4WU9D

Structure of cisptnap-ncp145
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
95
structure length
95
Chain Sequence
KTRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords Histone H3.2
publication title Stereochemical control of nucleosome targeting by platinum-intercalator antitumor agents.
pubmed doi rcsb
source organism Xenopus laevis
total genus 37
structure length 95
sequence length 95
chains with identical sequence H
ec nomenclature
pdb deposition date 2014-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4wu9D00
3A6NA 3NQUA 4QLCC 5B40C 3AZGD 1M19C 5AV6C 3LJAC 2CV5C 2NQBB 3RELC 5G49A 3KUYA 5CPKC 4H9SC 1KX5B 1AOIA 4AWLC 3TU4C 3REKA 4H9QB 5CP6C 3RELB 3MGSA 5B0YB 3AFAA 5CPKB 2YFWB 4Z5TB 3LZ0C 4AWLB 3REJC 3TU4B 3VH5A 5CP6B 1KX3D 5JRGD 3KXBD 3W98A 3REJB 5AVCD 1P3MA 1HQ3B 2PYOC 3MGPA 5AV8A 3V9RA 3MGQD 3WTPD 1TAFB 2NZDA 1A7WA 4H9RA 4M6BA 4KGCC 4WNNB 3X1VA 3B6FB 4J8VB 4JJNC 3W99A 3X1SC 1P3OA 2YFVA 5AV9D 4KGCB 2BYKA 5E5AD 3KWQD 2FJ7C 2AROD 3W96B 5B0ZC 3UT9C 3WA9C 1KX4C 1P34C 1TZYB 3LELD 3AZHD 1KX5A 5B24D 5B0ZB 3UT9B 5AVBC 3WA9B 3UTAC 3VH6W 2BYMA 5B31G 1P34B 1KX4B 3WKJA 5GSUA 5B0YA 4ZUXD 4Z5TA 3LZ1D 4KUDA 3NQJB 1U35C 1JFIB 1P3KD 1BH8B 3AZND 5BT1C 4X23C 1F66A 4WU8A 1HQ3A 5BS7A 4Z66B 1U35B 1TAFA 3REHC 1P3PB 1M18A 4YM6D 3C1CA 1P3AA 5BNVB 5GT0D 3AZKD 3B6FA 3AZFA 5B2ID 4J8VA 4XZQA 3REHB 1B6WA 3B0CW 3AZJB 4J8UC 3AZLC 3AV1D 4XUJC 5B32A 3W96A 3A6NC 5AV5D 1TZYA 4H9OB 1ID3D 4XUJB 3MNNA 3AYWD 4WU9D 3NQUB 3KUYC 1P3BA 2F8ND 1KX4A 2NQBD 1AOIC 3B0DC 4QLCD 4DRBA 5B40D 1M19D 3MGSC 3UTBB 5G49B 5AV6D 3KUYB 3LJAD 2CV5D 1AOIB 4G91C 3RELD 3B0DB 4WV4B 4J8XA 1BH8A 5CPKD 3MGSB 3O62A 3MGRA 3TU4D 5B1MA 5CP6D 3W98C 4Z66A 2HIOA 1P3MC 1P3PA 5C3IC 3LZ0D 3MGPC 1R4VA 5AV8C 3REJD 2NZDC 3W98B 5BNXB 1P3MB 3X1VC 1P3FA 3X1TD 5GXQA 5AV8B 3AZJA 3W99C 5CPIB 1P3OC 2PYOD 3X1VB 5B2JB 2F8NH 4KGCD 3W99B 1P3OB 1ZLAC 2YFVB 2BYKB 4JJND 3X1SD 1KX5C 2FJ7D 3WKJC 1P3IB 1ZLAB 5GSUC 4YS3B 1WWIA 5B0YC 5B0ZD 4R8PB 3UTBA 3UT9D 3WA9D 3AZMA 1P34D 4Z5TC 1H3OA 4HGAB 2BYMB 3WAAB 3WKJB 4KUDC 5DNMB 5GSUB 5BO0B 1F1EA 5AVBD 3UTAD 3AN2B 3W97A 4LD9B 2RVQC 1F66C 4WU8C 4J8WB 4KUDB 1HQ3C 1EQZA 5BS7C 3VH5T 1M18C 5BNXA 3C1CC 1F66B 1U35D 4WU8B 1P3AC 2F8NG 3B6FC 3AZFC 4EO5B 5BT1D 4X23D 3C1BA 4J8VC 4XZQC 5CPIA 1M18B 3C1CB 3AZEB 1P3AB 5B2JA 3REHD 3AZFB 5B32C 3W96C 3MVDA 4XZQB 5B1LA 1B67A 1TZYC 3B0BA 5B32B 3AV2A 3MNNC 3AZIA 1P3BC 5B33A 4J8UD 3AZLD 1M1AB 1BH9B 4XUJD 1P3IA 1ZLAA 4YS3A 3A6ND 4R8PA 5DNNB 3MNNB 1P3BB 3B6GB 3WAAA 5AY8B 3REIB 5DNMA 5BO0A 4J8XC 3KUYD 3AN2A 4LD9A 1AOID 3O62C 3MGRC 5B1MC 3REKD 4J8WA 5CPJA 4E45A 3MGSD 4Z66C 3AFAD 3VH6A 4J8XB 2HIOC 2JSSA 1BFMA 1P3PC 3O62B 3MGRB 5B1MB 3R45B 3X1UA 4H9NA 2HIOB 1P3FC 5GXQC 3W98D 3AZEA 3AZJC 1P3MD 3MGPD 5AV8D 4WZSB 1P3FB 2NZDD 5GXQB 3X1VD 4E44A 5F99A 3W99D 1M1AA 5KDMA 1P3OD 1BH9A 4ZBJC 1KX3B 1N1JA 4CAYB 5DNNA 4NE3A 3KXBB 3UTBC 2F8NK 5B31A 3B6GA 1P3LA 3AZMC 4NFTA 5AY8A 3REIA 4ZBJB 1ZLAD 1KX5D 1P3GA 5GT3A 3AZMB 3W97C 1S32A 3WKJD 5GSUD 1H3OB 5B0YD 1EQZC 1Q9CA 1WWSA 4Z5TD 3R45A 3W97B 4KUDD 2AROB 3AZGA 1ULYA 1EQZB 3C1BC 1F66D 4WU8D 5CPIC 4ZUXC 1HQ3D 5B2JC 1M18D 3C1BB 3MVDC 3C1CD 1P3AD 4ZUXB 5B1LC 3B6FD 3AZFD 4J8VD 3LZ1B 4Z2MH 4XZQD 3MVDB 3AV2C 1P3KB 1KX3A 5JRGA 5B1LB 3AZIC 5B33C 4CAYA 3KXBA 1P3IC 5B32D 3W96D 4YS3C 4R8PC 5AVCA 1TZYD 3AV2B 3MGQA 3WTPA 4HGAC 5B33B 3AZIB 3WAAC 4YM6B 5DNMC 3MNND 1P3BD 3AN2C 1KX4D 4LD9C 5CPJC 4J8WC 5AV9A 3KWQA 5E5AA 5FUGB 1ID3C 3AV1B 2IO5C 2AROA 4WU9C 5CPJB 4J8XD 3X1UC 4EO5C 3O62D 3MGRD 1ID3B 5B1MD 3LELA 2IO5B 3AZHA 5B24A 3AZEC 3AYWB 4Z66D 4WU9B 4Z2MG 2F8NB 2HIOD 3X1UB 4H9NB 1P3PD 4QLCB 4ZUXA 5B40B 1M19B 3VH5W 5AV6B 3LZ1A 3LJAB 2CV5B 1P3FD 5GXQD 5F99C 1P3KA 3AZJD 4DRAA 1M1AC 3AZNA 5DNNC 5F99B 5B31C 3B6GC 1P3LC 5KDMB 4CSRB 3LZ0B 5AY8C 4YM6A 3REIC 4KHAA 3X1TC 1N1JB 5GT0A 3AZKA 4UUZA 5JA4A 1P3GC 5GT3C 5CHLB 5B2IA 5B31B 3WTPE 1P3LB 3X1TB 1S32C 3UTBD 5FUGA 3AV1A 3AZMD 2PYOB 1P3GB 5GT3B 5AV5A 1S32B 3AZGC 1ID3A 3W97D 3VH6T 4JJNB 5B32G 3AYWA 4WU9A 3X1SB 2CWEA 2F8NA 2NQBA 3AZGB 1EQZD 4QLCA 2FJ7B 5B40A 1M19A 5AV6A 3LJAA 4H9QA 2CV5A 3RELA 3C1BD 5CPKA 5CPID 2YFWA 4H9SA 3KSYA 1KX3C 5AVBB 3TU4A 5JRGC 3UTAB 3KXBC 4H9PB 5B2JD 5CP6A 4NE5A 3MVDD 1KU5A 5AVCC 5B1LD 4CSRA 3LZ0A 3REJA 5JRGB 3WTPC 3MGQC 3AV2D 3B0CT 5AVCB 3AZID 5B33D 3X1TA 1P3ID 4X23B 4YS3D 3WTPB 3MGQB 4WNNA 4R8PD 2PYOA 5AV9C 3KWQC 5E5AC 4NE6A 3WAAD 2AROC 5DNMD 4KGCA 3AN2D 4LD9D 5AV9B 3KWQB 5E5AB 4JJNA 5CPJD 3LELC 3X1SA 4J8WD 3AZHC 5B24C 2L5AA 4J8UB 3AZLB 2FJ7A 2RVQD 5B0ZA 3A6NB 3UT9A 3LELB 2HUEC 3WA9A 3AZHB 3X1UD 1P34A 5B24B 3REKC 3LZ1C 3AZED 3AFAC 1P3KC 5AVBA 2HUEB 3UTAA 3AZNC 4H9PA 3NQJA 3REKB 1JFIA 3AFAB 3AZNB 4G91B 4YM6C 5F99D 1U35A 5GT0C 3AZKC 1M1AD 4X23A 5B2IC 5BNVA 5DNND 4KHAB 5GT0B 5B31D 4G92C 3AZKB 3AV1C 4UUZB 3REHA 1P3LD 5JA4B 3B6GD 5C3IB 5AY8D 5B2IB 3MGPB 3REID 3V9RB 2LY8A 5AV5C 2NZDB 4H9RB 1P3GD 5GT3D 4G92B 1HTAA 1S32D 3AYWC 4H9OA 5AV5B 4J8UA 3AZLA 2NQBC 4XUJA
