4WU9D

Structure of cisptnap-ncp145
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
95
structure length
95
Chain Sequence
KTRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.2
publication title Stereochemical control of nucleosome targeting by platinum-intercalator antitumor agents.
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Structural protein/dna
total genus 37
structure length 95
sequence length 95
chains with identical sequence H
ec nomenclature
pdb deposition date 2014-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4wu9D00
3AN2A 5B1LD 3MGRA 5B40D 3C1CA 2HIOB 5CPKC 4X23D 1KX5D 3MGPB 3KUYC 1P3OB 2CV5D 5GXQC 3AFAB 4LD9B 3AZNA 5AV8A 3VH6T 5AV5C 4J8UC 5DNND 3AZHA 3AV2C 1M18B 4XZQC 1R4VA 4ZUXD 3MNND 3C1BA 1EQZA 5GT0B 3RELD 5B1LC 5B40C 5CPIA 5GT3D 4J8WA 1P3KB 3AZMD 5AVCD 3AZED 4X23C 1KX5C 1WWIA 3X1TD 3TU4B 2CV5C 1TAFA 5CHLB 5DNNC 4ZUXC 3MNNC 3WA9A 5AY8D 3RELC 1S32A 4KUDB 4Z5TB 5GT3C 3AZMC 5AVCC 3AZEC 1ULYA 2YFWB 1M1AA 3X1TC 3WKJD 5B0YA 3X1UA 4J8VA 5AV9A 1P3BD 1ID3D 1KX3B 5B1MD 5AY8C 1H3OB 1KU5A 5CPKB 1Q9CA 3KUYB 5GSUB 5GXQB 3A6NA 3WKJC 1BH8B 5CPJD 1P3IA 5AV5B 2NQBD 5F99D 1P3BC 1ID3C 4XZQB 3WAAA 5B31A 3X1SA 3AZKA 5B1MC 4X23B 1A7WA 1ZLAB 4H9RA 5B0ZA 3LZ1A 1P3MA 4CAYB 5CPJC 2NQBC 5BNXA 2LY8A 5F99C 3WTPD 3AZGA 4H9QB 3VH6A 3RELB 3AN2D 5AVCB 4H9SC 1P3PA 3AZEB 1P3LD 3REID 3KWQA 3X1TB 4E45A 2HIOD 4UUZB 3MVDD 5AV8D 3MGPD 3WTPC 1HQ3A 3C1BD 1F66B 5G49A 3AN2C 4H9NA 4J8WD 1M18D 5B24D 3VH5A 4G92B 1P3LC 3AZLB 5C3IC 5GT0D 3UT9D 2PYOD 1BH9B 3REIC 5DNMD 3LJAA 4CSRA 2HIOC 5AV6B 3AV1A 3MVDC 3MGQA 5AV8C 3MGPC 2AROA 5B2IB 1P3OC 3WA9D 3C1BC 2JSSA 5B1MB 4ZBJB 1S32D 2NZDA 4YS3A 3KSYA 1M18C 5B24C 3LZ0B 3UTBB 1HTAA 2PYOC 5GT0C 5JRGA 3UT9C 4KUDD 3O62B 5DNMC 3REHA 3B6FD 1P3FA 1P3AA 3NQUA 5F99B 4J8VD 5AV9D 1F1EA 4M6BA 1P34A 3V9RA 3W96D 3WA9C 1S32C 4R8PA 4G91C 2BYKB 2CWEA 1BFMA 4DRAA 1KX3D 4KUDC 2FJ7A 3B6FC 3WTPB 4WNNA 5GSUD 5CP6A 5AV9C 4J8VC 3WAAD 4KGCA 4XUJB 3X1SD 3AZKD 4H9OA 3W96C 3MGSB 3AN2B 2L5AA 3WTPE 4NE5A 4QLCA 1P3LB 4Z66A 1KX3C 1N1JA 4EO5C 3LZ1D 3AZNB 3MVDB 5AV8B 4WU8A 1ZLAD 5GSUC 3WAAC 3AZGD 3W99A 3C1BB 3X1SC 3AZKC 1P3GA 3AYWD 5CPIB 4J8WB 5B24B 3LELD 2PYOB 5B2JA 3UT9B 5BS7A 3KWQD 4J8XA 5DNMB 1TAFB 3LZ1C 1ZLAC 3X1VA 3AZGC 3WA9B 1S32B 4Z2MG 3AYWC 4G91B 3KXBD 2YFVA 3LELC 3VH5T 3AZIA 1F66D 2IO5C 3KWQC 3R45A 4JJNA 1M1AB 3W98A 3B6FB 3VH6W 3X1UB 4J8VB 5AV9B 3AZLD 1TZYA 3AFAA 2AROD 2BYMA 3W96B 3B6GA 5AV6D 5B2ID 4YM6D 4YS3D 3KXBC 1P3KA 1F66C 4EO5B 3A6NB 3LZ0D 5B33A 4G92C 3UTBD 1P3AD 1P3FD 3AZLC 3TU4A 3WAAB 1U35A 3O62D 2AROC 3X1SB 4WZSB 3VH5W 3REJD 3REKA 3AZKB 2HUEB 5AV6C 1KX4D 5B2IC 4YM6C 5E5AA 4YS3C 4Z5TA 4H9PB 4ZBJC 4H9RB 3LZ1B 3AZJA 5FUGB 3LZ0C 3W97A 5BNXB 3UTBC 1P3AC 1P3FC 4KGCD 3AZGB 3O62C 3REJC 4NE3A 3AYWB 1KX4C 3LELB 4XUJD 1P3PB 5JA4A 2IO5B 1H3OA 3KWQB 3MGSD 3MGRD 5CPKA 1AOIA 3C1CD 4NFTA 5BO0B 4WU8D 1BH8A 4KGCC 3AV2A 4J8UA 1HQ3B 3W99D 3AZND 5G49B 3AZHD 4H9NB 3KXBB 5B1LA 1EQZD 5B40A 4XUJC 5B2JD 3MGSC 3MGRC 4J8XD 5CPID 3LJAB 4CSRB 1KX5A 3C1CC 4Z2MH 2CV5A 4WU9A 1M19A 2AROB 5BNVB 4AWLC 5B32A 2F8NA 3W99C 5DNNA 3AZNC 4ZUXA 3MNNA 3AZHC 4YM6B 2NZDB 4YS3B 1EQZC 5GT3A 5B2JC 3AZMA 5JRGB 4J8XC 4JJND 5CPIC 3UTAA 4J8WC 3REHB 3W98D 1P3FB 5AVBA 3NQUB 1P3AB 1M1AD 3REJB 5B0YD 3V9RB 3B6GD 3X1UD 3B0DB 1KX4B 4R8PB 5AY8A 2FJ7B 1JFIA 4JJNC 1BH9A 3W98C 3WKJA 4WNNB 5CP6B 4KGCB 1M1AC 3A6ND 3REKD 1P3BA 4H9OB 5B0YC 1ID3A 1P3ID 3NQJA 4KHAB 3B6GC 3X1UC 5B31D 4QLCB 2RVQD 4Z66B 3MGRB 1N1JB 3C1CB 3AZJD 5KDMA 4WU8B 4DRBA 4AWLB 5CPJA 2NQBA 3W99B 5F99A 5B0ZD 3A6NC 3REKC 1P3GB 1P3MD 1P3IC 3AZHB 5B31G 1EQZB 5B31C 2RVQC 5B2JB 2HUEC 4H9SA 4J8XB 1AOID 1P3PD 3AZJC 3X1VB 4HGAC 5B0ZC 1P3MC 3AZFA 2YFVB 1HQ3D 3AZIB 3R45B 1P3LA 4JJNB 3REIA 1AOIC 3W98B 1P3PC 4WU9D 2HIOA 1TZYB 1M19D 2BYMB 3MVDA 3LJAD 5B0YB 5B32D 2F8ND 3MGPA 3B6GB 1P3OA 3AV1D 3MGQD 4LD9A 2F8NK 1HQ3C 1M18A 5B24A 1B67A 2PYOA 5GT0A 3UT9A 3UTAD 2NZDD 5B33B 5DNMA 5AVBD 5JRGD 4WU9C 1U35B 1M19C 3REKB 5B32G 3LJAC 3REHD 5B32C 2F8NG 1P3IB 3B0BA 3AV1C 3MGQC 1P34D 5B31B 5E5AB 3AZJB 4R8PD 3UTAC 4KUDA 2NZDC 3W97B 5AVBC 4HGAB 5JRGC 3B6FA 2FJ7D 5B0ZB 1P3MB 3REHC 2YFWA 5CP6D 3W96A 1P34C 5JA4B 3B0DC 1KX3A 1AOIB 4QLCD 4R8PC 3B0CT 4NE6A 4Z66D 3AV2B 4J8UB 2FJ7C 3KUYA 5GSUA 5GXQA 5CP6C 5AV5A 5B1LB 5B40B 1P3GD 4XZQA 1KX5B 4H9PA 4QLCC 2CV5B 4WU9B 4Z66C 1M19B 4X23A 5FUGA 5B32B 2F8NB 1ZLAA 5DNNB 3AV1B 4ZUXB 3MNNB 3MGQB 4WU8C 3X1VD 4CAYA 3AZFD 3B0CW 3AYWA 5GT3B 1P3GC 3AZMB 4H9QA 3LELA 3UTAB 3RELA 5AVBB 3AZID 1WWSA 5AVCA 5BS7C 3AZEA 5BO0A 3X1TA 1P3OD 1TZYD 4UUZA 3AFAD 1P34B 4LD9D 3X1VC 4WV4B 5AY8B 3AZFC 4E44A 3KXBA 2F8NH 1JFIB 1F66A 3AZIC 3WKJB 1P3KD 5BT1D 3AZLA 1P3BB 1ID3B 5B33D 5BNVA 3NQJB 3TU4D 1TZYC 3AFAC 1U35D 5AV6A 4LD9C 5B2IA 4YM6A 5B1MA 5E5AD 4Z5TD 5KDMB 1P3KC 3LZ0A 5CPJB 2NQBB 5BT1C 3UTBA 5B33C 3O62A 3W97D 3REJA 3TU4C 1B6WA 1U35C 1KX4A 5E5AC 4Z5TC 5CPKD 2BYKA 3KUYD 5GXQD 3W97C 3AZFB 3AV2D 4KHAA 5AV5D 4J8UD 3WTPA 4XZQD 4XUJA 5C3IB 3REIB 3MGSA
