3UTBC

Crystal structure of nucleosome core particle assembled with the 146b alpha-satellite sequence (ncp146b)
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
103
structure length
103
Chain Sequence
TRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.2
publication title The mechanics behind DNA sequence-dependent properties of the nucleosome
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Structural protein/dna
total genus 31
structure length 103
sequence length 103
chains with identical sequence G
ec nomenclature
pdb deposition date 2011-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3utbC00
4H9RA 3NQJB 2HUEC 5B0ZA 5AV6D 3REJC 1B6WA 3LJAB 3MGQC 4E44A 5C3IB 1BH8B 1S32C 4Z5TD 3WTPE 4ZUXC 3X1UA 3REHB 3AZHC 5B24B 1U35B 2F8NG 3WA9A 5BNVA 3AZIC 3AZGB 1KX5D 5GXQA 3MGSB 4LD9B 2YFWA 3NQUB 4NE5A 4KUDB 4QLCC 4E45A 1ZLAC 3AZKC 3X1TD 1P3OA 3AYWD 3KUYB 3AN2D 4Z66D 3X1VC 4R8PD 2CV5C 3B0CT 3WAAC 5AVCD 4X23B 5E5AC 1N1JB 1ID3C 3W98A 1P34D 2AROD 5DNMC 3MGPB 3LZ1B 2NZDC 1BH9B 3REKA 1KX4B 5B31B 1P3LA 3W96C 5B33D 4YM6B 2IO5C 5B24A 3A6NB 5CP6C 4J8WC 4KGCA 4JJNC 3X1TB 3MNNC 3MVDC 4Z66B 2CWEA 3MGSA 1P3KD 4LD9A 3NQUA 1A7WA 4DRAA 3MGQD 4KUDA 1P3BC 3B6FC 4UUZB 1M18C 1P3AA 4WZSB 5AY8B 1S32D 1F1EA 1ULYA 5B0YD 5B0ZC 4X23A 1B67A 3REIB 3AZHD 1N1JA 3TU4A 5B32C 3C1BA 4G91B 5CPKD 3MGPA 4XZQA 3WTPB 3LZ1A 5GT3B 3UTBB 5DNND 3RELD 3C1CA 3X1UC 1BH9A 3MGRC 3WA9C 1ZLAD 3AZKD 1P3KB 3AV1B 3X1VD 4YM6A 2CV5D 3VH5A 5GXQC 3A6NA 3AZMB 4H9PB 3UT9B 4WU9B 1P3GB 5E5AD 1ID3D 5KDMA 5B0YB 1P3OC 4CSRB 4HGAC 1M19D 1TZYA 5AY8A 5DNNB 3W98C 5AV8B 3O62D 5CP6D 5B2ID 3MVDD 5AVBD 5B40B 3VH5T 4H9NB 3REKC 5F99A 3WTPA 3UTBA 1P3LC 1WWIA 2JSSA 1P3BD 4J8UA 4XUJB 5B24C 4WNNB 1P3PA 4KGCC 3WKJA 2HIOB 3AV1A 1P3IB 2FJ7A 3VH6W 4DRBA 3AZMA 4WU9A 3MGSC 4LD9C 1P3GA 1M19B 1AOIB 5JA4B 3UTAD 5AV5B 3AZFA 5GSUA 5B32D 1P3AC 3O62B 3VH5W 3X1UD 3MGRD 3AZEC 4CSRA 3WA9D 4YS3C 3TU4C 3C1BC 5GT0A 1HTAA 4CAYB 5GXQD 5AV8A 5B31G 4XZQC 1P3MA 3C1CC 4H9NA 5AV9B 5CPID 3W99D 3X1SA 5BS7C 5B1MB 4XUJA 3A6NC 4J8VB 2HIOA 2RVQC 1P3IA 1M1AD 3KWQC 4WV4B 5CPJB 3LZ0D 3AZLB 4WU8B 3REKD 4AWLB 1TZYC 5AY8C 3B6GD 5B2JB 4Z2MH 4ZBJB 5FUGB 5CPIB 1P3FD 1F66C 3W99B 4KGCD 5JRGB 