 3REIC 4LD9B 4CAYB 5AV6A 5CP6B 3LELA 2F8NB 5F99A 3REJB 3AZGB 4H9QA 3KXBC 5B40C 5C3IB 1BFMA 1EQZC 1P3PD 3AV2C 5GT3A 3X1UA 3O62D 5AVBA 1BH8B 5B2JC 3AZMA 1EQZD 4E45A 1H3OB 4KUDC 3MVDC 5AV5B 3WTPC 3REKA 5KDMA 3UTBA 1KX5D 3B6GC 5CPKB 3WA9A 3B0DC 5AVBD 5E5AA 1P3MA 1AOIA 3LJAD 4J8VD 3KSYA 1P3AA 4YM6A 1A7WA 5FUGA 4JJNB 4NE6A 1F66A 4DRAA 3AZFB 4H9SC 1P34C 1KX3C 5CP6A 5CPJD 2CV5A 3KUYC 3AFAB 4J8VA 1BH9A 3AZNA 3LZ0D 3AV1D 1AOID 4J8UA 3MGSA 5B1LB 2NQBD 1WWSA 4CSRB 5DNMB 3B0BA 3UT9C 3AZMD 3VH5A 3REHA 4UUZA 1ULYA 2LY8A 3AV2A 4YM6C 3AZJD 2HIOB 1M19C 4KGCC 3MNNC 1P3LD 2HIOC 1M19B 3W98B 3AN2B 3UTBC 4Z5TD 4R8PD 2CV5C 1EQZB 3KUYA 3REIA 3X1SA 1M1AC 5B32B 5B2JA 2BYMB 5BT1C 5AVCD 3AZGA 3UT9B 1P3BB 5BS7C 2RVQD 3MGRA 5E5AB 4J8XC 4KHAA 3X1VD 4XZQA 5FUGB 4J8WD 3AZHD 4ZUXD 4Z5TA 5CPJC 5E5AC 4X23A 3AZKC 4JJNC 3X1SD 3LZ1C 3X1TB 3B6FB 3RELA 1TAFA 5AVCA 5JRGA 3AZGD 4WU9C 5AV8A 5DNNB 3UTBB 3MVDA 4YS3B 3B0CT 1P3PB 1ZLAA 5GXQC 4HGAC 1P3MB 3W97D 5DNMD 4R8PA 2HIOA 5AV5C 4YM6B 4WU8D 2F8NK 5CP6D 3W99A 5JRGD 2AROA 3LZ0B 3AZJB 3AV1B 4JJNA 1P3AC 5B24A 4H9RA 5DNMC 5B0YC 3MGPA 5B40B 3KXBB 5B0YD 3WKJA 1P3AD 3WAAA 4J8UB 3AZIB 5CP6C 3LJAB 4J8WB 3AZHB 3A6ND 1P3FD 5BO0A 5B40D 3KXBD 1F66D 1P3OD 3LZ1D 3X1SC 3W97C 4JJND 5E5AD 3AZEA 5AY8D 3MGPD 3W99C 3C1CC 5DNND 1ID3D 4WU9A 2PYOB 4AWLB 3VH6A 3RELB 3REID 4XZQC 5F99B 3REJA 4EO5B 1KX5A 3AZKA 3MVDB 5B2IB 1ID3B 2NZDC 1HQ3C 4R8PC 1M1AA 5AV5A 3X1UB 5B31D 4H9OB 4NFTA 3REJD 2RVQC 4QLCA 4J8XD 3AZMB 5B2ID 4WV4B 5B33B 5KDMB 5B40A 3KXBA 3REJC 4Z5TC 5CPJA 2CV5D 5B1LA 1P3FB 4G91B 1P3BD 3VH6T 4Z66A 5CPIC 1U35D 3KUYD 2HIOD 5AY8B 2NZDD 1B67A 1P3AB 4WU8A 5B33C 1P3MC 4LD9C 3V9RA 2AROD 3NQUB 2NQBB 3AZFA 3KWQD 5GXQB 4NE5A 4J8VB 2NZDA 4Z66C 5DNMA 2YFWB 3MGQD 4KHAB 5AV8D 3C1CB 3MVDD 4AWLC 3UTAC 3WTPA 3REKC 3X1TD 3X1SB 3B6FD 5F99D 3LELD 2BYMA 5AVCB 4J8UC 4J8XB 1S32D 4NE3A 1P3GA 1R4VA 2BYKB 5BNVA 5AVBB 1TZYB 1H3OA 5CPKD 1M18B 1M19A 5B1MD 5AV6B 1B6WA 3MNNA 1P3ID 1P3PC 1TZYD 5JA4B 5CPIA 2FJ7C 3REKD 2HUEB 3UTAD 5B0ZC 3NQUA 3MGSC 1N1JA 3UT9A 3AZKD 5B33A 3MGSD 5AV8B 5BS7A 5DNNA 3MGRC 5B0ZD 3RELC 5CPJB 1U35A 3AZIA 1TZYC 3AZFC 3W99B 2F8ND 4X23B 1P3IC 3MGPB 4X23C 3TU4D 3LZ1A 4CSRA 4LD9D 5B0ZA 3AZED 3WA9B 1S32C 3WAAB 5GSUB 5B31A 1AOIB 3AZID 4XUJA 1P3GC 4QLCD 4J8XA 1KX5B 2F8NH 5GXQA 3LELC 1P3IB 5B0YB 1P3BC 4KUDB 1TZYA 3AZEB 3WA9D 2FJ7B 3W98A 5B24D 3W96D 3X1UD 5BO0B 3UT9D 4H9OA 2JSSA 5B32A 5B2JB 5GT3C 5B1MB 1WWIA 1P34D 1KX3D 2HUEC 1JFIA 4UUZB 3AZEC 5AV6D 1P3GB 4G91C 1P34B 1KX3B 4XZQD 3AFAC 3RELD 3MGPC 5G49B 4QLCB 3MGQB 4Z66B 3B6GB 4KUDD 2FJ7D 5B2IC 2NZDB 2CWEA 4DRBA 3W98C 3AV2D 3W97A 5BNXB 1U35B 4H9RB 5CPKC 4KGCB 2YFVB 3WTPB 5JRGB 1KX4D 3VH6W 1JFIB 5B1LC 4XUJD 1P3KD 5AV9D 5GXQD 2BYKA 3NQJA 3MGRD 1KU5A 1S32A 5AY8C 2IO5C 4WNNB 5CHLB 3AZLA 2AROB 3LZ0A 3REHC 4WZSB 3AZGC 3AV1A 1P3OC 4LD9A 1P3FC
chains in the Genus database with same CATH superfamily
4Z66D 3REKB 4Z2MG 4YS3D 4ZUXB 3AYWA 2PYOD 2F8NA 3KWQC 5B1MC 1P3LA 3UTAA 2F8NG 2L5AA 2XD1A 1Q9CA 3W96A 5B33D 5JRGC 3VH5T 4WU8C 1M1AD 4J8UD 1KX4C 3AZLC 5B32D 3AYWD 4WU9B 2PYOA 5F99C 3LZ1B 3X1TC 3B6FC 3O62B 3W98D 5GSUC 3KWQB 5CPKA 1M19D 4E44A 1ID3A 3MGQC 3REHB 3WKJD 5GT0C 3C1BC 4H9PB 3AN2D 1M18A 5B0YA 3NQJB 1P3KB 2Y2JA 3LZ0C 4J8WC 3AZHC 3AV1C 4CAYA 1HQ3D 2UWXA 4WNNA 2IO5B 3A6NA 4M6BA 3AFAD 4ZBJB 4XUJB 5GT0D 3C1BD 3AN2C 1P3MD 5BT1D 1P3IA 4H9QB 5AV9A 5B0ZB 1HQ3B 4H9NB 1ID3C 5DNNC 3C1CA 3UTBD 3W99D 5CPID 1U35C 3R45A 5GT3B 3AYWC 4XZQB 4HGAB 3WKJC 4KUDA 3TU4B 1F66C 3B6GD 5B1MA 3WAAC 3MNND 4H9SA 1S32B 3A6NC 1P3LC 1KX5C 3VH5W 3X1TA 3B6FA 3W96C 5GSUA 5B31B 3AN2A 3LELB 1M18D 5G49A 3WA9C 5B31C 1P3OA 1AOIC 4QLCC 2Y2GA 1BH8A 5B32C 2YFWA 3AZIC 1P3GD 1P3LB 1P3BA 5B32G 3MGRB 5JA4A 3B0DB 3TU4C 1F66B 1P34A 1KX3A 3MGQA 3B0CW 3AZJA 4J8VC 3C1CD 3X1VB 3AZNB 5AV9C 1KX4A 3FDDA 4ZBJC 4XUJC 5BNVB 3O62A 5B31G 5AV9B 5BNXA 3IP4C 3AV2B 4YS3A 3MNNB 3AZNC 3R45B 4H9PA 3X1VC 3WTPE 3AFAA 1BH9B 3TU4A 5CPIB 5B1LD 1P3KC 5GT0A 3C1BA 1M18C 1N1JB 5AVCC 4KGCA 3KUYB 1HTAA 4ZUXA 4UPKA 4DQYB 3WAAD 5AV5D 3UTAB 3EPLA 3WKJB 3AZLB 5B2IA 1M1AB 4KGCD 1EQZA 2CV5B 4WU9D 3AYWB 2Y2IA 3MGSB 2Y2QA 5AV8C 4ZUXC 2NQBC 4Z2MH 1ZLAC 1P3FA 5C3IC 1P3PA 1P3OB 2FJ7A 