chains in the Genus database with same CATH superfamily
3AN2A 5B1LD 3MGRA 5B40D 3C1CA 2HIOB 5CPKC 4X23D 1KX5D 3MGPB 3KUYC 1P3OB 2CV5D 5GXQC 3AFAB 4LD9B 3AZNA 5AV8A 3VH6T 5AV5C 4J8UC 5DNND 3AZHA 3AV2C 1M18B 4XZQC 1R4VA 4ZUXD 3MNND 3C1BA 1EQZA 5GT0B 3RELD 5B1LC 5B40C 5CPIA 5GT3D 4J8WA 1P3KB 3AZMD 5AVCD 3AZED 4X23C 1KX5C 1WWIA 3X1TD 3TU4B 2CV5C 1TAFA 5CHLB 5DNNC 4ZUXC 3MNNC 3WA9A 5AY8D 3RELC 1S32A 4KUDB 4Z5TB 5GT3C 3AZMC 5AVCC 3AZEC 1ULYA 3H0RC 2YFWB 1M1AA 3X1TC 3WKJD 5B0YA 3X1UA 4J8VA 5AV9A 1P3BD 1ID3D 1KX3B 2Y2JA 2UWXA 5B1MD 5AY8C 1H3OB 1KU5A 5CPKB 1Q9CA 3EG5B 3KUYB 2ZY2A 5GSUB 5GXQB 3A6NA 3WKJC 1BH8B 5CPJD 1P3IA 5AV5B 2NQBD 5F99D 3A1IA 1P3BC 1ID3C 4XZQB 3WAAA 5B31A 3X1SA 3AZKA 2DQNC 2RIQA 5B1MC 4X23B 2BG1A 1A7WA 1ZLAB 3KFUG 2FFFB 4H9RA 5B0ZA 3LZ1A 1P3MA 4CAYB 5CPJC 2NQBC 5BNXA 2LY8A 5F99C 3WTPD 3AZGA 4H9QB 3VH6A 3RELB 3AN2D 5AVCB 4H9SC 1P3PA 3AZEB 1P3LD 2Y2QA 3REID 3KWQA 3X1TB 4E45A 2HIOD 4UUZB 2W8SA 3MVDD 5AV8D 3MGPD 3WTPC 1HQ3A 3C1BD 1F66B 5G49A 3AN2C 4H9NA 4J8WD 1M18D 5B24D 3VH5A 4G92B 1P3LC 3AZLB 5C3IC 5GT0D 3UT9D 2PYOD 1BH9B 3REIC 5DNMD 3LJAA 4CSRA 2HIOC 3F6TA 5AV6B 3AV1A 3MVDC 3MGQA 5AV8C 3MGPC 2AROA 5B2IB 1P3OC 3WA9D 3C1BC 2JSSA 5B1MB 4ZBJB 1S32D 2NZDA 4YS3A 3KSYA 1M18C 5B24C 3LZ0B 3UTBB 3H0MC 1HTAA 2PYOC 5GT0C 5JRGA 3UT9C 4KUDD 3O62B 5DNMC 3REHA 3B6FD 1P3FA 1P3AA 3NQUA 5F99B 4J8VD 5AV9D 1F1EA 4M6BA 1P34A 3V9RA 3W96D 3WA9C 1S32C 4R8PA 4G91C 2BYKB 2CWEA 1BFMA 4DRAA 1KX3D 4KUDC 2FJ7A 2ZY4A 3B6FC 3WTPB 4WNNA 5GSUD 5CP6A 5AV9C 4J8VC 3WAAD 4KGCA 4XUJB 3X1SD 3AZKD 4H9OA 3W96C 3MGSB 3AN2B 2L5AA 3WTPE 4NE5A 3EPLA 4QLCA 1P3LB 3EPHA 4Z66A 1KX3C 4UPKA 1N1JA 4EO5C 3LZ1D 3AZNB 3MVDB 5AV8B 4WU8A 1ZLAD 5GSUC 2ZY5A 3WAAC 3AZGD 3W99A 3C1BB 3X1SC 3AZKC 1P3GA 3AYWD 5CPIB 4J8WB 5B24B 3LELD 2PYOB 5B2JA 3EPJA 3UT9B 5BS7A 3KWQD 4J8XA 5DNMB 2ZM5A 1TAFB 3LZ1C 2DF4C 1ZLAC 3X1VA 3AZGC 3WA9B 2G5HC 1S32B 4Z2MG 3AYWC 4G91B 3KXBD 2YFVA 3LELC 3VH5T 3AZIA 1F66D 2IO5C 3KWQC 3R45A 4JJNA 1M1AB 3W98A 3B6FB 3VH6W 3X1UB 4J8VB 5AV9B 3AZLD 1TZYA 3AFAA 2AROD 2BYMA 3W96B 3B6GA 5AV6D 5B2ID 4YM6D 4YS3D 3KXBC 1P3KA 1F66C 4EO5B 2Y2MA 3A6NB 3LZ0D 5B33A 4G92C 3UTBD 1P3AD 1P3FD 3AZLC 3TU4A 3WAAB 2Y2NA 1U35A 3O62D 2AROC 3X1SB 4WZSB 3VH5W 3REJD 3REKA 3AZKB 2HUEB 5AV6C 1KX4D 5B2IC 4YM6C 3P5JB 5E5AA 4YS3C 4Z5TA 4H9PB 2VQRA 4ZBJC 4H9RB 3LZ1B 3AZJA 5FUGB 3LZ0C 3W97A 5BNXB 3UTBC 1P3AC 1P3FC 4KGCD 3AZGB 3O62C 3REJC 4NE3A 3AYWB 1KX4C 3LELB 4XUJD 1P3PB 5JA4A 2IO5B 1H3OA 3KWQB 3MGSD 3MGRD 5CPKA 2Y2IA 1AOIA 3C1CD 4DQYB 4NFTA 5BO0B 4WU8D 1BH8A 4KGCC 3AV2A 4J8UA 1HQ3B 3W99D 3AZND 5G49B 3AZHD 4H9NB 3IP4C 3KXBB 5B1LA 1EQZD 5B40A 4XUJC 5B2JD 3MGSC 3MGRC 4J8XD 5CPID 3LJAB 4CSRB 1KX5A 3C1CC 4Z2MH 2CV5A 4WU9A 1M19A 2AROB 5BNVB 4AWLC 5B32A 2F8NA 3W99C 2Y2KA 5DNNA 3AZNC 4ZUXA 3MNNA 3AZHC 4YM6B 2NZDB 4YS3B 1EQZC 5GT3A 2Y2HA 5B2JC 3AZMA 5JRGB 4J8XC 4JJND 5CPIC 3UTAA 4J8WC 3REHB 3W98D 4WJ3C 1P3FB 5AVBA 3NQUB 1P3AB 1M1AD 3REJB 5B0YD 3V9RB 1PZRA 3B6GD 3X1UD 3B0DB 1KX4B 4R8PB 5AY8A 2XD5A 2FJ7B 1JFIA 4JJNC 1BH9A 3W98C 3WKJA 4WNNB 5CP6B 4KGCB 1M1AC 3A6ND 2XD1A 3REKD 4H9OB 5B0YC 1P3BA 1ID3A 1P3ID 3NQJA 4KHAB 3B6GC 3X1UC 5B31D 4QLCB 2RVQD 4Z66B 3MGRB 1N1JB 3C1CB 3AZJD 5KDMA 4WU8B 4DRBA 4AWLB 5CPJA 2NQBA 3W99B 5F99A 5B0ZD 3A6NC 3REKC 1P3GB 1P3MD 1P3IC 3AZHB 5B31G 1EQZB 5B31C 2RVQC 5B2JB 2HUEC 4H9SA 4J8XB 1AOID 1P3PD 3AZJC 2G5IC 3X1VB 4HGAC 5B0ZC 1P3MC 2JE5A 3AZFA 2YFVB 1HQ3D 3AZIB 3R45B 1P3LA 4JJNB 3REIA 1AOIC 3W98B 1P3PC 4WU9D 2HIOA 1TZYB 1M19D 2BYMB 3MVDA 3LJAD 5B0YB 5B32D 2F8ND 3MGPA 3B6GB 1P3OA 3AV1D 1W2EA 3MGQD 2Y2GA 4LD9A 2F8NK 1HQ3C 2F2AC 1M18A 5B24A 1B67A 2PYOA 5GT0A 3UT9A 3UTAD 2NZDD 5B33B 5DNMA 5AVBD 5JRGD 4WU9C 1U35B 1M19C 3REKB 5B32G 3LJAC 3REHD 5B32C 2F8NG 1P3IB 3B0BA 3AV1C 3MGQC 1P34D 5B31B 5E5AB 3AZJB 4R8PD 3UTAC 4KUDA 2NZDC 3W97B 5AVBC 4HGAB 5JRGC 3B6FA 2FJ7D 5B0ZB 1P3MB 3REHC 2Y2OA 2YFWA 5CP6D 3W96A 1P34C 5JA4B 