chains in the Genus database with same CATH superfamily
3A6NA 3NQUA 4QLCC 5B40C 3AZGD 1M19C 2Y2JA 5AV6C 3LJAC 2CV5C 2NQBB 3RELC 5G49A 3KUYA 5CPKC 2ZY5A 4H9SC 1KX5B 1AOIA 4AWLC 3TU4C 3REKA 4H9QB 5CP6C 3RELB 3MGSA 5B0YB 3AFAA 5CPKB 2YFWB 1W2EA 4Z5TB 3LZ0C 2Y2GA 4AWLB 3REJC 3TU4B 3VH5A 5CP6B 1KX3D 5JRGD 3KXBD 3W98A 3REJB 5AVCD 1P3MA 1HQ3B 2PYOC 3MGPA 5AV8A 3V9RA 3MGQD 3WTPD 1TAFB 2NZDA 1A7WA 4H9RA 4M6BA 4KGCC 4WNNB 3X1VA 3B6FB 3F6TA 4J8VB 4JJNC 3W99A 3X1SC 1P3OA 2YFVA 5AV9D 4KGCB 2BYKA 5E5AD 3KWQD 2FJ7C 2AROD 3W96B 5B0ZC 3UT9C 3WA9C 1KX4C 1P34C 1TZYB 3LELD 3AZHD 1KX5A 5B24D 5B0ZB 3UT9B 5AVBC 3WA9B 3UTAC 3VH6W 2BYMA 5B31G 1P34B 1KX4B 3WKJA 3EPLA 5GSUA 5B0YA 4ZUXD 4Z5TA 3LZ1D 2VQRA 4KUDA 3NQJB 1U35C 1JFIB 1P3KD 1BH8B 2XD1A 3AZND 5BT1C 4X23C 1F66A 4WU8A 1HQ3A 5BS7A 4Z66B 1U35B 3EPJA 1TAFA 3REHC 1P3PB 1M18A 4YM6D 3C1CA 1P3AA 5BNVB 5GT0D 3AZKD 3B6FA 3AZFA 5B2ID 4J8VA 3B6GD 4XZQA 3REHB 1B6WA 3B0CW 3AZJB 4J8UC 3AZLC 3AV1D 4XUJC 5B32A 3EPKA 3W96A 3A6NC 5AV5D 1TZYA 4H9OB 1ID3D 2G5IC 4XUJB 3MNNA 3AYWD 4WU9D 3NQUB 3KUYC 1P3BA 2F8ND 1KX4A 2NQBD 1AOIC 3B0DC 4QLCD 4DRBA 5B40D 1M19D 3MGSC 1Z2CB 3UTBB 5G49B 5AV6D 3KUYB 3LJAD 2CV5D 1AOIB 4G91C 3RELD 3B0DB 4WV4B 4J8XA 1BH8A 5CPKD 3MGSB 3O62A 3MGRA 3TU4D 5B1MA 2DQNC 5CP6D 3W98C 4Z66A 2HIOA 1P3MC 4WJ3C 1P3PA 5C3IC 3LZ0D 3MGPC 1R4VA 5AV8C 3REJD 2NZDC 2RIQA 3W98B 5BNXB 1P3MB 3X1VC 1P3FA 3X1TD 5GXQA 5AV8B 2ZM5A 3AZJA 3W99C 5CPIB 2Y2OA 1P3OC 2PYOD 2JCHA 3X1VB 5B2JB 2F8NH 4KGCD 3W99B 1P3OB 2J8PA 1ZLAC 2YFVB 2BYKB 4JJND 3X1SD 1KX5C 2FJ7D 3WKJC 1P3IB 1ZLAB 5GSUC 4YS3B 1WWIA 5B0YC 5B0ZD 4R8PB 3UTBA 3UT9D 3WA9D 3AZMA 1P34D 4Z5TC 1H3OA 4HGAB 2BYMB 3WAAB 3WKJB 4KUDC 5DNMB 5GSUB 5BO0B 1F1EA 5AVBD 3UTAD 3AN2B 3W97A 4LD9B 2RVQC 1F66C 4WU8C 3H0LC 4J8WB 4KUDB 1HQ3C 1EQZA 5BS7C 3VH5T 1M18C 5BNXA 3C1CC 1F66B 1U35D 4WU8B 1P3AC 2F8NG 3B6FC 3AZFC 4EO5B 5BT1D 4X23D 3C1BA 4J8VC 4XZQC 5CPIA 1M18B 3C1CB 3AZEB 1P3AB 5B2JA 3REHD 3AZFB 5B32C 3W96C 3MVDA 4XZQB 5B1LA 1B67A 1TZYC 3B0BA 5B32B 3KFUG 3AV2A 3MNNC 3A1IA 3AZIA 1P3BC 5B33A 4J8UD 3AZLD 1M1AB 1BH9B 4XUJD 1P3IA 1ZLAA 4YS3A 3A6ND 4R8PA 4UPKA 5DNNB 3MNNB 2F2AC 1P3BB 3B6GB 3WAAA 5AY8B 3REIB 5DNMA 5BO0A 4J8XC 3KUYD 3AN2A 4LD9A 1AOID 3O62C 3MGRC 2BG1A 5B1MC 4J8WA 3REKD 5CPJA 2ZY2A 4E45A 3MGSD 4Z66C 3AFAD 3VH6A 4J8XB 2HIOC 2JSSA 1BFMA 1P3PC 3O62B 3MGRB 5B1MB 3R45B 3X1UA 4H9NA 2HIOB 1P3FC 4DQYB 5GXQC 3W98D 3AZEA 3AZJC 3AL0C 3A1KA 2XD5A 1P3MD 3MGPD 5AV8D 4WZSB 1P3FB 2NZDD 5GXQB 3X1VD 4E44A 5F99A 3W99D 1M1AA 5KDMA 1P3OD 1BH9A 4ZBJC 1KX3B 1N1JA 4CAYB 5DNNA 2FFFB 4NE3A 3KXBB 3UTBC 2F8NK 5B31A 3B6GA 1P3LA 3AZMC 4NFTA 5AY8A 3REIA 4ZBJB 1ZLAD 1KX5D 1P3GA 3FDDA 5GT3A 3AZMB 3W97C 1S32A 3WKJD 5GSUD 2DF4C 1H3OB 5B0YD 1EQZC 1Q9CA 1WWSA 4Z5TD 3H0RC 3R45A 3W97B 4KUDD 2AROB 3AZGA 1ULYA 1EQZB 3C1BC 1F66D 4WU8D 5CPIC 4ZUXC 1HQ3D 5B2JC 1M18D 2Y2NA 3MVDC 3C1BB 3C1CD 1P3AD 4ZUXB 5B1LC 3B6FD 3AZFD 4J8VD 3LZ1B 4Z2MH 4XZQD 3MVDB 3AV2C 1P3KB 1KX3A 5JRGA 5B1LB 3AZIC 5B33C 4CAYA 3KXBA 1P3IC 2Y2MA 5B32D 3W96D 4YS3C 4R8PC 5AVCA 1TZYD 3AV2B 3MGQA 3WTPA 4HGAC 5B33B 3AZIB 3WAAC 4YM6B 5DNMC 3MNND 1P3BD 3AN2C 1KX4D 4LD9C 5CPJC 4J8WC 5AV9A 3KWQA 5E5AA 5FUGB 1ID3C 3IP4C 3AV1B 2IO5C 2AROA 2Y2IA 4WU9C 5CPJB 4J8XD 3X1UC 4EO5C 3O62D 3MGRD 1ID3B 5B1MD 3LELA 2IO5B 3AZHA 5B24A 3AZEC 3AYWB 4Z66D 4WU9B 4Z2MG 2ZY4A 2HIOD 3X1UB 4H9NB 2F8NB 1P3PD 2Y2HA 4QLCB 4ZUXA 5B40B 1M19B 3VH5W 5AV6B 3LZ1A 3LJAB 2CV5B 1P3FD 5GXQD 5F99C 1P3KA 3AZJD 4DRAA 1M1AC 3AZNA 5DNNC 2Y2LA 5F99B 5B31C 3B6GC 1P3LC 5KDMB 4CSRB 3LZ0B 5AY8C 4YM6A 3REIC 4KHAA 3X1TC 1N1JB 5GT0A 3AZKA 4UUZA 5JA4A 1P3GC 5GT3C 5CHLB 5B2IA 5B31B 3WTPE 1P3LB 3X1TB 1S32C 3UTBD 5FUGA 3AV1A 3AZMD 2PYOB 1P3GB 5GT3B 5AV5A 1S32B 3AZGC 1ID3A 3EPHA 3W97D 3VH6T 4JJNB 5B32G 3AYWA 4WU9A 3X1SB 2CWEA 2F8NA 2NQBA 3AZGB 1EQZD 4QLCA 2FJ7B 5B40A 1M19A 2Y2PA 5AV6A 3LJAA 4H9QA 2CV5A 3RELA 3C1BD 5CPKA 5CPID 2YFWA 4H9SA 3KSYA 1KX3C 5AVBB 