5GT3D 5AY8A 5AV6C 2AROC 5B24C 5GSUD 2Y2MA 3V9RB 3REIB 4Z5TB 2ZY4A 5B24B 3EG5B 5GT0B 5AVBC 3C1BB 3AZLD 3X1VA 4R8PB 3W96B 4YM6D 4G92C 3WTPD 3AZJC 1P3KA 1F1EA 3LJAA 3X1UC 1KX4B 2DF4C 1ZLAB 3A6NB 2J8PA 4EO5C 2YFVA 3AZMC 5B2JD 3O62C 4WU8B 1TAFB 2PYOC 4YS3C 3AZFD 3B6GA 1ZLAD 4H9NA 4G92B 3KWQA 3EPKA 3AZND 4J8WA 3AZHA 2NQBA 3REHD 3A1KA 4X23D 3AZKB 1HQ3A 3LJAC 3W97B 3REIC 4LD9B 4CAYB 5AV6A 5CP6B 3LELA 2F8NB 5F99A 3REJB 3AZGB 4H9QA 3KXBC 5B40C 5C3IB 2ZM5A 1BFMA 1EQZC 1P3PD 3AV2C 5GT3A 2Y2PA 3X1UA 3O62D 5AVBA 1BH8B 5B2JC 3AZMA 1EQZD 4E45A 1H3OB 4KUDC 3MVDC 5AV5B 3WTPC 3REKA 5KDMA 3UTBA 1KX5D 3B6GC 5CPKB 3WA9A 3B0DC 5AVBD 5E5AA 1P3MA 1AOIA 3LJAD 4J8VD 3KSYA 1P3AA 4YM6A 1A7WA 5FUGA 4JJNB 4NE6A 1F66A 4DRAA 3AZFB 4H9SC 1P34C 1KX3C 5CP6A 5CPJD 2CV5A 3KUYC 3AFAB 4J8VA 1BH9A 3AZNA 3LZ0D 3AV1D 1AOID 4J8UA 3MGSA 5B1LB 2NQBD 1WWSA 4CSRB 5DNMB 3B0BA 3UT9C 3AZMD 3VH5A 3REHA 4UUZA 1ULYA 2LY8A 3AV2A 2DQNC 4YM6C 3AZJD 2HIOB 1M19C 4KGCC 3MNNC 1P3LD 2HIOC 1M19B 3W98B 3AN2B 3UTBC 4Z5TD 4R8PD 2CV5C 1EQZB 3KUYA 3REIA 1W2EA 2G5IC 3X1SA 1M1AC 5B32B 5B2JA 2BYMB 5BT1C 5AVCD 3AZGA 3H0RC 3UT9B 1P3BB 5BS7C 2RVQD 3MGRA 5E5AB 4J8XC 4KHAA 3X1VD 4XZQA 5FUGB 4J8WD 3AZHD 4ZUXD 4Z5TA 5CPJC 5E5AC 2F2AC 4X23A 3AZKC 4JJNC 3X1SD 3LZ1C 3X1TB 3B6FB 3RELA 2ZY3A 1TAFA 5AVCA 5JRGA 3AZGD 4WU9C 5AV8A 5DNNB 3UTBB 4WJ3C 3MVDA 4YS3B 3B0CT 1P3PB 1ZLAA 5GXQC 4HGAC 1P3MB 3W97D 5DNMD 4R8PA 2HIOA 5AV5C 4YM6B 4WU8D 2F8NK 5CP6D 3W99A 5JRGD 2AROA 3LZ0B 3AZJB 3AV1B 4JJNA 1P3AC 5B24A 4H9RA 5DNMC 5B0YC 3MGPA 5B40B 3KXBB 5B0YD 2G5HC 3WKJA 1P3AD 3WAAA 4J8UB 3AZIB 5CP6C 3LJAB 4J8WB 3AZHB 3A6ND 1PZRA 1P3FD 5BO0A 5B40D 3KXBD 1F66D 1P3OD 3LZ1D 3X1SC 3W97C 4JJND 5E5AD 3AZEA 5AY8D 3MGPD 3W99C 3C1CC 5DNND 1ID3D 4WU9A 2PYOB 4AWLB 2Y2LA 3VH6A 3RELB 3REID 4XZQC 5F99B 3REJA 4EO5B 1KX5A 3AZKA 3MVDB 2JCHA 5B2IB 1ID3B 2NZDC 2XD5A 1HQ3C 4R8PC 1M1AA 5AV5A 3X1UB 5B31D 4H9OB 4NFTA 3REJD 2RVQC 4QLCA 4J8XD 3AZMB 5B2ID 4WV4B 2W8SA 5B33B 2ZY2A 5KDMB 5B40A 3KXBA 3REJC 4Z5TC 5CPJA 2CV5D 5B1LA 1P3FB 4G91B 1P3BD 3VH6T 1T3UA 4Z66A 3H0LC 5CPIC 1U35D 3KUYD 2HIOD 5AY8B 2NZDD 1B67A 1P3AB 4WU8A 5B33C 1P3MC 4LD9C 3V9RA 2AROD 3NQUB 2NQBB 3AZFA 3KWQD 5GXQB 4NE5A 4J8VB 3F6TA 2NZDA 4Z66C 5DNMA 2YFWB 3MGQD 4KHAB 5AV8D 3C1CB 3MVDD 4AWLC 3UTAC 3WTPA 3REKC 2ZY5A 3X1TD 3X1SB 3B6FD 5F99D 3LELD 2BYMA 5AVCB 4J8UC 4J8XB 3EPJA 1S32D 4NE3A 1P3GA 1R4VA 2BYKB 5BNVA 5AVBB 1TZYB 1H3OA 5CPKD 1M18B 1M19A 5B1MD 5AV6B 1B6WA 3MNNA 1P3ID 1P3PC 1TZYD 5JA4B 5CPIA 2FJ7C 3REKD 2HUEB 3UTAD 5B0ZC 3NQUA 3MGSC 1N1JA 3UT9A 3AZKD 5B33A 3MGSD 5AV8B 5BS7A 5DNNA 3MGRC 2RIQA 5B0ZD 3RELC 5CPJB 1U35A 3AZIA 1TZYC 3AZFC 3W99B 2Y2KA 2F8ND 4X23B 1P3IC 3MGPB 2JE5A 4X23C 3TU4D 3LZ1A 2VQRA 4CSRA 3AL0C 4LD9D 5B0ZA 3AZED 3WA9B 3H0MC 1S32C 3WAAB 5GSUB 5B31A 2Y2OA 1AOIB 2FFFB 4XUJA 3AZID 1P3GC 4QLCD 4J8XA 1KX5B 2F8NH 5GXQA 3LELC 1P3IB 5B0YB 1P3BC 4KUDB 1TZYA 3AZEB 3WA9D 2FJ7B 3W98A 5B24D 3W96D 3X1UD 5BO0B 3UT9D 3P5JB 4H9OA 2JSSA 5B32A 5B2JB 3EPHA 5GT3C 5B1MB 1WWIA 1P34D 1KX3D 2HUEC 1JFIA 4UUZB 3AZEC 1Z2CB 5AV6D 1P3GB 4G91C 1P34B 1KX3B 4XZQD 3AFAC 3RELD 3MGPC 5G49B 4QLCB 3MGQB 4Z66B 2BG1A 3B6GB 4KUDD 2FJ7D 2Y2NA 5B2IC 2NZDB 2CWEA 4DRBA 3W98C 3AV2D 3W97A 5BNXB 1U35B 4H9RB 5CPKC 4KGCB 2YFVB 3WTPB 5JRGB 1KX4D 3VH6W 1JFIB 5B1LC 4XUJD 1P3KD 5AV9D 3KFUG 2Y2HA 5GXQD 2BYKA 3A1IA 3NQJA 3MGRD 1KU5A 1S32A 5AY8C 2IO5C 4WNNB 5CHLB 3AZLA 2AROB 3LZ0A 3REHC 4WZSB 3AZGC 3AV1A 1P3OC 4LD9A 1P3FC
chains in the Genus database with same CATH topology
4Z66D 3REKB 4Z2MG 4YS3D 4ZUXB 3AYWA 2PYOD 2F8NA 3KWQC 5B1MC 1P3LA 3UTAA 2F8NG 2L5AA 2XD1A 1Q9CA 3W96A 5B33D 5JRGC 3VH5T 4WU8C 1M1AD 4J8UD 1KX4C 3AZLC 5B32D 3AYWD 4WU9B 2PYOA 5F99C 3LZ1B 3X1TC 3B6FC 3O62B 3W98D 5GSUC 3KWQB 5CPKA 1M19D 4E44A 1ID3A 3MGQC 3REHB 3WKJD 5GT0C 3C1BC 4H9PB 3AN2D 1M18A 5B0YA 3NQJB 1P3KB 2Y2JA 3LZ0C 4J8WC 3AZHC 3AV1C 4CAYA 1HQ3D 2UWXA 4WNNA 2IO5B 3A6NA 4M6BA 3AFAD 4ZBJB 4XUJB 5GT0D 3C1BD 3AN2C 1P3MD 5BT1D 1P3IA 4H9QB 5AV9A 5B0ZB 1HQ3B 4H9NB 1ID3C 5DNNC 3C1CA 3UTBD 3W99D 5CPID 1U35C 3R45A 5GT3B 3AYWC 4XZQB 4HGAB 3WKJC 4KUDA 3TU4B 1F66C 3B6GD 5B1MA 3WAAC 3MNND 4H9SA 1S32B 3A6NC 1P3LC 1KX5C 3VH5W 3X1TA 3B6FA 