2JCHA 3B0DC 1KX3A 1AOIB 3A1KA 4QLCD 4R8PC 3B0CT 4NE6A 4Z66D 3AV2B 4J8UB 2FJ7C 3KUYA 5GSUA 5GXQA 5CP6C 5AV5A 5B1LB 5B40B 1P3GD 4XZQA 2Y2PA 1KX5B 4H9PA 4QLCC 3FDDA 2CV5B 4WU9B 4Z66C 1M19B 4X23A 5FUGA 5B32B 2F8NB 1ZLAA 1Z2CB 5DNNB 3AV1B 2ZY3A 4ZUXB 3MNNB 3MGQB 4WU8C 3X1VD 4CAYA 3AZFD 3B0CW 3AYWA 5GT3B 1P3GC 3AZMB 4H9QA 3H0LC 3LELA 3UTAB 3RELA 5AVBB 3AZID 1WWSA 5AVCA 5BS7C 3AZEA 3AL0C 5BO0A 3X1TA 1P3OD 1TZYD 4UUZA 3AFAD 1P34B 4LD9D 3X1VC 4WV4B 5AY8B 3AZFC 4E44A 3KXBA 2F8NH 1JFIB 1F66A 3AZIC 3WKJB 1P3KD 5BT1D 3AZLA 1P3BB 1ID3B 5B33D 5BNVA 3NQJB 3TU4D 1TZYC 3AFAC 1U35D 5AV6A 4LD9C 2J8PA 1T3UA 5B2IA 4YM6A 5B1MA 5E5AD 4Z5TD 2Y2LA 5KDMB 1P3KC 3LZ0A 5CPJB 2NQBB 5BT1C 3UTBA 5B33C 3O62A 3W97D 3REJA 3TU4C 1B6WA 1U35C 1KX4A 5E5AC 4Z5TC 5CPKD 2BYKA 3EPKA 3KUYD 5GXQD 3W97C 3AZFB 3AV2D 4KHAA 5AV5D 4J8UD 3WTPA 4XZQD 4XUJA 5C3IB 3REIB 3MGSA
chains in the Genus database with same CATH topology
3AN2A 5B1LD 3MGRA 5B40D 3C1CA 2HIOB 5CPKC 4X23D 1KX5D 3MGPB 3KUYC 1P3OB 2CV5D 5GXQC 3AFAB 4LD9B 3AZNA 5AV8A 3VH6T 5AV5C 4J8UC 5DNND 3AZHA 3AV2C 1M18B 4XZQC 1R4VA 4ZUXD 3MNND 3C1BA 1EQZA 5GT0B 3RELD 5B1LC 5B40C 5CPIA 5GT3D 4J8WA 1P3KB 3AZMD 5AVCD 3AZED 4X23C 1KX5C 1WWIA 3X1TD 3TU4B 2CV5C 1TAFA 5CHLB 5DNNC 4ZUXC 3MNNC 3WA9A 5AY8D 3RELC 1S32A 4KUDB 4Z5TB 5GT3C 3AZMC 5AVCC 3AZEC 1ULYA 3H0RC 2YFWB 1M1AA 3X1TC 3WKJD 5B0YA 3X1UA 4J8VA 5AV9A 1P3BD 1ID3D 1KX3B 2Y2JA 2UWXA 5B1MD 5AY8C 1H3OB 1KU5A 5CPKB 1Q9CA 3EG5B 3KUYB 2ZY2A 5GSUB 5GXQB 3A6NA 3WKJC 1BH8B 5CPJD 1P3IA 5AV5B 2NQBD 5F99D 3A1IA 1P3BC 1ID3C 4XZQB 3WAAA 5B31A 3X1SA 3AZKA 2DQNC 2RIQA 5B1MC 4X23B 2BG1A 1A7WA 1ZLAB 3KFUG 2FFFB 4H9RA 5B0ZA 3LZ1A 1P3MA 4CAYB 5CPJC 2NQBC 5BNXA 2LY8A 5F99C 3WTPD 3AZGA 4H9QB 3VH6A 3RELB 3AN2D 5AVCB 4H9SC 1P3PA 3AZEB 1P3LD 2Y2QA 3REID 3KWQA 3X1TB 4E45A 2HIOD 4UUZB 2W8SA 3MVDD 5AV8D 3MGPD 3WTPC 1HQ3A 3C1BD 1F66B 5G49A 3AN2C 4H9NA 4J8WD 1M18D 5B24D 3VH5A 4G92B 1P3LC 3AZLB 5C3IC 5GT0D 3UT9D 2PYOD 1BH9B 3REIC 5DNMD 3LJAA 4CSRA 2HIOC 3F6TA 5AV6B 3AV1A 3MVDC 3MGQA 5AV8C 3MGPC 2AROA 5B2IB 1P3OC 3WA9D 3C1BC 2JSSA 5B1MB 4ZBJB 1S32D 2NZDA 4YS3A 3KSYA 1M18C 5B24C 3LZ0B 3UTBB 3H0MC 1HTAA 2PYOC 5GT0C 5JRGA 3UT9C 4KUDD 3O62B 5DNMC 3REHA 3B6FD 1P3FA 1P3AA 3NQUA 5F99B 4J8VD 5AV9D 1F1EA 4M6BA 1P34A 3V9RA 3W96D 3WA9C 1S32C 4R8PA 4G91C 2BYKB 2CWEA 1BFMA 4DRAA 1KX3D 4KUDC 2FJ7A 2ZY4A 3B6FC 3WTPB 4WNNA 5GSUD 5CP6A 5AV9C 4J8VC 3WAAD 4KGCA 4XUJB 3X1SD 3AZKD 4H9OA 3W96C 3MGSB 3AN2B 2L5AA 3WTPE 4NE5A 3EPLA 4QLCA 1P3LB 3EPHA 4Z66A 1KX3C 4UPKA 1N1JA 4EO5C 3LZ1D 3AZNB 3MVDB 5AV8B 4WU8A 1ZLAD 5GSUC 2ZY5A 3WAAC 3AZGD 3W99A 3C1BB 3X1SC 3AZKC 1P3GA 3AYWD 5CPIB 4J8WB 5B24B 3LELD 2PYOB 5B2JA 3EPJA 3UT9B 5BS7A 3KWQD 4J8XA 5DNMB 2ZM5A 1TAFB 3LZ1C 2DF4C 1ZLAC 3X1VA 3AZGC 3WA9B 2G5HC 1S32B 4Z2MG 3AYWC 4G91B 3KXBD 2YFVA 3LELC 3VH5T 3AZIA 1F66D 2IO5C 3KWQC 3R45A 4JJNA 1M1AB 3W98A 3B6FB 3VH6W 3X1UB 4J8VB 5AV9B 3AZLD 1TZYA 3AFAA 2AROD 2BYMA 3W96B 3B6GA 5AV6D 5B2ID 4YM6D 4YS3D 3KXBC 1P3KA 1F66C 4EO5B 2Y2MA 3A6NB 3LZ0D 5B33A 4G92C 3UTBD 1P3AD 1P3FD 3AZLC 3TU4A 3WAAB 2Y2NA 1U35A 3O62D 2AROC 3X1SB 4WZSB 3VH5W 3REJD 3REKA 3AZKB 2HUEB 5AV6C 1KX4D 5B2IC 4YM6C 3P5JB 5E5AA 4YS3C 4Z5TA 4H9PB 2VQRA 4ZBJC 4H9RB 3LZ1B 3AZJA 5FUGB 3LZ0C 3W97A 5BNXB 3UTBC 1P3AC 1P3FC 4KGCD 3AZGB 3O62C 3REJC 4NE3A 3AYWB 1KX4C 3LELB 4XUJD 1P3PB 5JA4A 2IO5B 1H3OA 3KWQB 3MGSD 3MGRD 5CPKA 2Y2IA 1AOIA 3C1CD 4DQYB 4NFTA 5BO0B 4WU8D 1BH8A 4KGCC 3AV2A 4J8UA 1HQ3B 3W99D 3AZND 5G49B 3AZHD 4H9NB 3IP4C 3KXBB 5B1LA 1EQZD 5B40A 4XUJC 5B2JD 3MGSC 3MGRC 4J8XD 5CPID 3LJAB 4CSRB 1KX5A 3C1CC 4Z2MH 2CV5A 4WU9A 1M19A 2AROB 5BNVB 4AWLC 5B32A 2F8NA 3W99C 2Y2KA 5DNNA 3AZNC 4ZUXA 3MNNA 3AZHC 4YM6B 2NZDB 4YS3B 1EQZC 5GT3A 2Y2HA 5B2JC 3AZMA 5JRGB 4J8XC 4JJND 5CPIC 3UTAA 4J8WC 3REHB 3W98D 4WJ3C 1P3FB 5AVBA 3NQUB 1P3AB 1M1AD 3REJB 5B0YD 3V9RB 1PZRA 3B6GD 3X1UD 3B0DB 1KX4B 4R8PB 5AY8A 2XD5A 2FJ7B 1JFIA 4JJNC 1BH9A 3W98C 3WKJA 4WNNB 5CP6B 4KGCB 1M1AC 3A6ND 2XD1A 3REKD 4H9OB 5B0YC 1P3BA 1ID3A 1P3ID 3NQJA 4KHAB 3B6GC 3X1UC 5B31D 4QLCB 2RVQD 4Z66B 3MGRB 1N1JB 3C1CB 3AZJD 5KDMA 4WU8B 4DRBA 4AWLB 5CPJA 2NQBA 3W99B 5F99A 5B0ZD 3A6NC 3REKC 1P3GB 1P3MD 1P3IC 3AZHB 5B31G 1EQZB 5B31C 2RVQC 5B2JB 2HUEC 4H9SA 4J8XB 1AOID 1P3PD 3AZJC 2G5IC 3X1VB 4HGAC 5B0ZC 1P3MC 2JE5A 3AZFA 2YFVB 1HQ3D 3AZIB 3R45B 1P3LA 4JJNB 3REIA 1AOIC 3W98B 1P3PC 4WU9D 2HIOA 1TZYB 1M19D 2BYMB 3MVDA 3LJAD 5B0YB 5B32D 2F8ND 3MGPA 3B6GB 1P3OA 3AV1D 