3TU4A 5JRGC 3UTAB 3KXBC 4H9PB 5B2JD 5CP6A 4NE5A 3MVDD 1KU5A 5AVCC 5B1LD 4CSRA 3LZ0A 3REJA 5JRGB 3WTPC 3MGQC 3AV2D 3B0CT 5AVCB 3AZID 5B33D 3X1TA 1P3ID 4X23B 4YS3D 3WTPB 3MGQB 4WNNA 2Y2KA 4R8PD 2PYOA 5AV9C 3KWQC 5E5AC 2W8SA 4NE6A 3WAAD 2AROC 5DNMD 4KGCA 3AN2D 4LD9D 2JE5A 5AV9B 3KWQB 5E5AB 4JJNA 5CPJD 3LELC 3X1SA 4J8WD 3AZHC 5B24C 2L5AA 4J8UB 3AZLB 2FJ7A 2RVQD 5B0ZA 3A6NB 3UT9A 3LELB 2HUEC 3WA9A 2UWXA 3X1UD 3AZHB 1P34A 5B24B 3REKC 3LZ1C 3AZED 3AFAC 1P3KC 5AVBA 2HUEB 1T3UA 3UTAA 3AZNC 4H9PA 3NQJA 3REKB 1JFIA 3EG5B 3AFAB 1PZRA 3AZNB 4G91B 4YM6C 5F99D 1U35A 5GT0C 3AZKC 1M1AD 4X23A 2G5HC 5B2IC 5BNVA 5DNND 2Y2QA 4KHAB 5GT0B 2ZY3A 5B31D 4G92C 3AZKB 4UUZB 3REHA 3AV1C 5JA4B 1P3LD 5C3IB 5AY8D 5B2IB 3MGPB 3REID 3V9RB 2LY8A 5AV5C 2NZDB 4H9RB 1P3GD 5GT3D 4G92B 1HTAA 3P5JB 1S32D 3H0MC 3AYWC 4H9OA 5AV5B 4J8UA 3AZLA 2NQBC 4XUJA
chains in the Genus database with same CATH topology
3A6NA 3NQUA 4QLCC 5B40C 3AZGD 1M19C 2Y2JA 5AV6C 3LJAC 2CV5C 2NQBB 3RELC 5G49A 3KUYA 5CPKC 2ZY5A 4H9SC 1KX5B 1AOIA 4AWLC 3TU4C 3REKA 4H9QB 5CP6C 3RELB 3MGSA 5B0YB 3AFAA 5CPKB 2YFWB 1W2EA 4Z5TB 3LZ0C 2Y2GA 4AWLB 3REJC 3TU4B 3VH5A 5CP6B 1KX3D 5JRGD 3KXBD 3W98A 3REJB 5AVCD 1P3MA 1HQ3B 2PYOC 3MGPA 5AV8A 3V9RA 3MGQD 3WTPD 1TAFB 2NZDA 1A7WA 4H9RA 4M6BA 4KGCC 4WNNB 3X1VA 3B6FB 3F6TA 4J8VB 4JJNC 3W99A 3X1SC 1P3OA 2YFVA 5AV9D 4KGCB 2BYKA 5E5AD 3KWQD 2FJ7C 2AROD 3W96B 5B0ZC 3UT9C 3WA9C 1KX4C 1P34C 1TZYB 3LELD 3AZHD 1KX5A 5B24D 5B0ZB 3UT9B 5AVBC 3WA9B 3UTAC 3VH6W 2BYMA 5B31G 1P34B 1KX4B 3WKJA 3EPLA 5GSUA 5B0YA 4ZUXD 4Z5TA 3LZ1D 2VQRA 4KUDA 3NQJB 1U35C 1JFIB 1P3KD 1BH8B 2XD1A 3AZND 5BT1C 4X23C 1F66A 4WU8A 1HQ3A 5BS7A 4Z66B 1U35B 3EPJA 1TAFA 3REHC 1P3PB 1M18A 4YM6D 3C1CA 1P3AA 5BNVB 5GT0D 3AZKD 3B6FA 3AZFA 5B2ID 4J8VA 3B6GD 4XZQA 3REHB 1B6WA 3B0CW 3AZJB 4J8UC 3AZLC 3AV1D 4XUJC 5B32A 3EPKA 3W96A 3A6NC 5AV5D 1TZYA 4H9OB 1ID3D 2G5IC 4XUJB 3MNNA 3AYWD 4WU9D 3NQUB 3KUYC 1P3BA 2F8ND 1KX4A 2NQBD 1AOIC 3B0DC 4QLCD 4DRBA 5B40D 1M19D 3MGSC 1Z2CB 3UTBB 5G49B 5AV6D 3KUYB 3LJAD 2CV5D 1AOIB 4G91C 3RELD 3B0DB 4WV4B 4J8XA 1BH8A 5CPKD 3MGSB 3O62A 3MGRA 3TU4D 5B1MA 2DQNC 5CP6D 3W98C 4Z66A 2HIOA 1P3MC 4WJ3C 1P3PA 5C3IC 3LZ0D 3MGPC 1R4VA 5AV8C 3REJD 2NZDC 2RIQA 3W98B 5BNXB 1P3MB 3X1VC 1P3FA 3X1TD 5GXQA 5AV8B 2ZM5A 3AZJA 3W99C 5CPIB 2Y2OA 1P3OC 2PYOD 2JCHA 3X1VB 5B2JB 2F8NH 4KGCD 3W99B 1P3OB 2J8PA 1ZLAC 2YFVB 2BYKB 4JJND 3X1SD 1KX5C 2FJ7D 3WKJC 1P3IB 1ZLAB 5GSUC 4YS3B 1WWIA 5B0YC 5B0ZD 4R8PB 3UTBA 3UT9D 3WA9D 3AZMA 1P34D 4Z5TC 1H3OA 4HGAB 2BYMB 3WAAB 3WKJB 4KUDC 5DNMB 5GSUB 5BO0B 1F1EA 5AVBD 3UTAD 3AN2B 3W97A 4LD9B 2RVQC 1F66C 4WU8C 3H0LC 4J8WB 4KUDB 1HQ3C 1EQZA 5BS7C 3VH5T 1M18C 5BNXA 3C1CC 1F66B 1U35D 4WU8B 1P3AC 2F8NG 3B6FC 3AZFC 4EO5B 5BT1D 4X23D 3C1BA 4J8VC 4XZQC 5CPIA 1M18B 3C1CB 3AZEB 1P3AB 5B2JA 3REHD 3AZFB 5B32C 3W96C 3MVDA 4XZQB 5B1LA 1B67A 1TZYC 3B0BA 5B32B 3KFUG 3AV2A 3MNNC 3A1IA 3AZIA 1P3BC 5B33A 4J8UD 3AZLD 1M1AB 1BH9B 4XUJD 1P3IA 1ZLAA 4YS3A 3A6ND 4R8PA 4UPKA 5DNNB 3MNNB 2F2AC 1P3BB 3B6GB 3WAAA 5AY8B 3REIB 5DNMA 5BO0A 4J8XC 3KUYD 3AN2A 4LD9A 1AOID 3O62C 3MGRC 2BG1A 5B1MC 4J8WA 3REKD 5CPJA 2ZY2A 4E45A 3MGSD 4Z66C 3AFAD 3VH6A 4J8XB 2HIOC 2JSSA 1BFMA 1P3PC 3O62B 3MGRB 5B1MB 3R45B 3X1UA 4H9NA 2HIOB 1P3FC 4DQYB 5GXQC 3W98D 3AZEA 3AZJC 3AL0C 3A1KA 2XD5A 1P3MD 3MGPD 5AV8D 4WZSB 1P3FB 2NZDD 5GXQB 3X1VD 4E44A 5F99A 3W99D 1M1AA 5KDMA 1P3OD 1BH9A 4ZBJC 1KX3B 1N1JA 4CAYB 5DNNA 2FFFB 4NE3A 3KXBB 3UTBC 2F8NK 5B31A 3B6GA 1P3LA 3AZMC 4NFTA 5AY8A 3REIA 4ZBJB 1ZLAD 1KX5D 1P3GA 3FDDA 5GT3A 3AZMB 3W97C 1S32A 3WKJD 5GSUD 2DF4C 1H3OB 5B0YD 1EQZC 1Q9CA 1WWSA 4Z5TD 3H0RC 3R45A 3W97B 4KUDD 2AROB 3AZGA 1ULYA 1EQZB 3C1BC 1F66D 4WU8D 5CPIC 4ZUXC 1HQ3D 5B2JC 1M18D 2Y2NA 3MVDC 3C1BB 3C1CD 1P3AD 4ZUXB 5B1LC 3B6FD 3AZFD 4J8VD 3LZ1B 4Z2MH 4XZQD 3MVDB 3AV2C 1P3KB 1KX3A 5JRGA 5B1LB 3AZIC 5B33C 4CAYA 3KXBA 1P3IC 2Y2MA 5B32D 3W96D 4YS3C 4R8PC 5AVCA 1TZYD 3AV2B 3MGQA 3WTPA 4HGAC 5B33B 3AZIB 3WAAC 4YM6B 5DNMC 3MNND 1P3BD 3AN2C 1KX4D 4LD9C 5CPJC 4J8WC 5AV9A 3KWQA 5E5AA 5FUGB 1ID3C 3IP4C 3AV1B 2IO5C 2AROA 2Y2IA 4WU9C 5CPJB 4J8XD 3X1UC 4EO5C 3O62D 3MGRD 1ID3B 5B1MD 3LELA 2IO5B 3AZHA 5B24A 3AZEC 3AYWB 4Z66D 4WU9B 4Z2MG 2ZY4A 2HIOD 3X1UB 4H9NB 2F8NB 1P3PD 2Y2HA 4QLCB 4ZUXA 5B40B 1M19B 3VH5W 5AV6B 3LZ1A 3LJAB 2CV5B 1P3FD 5GXQD 5F99C 1P3KA 3AZJD 4DRAA 1M1AC 3AZNA 5DNNC 2Y2LA 5F99B 5B31C 3B6GC 1P3LC 5KDMB 4CSRB 3LZ0B 5AY8C 4YM6A 3REIC 4KHAA 3X1TC 1N1JB 