3W96C 5GSUA 5B31B 3AN2A 3LELB 1M18D 5G49A 3WA9C 5B31C 1P3OA 1AOIC 4QLCC 2Y2GA 1BH8A 5B32C 2YFWA 3AZIC 1P3GD 1P3LB 1P3BA 5B32G 3MGRB 5JA4A 3B0DB 3TU4C 1F66B 1P34A 1KX3A 3MGQA 3B0CW 3AZJA 4J8VC 3C1CD 3X1VB 3AZNB 5AV9C 1KX4A 3FDDA 4ZBJC 4XUJC 5BNVB 3O62A 5B31G 5AV9B 5BNXA 3IP4C 3AV2B 4YS3A 3MNNB 3AZNC 3R45B 4H9PA 3X1VC 3WTPE 3AFAA 1BH9B 3TU4A 5CPIB 5B1LD 1P3KC 5GT0A 3C1BA 1M18C 1N1JB 5AVCC 4KGCA 3KUYB 1HTAA 4ZUXA 4UPKA 4DQYB 3WAAD 5AV5D 3UTAB 3EPLA 3WKJB 3AZLB 5B2IA 1M1AB 4KGCD 1EQZA 2CV5B 4WU9D 3AYWB 2Y2IA 3MGSB 2Y2QA 5AV8C 4ZUXC 2NQBC 4Z2MH 1ZLAC 1P3FA 5C3IC 1P3PA 1P3OB 2FJ7A 5GT3D 5AY8A 5AV6C 2AROC 5B24C 5GSUD 2Y2MA 3V9RB 3REIB 4Z5TB 2ZY4A 5B24B 3EG5B 5GT0B 5AVBC 3C1BB 3AZLD 3X1VA 4R8PB 3W96B 4YM6D 4G92C 3WTPD 3AZJC 1P3KA 1F1EA 3LJAA 3X1UC 1KX4B 2DF4C 1ZLAB 3A6NB 2J8PA 4EO5C 2YFVA 3AZMC 5B2JD 3O62C 4WU8B 1TAFB 2PYOC 4YS3C 3AZFD 3B6GA 1ZLAD 4H9NA 4G92B 3KWQA 3EPKA 3AZND 4J8WA 3AZHA 2NQBA 3REHD 3A1KA 4X23D 3AZKB 1HQ3A 3LJAC 3W97B 3REIC 4LD9B 4CAYB 5AV6A 5CP6B 3LELA 2F8NB 5F99A 3REJB 3AZGB 4H9QA 3KXBC 5B40C 5C3IB 2ZM5A 1BFMA 1EQZC 1P3PD 3AV2C 5GT3A 2Y2PA 3X1UA 3O62D 5AVBA 1BH8B 5B2JC 3AZMA 1EQZD 4E45A 1H3OB 4KUDC 3MVDC 5AV5B 3WTPC 3REKA 5KDMA 3UTBA 1KX5D 3B6GC 5CPKB 3WA9A 3B0DC 5AVBD 5E5AA 1P3MA 1AOIA 3LJAD 4J8VD 3KSYA 1P3AA 4YM6A 1A7WA 5FUGA 4JJNB 4NE6A 1F66A 4DRAA 3AZFB 4H9SC 1P34C 1KX3C 5CP6A 5CPJD 2CV5A 3KUYC 3AFAB 4J8VA 1BH9A 3AZNA 3LZ0D 3AV1D 1AOID 4J8UA 3MGSA 5B1LB 2NQBD 1WWSA 4CSRB 5DNMB 3B0BA 3UT9C 3AZMD 3VH5A 3REHA 4UUZA 1ULYA 2LY8A 3AV2A 2DQNC 4YM6C 3AZJD 2HIOB 1M19C 4KGCC 3MNNC 1P3LD 2HIOC 1M19B 3W98B 3AN2B 3UTBC 4Z5TD 4R8PD 2CV5C 1EQZB 3KUYA 3REIA 1W2EA 2G5IC 3X1SA 1M1AC 5B32B 5B2JA 2BYMB 5BT1C 5AVCD 3AZGA 3H0RC 3UT9B 1P3BB 5BS7C 2RVQD 3MGRA 5E5AB 4J8XC 4KHAA 3X1VD 4XZQA 5FUGB 4J8WD 3AZHD 4ZUXD 4Z5TA 5CPJC 5E5AC 2F2AC 4X23A 3AZKC 4JJNC 3X1SD 3LZ1C 3X1TB 3B6FB 3RELA 2ZY3A 1TAFA 5AVCA 5JRGA 3AZGD 4WU9C 5AV8A 5DNNB 3UTBB 4WJ3C 3MVDA 4YS3B 3B0CT 1P3PB 1ZLAA 5GXQC 4HGAC 1P3MB 3W97D 5DNMD 4R8PA 2HIOA 5AV5C 4YM6B 4WU8D 2F8NK 5CP6D 3W99A 5JRGD 2AROA 3LZ0B 3AZJB 3AV1B 4JJNA 1P3AC 5B24A 4H9RA 5DNMC 5B0YC 3MGPA 5B40B 3KXBB 5B0YD 2G5HC 3WKJA 1P3AD 3WAAA 4J8UB 3AZIB 5CP6C 3LJAB 4J8WB 3AZHB 3A6ND 1PZRA 1P3FD 5BO0A 5B40D 3KXBD 1F66D 1P3OD 3LZ1D 3X1SC 3W97C 4JJND 5E5AD 3AZEA 5AY8D 3MGPD 3W99C 3C1CC 5DNND 1ID3D 4WU9A 2PYOB 4AWLB 2Y2LA 3VH6A 3RELB 3REID 4XZQC 5F99B 3REJA 4EO5B 1KX5A 3AZKA 3MVDB 2JCHA 5B2IB 1ID3B 2NZDC 2XD5A 1HQ3C 4R8PC 1M1AA 5AV5A 3X1UB 5B31D 4H9OB 4NFTA 3REJD 2RVQC 4QLCA 4J8XD 3AZMB 5B2ID 4WV4B 2W8SA 5B33B 2ZY2A 5KDMB 5B40A 3KXBA 3REJC 4Z5TC 5CPJA 2CV5D 5B1LA 1P3FB 4G91B 1P3BD 3VH6T 1T3UA 4Z66A 3H0LC 5CPIC 1U35D 3KUYD 2HIOD 5AY8B 2NZDD 1B67A 1P3AB 4WU8A 5B33C 1P3MC 4LD9C 3V9RA 2AROD 3NQUB 2NQBB 3AZFA 3KWQD 5GXQB 4NE5A 4J8VB 3F6TA 2NZDA 4Z66C 5DNMA 2YFWB 3MGQD 4KHAB 5AV8D 3C1CB 3MVDD 4AWLC 3UTAC 3WTPA 3REKC 2ZY5A 3X1TD 3X1SB 3B6FD 5F99D 3LELD 2BYMA 5AVCB 4J8UC 4J8XB 3EPJA 1S32D 4NE3A 1P3GA 1R4VA 2BYKB 5BNVA 5AVBB 1TZYB 1H3OA 5CPKD 1M18B 1M19A 5B1MD 5AV6B 1B6WA 3MNNA 1P3ID 1P3PC 1TZYD 5JA4B 5CPIA 2FJ7C 3REKD 2HUEB 3UTAD 5B0ZC 3NQUA 3MGSC 1N1JA 3UT9A 3AZKD 5B33A 3MGSD 5AV8B 5BS7A 5DNNA 3MGRC 2RIQA 5B0ZD 3RELC 5CPJB 1U35A 3AZIA 1TZYC 3AZFC 3W99B 2Y2KA 2F8ND 4X23B 1P3IC 3MGPB 2JE5A 4X23C 3TU4D 3LZ1A 2VQRA 4CSRA 3AL0C 4LD9D 5B0ZA 3AZED 3WA9B 3H0MC 1S32C 3WAAB 5GSUB 5B31A 2Y2OA 1AOIB 2FFFB 4XUJA 3AZID 1P3GC 4QLCD 4J8XA 1KX5B 2F8NH 5GXQA 3LELC 1P3IB 5B0YB 1P3BC 4KUDB 1TZYA 3AZEB 3WA9D 2FJ7B 3W98A 5B24D 3W96D 3X1UD 5BO0B 3UT9D 3P5JB 4H9OA 2JSSA 5B32A 5B2JB 3EPHA 5GT3C 5B1MB 1WWIA 1P34D 1KX3D 2HUEC 1JFIA 4UUZB 3AZEC 1Z2CB 5AV6D 1P3GB 4G91C 1P34B 1KX3B 4XZQD 3AFAC 3RELD 3MGPC 5G49B 4QLCB 3MGQB 4Z66B 2BG1A 3B6GB 4KUDD 2FJ7D 2Y2NA 5B2IC 2NZDB 2CWEA 4DRBA 3W98C 3AV2D 3W97A 5BNXB 1U35B 4H9RB 5CPKC 4KGCB 2YFVB 3WTPB 5JRGB 1KX4D 3VH6W 1JFIB 5B1LC 4XUJD 1P3KD 5AV9D 3KFUG 2Y2HA 5GXQD 2BYKA 3A1IA 3NQJA 3MGRD 1KU5A 1S32A 5AY8C 2IO5C 4WNNB 5CHLB 3AZLA 2AROB 3LZ0A 3REHC 4WZSB 3AZGC 3AV1A 1P3OC 4LD9A 1P3FC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Z66 D;  3REK B;  4Z2M G;  4YS3 D;  4ZUX B;  3AYW A;  