1W2EA 3MGQD 2Y2GA 4LD9A 2F8NK 1HQ3C 2F2AC 1M18A 5B24A 1B67A 2PYOA 5GT0A 3UT9A 3UTAD 2NZDD 5B33B 5DNMA 5AVBD 5JRGD 4WU9C 1U35B 1M19C 3REKB 5B32G 3LJAC 3REHD 5B32C 2F8NG 1P3IB 3B0BA 3AV1C 3MGQC 1P34D 5B31B 5E5AB 3AZJB 4R8PD 3UTAC 4KUDA 2NZDC 3W97B 5AVBC 4HGAB 5JRGC 3B6FA 2FJ7D 5B0ZB 1P3MB 3REHC 2Y2OA 2YFWA 5CP6D 3W96A 1P34C 5JA4B 2JCHA 3B0DC 1KX3A 1AOIB 3A1KA 4QLCD 4R8PC 3B0CT 4NE6A 4Z66D 3AV2B 4J8UB 2FJ7C 3KUYA 5GSUA 5GXQA 5CP6C 5AV5A 5B1LB 5B40B 1P3GD 4XZQA 2Y2PA 1KX5B 4H9PA 4QLCC 3FDDA 2CV5B 4WU9B 4Z66C 1M19B 4X23A 5FUGA 5B32B 2F8NB 1ZLAA 1Z2CB 5DNNB 3AV1B 2ZY3A 4ZUXB 3MNNB 3MGQB 4WU8C 3X1VD 4CAYA 3AZFD 3B0CW 3AYWA 5GT3B 1P3GC 3AZMB 4H9QA 3H0LC 3LELA 3UTAB 3RELA 5AVBB 3AZID 1WWSA 5AVCA 5BS7C 3AZEA 3AL0C 5BO0A 3X1TA 1P3OD 1TZYD 4UUZA 3AFAD 1P34B 4LD9D 3X1VC 4WV4B 5AY8B 3AZFC 4E44A 3KXBA 2F8NH 1JFIB 1F66A 3AZIC 3WKJB 1P3KD 5BT1D 3AZLA 1P3BB 1ID3B 5B33D 5BNVA 3NQJB 3TU4D 1TZYC 3AFAC 1U35D 5AV6A 4LD9C 2J8PA 1T3UA 5B2IA 4YM6A 5B1MA 5E5AD 4Z5TD 2Y2LA 5KDMB 1P3KC 3LZ0A 5CPJB 2NQBB 5BT1C 3UTBA 5B33C 3O62A 3W97D 3REJA 3TU4C 1B6WA 1U35C 1KX4A 5E5AC 4Z5TC 5CPKD 2BYKA 3EPKA 3KUYD 5GXQD 3W97C 3AZFB 3AV2D 4KHAA 5AV5D 4J8UD 3WTPA 4XZQD 4XUJA 5C3IB 3REIB 3MGSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AN2 A;  5B1L D;  3MGR A;  5B40 D;  3C1C A;  2HIO B;  5CPK C;  4X23 D;  1KX5 D;  3MGP B;  3KUY C;  1P3O B;  2CV5 D;  5GXQ C;  3AFA B;  4LD9 B;  3AZN A;  5AV8 A;  3VH6 T;  5AV5 C;  4J8U C;  5DNN D;  3AZH A;  3AV2 C;  1M18 B;  4XZQ C;  1R4V A;  4ZUX D;  3MNN D;  3C1B A;  1EQZ A;  5GT0 B;  3REL D;  5B1L C;  5B40 C;  5CPI A;  5GT3 D;  4J8W A;  1P3K B;  3AZM D;  5AVC D;  3AZE D;  4X23 C;  1KX5 C;  1WWI A;  3X1T D;  3TU4 B;  2CV5 C;  1TAF A;  5CHL B;  5DNN C;  4ZUX C;  3MNN C;  3WA9 A;  5AY8 D;  3REL C;  1S32 A;  4KUD B;  4Z5T B;  5GT3 C;  3AZM C;  5AVC C;  3AZE C;  1ULY A;  2YFW B;  1M1A A;  3X1T C;  3WKJ D;  5B0Y A;  3X1U A;  4J8V A;  5AV9 A;  1P3B D;  1ID3 D;  1KX3 B;  5B1M D;  5AY8 C;  1H3O B;  1KU5 A;  5CPK B;  1Q9C A;  3KUY B;  5GSU B;  5GXQ B;  3A6N A;  3WKJ C;  1BH8 B;  5CPJ D;  1P3I A;  5AV5 B;  2NQB D;  5F99 D;  1P3B C;  1ID3 C;  4XZQ B;  3WAA A;  5B31 A;  3X1S A;  3AZK A;  5B1M C;  4X23 B;  1A7W A;  1ZLA B;  4H9R A;  5B0Z A;  3LZ1 A;  1P3M A;  4CAY B;  5CPJ C;  2NQB C;  5BNX A;  2LY8 A;  5F99 C;  3WTP D;  3AZG A;  4H9Q B;  3VH6 A;  3REL B;  3AN2 D;  5AVC B;  4H9S C;  1P3P A;  3AZE B;  1P3L D;  3REI D;  3KWQ A;  3X1T B;  4E45 A;  2HIO D;  4UUZ B;  3MVD D;  5AV8 D;  3MGP D;  3WTP C;  1HQ3 A;  3C1B D;  1F66 B;  5G49 A;  3AN2 C;  4H9N A;  4J8W D;  1M18 D;  5B24 D;  3VH5 A;  4G92 B;  1P3L C;  3AZL B;  5C3I C;  5GT0 D;  3UT9 D;  2PYO D;  1BH9 B;  3REI C;  5DNM D;  3LJA A;  4CSR A;  2HIO C;  5AV6 B;  3AV1 A;  3MVD C;  3MGQ A;  5AV8 C;  3MGP C;  2ARO A;  5B2I B;  1P3O C;  3WA9 D;  3C1B C;  2JSS A;  5B1M B;  4ZBJ B;  1S32 D;  2NZD A;  4YS3 A;  3KSY A;  1M18 C;  5B24 C;  3LZ0 B;  3UTB B;  1HTA A;  2PYO C;  5GT0 C;  5JRG A;  3UT9 C;  4KUD D;  3O62 B;  5DNM C;  3REH A;  3B6F D;  1P3F A;  1P3A A;  3NQU A;  5F99 B;  4J8V D;  5AV9 D;  1F1E A;  4M6B A;  1P34 A;  3V9R A;  3W96 D;  3WA9 C;  1S32 C;  4R8P A;  4G91 C;  2BYK B;  2CWE A;  1BFM A;  4DRA A;  1KX3 D;  4KUD C;  2FJ7 A;  3B6F C;  3WTP B;  4WNN A;  5GSU D;  5CP6 A;  5AV9 C;  4J8V C;  3WAA D;  4KGC A;  4XUJ B;  3X1S D;  3AZK D;  4H9O A;  3W96 C;  3MGS B;  3AN2 B;  2L5A A;  3WTP E;  4NE5 A;  4QLC A;  1P3L B;  4Z66 A;  1KX3 C;  1N1J A;  4EO5 C;  3LZ1 D;  3AZN B;  3MVD B;  5AV8 B;  4WU8 A;  1ZLA D;  5GSU C;  3WAA C;  3AZG D;  3W99 A;  3C1B B;  3X1S C;  3AZK C;  1P3G A;  3AYW D;  5CPI B;  4J8W B;  5B24 B;  3LEL D;  2PYO B;  5B2J A;  3UT9 B;  5BS7 A;  3KWQ D;  4J8X A;  5DNM B;  1TAF B;  3LZ1 C;  1ZLA C;  3X1V A;  3AZG C;  3WA9 B;  1S32 B;  4Z2M G;  3AYW C;  4G91 B;  3KXB D;  2YFV A;  3LEL C;  3VH5 T;  3AZI A;  1F66 D;  2IO5 C;  3KWQ C;  3R45 A;  4JJN A;  1M1A B;  3W98 A;  3B6F B;  3VH6 W;  3X1U B;  4J8V B;  5AV9 B;  3AZL D;  1TZY A;  3AFA A;  2ARO D;  2BYM A;  3W96 B;  3B6G A;  5AV6 D;  5B2I D;  4YM6 D;  4YS3 D;  3KXB C;  1P3K A;  1F66 C;  4EO5 B;  3A6N B;  3LZ0 D;  5B33 A;  4G92 C;  3UTB D;  1P3A D;  1P3F D;  3AZL C;  3TU4 A;  3WAA B;  1U35 A;  3O62 D;  2ARO C;  3X1S B;  4WZS B;  3VH5 W;  3REJ D;  3REK A;  3AZK B;  2HUE B;  5AV6 C;  1KX4 D;  5B2I C;  4YM6 C;  5E5A A;  4YS3 C;  4Z5T A;  4H9P B;  4ZBJ C;  4H9R B;  3LZ1 B;  