3LELB 5B1LB 1HQ3A 4J8XA 5F99C 3WTPC 3UTBC 2PYOA 5AV6B 4J8UC 5AV9A 3AZJD 1P3AD 4H9QB 1P3PC 4EO5C 3WKJC 3AV1C 3AFAA 2FJ7C 5B1MA 4J8VA 3NQJA 3AZMC 3AZED 2BYKB 1P3GC 4YS3D 3AZFC 4Z2MG 1KX3C 5GSUC 4Z5TB 3C1BD 4G92B 1P3FB 4NE3A 3LJAA 5CPJA 4XZQD 1EQZD 3AV2C 1KX5B 1BH8A 3C1CD 3AZLA 2NQBD 2LY8A 3W97D 1H3OB 3KXBC 3REHA 5B2JA 3AZND 5GT0C 1U35A 5FUGA 5AV8C 3AYWB 3AN2B 4R8PB 1P3MC 4KHAB 5JRGA 3AZGA 3LELA 5AVCB 5B1LA 3REJD 2L5AA 3KWQD 3B0DB 3X1SC 1P34B 2AROB 2BYMB 5AV6A 4XUJC 4H9QA 3KUYA 1EQZB 2HIOC 1TZYD 4ZUXD 1F66D 3W97B 3AZID 5B33B 3VH6A 3AZNB 2F8ND 5F99D 1KX5A 4QLCD 4J8UD 1KX4A 5B31A 1H3OA 4H9OB 3WKJD 3MGQB 3WAAD 4J8XC 1HQ3C 3X1TA 4Z66A 4R8PA 2PYOC 1S32B 1Q9CA 5GSUD 1KX3D 5AVCA 3AZHB 5DNMD 5AV9C 3AFAC 1P34A 1TAFB 4UUZA 2AROA 2BYMA 3VH6T 3AV2D 5CPKB 2NZDD 5G49B 2F8NB 4H9SA 3KXBD 3W96D 3RELB 3REIA 4J8WD 1ZLAB 5CHLB 4JJND 3LJAC 3MNND 3AZKB 5CPJC 3X1VB 2CV5B 5C3IC 3WAAB 3AZLC 5E5AB 5GT3A 3REHC 1ID3B 5B2JC 3X1SD 1M18D 3B6FD 1U35C 4ZBJC 1P3KA 3AZGC 3LELC 5B0ZD 4H9PA 5B1LC 3UT9A 3V9RB 4KUDC 5B0YA 2IO5B 5CP6B 3KUYC 5B2IB 3MNNB 5AVBB 3MVDB 4X23C 5CPKA 5G49A 5DNNA 3RELA 1P3BB 3B6FB 1WWSA 3MGPC 1HQ3D 3LZ1C 5B40A 2PYOD 2CV5A 1KX5C 1KX4C 1P3OD 5E5AA 5B31C 2F8NK 3UTAB 4YM6C 1ID3A 3AFAD 5B32B 1R4VA 4WNNA 3X1TC 4R8PC 4Z66C 3W98D 3KSYA 3X1UB 3MGRB 3WA9B 3V9RA 1M19A 1AOIA 5JA4A 3LJAD 5AV5A 1KU5A 2AROC 5GXQB 3O62A 5B2IA 4H9SC 1P3LD 5AVBA 2YFWB 3REHD 5B24D 3REIC 4G91C 3AZGD 1P3BA 4CAYA 3MGSD 4LD9D 4HGAB 5BT1C 5GT3C 4KUDD 3W98B 1M1AB 1P3KC 3KUYD 3UTAA 3LZ0B 5B32A 4X23D 3UT9C 3REKB 4WU9C 1P3LB 3B6GB 3TU4D 5B0YC 3MGRA 3MGPD 4KGCB 3LZ1D 3B0BA 4WU8A 5CPKC 1KX4D 5B31D 5DNNC 3RELC 4YM6D 3A6ND 5CPIA 3AZJB 1P3AB 3W99A 2RVQD 2YFVB 5B40C 3AZEB 4YS3B 3TU4B 3C1BB 1M1AA 4XZQB 5AY8D 3LZ0A 1P3IC 3C1CB 1JFIB 3REID 2BYKA 2NQBB 1M19C 4NFTA 1AOIC 5AV5C 3B6GA 4Z5TA 1P3FA 3O62C 5B2IC 3WTPD 5BT1D 5GT3D 3UTBD 5AVBC 3B0CW 2HUEB 5KDMB 3REJB 1P3PD 3KWQB 3AV1D 2FJ7D 3AZMD 4WU9D 3UT9D 3AYWA 3AZJA 1P3GD 3AN2A 4KHAA 3AZFD 1TZYB 2YFVA 5B32G 4ZUXB 3AZEA 1F66B 4YS3A 3UTAC 3AZIB 5B1MC 4J8VC 5BNXB 5BO0B 1EQZA 5F99B 5GT0D 4QLCB 4J8UB 1JFIA 5AV8D 2NQBA 1P3PB 3W97A 4EO5B 3WKJB 1P3MD 5B33A 5B40D 2FJ7B 3AZNA 5BS7A 4WU8C 4AWLC 3AZFB 1KX3B 5GSUB 5DNMB 