2PYO D;  2F8N A;  3KWQ C;  5B1M C;  1P3L A;  3UTA A;  2F8N G;  2L5A A;  1Q9C A;  3W96 A;  5B33 D;  5JRG C;  3VH5 T;  4WU8 C;  1M1A D;  4J8U D;  1KX4 C;  3AZL C;  5B32 D;  3AYW D;  4WU9 B;  2PYO A;  5F99 C;  3LZ1 B;  3X1T C;  3B6F C;  3O62 B;  3W98 D;  5GSU C;  3KWQ B;  5CPK A;  1M19 D;  4E44 A;  1ID3 A;  3MGQ C;  3REH B;  3WKJ D;  5GT0 C;  3C1B C;  4H9P B;  3AN2 D;  1M18 A;  5B0Y A;  3NQJ B;  1P3K B;  3LZ0 C;  3AV1 C;  4J8W C;  3AZH C;  4CAY A;  1HQ3 D;  4WNN A;  2IO5 B;  3A6N A;  4M6B A;  3AFA D;  4ZBJ B;  4XUJ B;  5GT0 D;  3C1B D;  3AN2 C;  1P3M D;  5BT1 D;  1P3I A;  4H9Q B;  5AV9 A;  5B0Z B;  1HQ3 B;  4H9N B;  1ID3 C;  5DNN C;  3C1C A;  3UTB D;  3W99 D;  5CPI D;  1U35 C;  3R45 A;  5GT3 B;  3AYW C;  4XZQ B;  4HGA B;  3WKJ C;  4KUD A;  3TU4 B;  1F66 C;  3B6G D;  5B1M A;  3WAA C;  3MNN D;  4H9S A;  1S32 B;  3A6N C;  1P3L C;  1KX5 C;  3VH5 W;  3X1T A;  3B6F A;  3W96 C;  5GSU A;  5B31 B;  3AN2 A;  3LEL B;  1M18 D;  5G49 A;  3WA9 C;  5B31 C;  1P3O A;  1AOI C;  4QLC C;  1BH8 A;  5B32 C;  2YFW A;  3AZI C;  1P3G D;  1P3L B;  1P3B A;  5B32 G;  3MGR B;  5JA4 A;  3B0D B;  3TU4 C;  1F66 B;  1P34 A;  1KX3 A;  3MGQ A;  3B0C W;  3AZJ A;  4J8V C;  3C1C D;  3X1V B;  3AZN B;  5AV9 C;  1KX4 A;  4ZBJ C;  4XUJ C;  5BNV B;  3O62 A;  5B31 G;  5AV9 B;  5BNX A;  3AV2 B;  4YS3 A;  3MNN B;  3AZN C;  3R45 B;  4H9P A;  3X1V C;  3WTP E;  3AFA A;  1BH9 B;  3TU4 A;  5CPI B;  5B1L D;  1P3K C;  5GT0 A;  3C1B A;  1M18 C;  1N1J B;  5AVC C;  4KGC A;  3KUY B;  1HTA A;  4ZUX A;  3WAA D;  5AV5 D;  3UTA B;  3WKJ B;  3AZL B;  5B2I A;  1M1A B;  4KGC D;  1EQZ A;  2CV5 B;  4WU9 D;  3AYW B;  3MGS B;  5AV8 C;  4ZUX C;  2NQB C;  4Z2M H;  1ZLA C;  1P3F A;  5C3I C;  1P3P A;  1P3O B;  2FJ7 A;  5GT3 D;  5AY8 A;  5AV6 C;  2ARO C;  5B24 C;  5GSU D;  3V9R B;  3REI B;  4Z5T B;  5B24 B;  5GT0 B;  3C1B B;  5AVB C;  3AZL D;  3X1V A;  4R8P B;  3W96 B;  4YM6 D;  4G92 C;  3WTP D;  3AZJ C;  1P3K A;  1F1E A;  3LJA A;  3X1U C;  1KX4 B;  1ZLA B;  3A6N B;  4EO5 C;  2YFV A;  3AZM C;  5B2J D;  3O62 C;  4WU8 B;  1TAF B;  2PYO C;  4YS3 C;  3AZF D;  3B6G A;  1ZLA D;  4H9N A;  4G92 B;  3KWQ A;  3AZN D;  4J8W A;  3AZH A;  2NQB A;  3REH D;  4X23 D;  3AZK B;  1HQ3 A;  3LJA C;  3W97 B;  3REI C;  4LD9 B;  4CAY B;  5AV6 A;  5CP6 B;  3LEL A;  2F8N B;  5F99 A;  3REJ B;  3AZG B;  4H9Q A;  3KXB C;  5B40 C;  5C3I B;  1BFM A;  1EQZ C;  1P3P D;  3AV2 C;  5GT3 A;  3X1U A;  3O62 D;  5AVB A;  1BH8 B;  5B2J C;  3AZM A;  1EQZ D;  4E45 A;  1H3O B;  4KUD C;  3MVD C;  5AV5 B;  3WTP C;  3REK A;  5KDM A;  3UTB A;  1KX5 D;  3B6G C;  5CPK B;  3WA9 A;  3B0D C;  5AVB D;  5E5A A;  1P3M A;  1AOI A;  3LJA D;  4J8V D;  3KSY A;  1P3A A;  4YM6 A;  1A7W A;  5FUG A;  4JJN B;  4NE6 A;  1F66 A;  4DRA A;  3AZF B;  4H9S C;  1P34 C;  1KX3 C;  5CP6 A;  5CPJ D;  2CV5 A;  3KUY C;  3AFA B;  4J8V A;  1BH9 A;  3AZN A;  3LZ0 D;  3AV1 D;  1AOI D;  4J8U A;  3MGS A;  5B1L B;  2NQB D;  1WWS A;  4CSR B;  5DNM B;  3B0B A;  3UT9 C;  3AZM D;  3VH5 A;  3REH A;  4UUZ A;  1ULY A;  2LY8 A;  3AV2 A;  4YM6 C;  3AZJ D;  2HIO B;  1M19 C;  4KGC C;  3MNN C;  1P3L D;  2HIO C;  1M19 B;  3W98 B;  3AN2 B;  3UTB C;  4Z5T D;  4R8P D;  2CV5 C;  1EQZ B;  3KUY A;  3REI A;  3X1S A;  1M1A C;  5B32 B;  5B2J A;  2BYM B;  5BT1 C;  5AVC D;  3AZG A;  3UT9 B;  1P3B B;  5BS7 C;  2RVQ D;  3MGR A;  5E5A B;  4J8X C;  4KHA A;  3X1V D;  4XZQ A;  5FUG B;  4J8W D;  3AZH D;  4ZUX D;  4Z5T A;  5CPJ C;  5E5A C;  4X23 A;  3AZK C;  4JJN C;  3X1S D;  3LZ1 C;  3X1T B;  3B6F B;  3REL A;  1TAF A;  5AVC A;  5JRG A;  3AZG D;  4WU9 C;  5AV8 A;  5DNN B;  3UTB B;  3MVD A;  4YS3 B;  3B0C T;  1P3P B;  1ZLA A;  5GXQ C;  4HGA C;  1P3M B;  3W97 D;  5DNM D;  4R8P A;  2HIO A;  5AV5 C;  4YM6 B;  4WU8 D;  2F8N K;  5CP6 D;  3W99 A;  5JRG D;  2ARO A;  3LZ0 B;  3AZJ B;  3AV1 B;  4JJN A;  1P3A C;  5B24 A;  4H9R A;  5DNM C;  5B0Y C;  3MGP A;  5B40 B;  3KXB B;  5B0Y D;  3WKJ A;  1P3A D;  3WAA A;  4J8U B;  3AZI B;  5CP6 C;  3LJA B;  4J8W B;  3AZH B;  3A6N D;  1P3F D;  5BO0 A;  5B40 D;  3KXB D;  1F66 D;  1P3O D;  3LZ1 D;  3X1S C;  3W97 C;  4JJN D;  5E5A D;  3AZE A;  5AY8 D;  3MGP D;  3W99 