3AZJ A;  5FUG B;  3LZ0 C;  3W97 A;  5BNX B;  3UTB C;  1P3A C;  1P3F C;  4KGC D;  3AZG B;  3O62 C;  3REJ C;  4NE3 A;  3AYW B;  1KX4 C;  3LEL B;  4XUJ D;  1P3P B;  5JA4 A;  2IO5 B;  1H3O A;  3KWQ B;  3MGS D;  3MGR D;  5CPK A;  1AOI A;  3C1C D;  4NFT A;  5BO0 B;  4WU8 D;  1BH8 A;  4KGC C;  3AV2 A;  4J8U A;  1HQ3 B;  3W99 D;  3AZN D;  5G49 B;  3AZH D;  4H9N B;  3KXB B;  5B1L A;  1EQZ D;  5B40 A;  4XUJ C;  5B2J D;  3MGS C;  3MGR C;  4J8X D;  5CPI D;  3LJA B;  4CSR B;  1KX5 A;  3C1C C;  4Z2M H;  2CV5 A;  4WU9 A;  1M19 A;  2ARO B;  5BNV B;  4AWL C;  5B32 A;  2F8N A;  3W99 C;  5DNN A;  3AZN C;  4ZUX A;  3MNN A;  3AZH C;  4YM6 B;  2NZD B;  4YS3 B;  1EQZ C;  5GT3 A;  5B2J C;  3AZM A;  5JRG B;  4J8X C;  4JJN D;  5CPI C;  3UTA A;  4J8W C;  3REH B;  3W98 D;  1P3F B;  5AVB A;  3NQU B;  1P3A B;  1M1A D;  3REJ B;  5B0Y D;  3V9R B;  3B6G D;  3X1U D;  3B0D B;  1KX4 B;  4R8P B;  5AY8 A;  2FJ7 B;  1JFI A;  4JJN C;  1BH9 A;  3W98 C;  3WKJ A;  4WNN B;  5CP6 B;  4KGC B;  1M1A C;  3A6N D;  3REK D;  1P3B A;  4H9O B;  5B0Y C;  1ID3 A;  1P3I D;  3NQJ A;  4KHA B;  3B6G C;  3X1U C;  5B31 D;  4QLC B;  2RVQ D;  4Z66 B;  3MGR B;  1N1J B;  3C1C B;  3AZJ D;  5KDM A;  4WU8 B;  4DRB A;  4AWL B;  5CPJ A;  2NQB A;  3W99 B;  5F99 A;  5B0Z D;  3A6N C;  3REK C;  1P3G B;  1P3M D;  1P3I C;  3AZH B;  5B31 G;  1EQZ B;  5B31 C;  2RVQ C;  5B2J B;  2HUE C;  4H9S A;  4J8X B;  1AOI D;  1P3P D;  3AZJ C;  3X1V B;  4HGA C;  5B0Z C;  1P3M C;  3AZF A;  2YFV B;  1HQ3 D;  3AZI B;  3R45 B;  1P3L A;  4JJN B;  3REI A;  1AOI C;  3W98 B;  1P3P C;  4WU9 D;  2HIO A;  1TZY B;  1M19 D;  2BYM B;  3MVD A;  3LJA D;  5B0Y B;  5B32 D;  2F8N D;  3MGP A;  3B6G B;  1P3O A;  3AV1 D;  3MGQ D;  4LD9 A;  2F8N K;  1HQ3 C;  1M18 A;  5B24 A;  1B67 A;  2PYO A;  5GT0 A;  3UT9 A;  3UTA D;  2NZD D;  5B33 B;  5DNM A;  5AVB D;  5JRG D;  4WU9 C;  1U35 B;  1M19 C;  3REK B;  5B32 G;  3LJA C;  3REH D;  5B32 C;  2F8N G;  1P3I B;  3B0B A;  3AV1 C;  3MGQ C;  1P34 D;  5B31 B;  5E5A B;  3AZJ B;  4R8P D;  3UTA C;  4KUD A;  2NZD C;  3W97 B;  5AVB C;  4HGA B;  5JRG C;  3B6F A;  2FJ7 D;  5B0Z B;  1P3M B;  3REH C;  2YFW A;  5CP6 D;  3W96 A;  1P34 C;  5JA4 B;  3B0D C;  1KX3 A;  1AOI B;  4QLC D;  4R8P C;  3B0C T;  4NE6 A;  4Z66 D;  3AV2 B;  4J8U B;  2FJ7 C;  3KUY A;  5GSU A;  5GXQ A;  5CP6 C;  5AV5 A;  5B1L B;  5B40 B;  1P3G D;  4XZQ A;  1KX5 B;  4H9P A;  4QLC C;  2CV5 B;  4WU9 B;  4Z66 C;  1M19 B;  4X23 A;  5FUG A;  5B32 B;  2F8N B;  1ZLA A;  5DNN B;  3AV1 B;  4ZUX B;  3MNN B;  3MGQ B;  4WU8 C;  3X1V D;  4CAY A;  3AZF D;  3B0C W;  3AYW A;  5GT3 B;  1P3G C;  3AZM B;  4H9Q A;  3LEL A;  3UTA B;  3REL A;  5AVB B;  3AZI D;  1WWS A;  5AVC A;  5BS7 C;  3AZE A;  5BO0 A;  3X1T A;  1P3O D;  1TZY D;  4UUZ A;  3AFA D;  1P34 B;  4LD9 D;  3X1V C;  4WV4 B;  5AY8 B;  3AZF C;  4E44 A;  3KXB A;  2F8N H;  1JFI B;  1F66 A;  3AZI C;  3WKJ B;  1P3K D;  5BT1 D;  3AZL A;  1P3B B;  1ID3 B;  5B33 D;  5BNV A;  3NQJ B;  3TU4 D;  1TZY C;  3AFA C;  1U35 D;  5AV6 A;  4LD9 C;  5B2I A;  4YM6 A;  5B1M A;  5E5A D;  4Z5T D;  5KDM B;  1P3K C;  3LZ0 A;  5CPJ B;  2NQB B;  5BT1 C;  3UTB A;  5B33 C;  3O62 A;  3W97 D;  3REJ A;  3TU4 C;  1B6W A;  1U35 C;  1KX4 A;  5E5A C;  4Z5T C;  5CPK D;  2BYK A;  3KUY D;  5GXQ D;  3W97 C;  3AZF B;  3AV2 D;  4KHA A;  5AV5 D;  4J8U D;  3WTP A;  4XZQ D;  4XUJ A;  5C3I B;  3REI B;  3MGS A; 
#chains in the Genus database with same CATH topology
 3AN2 A;  5B1L D;  3MGR A;  5B40 D;  3C1C A;  2HIO B;  5CPK C;  4X23 D;  1KX5 D;  3MGP B;  3KUY C;  1P3O B;  2CV5 D;  5GXQ C;  3AFA B;  4LD9 B;  3AZN A;  5AV8 A;  3VH6 T;  5AV5 C;  4J8U C;  5DNN D;  3AZH A;  3AV2 C;  1M18 B;  4XZQ C;  1R4V A;  4ZUX D;  3MNN D;  3C1B A;  1EQZ A;  5GT0 B;  3REL D;  5B1L C;  5B40 C;  5CPI A;  5GT3 D;  4J8W A;  1P3K B;  3AZM D;  5AVC D;  3AZE D;  4X23 C;  1KX5 C;  1WWI A;  3X1T D;  3TU4 B;  2CV5 C;  1TAF A;  5CHL B;  5DNN C;  4ZUX C;  3MNN C;  3WA9 A;  5AY8 D;  3REL C;  1S32 A;  4KUD B;  4Z5T B;  5GT3 C;  3AZM C;  5AVC C;  3AZE C;  1ULY A;  3H0R C;  2YFW B;  1M1A A;  3X1T C;  3WKJ D;  5B0Y A;  3X1U A;  4J8V A;  5AV9 A;  1P3B D;  1ID3 D;  1KX3 B;  2Y2J A;  2UWX A;  5B1M D;  5AY8 C;  1H3O B;  1KU5 A;  5CPK B;  1Q9C A;  3EG5 B;  3KUY B;  2ZY2 A;  5GSU B;  5GXQ B;  3A6N A;  3WKJ C;  1BH8 B;  5CPJ D;  1P3I A;  5AV5 B;  2NQB D;  5F99 D;  3A1I A;  1P3B C;  1ID3 C;  4XZQ B;  3WAA A;  5B31 A;  