4XUJD 5CPIC 3REJA 3W99C 3KWQA 4H9OA 3MGQA 2HIOD 5JRGC 1P3ID 3AV2B 2NZDB 3R45B 1AOID 3KXBB 1S32A 5AV5D 3W96B 3AZHA 4ZUXA 5AV6C 5GT0B 1M1AC 4J8WB 1BFMA 1F66A 4JJNB 3LZ0C 3AZIA 1TAFA 1P3MB 5BNXA 5BO0A 3AZNC 2F8NA 3B6GC 4Z5TC 3X1SB 1M18B 4QLCA 4J8XD 4G92C 4H9RB 3AZKA 1P3FC 1ZLAA 3X1VA 3WAAA 5B0ZB 5AV9D 4M6BA 1KX3A 4NE6A 5B1MD 5DNMA 4J8VD 3AZJC 3AYWC 3AN2C 5AVCC 3AV2A 2NZDA 3R45A 5BNVB 5CPJD 3B0DC 3KXBA 3W96A 1P34C 3AZLD 5CP6A 1HQ3B 4J8WA 4J8XB 4WU8D 4JJNA 1EQZC 3MNNA 3MVDA 2PYOB 5B2JD 1U35D 2NQBC 1P3OB 3W97C 2F8NH 5JRGD 5B33C 3AFAB 3LELD 3B6FA 1M18A 5B1LD
chains in the Genus database with same CATH superfamily
4H9RA 3NQJB 2HUEC 5B0ZA 5AV6D 3REJC 1B6WA 3LJAB 3MGQC 4E44A 5C3IB 1BH8B 1S32C 3A1IA 4Z5TD 3WTPE 4ZUXC 3X1UA 3REHB 3AZHC 5B24B 1U35B 2F8NG 3WA9A 5BNVA 3AZIC 3AZGB 1KX5D 5GXQA 3MGSB 2DF4C 4LD9B 2YFWA 3NQUB 4NE5A 4KUDB 4QLCC 4E45A 1ZLAC 3AZKC 3X1TD 1P3OA 3AYWD 3KUYB 3AN2D 4Z66D 3X1VC 4R8PD 2CV5C 3B0CT 3WAAC 5AVCD 4X23B 5E5AC 1N1JB 1ID3C 3W98A 1P34D 2AROD 5DNMC 3MGPB 3LZ1B 2NZDC 1BH9B 3REKA 1KX4B 1Z2CB 2W8SA 5B31B 1P3LA 3W96C 2Y2QA 5B33D 4YM6B 2IO5C 5B24A 3A6NB 5CP6C 4J8WC 4KGCA 4JJNC 3X1TB 3MNNC 3MVDC 3EPJA 4Z66B 2CWEA 3MGSA 1P3KD 4LD9A 3NQUA 1A7WA 4DRAA 3MGQD 4KUDA 1P3BC 3B6FC 4UUZB 1M18C 1P3AA 4WZSB 5AY8B 2XD5A 1S32D 1F1EA 1ULYA 5B0YD 5B0ZC 4X23A 1B67A 3REIB 3AZHD 1N1JA 3TU4A 5B32C 2Y2PA 3C1BA 4G91B 5CPKD 3MGPA 3EPHA 4XZQA 3WTPB 3LZ1A 5GT3B 3UTBB 5DNND 3RELD 3C1CA 3X1UC 2Y2JA 1BH9A 3MGRC 3WA9C 2XD1A 1ZLAD 3AZKD 1P3KB 3AV1B 3X1VD 4YM6A 2CV5D 3VH5A 5GXQC 3A6NA 3AZMB 4H9PB 3UT9B 4WU9B 1P3GB 5E5AD 1ID3D 5KDMA 5B0YB 1P3OC 2JCHA 4CSRB 4HGAC 1M19D 1TZYA 5AY8A 5DNNB 3W98C 5AV8B 3O62D 5CP6D 5B2ID 3MVDD 5AVBD 5B40B 3VH5T 4H9NB 3REKC 5F99A 3WTPA 3UTBA 1P3LC 1WWIA 2JSSA 1P3BD 4J8UA 4XUJB 5B24C 4WNNB 1P3PA 4KGCC 3WKJA 2HIOB 3AV1A 1P3IB 2FJ7A 3VH6W 4DRBA 3AZMA 4WU9A 3MGSC 4LD9C 1P3GA 1M19B 3EPLA 1AOIB 2Y2GA 5JA4B 5AV5B 3UTAD 5GSUA 3AZFA 2DQNC 5B32D 3EPKA 1P3AC 3O62B 3VH5W 3X1UD 3MGRD 3AZEC 4CSRA 3WA9D 4YS3C 3TU4C 3C1BC 5GT0A 1HTAA 4CAYB 5GXQD 5AV8A 5B31G 4XZQC 1P3MA 3C1CC 4H9NA 5AV9B 5CPID 3W99D 2RIQA 3X1SA 5BS7C 5B1MB 4XUJA 3A6NC 4J8VB 2HIOA 2RVQC 2Y2NA 1P3IA 1M1AD 3KWQC 4WV4B 5CPJB 3LZ0D 2Y2OA 