C;  3C1C C;  5DNN D;  1ID3 D;  4WU9 A;  2PYO B;  4AWL B;  3VH6 A;  3REL B;  3REI D;  4XZQ C;  5F99 B;  3REJ A;  4EO5 B;  1KX5 A;  3AZK A;  3MVD B;  5B2I B;  1ID3 B;  2NZD C;  1HQ3 C;  4R8P C;  1M1A A;  5AV5 A;  3X1U B;  5B31 D;  4H9O B;  4NFT A;  3REJ D;  2RVQ C;  4QLC A;  4J8X D;  3AZM B;  5B2I D;  4WV4 B;  5B33 B;  5KDM B;  5B40 A;  3KXB A;  3REJ C;  4Z5T C;  5CPJ A;  2CV5 D;  5B1L A;  1P3F B;  4G91 B;  1P3B D;  3VH6 T;  4Z66 A;  5CPI C;  1U35 D;  3KUY D;  2HIO D;  5AY8 B;  2NZD D;  1B67 A;  1P3A B;  4WU8 A;  5B33 C;  1P3M C;  4LD9 C;  3V9R A;  2ARO D;  3NQU B;  2NQB B;  3AZF A;  3KWQ D;  5GXQ B;  4NE5 A;  4J8V B;  2NZD A;  4Z66 C;  5DNM A;  2YFW B;  3MGQ D;  4KHA B;  5AV8 D;  3C1C B;  3MVD D;  4AWL C;  3UTA C;  3WTP A;  3REK C;  3X1T D;  3X1S B;  3B6F D;  5F99 D;  3LEL D;  2BYM A;  5AVC B;  4J8U C;  4J8X B;  1S32 D;  4NE3 A;  1P3G A;  1R4V A;  2BYK B;  5BNV A;  5AVB B;  1TZY B;  1H3O A;  5CPK D;  1M18 B;  1M19 A;  5B1M D;  5AV6 B;  1B6W A;  3MNN A;  1P3I D;  1P3P C;  1TZY D;  5JA4 B;  5CPI A;  2FJ7 C;  3REK D;  2HUE B;  3UTA D;  5B0Z C;  3NQU A;  3MGS C;  1N1J A;  3UT9 A;  3AZK D;  5B33 A;  3MGS D;  5AV8 B;  5BS7 A;  5DNN A;  3MGR C;  5B0Z D;  3REL C;  5CPJ B;  1U35 A;  3AZI A;  1TZY C;  3AZF C;  3W99 B;  2F8N D;  4X23 B;  1P3I C;  3MGP B;  4X23 C;  3TU4 D;  3LZ1 A;  4CSR A;  4LD9 D;  5B0Z A;  3AZE D;  3WA9 B;  1S32 C;  3WAA B;  5GSU B;  5B31 A;  1AOI B;  3AZI D;  4XUJ A;  1P3G C;  4QLC D;  4J8X A;  1KX5 B;  2F8N H;  5GXQ A;  3LEL C;  1P3I B;  5B0Y B;  1P3B C;  4KUD B;  1TZY A;  3AZE B;  3WA9 D;  2FJ7 B;  3W98 A;  5B24 D;  3W96 D;  3X1U D;  5BO0 B;  3UT9 D;  4H9O A;  2JSS A;  5B32 A;  5B2J B;  5GT3 C;  5B1M B;  1WWI A;  1P34 D;  1KX3 D;  2HUE C;  1JFI A;  4UUZ B;  3AZE C;  5AV6 D;  1P3G B;  4G91 C;  1P34 B;  1KX3 B;  4XZQ D;  3AFA C;  3REL D;  3MGP C;  5G49 B;  4QLC B;  3MGQ B;  4Z66 B;  3B6G B;  4KUD D;  2FJ7 D;  5B2I C;  2NZD B;  2CWE A;  4DRB A;  3W98 C;  3AV2 D;  3W97 A;  5BNX B;  1U35 B;  4H9R B;  5CPK C;  4KGC B;  2YFV B;  3WTP B;  5JRG B;  1KX4 D;  3VH6 W;  1JFI B;  5B1L C;  4XUJ D;  1P3K D;  5AV9 D;  5GXQ D;  2BYK A;  3NQJ A;  3MGR D;  1KU5 A;  1S32 A;  5AY8 C;  2IO5 C;  4WNN B;  5CHL B;  3AZL A;  2ARO B;  3LZ0 A;  3REH C;  4WZS B;  3AZG C;  3AV1 A;  1P3O C;  4LD9 A;  1P3F C; 
#chains in the Genus database with same CATH topology
 4Z66 D;  3REK B;  4Z2M G;  4YS3 D;  4ZUX B;  3AYW A;  2PYO D;  2F8N A;  3KWQ C;  5B1M C;  1P3L A;  3UTA A;  2F8N G;  2L5A A;  2XD1 A;  1Q9C A;  3W96 A;  5B33 D;  5JRG C;  3VH5 T;  4WU8 C;  1M1A D;  4J8U D;  1KX4 C;  3AZL C;  5B32 D;  3AYW D;  4WU9 B;  2PYO A;  5F99 C;  3LZ1 B;  3X1T C;  3B6F C;  3O62 B;  3W98 D;  5GSU C;  3KWQ B;  5CPK A;  1M19 D;  4E44 A;  1ID3 A;  3MGQ C;  3REH B;  3WKJ D;  5GT0 C;  3C1B C;  4H9P B;  3AN2 D;  1M18 A;  5B0Y A;  3NQJ B;  1P3K B;  2Y2J A;  3LZ0 C;  4J8W C;  3AZH C;  3AV1 C;  4CAY A;  1HQ3 D;  2UWX A;  4WNN A;  2IO5 B;  3A6N A;  4M6B A;  3AFA D;  4ZBJ B;  4XUJ B;  5GT0 D;  3C1B D;  3AN2 C;  1P3M D;  5BT1 D;  1P3I A;  4H9Q B;  5AV9 A;  5B0Z B;  1HQ3 B;  4H9N B;  1ID3 C;  5DNN C;  3C1C A;  3UTB D;  3W99 D;  5CPI D;  1U35 C;  3R45 A;  5GT3 B;  3AYW C;  4XZQ B;  4HGA B;  3WKJ C;  4KUD A;  3TU4 B;  1F66 C;  3B6G D;  5B1M A;  3WAA C;  3MNN D;  4H9S A;  1S32 B;  3A6N C;  1P3L C;  1KX5 C;  3VH5 W;  3X1T A;  3B6F A;  3W96 C;  5GSU A;  5B31 B;  3AN2 A;  3LEL B;  1M18 D;  5G49 A;  3WA9 C;  5B31 C;  1P3O A;  1AOI C;  4QLC C;  2Y2G A;  1BH8 A;  5B32 C;  2YFW A;  3AZI C;  1P3G D;  1P3L B;  1P3B A;  5B32 G;  3MGR B;  5JA4 A;  3B0D B;  3TU4 C;  1F66 B;  1P34 A;  1KX3 A;  3MGQ A;  3B0C W;  3AZJ A;  4J8V C;  3C1C D;  3X1V B;  3AZN B;  5AV9 C;  1KX4 A;  3FDD A;  4ZBJ C;  4XUJ C;  5BNV B;  3O62 A;  5B31 G;  5AV9 B;  5BNX A;  3IP4 C;  3AV2 B;  4YS3 A;  3MNN B;  3AZN C;  3R45 B;  4H9P A;  3X1V C;  3WTP E;  3AFA A;  1BH9 B;  3TU4 A;  5CPI B;  5B1L D;  1P3K C;  5GT0 A;  3C1B A;  1M18 C;  1N1J B;  5AVC C;  4KGC A;  3KUY B;  1HTA A;  4ZUX A;  4UPK A;  4DQY B;  3WAA D;  5AV5 D;  3UTA B;  3EPL A;  3WKJ B;  3AZL B;  5B2I A;  1M1A B;  4KGC D;  1EQZ A;  2CV5 B;  