5GT0A 3AZKA 4UUZA 5JA4A 1P3GC 5GT3C 5CHLB 5B2IA 5B31B 3WTPE 1P3LB 3X1TB 1S32C 3UTBD 5FUGA 3AV1A 3AZMD 2PYOB 1P3GB 5GT3B 5AV5A 1S32B 3AZGC 1ID3A 3EPHA 3W97D 3VH6T 4JJNB 5B32G 3AYWA 4WU9A 3X1SB 2CWEA 2F8NA 2NQBA 3AZGB 1EQZD 4QLCA 2FJ7B 5B40A 1M19A 2Y2PA 5AV6A 3LJAA 4H9QA 2CV5A 3RELA 3C1BD 5CPKA 5CPID 2YFWA 4H9SA 3KSYA 1KX3C 5AVBB 3TU4A 5JRGC 3UTAB 3KXBC 4H9PB 5B2JD 5CP6A 4NE5A 3MVDD 1KU5A 5AVCC 5B1LD 4CSRA 3LZ0A 3REJA 5JRGB 3WTPC 3MGQC 3AV2D 3B0CT 5AVCB 3AZID 5B33D 3X1TA 1P3ID 4X23B 4YS3D 3WTPB 3MGQB 4WNNA 2Y2KA 4R8PD 2PYOA 5AV9C 3KWQC 5E5AC 2W8SA 4NE6A 3WAAD 2AROC 5DNMD 4KGCA 3AN2D 4LD9D 2JE5A 5AV9B 3KWQB 5E5AB 4JJNA 5CPJD 3LELC 3X1SA 4J8WD 3AZHC 5B24C 2L5AA 4J8UB 3AZLB 2FJ7A 2RVQD 5B0ZA 3A6NB 3UT9A 3LELB 2HUEC 3WA9A 2UWXA 3X1UD 3AZHB 1P34A 5B24B 3REKC 3LZ1C 3AZED 3AFAC 1P3KC 5AVBA 2HUEB 1T3UA 3UTAA 3AZNC 4H9PA 3NQJA 3REKB 1JFIA 3EG5B 3AFAB 1PZRA 3AZNB 4G91B 4YM6C 5F99D 1U35A 5GT0C 3AZKC 1M1AD 4X23A 2G5HC 5B2IC 5BNVA 5DNND 2Y2QA 4KHAB 5GT0B 2ZY3A 5B31D 4G92C 3AZKB 4UUZB 3REHA 3AV1C 5JA4B 1P3LD 5C3IB 5AY8D 5B2IB 3MGPB 3REID 3V9RB 2LY8A 5AV5C 2NZDB 4H9RB 1P3GD 5GT3D 4G92B 1HTAA 3P5JB 1S32D 3H0MC 3AYWC 4H9OA 5AV5B 4J8UA 3AZLA 2NQBC 4XUJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3A6N A;  3NQU A;  4QLC C;  5B40 C;  3AZG D;  1M19 C;  5AV6 C;  3LJA C;  2CV5 C;  2NQB B;  3REL C;  5G49 A;  3KUY A;  5CPK C;  4H9S C;  1KX5 B;  1AOI A;  4AWL C;  3TU4 C;  3REK A;  4H9Q B;  5CP6 C;  3REL B;  3MGS A;  5B0Y B;  3AFA A;  5CPK B;  2YFW B;  4Z5T B;  3LZ0 C;  4AWL B;  3REJ C;  3TU4 B;  3VH5 A;  5CP6 B;  1KX3 D;  5JRG D;  3KXB D;  3W98 A;  3REJ B;  5AVC D;  1P3M A;  1HQ3 B;  2PYO C;  3MGP A;  5AV8 A;  3V9R A;  3MGQ D;  3WTP D;  1TAF B;  2NZD A;  1A7W A;  4H9R A;  4M6B A;  4KGC C;  4WNN B;  3X1V A;  3B6F B;  4J8V B;  4JJN C;  3W99 A;  3X1S C;  1P3O A;  2YFV A;  5AV9 D;  4KGC B;  2BYK A;  5E5A D;  3KWQ D;  2FJ7 C;  2ARO D;  3W96 B;  5B0Z C;  3UT9 C;  3WA9 C;  1KX4 C;  1P34 C;  1TZY B;  3LEL D;  3AZH D;  1KX5 A;  5B24 D;  5B0Z B;  3UT9 B;  5AVB C;  3WA9 B;  3UTA C;  3VH6 W;  2BYM A;  5B31 G;  1P34 B;  1KX4 B;  3WKJ A;  5GSU A;  5B0Y A;  4ZUX D;  4Z5T A;  3LZ1 D;  4KUD A;  3NQJ B;  1U35 C;  1JFI B;  1P3K D;  1BH8 B;  3AZN D;  5BT1 C;  4X23 C;  1F66 A;  4WU8 A;  1HQ3 A;  5BS7 A;  4Z66 B;  1U35 B;  1TAF A;  3REH C;  1P3P B;  1M18 A;  4YM6 D;  3C1C A;  1P3A A;  5BNV B;  5GT0 D;  3AZK D;  3B6F A;  3AZF A;  5B2I D;  4J8V A;  4XZQ A;  3REH B;  1B6W A;  3B0C W;  3AZJ B;  4J8U C;  3AZL C;  3AV1 D;  4XUJ C;  5B32 A;  3W96 A;  3A6N C;  5AV5 D;  1TZY A;  4H9O B;  1ID3 D;  4XUJ B;  3MNN A;  3AYW D;  4WU9 D;  3NQU B;  3KUY C;  1P3B A;  2F8N D;  1KX4 A;  2NQB D;  1AOI C;  3B0D C;  4QLC D;  4DRB A;  5B40 D;  1M19 D;  3MGS C;  3UTB B;  5G49 B;  5AV6 D;  3KUY B;  3LJA D;  2CV5 D;  1AOI B;  4G91 C;  3REL D;  3B0D B;  4WV4 B;  4J8X A;  1BH8 A;  5CPK D;  3MGS B;  3O62 A;  3MGR A;  3TU4 D;  5B1M A;  5CP6 D;  3W98 C;  4Z66 A;  2HIO A;  1P3M C;  1P3P A;  5C3I C;  3LZ0 D;  3MGP C;  1R4V A;  5AV8 C;  3REJ D;  2NZD C;  3W98 B;  5BNX B;  1P3M B;  3X1V C;  1P3F A;  3X1T D;  5GXQ A;  5AV8 B;  3AZJ A;  3W99 C;  5CPI B;  1P3O C;  2PYO D;  3X1V B;  5B2J B;  2F8N H;  4KGC D;  3W99 B;  1P3O B;  1ZLA C;  2YFV B;  2BYK B;  4JJN D;  3X1S D;  1KX5 C;  2FJ7 D;  3WKJ C;  1P3I B;  1ZLA B;  5GSU C;  4YS3 B;  1WWI A;  5B0Y C;  5B0Z D;  4R8P B;  3UTB A;  3UT9 D;  3WA9 D;  3AZM A;  1P34 D;  4Z5T C;  1H3O A;  4HGA B;  2BYM B;  3WAA B;  3WKJ B;  4KUD C;  5DNM B;  5GSU B;  5BO0 B;  1F1E A;  5AVB D;  3UTA D;  3AN2 B;  3W97 A;  4LD9 B;  2RVQ C;  1F66 C;  4WU8 C;  4J8W B;  4KUD B;  1HQ3 C;  1EQZ A;  5BS7 C;  3VH5 T;  1M18 C;  5BNX A;  3C1C C;  1F66 B;  1U35 D;  4WU8 B;  1P3A C;  2F8N G;  3B6F C;  3AZF C;  4EO5 B;  5BT1 D;  4X23 D;  3C1B A;  4J8V C;  4XZQ C;  5CPI A;  1M18 B;  3C1C B;  3AZE B;  1P3A B;  5B2J A;  3REH D;  3AZF B;  5B32 C;  3W96 C;  3MVD A;  4XZQ B;  5B1L A;  1B67 A;  1TZY C;  3B0B A;  5B32 B;  3AV2 A;  3MNN C;  3AZI A;  1P3B C;  5B33 A;  4J8U D;  3AZL D;  1M1A B;  1BH9 B;  4XUJ D;  1P3I A;  1ZLA A;  4YS3 A;  3A6N D;  4R8P A;  5DNN B;  3MNN B;  1P3B B;  3B6G B;  3WAA A;  5AY8 B;  3REI B;  5DNM A;  5BO0 A;  4J8X C;  3KUY D;  3AN2 A;  4LD9 A;  1AOI D;  3O62 C;  3MGR C;  5B1M C;  3REK D;  4J8W A;  5CPJ A;  4E45 A;  3MGS D;  4Z66 C;  3AFA D;  3VH6 A;  4J8X B;  2HIO C;  2JSS A;  1BFM A;  1P3P C;  3O62 