3X1S A;  3AZK A;  2DQN C;  2RIQ A;  5B1M C;  4X23 B;  2BG1 A;  1A7W A;  1ZLA B;  3KFU G;  2FFF B;  4H9R A;  5B0Z A;  3LZ1 A;  1P3M A;  4CAY B;  5CPJ C;  2NQB C;  5BNX A;  2LY8 A;  5F99 C;  3WTP D;  3AZG A;  4H9Q B;  3VH6 A;  3REL B;  3AN2 D;  5AVC B;  4H9S C;  1P3P A;  3AZE B;  1P3L D;  2Y2Q A;  3REI D;  3KWQ A;  3X1T B;  4E45 A;  2HIO D;  4UUZ B;  2W8S A;  3MVD D;  5AV8 D;  3MGP D;  3WTP C;  1HQ3 A;  3C1B D;  1F66 B;  5G49 A;  3AN2 C;  4H9N A;  4J8W D;  1M18 D;  5B24 D;  3VH5 A;  4G92 B;  1P3L C;  3AZL B;  5C3I C;  5GT0 D;  3UT9 D;  2PYO D;  1BH9 B;  3REI C;  5DNM D;  3LJA A;  4CSR A;  2HIO C;  3F6T A;  5AV6 B;  3AV1 A;  3MVD C;  3MGQ A;  5AV8 C;  3MGP C;  2ARO A;  5B2I B;  1P3O C;  3WA9 D;  3C1B C;  2JSS A;  5B1M B;  4ZBJ B;  1S32 D;  2NZD A;  4YS3 A;  3KSY A;  1M18 C;  5B24 C;  3LZ0 B;  3UTB B;  3H0M C;  1HTA A;  2PYO C;  5GT0 C;  5JRG A;  3UT9 C;  4KUD D;  3O62 B;  5DNM C;  3REH A;  3B6F D;  1P3F A;  1P3A A;  3NQU A;  5F99 B;  4J8V D;  5AV9 D;  1F1E A;  4M6B A;  1P34 A;  3V9R A;  3W96 D;  3WA9 C;  1S32 C;  4R8P A;  4G91 C;  2BYK B;  2CWE A;  1BFM A;  4DRA A;  1KX3 D;  4KUD C;  2FJ7 A;  2ZY4 A;  3B6F C;  3WTP B;  4WNN A;  5GSU D;  5CP6 A;  5AV9 C;  4J8V C;  3WAA D;  4KGC A;  4XUJ B;  3X1S D;  3AZK D;  4H9O A;  3W96 C;  3MGS B;  3AN2 B;  2L5A A;  3WTP E;  4NE5 A;  3EPL A;  4QLC A;  1P3L B;  3EPH A;  4Z66 A;  1KX3 C;  4UPK A;  1N1J A;  4EO5 C;  3LZ1 D;  3AZN B;  3MVD B;  5AV8 B;  4WU8 A;  1ZLA D;  5GSU C;  2ZY5 A;  3WAA C;  3AZG D;  3W99 A;  3C1B B;  3X1S C;  3AZK C;  1P3G A;  3AYW D;  5CPI B;  4J8W B;  5B24 B;  3LEL D;  2PYO B;  5B2J A;  3EPJ A;  3UT9 B;  5BS7 A;  3KWQ D;  4J8X A;  5DNM B;  2ZM5 A;  1TAF B;  3LZ1 C;  2DF4 C;  1ZLA C;  3X1V A;  3AZG C;  3WA9 B;  2G5H C;  1S32 B;  4Z2M G;  3AYW C;  4G91 B;  3KXB D;  2YFV A;  3LEL C;  3VH5 T;  3AZI A;  1F66 D;  2IO5 C;  3KWQ C;  3R45 A;  4JJN A;  1M1A B;  3W98 A;  3B6F B;  3VH6 W;  3X1U B;  4J8V B;  5AV9 B;  3AZL D;  1TZY A;  3AFA A;  2ARO D;  2BYM A;  3W96 B;  3B6G A;  5AV6 D;  5B2I D;  4YM6 D;  4YS3 D;  3KXB C;  1P3K A;  1F66 C;  4EO5 B;  2Y2M A;  3A6N B;  3LZ0 D;  5B33 A;  4G92 C;  3UTB D;  1P3A D;  1P3F D;  3AZL C;  3TU4 A;  3WAA B;  2Y2N A;  1U35 A;  3O62 D;  2ARO C;  3X1S B;  4WZS B;  3VH5 W;  3REJ D;  3REK A;  3AZK B;  2HUE B;  5AV6 C;  1KX4 D;  5B2I C;  4YM6 C;  3P5J B;  5E5A A;  4YS3 C;  4Z5T A;  4H9P B;  2VQR A;  4ZBJ C;  4H9R B;  3LZ1 B;  3AZJ A;  5FUG B;  3LZ0 C;  3W97 A;  5BNX B;  3UTB C;  1P3A C;  1P3F C;  4KGC D;  3AZG B;  3O62 C;  3REJ C;  4NE3 A;  3AYW B;  1KX4 C;  3LEL B;  4XUJ D;  1P3P B;  5JA4 A;  2IO5 B;  1H3O A;  3KWQ B;  3MGS D;  3MGR D;  5CPK A;  2Y2I A;  1AOI A;  3C1C D;  4DQY B;  4NFT A;  5BO0 B;  4WU8 D;  1BH8 A;  4KGC C;  3AV2 A;  4J8U A;  1HQ3 B;  3W99 D;  3AZN D;  5G49 B;  3AZH D;  4H9N B;  3IP4 C;  3KXB B;  5B1L A;  1EQZ D;  5B40 A;  4XUJ C;  5B2J D;  3MGS C;  3MGR C;  4J8X D;  5CPI D;  3LJA B;  4CSR B;  1KX5 A;  3C1C C;  4Z2M H;  2CV5 A;  4WU9 A;  1M19 A;  2ARO B;  5BNV B;  4AWL C;  5B32 A;  2F8N A;  3W99 C;  2Y2K A;  5DNN A;  3AZN C;  4ZUX A;  3MNN A;  3AZH C;  4YM6 B;  2NZD B;  4YS3 B;  1EQZ C;  5GT3 A;  2Y2H A;  5B2J C;  3AZM A;  5JRG B;  4J8X C;  4JJN D;  5CPI C;  3UTA A;  4J8W C;  3REH B;  3W98 D;  4WJ3 C;  1P3F B;  5AVB A;  3NQU B;  1P3A B;  1M1A D;  3REJ B;  5B0Y D;  3V9R B;  1PZR A;  3B6G D;  3X1U D;  3B0D B;  1KX4 B;  4R8P B;  5AY8 A;  2XD5 A;  2FJ7 B;  1JFI A;  4JJN C;  1BH9 A;  3W98 C;  3WKJ A;  4WNN B;  5CP6 B;  4KGC B;  1M1A C;  3A6N D;  2XD1 A;  3REK D;  4H9O B;  5B0Y C;  1P3B A;  1ID3 A;  1P3I D;  3NQJ A;  4KHA B;  3B6G C;  3X1U C;  5B31 D;  4QLC B;  2RVQ D;  4Z66 B;  3MGR B;  1N1J B;  3C1C B;  3AZJ D;  5KDM A;  4WU8 B;  4DRB A;  4AWL B;  5CPJ A;  2NQB A;  3W99 B;  5F99 A;  5B0Z D;  3A6N C;  3REK C;  1P3G B;  1P3M D;  1P3I C;  3AZH B;  5B31 G;  1EQZ B;  5B31 C;  2RVQ C;  5B2J B;  2HUE C;  4H9S A;  4J8X B;  1AOI D;  1P3P D;  3AZJ C;  2G5I C;  3X1V B;  4HGA C;  5B0Z C;  1P3M C;  2JE5 A;  3AZF A;  2YFV B;  1HQ3 D;  3AZI B;  3R45 B;  1P3L A;  4JJN B;  3REI A;  1AOI C;  3W98 B;  1P3P C;  4WU9 D;  2HIO A;  1TZY B;  1M19 D;  2BYM B;  3MVD A;  3LJA D;  5B0Y B;  5B32 D;  2F8N D;  3MGP A;  3B6G B;  1P3O A;  3AV1 D;  1W2E A;  3MGQ D;  2Y2G A;  4LD9 A;  2F8N K;  1HQ3 C;  2F2A C;  1M18 A;  5B24 A;  1B67 A;  2PYO A;  5GT0 A;  3UT9 A;  3UTA D;  2NZD D;  5B33 B;  5DNM