4WU9 D;  3AYW B;  2Y2I A;  3MGS B;  2Y2Q A;  5AV8 C;  4ZUX C;  2NQB C;  4Z2M H;  1ZLA C;  1P3F A;  5C3I C;  1P3P A;  1P3O B;  2FJ7 A;  5GT3 D;  5AY8 A;  5AV6 C;  2ARO C;  5B24 C;  5GSU D;  2Y2M A;  3V9R B;  3REI B;  4Z5T B;  2ZY4 A;  5B24 B;  3EG5 B;  5GT0 B;  5AVB C;  3C1B B;  3AZL D;  3X1V A;  4R8P B;  3W96 B;  4YM6 D;  4G92 C;  3WTP D;  3AZJ C;  1P3K A;  1F1E A;  3LJA A;  3X1U C;  1KX4 B;  2DF4 C;  1ZLA B;  3A6N B;  2J8P A;  4EO5 C;  2YFV A;  3AZM C;  5B2J D;  3O62 C;  4WU8 B;  1TAF B;  2PYO C;  4YS3 C;  3AZF D;  3B6G A;  1ZLA D;  4H9N A;  4G92 B;  3KWQ A;  3EPK A;  3AZN D;  4J8W A;  3AZH A;  2NQB A;  3REH D;  3A1K A;  4X23 D;  3AZK B;  1HQ3 A;  3LJA C;  3W97 B;  3REI C;  4LD9 B;  4CAY B;  5AV6 A;  5CP6 B;  3LEL A;  2F8N B;  5F99 A;  3REJ B;  3AZG B;  4H9Q A;  3KXB C;  5B40 C;  5C3I B;  2ZM5 A;  1BFM A;  1EQZ C;  1P3P D;  3AV2 C;  5GT3 A;  2Y2P A;  3X1U A;  3O62 D;  5AVB A;  1BH8 B;  5B2J C;  3AZM A;  1EQZ D;  4E45 A;  1H3O B;  4KUD C;  3MVD C;  5AV5 B;  3WTP C;  3REK A;  5KDM A;  3UTB A;  1KX5 D;  3B6G C;  5CPK B;  3WA9 A;  3B0D C;  5AVB D;  5E5A A;  1P3M A;  1AOI A;  3LJA D;  4J8V D;  3KSY A;  1P3A A;  4YM6 A;  1A7W A;  5FUG A;  4JJN B;  4NE6 A;  1F66 A;  4DRA A;  3AZF B;  4H9S C;  1P34 C;  1KX3 C;  5CP6 A;  5CPJ D;  2CV5 A;  3KUY C;  3AFA B;  4J8V A;  1BH9 A;  3AZN A;  3LZ0 D;  3AV1 D;  1AOI D;  4J8U A;  3MGS A;  5B1L B;  2NQB D;  1WWS A;  4CSR B;  5DNM B;  3B0B A;  3UT9 C;  3AZM D;  3VH5 A;  3REH A;  4UUZ A;  1ULY A;  2LY8 A;  3AV2 A;  2DQN C;  4YM6 C;  3AZJ D;  2HIO B;  1M19 C;  4KGC C;  3MNN C;  1P3L D;  2HIO C;  1M19 B;  3W98 B;  3AN2 B;  3UTB C;  4Z5T D;  4R8P D;  2CV5 C;  1EQZ B;  3KUY A;  3REI A;  1W2E A;  2G5I C;  3X1S A;  1M1A C;  5B32 B;  5B2J A;  2BYM B;  5BT1 C;  5AVC D;  3AZG A;  3H0R C;  3UT9 B;  1P3B B;  5BS7 C;  2RVQ D;  3MGR A;  5E5A B;  4J8X C;  4KHA A;  3X1V D;  4XZQ A;  5FUG B;  4J8W D;  3AZH D;  4ZUX D;  4Z5T A;  5CPJ C;  5E5A C;  2F2A C;  4X23 A;  3AZK C;  4JJN C;  3X1S D;  3LZ1 C;  3X1T B;  3B6F B;  3REL A;  2ZY3 A;  1TAF A;  5AVC A;  5JRG A;  3AZG D;  4WU9 C;  5AV8 A;  5DNN B;  3UTB B;  4WJ3 C;  3MVD A;  4YS3 B;  3B0C T;  1P3P B;  1ZLA A;  5GXQ C;  4HGA C;  1P3M B;  3W97 D;  5DNM D;  4R8P A;  2HIO A;  5AV5 C;  4YM6 B;  4WU8 D;  2F8N K;  5CP6 D;  3W99 A;  5JRG D;  2ARO A;  3LZ0 B;  3AZJ B;  3AV1 B;  4JJN A;  1P3A C;  5B24 A;  4H9R A;  5DNM C;  5B0Y C;  3MGP A;  5B40 B;  3KXB B;  5B0Y D;  2G5H C;  3WKJ A;  1P3A D;  3WAA A;  4J8U B;  3AZI B;  5CP6 C;  3LJA B;  4J8W B;  3AZH B;  3A6N D;  1PZR A;  1P3F D;  5BO0 A;  5B40 D;  3KXB D;  1F66 D;  1P3O D;  3LZ1 D;  3X1S C;  3W97 C;  4JJN D;  5E5A D;  3AZE A;  5AY8 D;  3MGP D;  3W99 C;  3C1C C;  5DNN D;  1ID3 D;  4WU9 A;  2PYO B;  4AWL B;  2Y2L A;  3VH6 A;  3REL B;  3REI D;  4XZQ C;  5F99 B;  3REJ A;  4EO5 B;  1KX5 A;  3AZK A;  3MVD B;  2JCH A;  5B2I B;  1ID3 B;  2NZD C;  2XD5 A;  1HQ3 C;  4R8P C;  1M1A A;  5AV5 A;  3X1U B;  5B31 D;  4H9O B;  4NFT A;  3REJ D;  2RVQ C;  4QLC A;  4J8X D;  3AZM B;  5B2I D;  4WV4 B;  2W8S A;  5B33 B;  2ZY2 A;  5KDM B;  5B40 A;  3KXB A;  3REJ C;  4Z5T C;  5CPJ A;  2CV5 D;  5B1L A;  1P3F B;  4G91 B;  1P3B D;  3VH6 T;  1T3U A;  4Z66 A;  3H0L C;  5CPI C;  1U35 D;  3KUY D;  2HIO D;  5AY8 B;  2NZD D;  1B67 A;  1P3A B;  4WU8 A;  5B33 C;  1P3M C;  4LD9 C;  3V9R A;  2ARO D;  3NQU B;  2NQB B;  3AZF A;  3KWQ D;  5GXQ B;  4NE5 A;  4J8V B;  3F6T A;  2NZD A;  4Z66 C;  5DNM A;  2YFW B;  3MGQ D;  4KHA B;  5AV8 D;  3C1C B;  3MVD D;  4AWL C;  3UTA C;  3WTP A;  3REK C;  2ZY5 A;  3X1T D;  3X1S B;  3B6F D;  5F99 D;  3LEL D;  2BYM A;  5AVC B;  4J8U C;  4J8X B;  3EPJ A;  1S32 D;  4NE3 A;  1P3G A;  1R4V A;  2BYK B;  5BNV A;  5AVB B;  1TZY B;  1H3O A;  5CPK D;  1M18 B;  1M19 A;  5B1M D;  5AV6 B;  1B6W A;  3MNN A;  1P3I D;  1P3P C;  1TZY D;  5JA4 B;  5CPI A;  2FJ7 C;  3REK D;  2HUE B;  3UTA D;  5B0Z C;  3NQU A;  3MGS C;  1N1J A;  3UT9 A;  3AZK D;  5B33 A;  3MGS D;  5AV8 B;  5BS7 A;  5DNN A;  3MGR C;  2RIQ A;  5B0Z D;  3REL C;  5CPJ B;  1U35 A;  3AZI A;  1TZY C;  3AZF C;  3W99 B;  2Y2K A;  2F8N D;  4X23 B;  1P3I C;  3MGP B;  