B;  3MGR B;  5B1M B;  3R45 B;  3X1U A;  4H9N A;  2HIO B;  1P3F C;  5GXQ C;  3W98 D;  3AZE A;  3AZJ C;  1P3M D;  3MGP D;  5AV8 D;  4WZS B;  1P3F B;  2NZD D;  5GXQ B;  3X1V D;  4E44 A;  5F99 A;  3W99 D;  1M1A A;  5KDM A;  1P3O D;  1BH9 A;  4ZBJ C;  1KX3 B;  1N1J A;  4CAY B;  5DNN A;  4NE3 A;  3KXB B;  3UTB C;  2F8N K;  5B31 A;  3B6G A;  1P3L A;  3AZM C;  4NFT A;  5AY8 A;  3REI A;  4ZBJ B;  1ZLA D;  1KX5 D;  1P3G A;  5GT3 A;  3AZM B;  3W97 C;  1S32 A;  3WKJ D;  5GSU D;  1H3O B;  5B0Y D;  1EQZ C;  1Q9C A;  1WWS A;  4Z5T D;  3R45 A;  3W97 B;  4KUD D;  2ARO B;  3AZG A;  1ULY A;  1EQZ B;  3C1B C;  1F66 D;  4WU8 D;  5CPI C;  4ZUX C;  1HQ3 D;  5B2J C;  1M18 D;  3C1B B;  3MVD C;  3C1C D;  1P3A D;  4ZUX B;  5B1L C;  3B6F D;  3AZF D;  4J8V D;  3LZ1 B;  4Z2M H;  4XZQ D;  3MVD B;  3AV2 C;  1P3K B;  1KX3 A;  5JRG A;  5B1L B;  3AZI C;  5B33 C;  4CAY A;  3KXB A;  1P3I C;  5B32 D;  3W96 D;  4YS3 C;  4R8P C;  5AVC A;  1TZY D;  3AV2 B;  3MGQ A;  3WTP A;  4HGA C;  5B33 B;  3AZI B;  3WAA C;  4YM6 B;  5DNM C;  3MNN D;  1P3B D;  3AN2 C;  1KX4 D;  4LD9 C;  5CPJ C;  4J8W C;  5AV9 A;  3KWQ A;  5E5A A;  5FUG B;  1ID3 C;  3AV1 B;  2IO5 C;  2ARO A;  4WU9 C;  5CPJ B;  4J8X D;  3X1U C;  4EO5 C;  3O62 D;  3MGR D;  1ID3 B;  5B1M D;  3LEL A;  2IO5 B;  3AZH A;  5B24 A;  3AZE C;  3AYW B;  4Z66 D;  4WU9 B;  4Z2M G;  2F8N B;  2HIO D;  3X1U B;  4H9N B;  1P3P D;  4QLC B;  4ZUX A;  5B40 B;  1M19 B;  3VH5 W;  5AV6 B;  3LZ1 A;  3LJA B;  2CV5 B;  1P3F D;  5GXQ D;  5F99 C;  1P3K A;  3AZJ D;  4DRA A;  1M1A C;  3AZN A;  5DNN C;  5F99 B;  5B31 C;  3B6G C;  1P3L C;  5KDM B;  4CSR B;  3LZ0 B;  5AY8 C;  4YM6 A;  3REI C;  4KHA A;  3X1T C;  1N1J B;  5GT0 A;  3AZK A;  4UUZ A;  5JA4 A;  1P3G C;  5GT3 C;  5CHL B;  5B2I A;  5B31 B;  3WTP E;  1P3L B;  3X1T B;  1S32 C;  3UTB D;  5FUG A;  3AV1 A;  3AZM D;  2PYO B;  1P3G B;  5GT3 B;  5AV5 A;  1S32 B;  3AZG C;  1ID3 A;  3W97 D;  3VH6 T;  4JJN B;  5B32 G;  3AYW A;  4WU9 A;  3X1S B;  2CWE A;  2F8N A;  2NQB A;  3AZG B;  1EQZ D;  4QLC A;  2FJ7 B;  5B40 A;  1M19 A;  5AV6 A;  3LJA A;  4H9Q A;  2CV5 A;  3REL A;  3C1B D;  5CPK A;  5CPI D;  2YFW A;  4H9S A;  3KSY A;  1KX3 C;  5AVB B;  3TU4 A;  5JRG C;  3UTA B;  3KXB C;  4H9P B;  5B2J D;  5CP6 A;  4NE5 A;  3MVD D;  1KU5 A;  5AVC C;  5B1L D;  4CSR A;  3LZ0 A;  3REJ A;  5JRG B;  3WTP C;  3MGQ C;  3AV2 D;  3B0C T;  5AVC B;  3AZI D;  5B33 D;  3X1T A;  1P3I D;  4X23 B;  4YS3 D;  3WTP B;  3MGQ B;  4WNN A;  4R8P D;  2PYO A;  5AV9 C;  3KWQ C;  5E5A C;  4NE6 A;  3WAA D;  2ARO C;  5DNM D;  4KGC A;  3AN2 D;  4LD9 D;  5AV9 B;  3KWQ B;  5E5A B;  4JJN A;  5CPJ D;  3LEL C;  3X1S A;  4J8W D;  3AZH C;  5B24 C;  2L5A A;  4J8U B;  3AZL B;  2FJ7 A;  2RVQ D;  5B0Z A;  3A6N B;  3UT9 A;  3LEL B;  2HUE C;  3WA9 A;  3AZH B;  3X1U D;  1P34 A;  5B24 B;  3REK C;  3LZ1 C;  3AZE D;  3AFA C;  1P3K C;  5AVB A;  2HUE B;  3UTA A;  3AZN C;  4H9P A;  3NQJ A;  3REK B;  1JFI A;  3AFA B;  3AZN B;  4G91 B;  4YM6 C;  5F99 D;  1U35 A;  5GT0 C;  3AZK C;  1M1A D;  4X23 A;  5B2I C;  5BNV A;  5DNN D;  4KHA B;  5GT0 B;  5B31 D;  4G92 C;  3AZK B;  3AV1 C;  4UUZ B;  3REH A;  1P3L D;  5JA4 B;  3B6G D;  5C3I B;  5AY8 D;  5B2I B;  3MGP B;  3REI D;  3V9R B;  2LY8 A;  5AV5 C;  2NZD B;  4H9R B;  1P3G D;  5GT3 D;  4G92 B;  1HTA A;  1S32 D;  3AYW C;  4H9O A;  5AV5 B;  4J8U A;  3AZL A;  2NQB C;  4XUJ A; 
#chains in the Genus database with same CATH topology
 3A6N A;  3NQU A;  4QLC C;  5B40 C;  3AZG D;  1M19 C;  2Y2J A;  5AV6 C;  3LJA C;  2CV5 C;  2NQB B;  3REL C;  5G49 A;  3KUY A;  5CPK C;  2ZY5 A;  4H9S C;  1KX5 B;  1AOI A;  4AWL C;  3TU4 C;  3REK A;  4H9Q B;  5CP6 C;  3REL B;  3MGS A;  5B0Y B;  3AFA A;  5CPK B;  2YFW B;  1W2E A;  4Z5T B;  3LZ0 C;  2Y2G A;  4AWL B;  3REJ C;  3TU4 B;  3VH5 A;  5CP6 B;  1KX3 D;  5JRG D;  3KXB D;  3W98 A;  3REJ B;  5AVC D;  1P3M A;  1HQ3 B;  2PYO C;  3MGP A;  5AV8 A;  3V9R A;  3MGQ D;  3WTP D;  1TAF B;  2NZD A;  1A7W A;  4H9R A;  4M6B A;  4KGC C;  4WNN B;  3X1V A;  3B6F B;  3F6T A;  4J8V B;  4JJN C;  3W99 A;  3X1S C;  1P3O A;  2YFV A;  5AV9 D;  4KGC B;  2BYK A;  5E5A D;  3KWQ D;  2FJ7 C;  2ARO D;  3W96 B;  5B0Z C;  3UT9 C;  3WA9 C;  1KX4 C;  1P34 C;  1TZY B;  3LEL D;  3AZH D;  1KX5 A;  5B24 D;  5B0Z B;  3UT9 B;  5AVB C;  3WA9 B;  3UTA C;  3VH6 W;  2BYM A;  5B31 G;  1P34 B;  1KX4 B;  3WKJ A;  3EPL A;  5GSU A;  5B0Y A;  4ZUX D;  4Z5T A;  3LZ1 