3AZLB 4WU8B 3REKD 4AWLB 1TZYC 5AY8C 3B6GD 5B2JB 4Z2MH 4ZBJB 5FUGB 5CPIB 1P3FD 1F66C 3W99B 4KGCD 5JRGB 3LELB 5B1LB 1HQ3A 4J8XA 3H0MC 3P5JB 5F99C 3WTPC 3UTBC 2PYOA 5AV6B 4J8UC 5AV9A 3AZJD 1P3AD 4H9QB 1P3PC 4EO5C 2F2AC 3WKJC 3AV1C 3AFAA 2FJ7C 5B1MA 4J8VA 3NQJA 3AZMC 3AZED 2BYKB 1P3GC 4YS3D 3AZFC 4Z2MG 1KX3C 5GSUC 4Z5TB 3C1BD 4G92B 1P3FB 4NE3A 3LJAA 5CPJA 4XZQD 1EQZD 3AV2C 1KX5B 1BH8A 3C1CD 3AZLA 2NQBD 2LY8A 3W97D 1H3OB 3KXBC 3REHA 5B2JA 3AZND 5GT0C 1U35A 5FUGA 5AV8C 3AYWB 3AN2B 4R8PB 1P3MC 4KHAB 5JRGA 3AZGA 3LELA 5AVCB 5B1LA 3REJD 2L5AA 3KWQD 3B0DB 2ZY3A 3X1SC 1P34B 2AROB 2BYMB 5AV6A 4XUJC 4H9QA 3KUYA 1EQZB 2HIOC 1TZYD 4ZUXD 1F66D 3W97B 2Y2IA 3AZID 5B33B 3VH6A 2J8PA 3AZNB 2F8ND 5F99D 1KX5A 4QLCD 4J8UD 1KX4A 5B31A 1H3OA 4H9OB 3WKJD 3MGQB 3WAAD 4J8XC 1HQ3C 2ZM5A 3X1TA 2FFFB 4Z66A 4R8PA 2PYOC 1S32B 1Q9CA 5GSUD 1KX3D 5AVCA 3AZHB 5DNMD 5AV9C 3FDDA 3AFAC 1P34A 1TAFB 4UUZA 2AROA 2BYMA 3VH6T 3AV2D 5CPKB 2NZDD 5G49B 2F8NB 4H9SA 3KXBD 3W96D 3RELB 3REIA 4J8WD 1ZLAB 5CHLB 4JJND 3LJAC 3MNND 3AZKB 5CPJC 3X1VB 2CV5B 5C3IC 3WAAB 3AZLC 2Y2HA 5E5AB 5GT3A 2Y2KA 2JE5A 3REHC 1ID3B 5B2JC 3X1SD 1M18D 3B6FD 1U35C 4ZBJC 2Y2MA 1P3KA 3AZGC 3LELC 3KFUG 5B0ZD 4H9PA 5B1LC 3UT9A 3V9RB 4KUDC 3F6TA 5B0YA 2IO5B 5CP6B 3KUYC 5B2IB 3MNNB 5AVBB 3MVDB 4DQYB 4X23C 5CPKA 5G49A 5DNNA 3RELA 4WJ3C 1P3BB 3B6FB 1WWSA 3MGPC 1HQ3D 3LZ1C 2Y2LA 5B40A 2PYOD 2CV5A 1KX5C 1KX4C 1P3OD 5E5AA 5B31C 2F8NK 3UTAB 4YM6C 1ID3A 3AFAD 5B32B 1R4VA 4WNNA 3X1TC 4R8PC 4Z66C 3W98D 3KSYA 3X1UB 3MGRB 3WA9B 3V9RA 1M19A 1AOIA 5JA4A 3LJAD 5AV5A 1KU5A 2AROC 5GXQB 2ZY5A 3O62A 2BG1A 5B2IA 4H9SC 1P3LD 5AVBA 2YFWB 2VQRA 3REHD 5B24D 3REIC 3H0LC 4G91C 3AZGD 1P3BA 4CAYA 3MGSD 4LD9D 4HGAB 5BT1C 5GT3C 3IP4C 4KUDD 3W98B 2ZY4A 1M1AB 2ZY2A 1P3KC 3KUYD 3UTAA 3LZ0B 3EG5B 5B32A 4X23D 3UT9C 3REKB 4WU9C 1P3LB 3B6GB 3TU4D 5B0YC 3MGRA 3MGPD 1W2EA 4KGCB 3LZ1D 3B0BA 4WU8A 5CPKC 1KX4D 5B31D 5DNNC 3RELC 4YM6D 3A6ND 5CPIA 3AZJB 1P3AB 3W99A 2RVQD 2YFVB 5B40C 3AZEB 4YS3B 3TU4B 3C1BB 1M1AA 4XZQB 5AY8D 3LZ0A 1P3IC 3C1CB 1JFIB 3REID 2BYKA 2NQBB 1M19C 4NFTA 1AOIC 5AV5C 3B6GA 4Z5TA 2UWXA 1P3FA 3O62C 5B2IC 3WTPD 5BT1D 5GT3D 3UTBD 5AVBC 3B0CW 2HUEB 4UPKA 5KDMB 3REJB 1P3PD 3KWQB 3AV1D 2FJ7D 