2JE5 A;  4X23 C;  3TU4 D;  3LZ1 A;  2VQR A;  4CSR A;  3AL0 C;  4LD9 D;  5B0Z A;  3AZE D;  3WA9 B;  3H0M C;  1S32 C;  3WAA B;  5GSU B;  5B31 A;  2Y2O A;  1AOI B;  2FFF B;  4XUJ A;  3AZI D;  1P3G C;  4QLC D;  4J8X A;  1KX5 B;  2F8N H;  5GXQ A;  3LEL C;  1P3I B;  5B0Y B;  1P3B C;  4KUD B;  1TZY A;  3AZE B;  3WA9 D;  2FJ7 B;  3W98 A;  5B24 D;  3W96 D;  3X1U D;  5BO0 B;  3UT9 D;  3P5J B;  4H9O A;  2JSS A;  5B32 A;  5B2J B;  3EPH A;  5GT3 C;  5B1M B;  1WWI A;  1P34 D;  1KX3 D;  2HUE C;  1JFI A;  4UUZ B;  3AZE C;  1Z2C B;  5AV6 D;  1P3G B;  4G91 C;  1P34 B;  1KX3 B;  4XZQ D;  3AFA C;  3REL D;  3MGP C;  5G49 B;  4QLC B;  3MGQ B;  4Z66 B;  2BG1 A;  3B6G B;  4KUD D;  2FJ7 D;  2Y2N A;  5B2I C;  2NZD B;  2CWE A;  4DRB A;  3W98 C;  3AV2 D;  3W97 A;  5BNX B;  1U35 B;  4H9R B;  5CPK C;  4KGC B;  2YFV B;  3WTP B;  5JRG B;  1KX4 D;  3VH6 W;  1JFI B;  5B1L C;  4XUJ D;  1P3K D;  5AV9 D;  3KFU G;  2Y2H A;  5GXQ D;  2BYK A;  3A1I A;  3NQJ A;  3MGR D;  1KU5 A;  1S32 A;  5AY8 C;  2IO5 C;  4WNN B;  5CHL B;  3AZL A;  2ARO B;  3LZ0 A;  3REH C;  4WZS B;  3AZG C;  3AV1 A;  1P3O C;  4LD9 A;  1P3F C; 
#chains in the Genus database with same CATH homology
 4Z66 D;  3REK B;  4Z2M G;  4YS3 D;  4ZUX B;  3AYW A;  2PYO D;  2F8N A;  3KWQ C;  5B1M C;  1P3L A;  3UTA A;  2F8N G;  2L5A A;  2XD1 A;  1Q9C A;  3W96 A;  5B33 D;  5JRG C;  3VH5 T;  4WU8 C;  1M1A D;  4J8U D;  1KX4 C;  3AZL C;  5B32 D;  3AYW D;  4WU9 B;  2PYO A;  5F99 C;  3LZ1 B;  3X1T C;  3B6F C;  3O62 B;  3W98 D;  5GSU C;  3KWQ B;  5CPK A;  1M19 D;  4E44 A;  1ID3 A;  3MGQ C;  3REH B;  3WKJ D;  5GT0 C;  3C1B C;  4H9P B;  3AN2 D;  1M18 A;  5B0Y A;  3NQJ B;  1P3K B;  2Y2J A;  3LZ0 C;  4J8W C;  3AZH C;  3AV1 C;  4CAY A;  1HQ3 D;  2UWX A;  4WNN A;  2IO5 B;  3A6N A;  4M6B A;  3AFA D;  4ZBJ B;  4XUJ B;  5GT0 D;  3C1B D;  3AN2 C;  1P3M D;  5BT1 D;  1P3I A;  4H9Q B;  5AV9 A;  5B0Z B;  1HQ3 B;  4H9N B;  1ID3 C;  5DNN C;  3C1C A;  3UTB D;  3W99 D;  5CPI D;  1U35 C;  3R45 A;  5GT3 B;  3AYW C;  4XZQ B;  4HGA B;  3WKJ C;  4KUD A;  3TU4 B;  1F66 C;  3B6G D;  5B1M A;  3WAA C;  3MNN D;  4H9S A;  1S32 B;  3A6N C;  1P3L C;  1KX5 C;  3VH5 W;  3X1T A;  3B6F A;  3W96 C;  5GSU A;  5B31 B;  3AN2 A;  3LEL B;  1M18 D;  5G49 A;  3WA9 C;  5B31 C;  1P3O A;  1AOI C;  4QLC C;  2Y2G A;  1BH8 A;  5B32 C;  2YFW A;  3AZI C;  1P3G D;  1P3L B;  1P3B A;  5B32 G;  3MGR B;  5JA4 A;  3B0D B;  3TU4 C;  1F66 B;  1P34 A;  1KX3 A;  3MGQ A;  3B0C W;  3AZJ A;  4J8V C;  3C1C D;  3X1V B;  3AZN B;  5AV9 C;  1KX4 A;  3FDD A;  4ZBJ C;  4XUJ C;  5BNV B;  3O62 A;  5B31 G;  5AV9 B;  5BNX A;  3IP4 C;  3AV2 B;  4YS3 A;  3MNN B;  3AZN C;  3R45 B;  4H9P A;  3X1V C;  3WTP E;  3AFA A;  1BH9 B;  3TU4 A;  5CPI B;  5B1L D;  1P3K C;  5GT0 A;  3C1B A;  1M18 C;  1N1J B;  5AVC C;  4KGC A;  3KUY B;  1HTA A;  4ZUX A;  4UPK A;  4DQY B;  3WAA D;  5AV5 D;  3UTA B;  3EPL A;  3WKJ B;  3AZL B;  5B2I A;  1M1A B;  4KGC D;  1EQZ A;  2CV5 B;  4WU9 D;  3AYW B;  2Y2I A;  3MGS B;  2Y2Q A;  5AV8 C;  4ZUX C;  2NQB C;  4Z2M H;  1ZLA C;  1P3F A;  5C3I C;  1P3P A;  1P3O B;  2FJ7 A;  5GT3 D;  5AY8 A;  5AV6 C;  2ARO C;  5B24 C;  5GSU D;  2Y2M A;  3V9R B;  3REI B;  4Z5T B;  2ZY4 A;  5B24 B;  3EG5 B;  5GT0 B;  5AVB C;  3C1B B;  3AZL D;  3X1V A;  4R8P B;  3W96 B;  4YM6 D;  4G92 C;  3WTP D;  3AZJ C;  1P3K A;  1F1E A;  3LJA A;  3X1U C;  1KX4 B;  2DF4 C;  1ZLA B;  3A6N B;  2J8P A;  4EO5 C;  2YFV A;  3AZM C;  5B2J D;  3O62 C;  4WU8 B;  1TAF B;  2PYO C;  4YS3 C;  3AZF D;  3B6G A;  1ZLA D;  4H9N A;  4G92 B;  3KWQ A;  3EPK A;  3AZN D;  4J8W A;  3AZH A;  2NQB A;  3REH D;  3A1K A;  4X23 D;  3AZK B;  1HQ3 A;  3LJA C;  3W97 B;  3REI C;  4LD9 B;  4CAY B;  5AV6 A;  5CP6 B;  3LEL A;  2F8N B;  5F99 A;  3REJ B;  3AZG B;  4H9Q A;  3KXB C;  5B40 C;  5C3I B;  2ZM5 A;  1BFM A;  1EQZ C;  1P3P D;  3AV2 C;  5GT3 A;  2Y2P A;  3X1U A;  3O62 D;  5AVB A;  1BH8 B;  5B2J C;  3AZM A;  1EQZ D;  4E45 A;  1H3O B;  4KUD C;  3MVD C;  5AV5 B;  3WTP C;  3REK A;  5KDM A;  3UTB A;  1KX5 D;  3B6G C;  5CPK B;  3WA9 A;  3B0D C;  5AVB D;  5E5A A;  1P3M A;  1AOI A;  3LJA D;  4J8V D;  3KSY A;  1P3A A;  4YM6 A;  1A7W