D;  2VQR A;  4KUD A;  3NQJ B;  1U35 C;  1JFI B;  1P3K D;  1BH8 B;  2XD1 A;  3AZN D;  5BT1 C;  4X23 C;  1F66 A;  4WU8 A;  1HQ3 A;  5BS7 A;  4Z66 B;  1U35 B;  3EPJ A;  1TAF A;  3REH C;  1P3P B;  1M18 A;  4YM6 D;  3C1C A;  1P3A A;  5BNV B;  5GT0 D;  3AZK D;  3B6F A;  3AZF A;  5B2I D;  4J8V A;  3B6G D;  4XZQ A;  3REH B;  1B6W A;  3B0C W;  3AZJ B;  4J8U C;  3AZL C;  3AV1 D;  4XUJ C;  5B32 A;  3EPK A;  3W96 A;  3A6N C;  5AV5 D;  1TZY A;  4H9O B;  1ID3 D;  2G5I C;  4XUJ B;  3MNN A;  3AYW D;  4WU9 D;  3NQU B;  3KUY C;  1P3B A;  2F8N D;  1KX4 A;  2NQB D;  1AOI C;  3B0D C;  4QLC D;  4DRB A;  5B40 D;  1M19 D;  3MGS C;  1Z2C B;  3UTB B;  5G49 B;  5AV6 D;  3KUY B;  3LJA D;  2CV5 D;  1AOI B;  4G91 C;  3REL D;  3B0D B;  4WV4 B;  4J8X A;  1BH8 A;  5CPK D;  3MGS B;  3O62 A;  3MGR A;  3TU4 D;  5B1M A;  2DQN C;  5CP6 D;  3W98 C;  4Z66 A;  2HIO A;  1P3M C;  4WJ3 C;  1P3P A;  5C3I C;  3LZ0 D;  3MGP C;  1R4V A;  5AV8 C;  3REJ D;  2NZD C;  2RIQ A;  3W98 B;  5BNX B;  1P3M B;  3X1V C;  1P3F A;  3X1T D;  5GXQ A;  5AV8 B;  2ZM5 A;  3AZJ A;  3W99 C;  5CPI B;  2Y2O A;  1P3O C;  2PYO D;  2JCH A;  3X1V B;  5B2J B;  2F8N H;  4KGC D;  3W99 B;  1P3O B;  2J8P A;  1ZLA C;  2YFV B;  2BYK B;  4JJN D;  3X1S D;  1KX5 C;  2FJ7 D;  3WKJ C;  1P3I B;  1ZLA B;  5GSU C;  4YS3 B;  1WWI A;  5B0Y C;  5B0Z D;  4R8P B;  3UTB A;  3UT9 D;  3WA9 D;  3AZM A;  1P34 D;  4Z5T C;  1H3O A;  4HGA B;  2BYM B;  3WAA B;  3WKJ B;  4KUD C;  5DNM B;  5GSU B;  5BO0 B;  1F1E A;  5AVB D;  3UTA D;  3AN2 B;  3W97 A;  4LD9 B;  2RVQ C;  1F66 C;  4WU8 C;  3H0L C;  4J8W B;  4KUD B;  1HQ3 C;  1EQZ A;  5BS7 C;  3VH5 T;  1M18 C;  5BNX A;  3C1C C;  1F66 B;  1U35 D;  4WU8 B;  1P3A C;  2F8N G;  3B6F C;  3AZF C;  4EO5 B;  5BT1 D;  4X23 D;  3C1B A;  4J8V C;  4XZQ C;  5CPI A;  1M18 B;  3C1C B;  3AZE B;  1P3A B;  5B2J A;  3REH D;  3AZF B;  5B32 C;  3W96 C;  3MVD A;  4XZQ B;  5B1L A;  1B67 A;  1TZY C;  3B0B A;  5B32 B;  3KFU G;  3AV2 A;  3MNN C;  3A1I A;  3AZI A;  1P3B C;  5B33 A;  4J8U D;  3AZL D;  1M1A B;  1BH9 B;  4XUJ D;  1P3I A;  1ZLA A;  4YS3 A;  3A6N D;  4R8P A;  4UPK A;  5DNN B;  3MNN B;  2F2A C;  1P3B B;  3B6G B;  3WAA A;  5AY8 B;  3REI B;  5DNM A;  5BO0 A;  4J8X C;  3KUY D;  3AN2 A;  4LD9 A;  1AOI D;  3O62 C;  3MGR C;  2BG1 A;  5B1M C;  4J8W A;  3REK D;  5CPJ A;  2ZY2 A;  4E45 A;  3MGS D;  4Z66 C;  3AFA D;  3VH6 A;  4J8X B;  2HIO C;  2JSS A;  1BFM A;  1P3P C;  3O62 B;  3MGR B;  5B1M B;  3R45 B;  3X1U A;  4H9N A;  2HIO B;  1P3F C;  4DQY B;  5GXQ C;  3W98 D;  3AZE A;  3AZJ C;  3AL0 C;  3A1K A;  2XD5 A;  1P3M D;  3MGP D;  5AV8 D;  4WZS B;  1P3F B;  2NZD D;  5GXQ B;  3X1V D;  4E44 A;  5F99 A;  3W99 D;  1M1A A;  5KDM A;  1P3O D;  1BH9 A;  4ZBJ C;  1KX3 B;  1N1J A;  4CAY B;  5DNN A;  2FFF B;  4NE3 A;  3KXB B;  3UTB C;  2F8N K;  5B31 A;  3B6G A;  1P3L A;  3AZM C;  4NFT A;  5AY8 A;  3REI A;  4ZBJ B;  1ZLA D;  1KX5 D;  1P3G A;  3FDD A;  5GT3 A;  3AZM B;  3W97 C;  1S32 A;  3WKJ D;  5GSU D;  2DF4 C;  1H3O B;  5B0Y D;  1EQZ C;  1Q9C A;  1WWS A;  4Z5T D;  3H0R C;  3R45 A;  3W97 B;  4KUD D;  2ARO B;  3AZG A;  1ULY A;  1EQZ B;  3C1B C;  1F66 D;  4WU8 D;  5CPI C;  4ZUX C;  1HQ3 D;  5B2J C;  1M18 D;  2Y2N A;  3MVD C;  3C1B B;  3C1C D;  1P3A D;  4ZUX B;  5B1L C;  3B6F D;  3AZF D;  4J8V D;  3LZ1 B;  4Z2M H;  4XZQ D;  3MVD B;  3AV2 C;  1P3K B;  1KX3 A;  5JRG A;  5B1L B;  3AZI C;  5B33 C;  4CAY A;  3KXB A;  1P3I C;  2Y2M A;  5B32 D;  3W96 D;  4YS3 C;  4R8P C;  5AVC A;  1TZY D;  3AV2 B;  3MGQ A;  3WTP A;  4HGA C;  5B33 B;  3AZI B;  3WAA C;  4YM6 B;  5DNM C;  3MNN D;  1P3B D;  3AN2 C;  1KX4 D;  4LD9 C;  5CPJ C;  4J8W C;  5AV9 A;  3KWQ A;  5E5A A;  5FUG B;  1ID3 C;  3IP4 C;  3AV1 B;  2IO5 C;  2ARO A;  2Y2I A;  4WU9 C;  5CPJ B;  4J8X D;  3X1U C;  4EO5 C;  3O62 D;  3MGR D;  1ID3 B;  5B1M D;  3LEL A;  2IO5 B;  3AZH A;  5B24 A;  3AZE C;  3AYW B;  4Z66 D;  4WU9 B;  4Z2M G;  2ZY4 A;  2HIO D;  3X1U B;  4H9N B;  2F8N B;  1P3P D;  2Y2H A;  4QLC B;  4ZUX A;  5B40 B;  1M19 B;  3VH5 W;  5AV6 B;  3LZ1 A;  3LJA B;  2CV5 B;  1P3F D;  5GXQ D;  5F99 C;  1P3K A;  3AZJ D;  4DRA A;  1M1A C;  3AZN A;  5DNN C;  2Y2L A;  5F99 B;  5B31 C;  3B6G C;  1P3L C;  5KDM B;  4CSR B;  3LZ0 B;  5AY8 C;  4YM6 A;  3REI C;  4KHA A;  3X1T C;  1N1J B;  5GT0 A;  3AZK A;  4UUZ A;  5JA4 A;  1P3G C;  5GT3 C;  5CHL B;  5B2I A;  5B31 B;  3WTP E;  1P3L B;  3X1T B;  1S32 C;  3UTB D;  5FUG A;  