2G5IC 4WU9D 3UT9D 3AYWA 3AZJA 3AZMD 3AN2A 1P3GD 4KHAA 3AZFD 1TZYB 2YFVA 5B32G 4ZUXB 3AZEA 1F66B 4YS3A 3UTAC 3AZIB 5B1MC 4J8VC 5BNXB 5BO0B 1EQZA 5F99B 5GT0D 4QLCB 4J8UB 1JFIA 1PZRA 5AV8D 2NQBA 1P3PB 3W97A 4EO5B 3WKJB 1P3MD 5B33A 5B40D 2FJ7B 3AZNA 5BS7A 4WU8C 4AWLC 3AZFB 1KX3B 5GSUB 3AL0C 3H0RC 5DNMB 4XUJD 2G5HC 5CPIC 3W99C 3REJA 3KWQA 4H9OA 3MGQA 2HIOD 5JRGC 1P3ID 3AV2B 2NZDB 3R45B 1T3UA 1AOID 3KXBB 1S32A 5AV5D 3W96B 3AZHA 4ZUXA 5AV6C 5GT0B 1M1AC 4J8WB 1BFMA 1F66A 4JJNB 3LZ0C 3AZIA 1TAFA 1P3MB 5BNXA 5BO0A 3AZNC 2F8NA 3B6GC 4Z5TC 3X1SB 1M18B 4QLCA 4J8XD 4G92C 4H9RB 3AZKA 1P3FC 1ZLAA 3X1VA 3WAAA 5B0ZB 5AV9D 4M6BA 1KX3A 4NE6A 5B1MD 5DNMA 4J8VD 3AZJC 3AYWC 3A1KA 3AN2C 5AVCC 3AV2A 2NZDA 3R45A 5BNVB 5CPJD 3B0DC 3KXBA 3W96A 1P34C 3AZLD 5CP6A 1HQ3B 4J8WA 4J8XB 4WU8D 4JJNA 1EQZC 3MNNA 3MVDA 2PYOB 5B2JD 1U35D 2NQBC 1P3OB 3W97C 2F8NH 5JRGD 5B33C 3AFAB 3LELD 3B6FA 1M18A 5B1LD
chains in the Genus database with same CATH topology
4H9RA 3NQJB 2HUEC 5B0ZA 5AV6D 3REJC 1B6WA 3LJAB 3MGQC 4E44A 5C3IB 1BH8B 1S32C 3A1IA 4Z5TD 3WTPE 4ZUXC 3X1UA 3REHB 3AZHC 5B24B 1U35B 2F8NG 3WA9A 5BNVA 3AZIC 3AZGB 1KX5D 5GXQA 3MGSB 2DF4C 4LD9B 2YFWA 3NQUB 4NE5A 4KUDB 4QLCC 4E45A 1ZLAC 3AZKC 3X1TD 1P3OA 3AYWD 3KUYB 3AN2D 4Z66D 3X1VC 4R8PD 2CV5C 3B0CT 3WAAC 5AVCD 4X23B 5E5AC 1N1JB 1ID3C 3W98A 1P34D 2AROD 5DNMC 3MGPB 3LZ1B 2NZDC 1BH9B 3REKA 1KX4B 1Z2CB 2W8SA 5B31B 1P3LA 3W96C 2Y2QA 5B33D 4YM6B 2IO5C 5B24A 3A6NB 5CP6C 4J8WC 4KGCA 4JJNC 3X1TB 3MNNC 3MVDC 3EPJA 4Z66B 2CWEA 3MGSA 1P3KD 4LD9A 3NQUA 1A7WA 4DRAA 3MGQD 4KUDA 1P3BC 3B6FC 4UUZB 1M18C 1P3AA 4WZSB 5AY8B 2XD5A 1S32D 1F1EA 1ULYA 5B0YD 5B0ZC 4X23A 1B67A 3REIB 3AZHD 1N1JA 3TU4A 5B32C 2Y2PA 3C1BA 4G91B 5CPKD 3MGPA 3EPHA 4XZQA 3WTPB 3LZ1A 5GT3B 3UTBB 5DNND 3RELD 3C1CA 3X1UC 2Y2JA 1BH9A 3MGRC 3WA9C 2XD1A 1ZLAD 3AZKD 1P3KB 3AV1B 3X1VD 4YM6A 2CV5D 3VH5A 5GXQC 3A6NA 3AZMB 4H9PB 3UT9B 4WU9B 1P3GB 5E5AD 1ID3D 5KDMA 5B0YB 1P3OC 2JCHA 4CSRB 4HGAC 1M19D 1TZYA 5AY8A 5DNNB 3W98C 5AV8B 3O62D 5CP6D 5B2ID 3MVDD 5AVBD 5B40B 3VH5T 4H9NB 3REKC 5F99A 3WTPA 3UTBA 1P3LC 1WWIA 2JSSA 1P3BD 4J8UA 4XUJB 5B24C 4WNNB 1P3PA 4KGCC 3WKJA 2HIOB 3AV1A 1P3IB 2FJ7A 3VH6W 4DRBA 3AZMA 4WU9A 3MGSC 4LD9C 1P3GA 