A;  5FUG A;  4JJN B;  4NE6 A;  1F66 A;  4DRA A;  3AZF B;  4H9S C;  1P34 C;  1KX3 C;  5CP6 A;  5CPJ D;  2CV5 A;  3KUY C;  3AFA B;  4J8V A;  1BH9 A;  3AZN A;  3LZ0 D;  3AV1 D;  1AOI D;  4J8U A;  3MGS A;  5B1L B;  2NQB D;  1WWS A;  4CSR B;  5DNM B;  3B0B A;  3UT9 C;  3AZM D;  3VH5 A;  3REH A;  4UUZ A;  1ULY A;  2LY8 A;  3AV2 A;  2DQN C;  4YM6 C;  3AZJ D;  2HIO B;  1M19 C;  4KGC C;  3MNN C;  1P3L D;  2HIO C;  1M19 B;  3W98 B;  3AN2 B;  3UTB C;  4Z5T D;  4R8P D;  2CV5 C;  1EQZ B;  3KUY A;  3REI A;  1W2E A;  2G5I C;  3X1S A;  1M1A C;  5B32 B;  5B2J A;  2BYM B;  5BT1 C;  5AVC D;  3AZG A;  3H0R C;  3UT9 B;  1P3B B;  5BS7 C;  2RVQ D;  3MGR A;  5E5A B;  4J8X C;  4KHA A;  3X1V D;  4XZQ A;  5FUG B;  4J8W D;  3AZH D;  4ZUX D;  4Z5T A;  5CPJ C;  5E5A C;  2F2A C;  4X23 A;  3AZK C;  4JJN C;  3X1S D;  3LZ1 C;  3X1T B;  3B6F B;  3REL A;  2ZY3 A;  1TAF A;  5AVC A;  5JRG A;  3AZG D;  4WU9 C;  5AV8 A;  5DNN B;  3UTB B;  4WJ3 C;  3MVD A;  4YS3 B;  3B0C T;  1P3P B;  1ZLA A;  5GXQ C;  4HGA C;  1P3M B;  3W97 D;  5DNM D;  4R8P A;  2HIO A;  5AV5 C;  4YM6 B;  4WU8 D;  2F8N K;  5CP6 D;  3W99 A;  5JRG D;  2ARO A;  3LZ0 B;  3AZJ B;  3AV1 B;  4JJN A;  1P3A C;  5B24 A;  4H9R A;  5DNM C;  5B0Y C;  3MGP A;  5B40 B;  3KXB B;  5B0Y D;  2G5H C;  3WKJ A;  1P3A D;  3WAA A;  4J8U B;  3AZI B;  5CP6 C;  3LJA B;  4J8W B;  3AZH B;  3A6N D;  1PZR A;  1P3F D;  5BO0 A;  5B40 D;  3KXB D;  1F66 D;  1P3O D;  3LZ1 D;  3X1S C;  3W97 C;  4JJN D;  5E5A D;  3AZE A;  5AY8 D;  3MGP D;  3W99 C;  3C1C C;  5DNN D;  1ID3 D;  4WU9 A;  2PYO B;  4AWL B;  2Y2L A;  3VH6 A;  3REL B;  3REI D;  4XZQ C;  5F99 B;  3REJ A;  4EO5 B;  1KX5 A;  3AZK A;  3MVD B;  2JCH A;  5B2I B;  1ID3 B;  2NZD C;  2XD5 A;  1HQ3 C;  4R8P C;  1M1A A;  5AV5 A;  3X1U B;  5B31 D;  4H9O B;  4NFT A;  3REJ D;  2RVQ C;  4QLC A;  4J8X D;  3AZM B;  5B2I D;  4WV4 B;  2W8S A;  5B33 B;  2ZY2 A;  5KDM B;  5B40 A;  3KXB A;  3REJ C;  4Z5T C;  5CPJ A;  2CV5 D;  5B1L A;  1P3F B;  4G91 B;  1P3B D;  3VH6 T;  1T3U A;  4Z66 A;  3H0L C;  5CPI C;  1U35 D;  3KUY D;  2HIO D;  5AY8 B;  2NZD D;  1B67 A;  1P3A B;  4WU8 A;  5B33 C;  1P3M C;  4LD9 C;  3V9R A;  2ARO D;  3NQU B;  2NQB B;  3AZF A;  3KWQ D;  5GXQ B;  4NE5 A;  4J8V B;  3F6T A;  2NZD A;  4Z66 C;  5DNM A;  2YFW B;  3MGQ D;  4KHA B;  5AV8 D;  3C1C B;  3MVD D;  4AWL C;  3UTA C;  3WTP A;  3REK C;  2ZY5 A;  3X1T D;  3X1S B;  3B6F D;  5F99 D;  3LEL D;  2BYM A;  5AVC B;  4J8U C;  4J8X B;  3EPJ A;  1S32 D;  4NE3 A;  1P3G A;  1R4V A;  2BYK B;  5BNV A;  5AVB B;  1TZY B;  1H3O A;  5CPK D;  1M18 B;  1M19 A;  5B1M D;  5AV6 B;  1B6W A;  3MNN A;  1P3I D;  1P3P C;  1TZY D;  5JA4 B;  5CPI A;  2FJ7 C;  3REK D;  2HUE B;  3UTA D;  5B0Z C;  3NQU A;  3MGS C;  1N1J A;  3UT9 A;  3AZK D;  5B33 A;  3MGS D;  5AV8 B;  5BS7 A;  5DNN A;  3MGR C;  2RIQ A;  5B0Z D;  3REL C;  5CPJ B;  1U35 A;  3AZI A;  1TZY C;  3AZF C;  3W99 B;  2Y2K A;  2F8N D;  4X23 B;  1P3I C;  3MGP B;  2JE5 A;  4X23 C;  3TU4 D;  3LZ1 A;  2VQR A;  4CSR A;  3AL0 C;  4LD9 D;  5B0Z A;  3AZE D;  3WA9 B;  3H0M C;  1S32 C;  3WAA B;  5GSU B;  5B31 A;  2Y2O A;  1AOI B;  2FFF B;  4XUJ A;  3AZI D;  1P3G C;  4QLC D;  4J8X A;  1KX5 B;  2F8N H;  5GXQ A;  3LEL C;  1P3I B;  5B0Y B;  1P3B C;  4KUD B;  1TZY A;  3AZE B;  3WA9 D;  2FJ7 B;  3W98 A;  5B24 D;  3W96 D;  3X1U D;  5BO0 B;  3UT9 D;  3P5J B;  4H9O A;  2JSS A;  5B32 A;  5B2J B;  3EPH A;  5GT3 C;  5B1M B;  1WWI A;  1P34 D;  1KX3 D;  2HUE C;  1JFI A;  4UUZ B;  3AZE C;  1Z2C B;  5AV6 D;  1P3G B;  4G91 C;  1P34 B;  1KX3 B;  4XZQ D;  3AFA C;  3REL D;  3MGP C;  5G49 B;  4QLC B;  3MGQ B;  4Z66 B;  2BG1 A;  3B6G B;  4KUD D;  2FJ7 D;  2Y2N A;  5B2I C;  2NZD B;  2CWE A;  4DRB A;  3W98 C;  3AV2 D;  3W97 A;  5BNX B;  1U35 B;  4H9R B;  5CPK C;  4KGC B;  2YFV B;  3WTP B;  5JRG B;  1KX4 D;  3VH6 W;  1JFI B;  5B1L C;  4XUJ D;  1P3K D;  5AV9 D;  3KFU G;  2Y2H A;  5GXQ D;  2BYK A;  3A1I A;  3NQJ A;  3MGR D;  1KU5 A;  1S32 A;  5AY8 C;  2IO5 C;  4WNN B;  5CHL B;  3AZL A;  2ARO B;  3LZ0 A;  3REH C;  4WZS B;  3AZG C;  3AV1 A;  1P3O C;  4LD9 A;  1P3F C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...