3AV1 A;  3AZM D;  2PYO B;  1P3G B;  5GT3 B;  5AV5 A;  1S32 B;  3AZG C;  1ID3 A;  3EPH A;  3W97 D;  3VH6 T;  4JJN B;  5B32 G;  3AYW A;  4WU9 A;  3X1S B;  2CWE A;  2F8N A;  2NQB A;  3AZG B;  1EQZ D;  4QLC A;  2FJ7 B;  5B40 A;  1M19 A;  2Y2P A;  5AV6 A;  3LJA A;  4H9Q A;  2CV5 A;  3REL A;  3C1B D;  5CPK A;  5CPI D;  2YFW A;  4H9S A;  3KSY A;  1KX3 C;  5AVB B;  3TU4 A;  5JRG C;  3UTA B;  3KXB C;  4H9P B;  5B2J D;  5CP6 A;  4NE5 A;  3MVD D;  1KU5 A;  5AVC C;  5B1L D;  4CSR A;  3LZ0 A;  3REJ A;  5JRG B;  3WTP C;  3MGQ C;  3AV2 D;  3B0C T;  5AVC B;  3AZI D;  5B33 D;  3X1T A;  1P3I D;  4X23 B;  4YS3 D;  3WTP B;  3MGQ B;  4WNN A;  2Y2K A;  4R8P D;  2PYO A;  5AV9 C;  3KWQ C;  5E5A C;  2W8S A;  4NE6 A;  3WAA D;  2ARO C;  5DNM D;  4KGC A;  3AN2 D;  4LD9 D;  2JE5 A;  5AV9 B;  3KWQ B;  5E5A B;  4JJN A;  5CPJ D;  3LEL C;  3X1S A;  4J8W D;  3AZH C;  5B24 C;  2L5A A;  4J8U B;  3AZL B;  2FJ7 A;  2RVQ D;  5B0Z A;  3A6N B;  3UT9 A;  3LEL B;  2HUE C;  3WA9 A;  2UWX A;  3X1U D;  3AZH B;  1P34 A;  5B24 B;  3REK C;  3LZ1 C;  3AZE D;  3AFA C;  1P3K C;  5AVB A;  2HUE B;  1T3U A;  3UTA A;  3AZN C;  4H9P A;  3NQJ A;  3REK B;  1JFI A;  3EG5 B;  3AFA B;  1PZR A;  3AZN B;  4G91 B;  4YM6 C;  5F99 D;  1U35 A;  5GT0 C;  3AZK C;  1M1A D;  4X23 A;  2G5H C;  5B2I C;  5BNV A;  5DNN D;  2Y2Q A;  4KHA B;  5GT0 B;  2ZY3 A;  5B31 D;  4G92 C;  3AZK B;  4UUZ B;  3REH A;  3AV1 C;  5JA4 B;  1P3L D;  5C3I B;  5AY8 D;  5B2I B;  3MGP B;  3REI D;  3V9R B;  2LY8 A;  5AV5 C;  2NZD B;  4H9R B;  1P3G D;  5GT3 D;  4G92 B;  1HTA A;  3P5J B;  1S32 D;  3H0M C;  3AYW C;  4H9O A;  5AV5 B;  4J8U A;  3AZL A;  2NQB C;  4XUJ A; 
#chains in the Genus database with same CATH homology
 3A6N A;  3NQU A;  4QLC C;  5B40 C;  3AZG D;  1M19 C;  2Y2J A;  5AV6 C;  3LJA C;  2CV5 C;  2NQB B;  3REL C;  5G49 A;  3KUY A;  5CPK C;  2ZY5 A;  4H9S C;  1KX5 B;  1AOI A;  4AWL C;  3TU4 C;  3REK A;  4H9Q B;  5CP6 C;  3REL B;  3MGS A;  5B0Y B;  3AFA A;  5CPK B;  2YFW B;  1W2E A;  4Z5T B;  3LZ0 C;  2Y2G A;  4AWL B;  3REJ C;  3TU4 B;  3VH5 A;  5CP6 B;  1KX3 D;  5JRG D;  3KXB D;  3W98 A;  3REJ B;  5AVC D;  1P3M A;  1HQ3 B;  2PYO C;  3MGP A;  5AV8 A;  3V9R A;  3MGQ D;  3WTP D;  1TAF B;  2NZD A;  1A7W A;  4H9R A;  4M6B A;  4KGC C;  4WNN B;  3X1V A;  3B6F B;  3F6T A;  4J8V B;  4JJN C;  3W99 A;  3X1S C;  1P3O A;  2YFV A;  5AV9 D;  4KGC B;  2BYK A;  5E5A D;  3KWQ D;  2FJ7 C;  2ARO D;  3W96 B;  5B0Z C;  3UT9 C;  3WA9 C;  1KX4 C;  1P34 C;  1TZY B;  3LEL D;  3AZH D;  1KX5 A;  5B24 D;  5B0Z B;  3UT9 B;  5AVB C;  3WA9 B;  3UTA C;  3VH6 W;  2BYM A;  5B31 G;  1P34 B;  1KX4 B;  3WKJ A;  3EPL A;  5GSU A;  5B0Y A;  4ZUX D;  4Z5T A;  3LZ1 D;  2VQR A;  4KUD A;  3NQJ B;  1U35 C;  1JFI B;  1P3K D;  1BH8 B;  2XD1 A;  3AZN D;  5BT1 C;  4X23 C;  1F66 A;  4WU8 A;  1HQ3 A;  5BS7 A;  4Z66 B;  1U35 B;  3EPJ A;  1TAF A;  3REH C;  1P3P B;  1M18 A;  4YM6 D;  3C1C A;  1P3A A;  5BNV B;  5GT0 D;  3AZK D;  3B6F A;  3AZF A;  5B2I D;  4J8V A;  3B6G D;  4XZQ A;  3REH B;  1B6W A;  3B0C W;  3AZJ B;  4J8U C;  3AZL C;  3AV1 D;  4XUJ C;  5B32 A;  3EPK A;  3W96 A;  3A6N C;  5AV5 D;  1TZY A;  4H9O B;  1ID3 D;  2G5I C;  4XUJ B;  3MNN A;  3AYW D;  4WU9 D;  3NQU B;  3KUY C;  1P3B A;  2F8N D;  1KX4 A;  2NQB D;  1AOI C;  3B0D C;  4QLC D;  4DRB A;  5B40 D;  1M19 D;  3MGS C;  1Z2C B;  3UTB B;  5G49 B;  5AV6 D;  3KUY B;  3LJA D;  2CV5 D;  1AOI B;  4G91 C;  3REL D;  3B0D B;  4WV4 B;  4J8X A;  1BH8 A;  5CPK D;  3MGS B;  3O62 A;  3MGR A;  3TU4 D;  5B1M A;  2DQN C;  5CP6 D;  3W98 C;  4Z66 A;  2HIO A;  1P3M C;  4WJ3 C;  1P3P A;  5C3I C;  3LZ0 D;  3MGP C;  1R4V A;  5AV8 C;  3REJ D;  2NZD C;  2RIQ A;  3W98 B;  5BNX B;  1P3M B;  3X1V C;  1P3F A;  3X1T D;  5GXQ A;  5AV8 B;  2ZM5 A;  3AZJ A;  3W99 C;  5CPI B;  2Y2O A;  1P3O C;  2PYO D;  2JCH A;  3X1V B;  5B2J B;  2F8N H;  4KGC D;  3W99 B;  1P3O B;  2J8P A;  1ZLA C;  2YFV B;  2BYK B;  4JJN D;  3X1S D;  1KX5 C;  2FJ7 D;  3WKJ C;  1P3I B;  1ZLA B;  5GSU C;  4YS3 B;  1WWI A;  5B0Y C;  5B0Z D;  4R8P B;  3UTB A;  3UT9 D;  3WA9 D;  3AZM A;  1P34 D;  4Z5T C;  1H3O A;  4HGA B;  2BYM B;  3WAA B;  3WKJ B;  4KUD C;  5DNM B;  5GSU B;  5BO0 B;  1F1E A;  5AVB D;  3UTA D;  3AN2 B;  3W97 A;  4LD9 B;  2RVQ C;  1F66 C;  4WU8 C;  3H0L C;  4J8W B;  4KUD B;  1HQ3 C;  1EQZ A;  5BS7 C;  3VH5 T;  1M18 C;  5BNX A;  3C1C C;  1F66 B;  1U35 D;  4WU8 B;  1P3A C;  2F8N G;  3B6F