1M19B 3EPLA 1AOIB 2Y2GA 5JA4B 5AV5B 3UTAD 5GSUA 3AZFA 2DQNC 5B32D 3EPKA 1P3AC 3O62B 3VH5W 3X1UD 3MGRD 3AZEC 4CSRA 3WA9D 4YS3C 3TU4C 3C1BC 5GT0A 1HTAA 4CAYB 5GXQD 5AV8A 5B31G 4XZQC 1P3MA 3C1CC 4H9NA 5AV9B 5CPID 3W99D 2RIQA 3X1SA 5BS7C 5B1MB 4XUJA 3A6NC 4J8VB 2HIOA 2RVQC 2Y2NA 1P3IA 1M1AD 3KWQC 4WV4B 5CPJB 3LZ0D 2Y2OA 3AZLB 4WU8B 3REKD 4AWLB 1TZYC 5AY8C 3B6GD 5B2JB 4Z2MH 4ZBJB 5FUGB 5CPIB 1P3FD 1F66C 3W99B 4KGCD 5JRGB 3LELB 5B1LB 1HQ3A 4J8XA 3H0MC 3P5JB 5F99C 3WTPC 3UTBC 2PYOA 5AV6B 4J8UC 5AV9A 3AZJD 1P3AD 4H9QB 1P3PC 4EO5C 2F2AC 3WKJC 3AV1C 3AFAA 2FJ7C 5B1MA 4J8VA 3NQJA 3AZMC 3AZED 2BYKB 1P3GC 4YS3D 3AZFC 4Z2MG 1KX3C 5GSUC 4Z5TB 3C1BD 4G92B 1P3FB 4NE3A 3LJAA 5CPJA 4XZQD 1EQZD 3AV2C 1KX5B 1BH8A 3C1CD 3AZLA 2NQBD 2LY8A 3W97D 1H3OB 3KXBC 3REHA 5B2JA 3AZND 5GT0C 1U35A 5FUGA 5AV8C 3AYWB 3AN2B 4R8PB 1P3MC 4KHAB 5JRGA 3AZGA 3LELA 5AVCB 5B1LA 3REJD 2L5AA 3KWQD 3B0DB 2ZY3A 3X1SC 1P34B 2AROB 2BYMB 5AV6A 4XUJC 4H9QA 3KUYA 1EQZB 2HIOC 1TZYD 4ZUXD 1F66D 3W97B 2Y2IA 3AZID 5B33B 3VH6A 2J8PA 3AZNB 2F8ND 5F99D 1KX5A 4QLCD 4J8UD 1KX4A 5B31A 1H3OA 4H9OB 3WKJD 3MGQB 3WAAD 4J8XC 1HQ3C 2ZM5A 3X1TA 2FFFB 4Z66A 4R8PA 2PYOC 1S32B 1Q9CA 5GSUD 1KX3D 5AVCA 3AZHB 5DNMD 5AV9C 3FDDA 3AFAC 1P34A 1TAFB 4UUZA 2AROA 2BYMA 3VH6T 3AV2D 5CPKB 2NZDD 5G49B 2F8NB 4H9SA 3KXBD 3W96D 3RELB 3REIA 4J8WD 1ZLAB 5CHLB 4JJND 3LJAC 3MNND 3AZKB 5CPJC 3X1VB 2CV5B 5C3IC 3WAAB 3AZLC 2Y2HA 5E5AB 5GT3A 2Y2KA 2JE5A 3REHC 1ID3B 5B2JC 3X1SD 1M18D 3B6FD 1U35C 4ZBJC 2Y2MA 1P3KA 3AZGC 3LELC 3KFUG 5B0ZD 4H9PA 5B1LC 3UT9A 3V9RB 4KUDC 3F6TA 5B0YA 2IO5B 5CP6B 3KUYC 5B2IB 3MNNB 5AVBB 3MVDB 4DQYB 4X23C 5CPKA 5G49A 5DNNA 3RELA 4WJ3C 1P3BB 3B6FB 1WWSA 3MGPC 1HQ3D 3LZ1C 2Y2LA 5B40A 2PYOD 2CV5A 1KX5C 1KX4C 1P3OD 5E5AA 5B31C 2F8NK 3UTAB 4YM6C 1ID3A 3AFAD 5B32B 1R4VA 4WNNA 3X1TC 4R8PC 4Z66C 3W98D 3KSYA 3X1UB 3MGRB 3WA9B 3V9RA 1M19A 1AOIA 5JA4A 3LJAD 5AV5A 1KU5A 2AROC 5GXQB 2ZY5A 3O62A 2BG1A 5B2IA 4H9SC 1P3LD 5AVBA 2YFWB 2VQRA 3REHD 5B24D 3REIC 3H0LC 4G91C 3AZGD 1P3BA 4CAYA 3MGSD 4LD9D 4HGAB 5BT1C 5GT3C 3IP4C 4KUDD 3W98B 2ZY4A 1M1AB 2ZY2A 1P3KC 3KUYD 3UTAA 3LZ0B 3EG5B 5B32A 4X23D 3UT9C 3REKB 4WU9C 1P3LB 3B6GB 3TU4D 5B0YC 3MGRA 3MGPD 1W2EA 4KGCB 3LZ1D 3B0BA 