A;  5AVB D;  5JRG D;  4WU9 C;  1U35 B;  1M19 C;  3REK B;  5B32 G;  3LJA C;  3REH D;  5B32 C;  2F8N G;  1P3I B;  3B0B A;  3AV1 C;  3MGQ C;  1P34 D;  5B31 B;  5E5A B;  3AZJ B;  4R8P D;  3UTA C;  4KUD A;  2NZD C;  3W97 B;  5AVB C;  4HGA B;  5JRG C;  3B6F A;  2FJ7 D;  5B0Z B;  1P3M B;  3REH C;  2Y2O A;  2YFW A;  5CP6 D;  3W96 A;  1P34 C;  5JA4 B;  2JCH A;  3B0D C;  1KX3 A;  1AOI B;  3A1K A;  4QLC D;  4R8P C;  3B0C T;  4NE6 A;  4Z66 D;  3AV2 B;  4J8U B;  2FJ7 C;  3KUY A;  5GSU A;  5GXQ A;  5CP6 C;  5AV5 A;  5B1L B;  5B40 B;  1P3G D;  4XZQ A;  2Y2P A;  1KX5 B;  4H9P A;  4QLC C;  3FDD A;  2CV5 B;  4WU9 B;  4Z66 C;  1M19 B;  4X23 A;  5FUG A;  5B32 B;  2F8N B;  1ZLA A;  1Z2C B;  5DNN B;  3AV1 B;  2ZY3 A;  4ZUX B;  3MNN B;  3MGQ B;  4WU8 C;  3X1V D;  4CAY A;  3AZF D;  3B0C W;  3AYW A;  5GT3 B;  1P3G C;  3AZM B;  4H9Q A;  3H0L C;  3LEL A;  3UTA B;  3REL A;  5AVB B;  3AZI D;  1WWS A;  5AVC A;  5BS7 C;  3AZE A;  3AL0 C;  5BO0 A;  3X1T A;  1P3O D;  1TZY D;  4UUZ A;  3AFA D;  1P34 B;  4LD9 D;  3X1V C;  4WV4 B;  5AY8 B;  3AZF C;  4E44 A;  3KXB A;  2F8N H;  1JFI B;  1F66 A;  3AZI C;  3WKJ B;  1P3K D;  5BT1 D;  3AZL A;  1P3B B;  1ID3 B;  5B33 D;  5BNV A;  3NQJ B;  3TU4 D;  1TZY C;  3AFA C;  1U35 D;  5AV6 A;  4LD9 C;  2J8P A;  1T3U A;  5B2I A;  4YM6 A;  5B1M A;  5E5A D;  4Z5T D;  2Y2L A;  5KDM B;  1P3K C;  3LZ0 A;  5CPJ B;  2NQB B;  5BT1 C;  3UTB A;  5B33 C;  3O62 A;  3W97 D;  3REJ A;  3TU4 C;  1B6W A;  1U35 C;  1KX4 A;  5E5A C;  4Z5T C;  5CPK D;  2BYK A;  3EPK A;  3KUY D;  5GXQ D;  3W97 C;  3AZF B;  3AV2 D;  4KHA A;  5AV5 D;  4J8U D;  3WTP A;  4XZQ D;  4XUJ A;  5C3I B;  3REI B;  3MGS A; 
#chains in the Genus database with same CATH homology
 3AN2 A;  5B1L D;  3MGR A;  5B40 D;  3C1C A;  2HIO B;  5CPK C;  4X23 D;  1KX5 D;  3MGP B;  3KUY C;  1P3O B;  2CV5 D;  5GXQ C;  3AFA B;  4LD9 B;  3AZN A;  5AV8 A;  3VH6 T;  5AV5 C;  4J8U C;  5DNN D;  3AZH A;  3AV2 C;  1M18 B;  4XZQ C;  1R4V A;  4ZUX D;  3MNN D;  3C1B A;  1EQZ A;  5GT0 B;  3REL D;  5B1L C;  5B40 C;  5CPI A;  5GT3 D;  4J8W A;  1P3K B;  3AZM D;  5AVC D;  3AZE D;  4X23 C;  1KX5 C;  1WWI A;  3X1T D;  3TU4 B;  2CV5 C;  1TAF A;  5CHL B;  5DNN C;  4ZUX C;  3MNN C;  3WA9 A;  5AY8 D;  3REL C;  1S32 A;  4KUD B;  4Z5T B;  5GT3 C;  3AZM C;  5AVC C;  3AZE C;  1ULY A;  3H0R C;  2YFW B;  1M1A A;  3X1T C;  3WKJ D;  5B0Y A;  3X1U A;  4J8V A;  5AV9 A;  1P3B D;  1ID3 D;  1KX3 B;  2Y2J A;  2UWX A;  5B1M D;  5AY8 C;  1H3O B;  1KU5 A;  5CPK B;  1Q9C A;  3EG5 B;  3KUY B;  2ZY2 A;  5GSU B;  5GXQ B;  3A6N A;  3WKJ C;  1BH8 B;  5CPJ D;  1P3I A;  5AV5 B;  2NQB D;  5F99 D;  3A1I A;  1P3B C;  1ID3 C;  4XZQ B;  3WAA A;  5B31 A;  3X1S A;  3AZK A;  2DQN C;  2RIQ A;  5B1M C;  4X23 B;  2BG1 A;  1A7W A;  1ZLA B;  3KFU G;  2FFF B;  4H9R A;  5B0Z A;  3LZ1 A;  1P3M A;  4CAY B;  5CPJ C;  2NQB C;  5BNX A;  2LY8 A;  5F99 C;  3WTP D;  3AZG A;  4H9Q B;  3VH6 A;  3REL B;  3AN2 D;  5AVC B;  4H9S C;  1P3P A;  3AZE B;  1P3L D;  2Y2Q A;  3REI D;  3KWQ A;  3X1T B;  4E45 A;  2HIO D;  4UUZ B;  2W8S A;  3MVD D;  5AV8 D;  3MGP D;  3WTP C;  1HQ3 A;  3C1B D;  1F66 B;  5G49 A;  3AN2 C;  4H9N A;  4J8W D;  1M18 D;  5B24 D;  3VH5 A;  4G92 B;  1P3L C;  3AZL B;  5C3I C;  5GT0 D;  3UT9 D;  2PYO D;  1BH9 B;  3REI C;  5DNM D;  3LJA A;  4CSR A;  2HIO C;  3F6T A;  5AV6 B;  3AV1 A;  3MVD C;  3MGQ A;  5AV8 C;  3MGP C;  2ARO A;  5B2I B;  1P3O C;  3WA9 D;  3C1B C;  2JSS A;  5B1M B;  4ZBJ B;  1S32 D;  2NZD A;  4YS3 A;  3KSY A;  1M18 C;  5B24 C;  3LZ0 B;  3UTB B;  3H0M C;  1HTA A;  2PYO C;  5GT0 C;  5JRG A;  3UT9 C;  4KUD D;  3O62 B;  5DNM C;  3REH A;  3B6F D;  1P3F A;  1P3A A;  3NQU A;  5F99 B;  4J8V D;  5AV9 D;  1F1E A;  4M6B A;  1P34 A;  3V9R A;  3W96 D;  3WA9 C;  1S32 C;  4R8P A;  4G91 C;  2BYK B;  2CWE A;  1BFM A;  4DRA A;  1KX3 D;  4KUD C;  2FJ7 A;  2ZY4 A;  3B6F C;  3WTP B;  4WNN A;  5GSU D;  5CP6 A;  5AV9 C;  4J8V C;  3WAA D;  4KGC A;  4XUJ B;  3X1S D;  3AZK D;  4H9O A;  3W96 C;  3MGS B;  3AN2 B;  2L5A A;  3WTP E;  4NE5 A;  3EPL A;  4QLC A;  1P3L B;  3EPH A;  4Z66 A;  1KX3 C;  4UPK A;  1N1J A;  4EO5 C;  3LZ1 D;  3AZN B;  3MVD B;  5AV8 B;  4WU8 A;  1ZLA D;  5GSU C;  2ZY5 A;  3WAA C;  3AZG D;  3W99 A;  3C1B B;  3X1S C;  3AZK C;  1P3G A;  3AYW D;  5CPI B;  4J8W B;  5B24 B;  3LEL D;  2PYO B;  5B2J A;  3EPJ A;  3UT9 B;  5BS7 A;  3KWQ D;  4J8X A;  5DNM B;  2ZM5 A;  1TAF B;  3LZ1 C;  