C;  3AZF C;  4EO5 B;  5BT1 D;  4X23 D;  3C1B A;  4J8V C;  4XZQ C;  5CPI A;  1M18 B;  3C1C B;  3AZE B;  1P3A B;  5B2J A;  3REH D;  3AZF B;  5B32 C;  3W96 C;  3MVD A;  4XZQ B;  5B1L A;  1B67 A;  1TZY C;  3B0B A;  5B32 B;  3KFU G;  3AV2 A;  3MNN C;  3A1I A;  3AZI A;  1P3B C;  5B33 A;  4J8U D;  3AZL D;  1M1A B;  1BH9 B;  4XUJ D;  1P3I A;  1ZLA A;  4YS3 A;  3A6N D;  4R8P A;  4UPK A;  5DNN B;  3MNN B;  2F2A C;  1P3B B;  3B6G B;  3WAA A;  5AY8 B;  3REI B;  5DNM A;  5BO0 A;  4J8X C;  3KUY D;  3AN2 A;  4LD9 A;  1AOI D;  3O62 C;  3MGR C;  2BG1 A;  5B1M C;  4J8W A;  3REK D;  5CPJ A;  2ZY2 A;  4E45 A;  3MGS D;  4Z66 C;  3AFA D;  3VH6 A;  4J8X B;  2HIO C;  2JSS A;  1BFM A;  1P3P C;  3O62 B;  3MGR B;  5B1M B;  3R45 B;  3X1U A;  4H9N A;  2HIO B;  1P3F C;  4DQY B;  5GXQ C;  3W98 D;  3AZE A;  3AZJ C;  3AL0 C;  3A1K A;  2XD5 A;  1P3M D;  3MGP D;  5AV8 D;  4WZS B;  1P3F B;  2NZD D;  5GXQ B;  3X1V D;  4E44 A;  5F99 A;  3W99 D;  1M1A A;  5KDM A;  1P3O D;  1BH9 A;  4ZBJ C;  1KX3 B;  1N1J A;  4CAY B;  5DNN A;  2FFF B;  4NE3 A;  3KXB B;  3UTB C;  2F8N K;  5B31 A;  3B6G A;  1P3L A;  3AZM C;  4NFT A;  5AY8 A;  3REI A;  4ZBJ B;  1ZLA D;  1KX5 D;  1P3G A;  3FDD A;  5GT3 A;  3AZM B;  3W97 C;  1S32 A;  3WKJ D;  5GSU D;  2DF4 C;  1H3O B;  5B0Y D;  1EQZ C;  1Q9C A;  1WWS A;  4Z5T D;  3H0R C;  3R45 A;  3W97 B;  4KUD D;  2ARO B;  3AZG A;  1ULY A;  1EQZ B;  3C1B C;  1F66 D;  4WU8 D;  5CPI C;  4ZUX C;  1HQ3 D;  5B2J C;  1M18 D;  2Y2N A;  3MVD C;  3C1B B;  3C1C D;  1P3A D;  4ZUX B;  5B1L C;  3B6F D;  3AZF D;  4J8V D;  3LZ1 B;  4Z2M H;  4XZQ D;  3MVD B;  3AV2 C;  1P3K B;  1KX3 A;  5JRG A;  5B1L B;  3AZI C;  5B33 C;  4CAY A;  3KXB A;  1P3I C;  2Y2M A;  5B32 D;  3W96 D;  4YS3 C;  4R8P C;  5AVC A;  1TZY D;  3AV2 B;  3MGQ A;  3WTP A;  4HGA C;  5B33 B;  3AZI B;  3WAA C;  4YM6 B;  5DNM C;  3MNN D;  1P3B D;  3AN2 C;  1KX4 D;  4LD9 C;  5CPJ C;  4J8W C;  5AV9 A;  3KWQ A;  5E5A A;  5FUG B;  1ID3 C;  3IP4 C;  3AV1 B;  2IO5 C;  2ARO A;  2Y2I A;  4WU9 C;  5CPJ B;  4J8X D;  3X1U C;  4EO5 C;  3O62 D;  3MGR D;  1ID3 B;  5B1M D;  3LEL A;  2IO5 B;  3AZH A;  5B24 A;  3AZE C;  3AYW B;  4Z66 D;  4WU9 B;  4Z2M G;  2ZY4 A;  2HIO D;  3X1U B;  4H9N B;  2F8N B;  1P3P D;  2Y2H A;  4QLC B;  4ZUX A;  5B40 B;  1M19 B;  3VH5 W;  5AV6 B;  3LZ1 A;  3LJA B;  2CV5 B;  1P3F D;  5GXQ D;  5F99 C;  1P3K A;  3AZJ D;  4DRA A;  1M1A C;  3AZN A;  5DNN C;  2Y2L A;  5F99 B;  5B31 C;  3B6G C;  1P3L C;  5KDM B;  4CSR B;  3LZ0 B;  5AY8 C;  4YM6 A;  3REI C;  4KHA A;  3X1T C;  1N1J B;  5GT0 A;  3AZK A;  4UUZ A;  5JA4 A;  1P3G C;  5GT3 C;  5CHL B;  5B2I A;  5B31 B;  3WTP E;  1P3L B;  3X1T B;  1S32 C;  3UTB D;  5FUG A;  3AV1 A;  3AZM D;  2PYO B;  1P3G B;  5GT3 B;  5AV5 A;  1S32 B;  3AZG C;  1ID3 A;  3EPH A;  3W97 D;  3VH6 T;  4JJN B;  5B32 G;  3AYW A;  4WU9 A;  3X1S B;  2CWE A;  2F8N A;  2NQB A;  3AZG B;  1EQZ D;  4QLC A;  2FJ7 B;  5B40 A;  1M19 A;  2Y2P A;  5AV6 A;  3LJA A;  4H9Q A;  2CV5 A;  3REL A;  3C1B D;  5CPK A;  5CPI D;  2YFW A;  4H9S A;  3KSY A;  1KX3 C;  5AVB B;  3TU4 A;  5JRG C;  3UTA B;  3KXB C;  4H9P B;  5B2J D;  5CP6 A;  4NE5 A;  3MVD D;  1KU5 A;  5AVC C;  5B1L D;  4CSR A;  3LZ0 A;  3REJ A;  5JRG B;  3WTP C;  3MGQ C;  3AV2 D;  3B0C T;  5AVC B;  3AZI D;  5B33 D;  3X1T A;  1P3I D;  4X23 B;  4YS3 D;  3WTP B;  3MGQ B;  4WNN A;  2Y2K A;  4R8P D;  2PYO A;  5AV9 C;  3KWQ C;  5E5A C;  2W8S A;  4NE6 A;  3WAA D;  2ARO C;  5DNM D;  4KGC A;  3AN2 D;  4LD9 D;  2JE5 A;  5AV9 B;  3KWQ B;  5E5A B;  4JJN A;  5CPJ D;  3LEL C;  3X1S A;  4J8W D;  3AZH C;  5B24 C;  2L5A A;  4J8U B;  3AZL B;  2FJ7 A;  2RVQ D;  5B0Z A;  3A6N B;  3UT9 A;  3LEL B;  2HUE C;  3WA9 A;  2UWX A;  3X1U D;  3AZH B;  1P34 A;  5B24 B;  3REK C;  3LZ1 C;  3AZE D;  3AFA C;  1P3K C;  5AVB A;  2HUE B;  1T3U A;  3UTA A;  3AZN C;  4H9P A;  3NQJ A;  3REK B;  1JFI A;  3EG5 B;  3AFA B;  1PZR A;  3AZN B;  4G91 B;  4YM6 C;  5F99 D;  1U35 A;  5GT0 C;  3AZK C;  1M1A D;  4X23 A;  2G5H C;  5B2I C;  5BNV A;  5DNN D;  2Y2Q A;  4KHA B;  5GT0 B;  2ZY3 A;  5B31 D;  4G92 C;  3AZK B;  4UUZ B;  3REH A;  3AV1 C;  5JA4 B;  1P3L D;  5C3I B;  5AY8 D;  5B2I B;  3MGP B;  3REI D;  3V9R B;  2LY8 A;  5AV5 C;  2NZD B;  4H9R B;  1P3G D;  5GT3 D;  4G92 B;  1HTA A;  3P5J B;  1S32 D;  3H0M C;  3AYW C;  4H9O A;  5AV5 B;  4J8U A;  3AZL A;  2NQB C;  4XUJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...