4WU8A 5CPKC 1KX4D 5B31D 5DNNC 3RELC 4YM6D 3A6ND 5CPIA 3AZJB 1P3AB 3W99A 2RVQD 2YFVB 5B40C 3AZEB 4YS3B 3TU4B 3C1BB 1M1AA 4XZQB 5AY8D 3LZ0A 1P3IC 3C1CB 1JFIB 3REID 2BYKA 2NQBB 1M19C 4NFTA 1AOIC 5AV5C 3B6GA 4Z5TA 2UWXA 1P3FA 3O62C 5B2IC 3WTPD 5BT1D 5GT3D 3UTBD 5AVBC 3B0CW 2HUEB 4UPKA 5KDMB 3REJB 1P3PD 3KWQB 3AV1D 2FJ7D 2G5IC 4WU9D 3UT9D 3AYWA 3AZJA 3AZMD 3AN2A 1P3GD 4KHAA 3AZFD 1TZYB 2YFVA 5B32G 4ZUXB 3AZEA 1F66B 4YS3A 3UTAC 3AZIB 5B1MC 4J8VC 5BNXB 5BO0B 1EQZA 5F99B 5GT0D 4QLCB 4J8UB 1JFIA 1PZRA 5AV8D 2NQBA 1P3PB 3W97A 4EO5B 3WKJB 1P3MD 5B33A 5B40D 2FJ7B 3AZNA 5BS7A 4WU8C 4AWLC 3AZFB 1KX3B 5GSUB 3AL0C 3H0RC 5DNMB 4XUJD 2G5HC 5CPIC 3W99C 3REJA 3KWQA 4H9OA 3MGQA 2HIOD 5JRGC 1P3ID 3AV2B 2NZDB 3R45B 1T3UA 1AOID 3KXBB 1S32A 5AV5D 3W96B 3AZHA 4ZUXA 5AV6C 5GT0B 1M1AC 4J8WB 1BFMA 1F66A 4JJNB 3LZ0C 3AZIA 1TAFA 1P3MB 5BNXA 5BO0A 3AZNC 2F8NA 3B6GC 4Z5TC 3X1SB 1M18B 4QLCA 4J8XD 4G92C 4H9RB 3AZKA 1P3FC 1ZLAA 3X1VA 3WAAA 5B0ZB 5AV9D 4M6BA 1KX3A 4NE6A 5B1MD 5DNMA 4J8VD 3AZJC 3AYWC 3A1KA 3AN2C 5AVCC 3AV2A 2NZDA 3R45A 5BNVB 5CPJD 3B0DC 3KXBA 3W96A 1P34C 3AZLD 5CP6A 1HQ3B 4J8WA 4J8XB 4WU8D 4JJNA 1EQZC 3MNNA 3MVDA 2PYOB 5B2JD 1U35D 2NQBC 1P3OB 3W97C 2F8NH 5JRGD 5B33C 3AFAB 3LELD 3B6FA 1M18A 5B1LD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4H9R A;  3NQJ B;  2HUE C;  5B0Z A;  5AV6 D;  3REJ C;  1B6W A;  3LJA B;  3MGQ C;  4E44 A;  5C3I B;  1BH8 B;  1S32 C;  4Z5T D;  3WTP E;  4ZUX C;  3X1U A;  3REH B;  3AZH C;  5B24 B;  1U35 B;  2F8N G;  3WA9 A;  5BNV A;  3AZI C;  3AZG B;  1KX5 D;  5GXQ A;  3MGS B;  4LD9 B;  2YFW A;  3NQU B;  4NE5 A;  4KUD B;  4QLC C;  4E45 A;  1ZLA C;  3AZK C;  3X1T D;  1P3O A;  3AYW D;  3KUY B;  3AN2 D;  4Z66 D;  3X1V C;  4R8P D;  2CV5 C;  3B0C T;  3WAA C;  5AVC D;  4X23 B;  5E5A C;  1N1J B;  1ID3 C;  3W98 A;  1P34 D;  2ARO D;  5DNM C;  3MGP B;  3LZ1 B;  2NZD C;  1BH9 B;  3REK A;  1KX4 B;  5B31 B;  1P3L A;  3W96 C;  5B33 D;  4YM6 B;  2IO5 C;  5B24 A;  3A6N B;  5CP6 C;  4J8W C;  4KGC A;  4JJN C;  3X1T B;  3MNN C;  3MVD C;  4Z66 B;  2CWE A;  3MGS A;  1P3K D;  4LD9 A;  3NQU A;  1A7W A;  4DRA A;  3MGQ D;  4KUD A;  1P3B C;  3B6F C;  4UUZ B;  1M18 C;  1P3A A;  4WZS B;  5AY8 B;  1S32 D;  