2DF4 C;  1ZLA C;  3X1V A;  3AZG C;  3WA9 B;  2G5H C;  1S32 B;  4Z2M G;  3AYW C;  4G91 B;  3KXB D;  2YFV A;  3LEL C;  3VH5 T;  3AZI A;  1F66 D;  2IO5 C;  3KWQ C;  3R45 A;  4JJN A;  1M1A B;  3W98 A;  3B6F B;  3VH6 W;  3X1U B;  4J8V B;  5AV9 B;  3AZL D;  1TZY A;  3AFA A;  2ARO D;  2BYM A;  3W96 B;  3B6G A;  5AV6 D;  5B2I D;  4YM6 D;  4YS3 D;  3KXB C;  1P3K A;  1F66 C;  4EO5 B;  2Y2M A;  3A6N B;  3LZ0 D;  5B33 A;  4G92 C;  3UTB D;  1P3A D;  1P3F D;  3AZL C;  3TU4 A;  3WAA B;  2Y2N A;  1U35 A;  3O62 D;  2ARO C;  3X1S B;  4WZS B;  3VH5 W;  3REJ D;  3REK A;  3AZK B;  2HUE B;  5AV6 C;  1KX4 D;  5B2I C;  4YM6 C;  3P5J B;  5E5A A;  4YS3 C;  4Z5T A;  4H9P B;  2VQR A;  4ZBJ C;  4H9R B;  3LZ1 B;  3AZJ A;  5FUG B;  3LZ0 C;  3W97 A;  5BNX B;  3UTB C;  1P3A C;  1P3F C;  4KGC D;  3AZG B;  3O62 C;  3REJ C;  4NE3 A;  3AYW B;  1KX4 C;  3LEL B;  4XUJ D;  1P3P B;  5JA4 A;  2IO5 B;  1H3O A;  3KWQ B;  3MGS D;  3MGR D;  5CPK A;  2Y2I A;  1AOI A;  3C1C D;  4DQY B;  4NFT A;  5BO0 B;  4WU8 D;  1BH8 A;  4KGC C;  3AV2 A;  4J8U A;  1HQ3 B;  3W99 D;  3AZN D;  5G49 B;  3AZH D;  4H9N B;  3IP4 C;  3KXB B;  5B1L A;  1EQZ D;  5B40 A;  4XUJ C;  5B2J D;  3MGS C;  3MGR C;  4J8X D;  5CPI D;  3LJA B;  4CSR B;  1KX5 A;  3C1C C;  4Z2M H;  2CV5 A;  4WU9 A;  1M19 A;  2ARO B;  5BNV B;  4AWL C;  5B32 A;  2F8N A;  3W99 C;  2Y2K A;  5DNN A;  3AZN C;  4ZUX A;  3MNN A;  3AZH C;  4YM6 B;  2NZD B;  4YS3 B;  1EQZ C;  5GT3 A;  2Y2H A;  5B2J C;  3AZM A;  5JRG B;  4J8X C;  4JJN D;  5CPI C;  3UTA A;  4J8W C;  3REH B;  3W98 D;  4WJ3 C;  1P3F B;  5AVB A;  3NQU B;  1P3A B;  1M1A D;  3REJ B;  5B0Y D;  3V9R B;  1PZR A;  3B6G D;  3X1U D;  3B0D B;  1KX4 B;  4R8P B;  5AY8 A;  2XD5 A;  2FJ7 B;  1JFI A;  4JJN C;  1BH9 A;  3W98 C;  3WKJ A;  4WNN B;  5CP6 B;  4KGC B;  1M1A C;  3A6N D;  2XD1 A;  3REK D;  4H9O B;  5B0Y C;  1P3B A;  1ID3 A;  1P3I D;  3NQJ A;  4KHA B;  3B6G C;  3X1U C;  5B31 D;  4QLC B;  2RVQ D;  4Z66 B;  3MGR B;  1N1J B;  3C1C B;  3AZJ D;  5KDM A;  4WU8 B;  4DRB A;  4AWL B;  5CPJ A;  2NQB A;  3W99 B;  5F99 A;  5B0Z D;  3A6N C;  3REK C;  1P3G B;  1P3M D;  1P3I C;  3AZH B;  5B31 G;  1EQZ B;  5B31 C;  2RVQ C;  5B2J B;  2HUE C;  4H9S A;  4J8X B;  1AOI D;  1P3P D;  3AZJ C;  2G5I C;  3X1V B;  4HGA C;  5B0Z C;  1P3M C;  2JE5 A;  3AZF A;  2YFV B;  1HQ3 D;  3AZI B;  3R45 B;  1P3L A;  4JJN B;  3REI A;  1AOI C;  3W98 B;  1P3P C;  4WU9 D;  2HIO A;  1TZY B;  1M19 D;  2BYM B;  3MVD A;  3LJA D;  5B0Y B;  5B32 D;  2F8N D;  3MGP A;  3B6G B;  1P3O A;  3AV1 D;  1W2E A;  3MGQ D;  2Y2G A;  4LD9 A;  2F8N K;  1HQ3 C;  2F2A C;  1M18 A;  5B24 A;  1B67 A;  2PYO A;  5GT0 A;  3UT9 A;  3UTA D;  2NZD D;  5B33 B;  5DNM A;  5AVB D;  5JRG D;  4WU9 C;  1U35 B;  1M19 C;  3REK B;  5B32 G;  3LJA C;  3REH D;  5B32 C;  2F8N G;  1P3I B;  3B0B A;  3AV1 C;  3MGQ C;  1P34 D;  5B31 B;  5E5A B;  3AZJ B;  4R8P D;  3UTA C;  4KUD A;  2NZD C;  3W97 B;  5AVB C;  4HGA B;  5JRG C;  3B6F A;  2FJ7 D;  5B0Z B;  1P3M B;  3REH C;  2Y2O A;  2YFW A;  5CP6 D;  3W96 A;  1P34 C;  5JA4 B;  2JCH A;  3B0D C;  1KX3 A;  1AOI B;  3A1K A;  4QLC D;  4R8P C;  3B0C T;  4NE6 A;  4Z66 D;  3AV2 B;  4J8U B;  2FJ7 C;  3KUY A;  5GSU A;  5GXQ A;  5CP6 C;  5AV5 A;  5B1L B;  5B40 B;  1P3G D;  4XZQ A;  2Y2P A;  1KX5 B;  4H9P A;  4QLC C;  3FDD A;  2CV5 B;  4WU9 B;  4Z66 C;  1M19 B;  4X23 A;  5FUG A;  5B32 B;  2F8N B;  1ZLA A;  1Z2C B;  5DNN B;  3AV1 B;  2ZY3 A;  4ZUX B;  3MNN B;  3MGQ B;  4WU8 C;  3X1V D;  4CAY A;  3AZF D;  3B0C W;  3AYW A;  5GT3 B;  1P3G C;  3AZM B;  4H9Q A;  3H0L C;  3LEL A;  3UTA B;  3REL A;  5AVB B;  3AZI D;  1WWS A;  5AVC A;  5BS7 C;  3AZE A;  3AL0 C;  5BO0 A;  3X1T A;  1P3O D;  1TZY D;  4UUZ A;  3AFA D;  1P34 B;  4LD9 D;  3X1V C;  4WV4 B;  5AY8 B;  3AZF C;  4E44 A;  3KXB A;  2F8N H;  1JFI B;  1F66 A;  3AZI C;  3WKJ B;  1P3K D;  5BT1 D;  3AZL A;  1P3B B;  1ID3 B;  5B33 D;  5BNV A;  3NQJ B;  3TU4 D;  1TZY C;  3AFA C;  1U35 D;  5AV6 A;  4LD9 C;  2J8P A;  1T3U A;  5B2I A;  4YM6 A;  5B1M A;  5E5A D;  4Z5T D;  2Y2L A;  5KDM B;  1P3K C;  3LZ0 A;  5CPJ B;  2NQB B;  5BT1 C;  3UTB A;  5B33 C;  3O62 A;  3W97 D;  3REJ A;  3TU4 C;  1B6W A;  1U35 C;  1KX4 A;  5E5A C;  4Z5T C;  5CPK D;  2BYK A;  3EPK A;  3KUY D;  5GXQ D;  3W97 C;  3AZF B;  3AV2 D;  4KHA A;  5AV5 D;  4J8U D;  3WTP A;  4XZQ D;  4XUJ A;  5C3I B;  3REI B;  3MGS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...