1F1E A;  1ULY A;  5B0Y D;  5B0Z C;  4X23 A;  1B67 A;  3REI B;  3AZH D;  1N1J A;  3TU4 A;  5B32 C;  3C1B A;  4G91 B;  5CPK D;  3MGP A;  4XZQ A;  3WTP B;  3LZ1 A;  5GT3 B;  3UTB B;  5DNN D;  3REL D;  3C1C A;  3X1U C;  1BH9 A;  3MGR C;  3WA9 C;  1ZLA D;  3AZK D;  1P3K B;  3AV1 B;  3X1V D;  4YM6 A;  2CV5 D;  3VH5 A;  5GXQ C;  3A6N A;  3AZM B;  4H9P B;  3UT9 B;  4WU9 B;  1P3G B;  5E5A D;  1ID3 D;  5KDM A;  5B0Y B;  1P3O C;  4CSR B;  4HGA C;  1M19 D;  1TZY A;  5AY8 A;  5DNN B;  3W98 C;  5AV8 B;  3O62 D;  5CP6 D;  5B2I D;  3MVD D;  5AVB D;  5B40 B;  3VH5 T;  4H9N B;  3REK C;  5F99 A;  3WTP A;  3UTB A;  1P3L C;  1WWI A;  2JSS A;  1P3B D;  4J8U A;  4XUJ B;  5B24 C;  4WNN B;  1P3P A;  4KGC C;  3WKJ A;  2HIO B;  3AV1 A;  1P3I B;  2FJ7 A;  3VH6 W;  4DRB A;  3AZM A;  4WU9 A;  3MGS C;  4LD9 C;  1P3G A;  1M19 B;  1AOI B;  5JA4 B;  3UTA D;  5AV5 B;  3AZF A;  5GSU A;  5B32 D;  1P3A C;  3O62 B;  3VH5 W;  3X1U D;  3MGR D;  3AZE C;  4CSR A;  3WA9 D;  4YS3 C;  3TU4 C;  3C1B C;  5GT0 A;  1HTA A;  4CAY B;  5GXQ D;  5AV8 A;  5B31 G;  4XZQ C;  1P3M A;  3C1C C;  4H9N A;  5AV9 B;  5CPI D;  3W99 D;  3X1S A;  5BS7 C;  5B1M B;  4XUJ A;  3A6N C;  4J8V B;  2HIO A;  2RVQ C;  1P3I A;  1M1A D;  3KWQ C;  4WV4 B;  5CPJ B;  3LZ0 D;  3AZL B;  4WU8 B;  3REK D;  4AWL B;  1TZY C;  5AY8 C;  3B6G D;  5B2J B;  4Z2M H;  4ZBJ B;  5FUG B;  5CPI B;  1P3F D;  1F66 C;  3W99 B;  4KGC D;  5JRG B;  3LEL B;  5B1L B;  1HQ3 A;  4J8X A;  5F99 C;  3WTP C;  3UTB C;  2PYO A;  5AV6 B;  4J8U C;  5AV9 A;  3AZJ D;  1P3A D;  4H9Q B;  1P3P C;  4EO5 C;  3WKJ C;  3AV1 C;  3AFA A;  2FJ7 C;  5B1M A;  4J8V A;  3NQJ A;  3AZM C;  3AZE D;  2BYK B;  1P3G C;  4YS3 D;  3AZF C;  4Z2M G;  1KX3 C;  5GSU C;  4Z5T B;  3C1B D;  4G92 B;  1P3F B;  4NE3 A;  3LJA A;  5CPJ A;  4XZQ D;  1EQZ D;  3AV2 C;  1KX5 B;  1BH8 A;  3C1C D;  3AZL A;  2NQB D;  2LY8 A;  3W97 D;  1H3O B;  3KXB C;  3REH A;  5B2J A;  3AZN D;  5GT0 C;  1U35 A;  5FUG A;  5AV8 C;  3AYW B;  3AN2 B;  4R8P B;  1P3M C;  4KHA B;  5JRG A;  3AZG A;  3LEL A;  5AVC B;  5B1L A;  3REJ D;  2L5A A;  3KWQ D;  3B0D B;  3X1S C;  1P34 B;  2ARO B;  2BYM B;  5AV6 A;  4XUJ C;  4H9Q A;  3KUY A;  1EQZ B;  2HIO C;  1TZY D;  4ZUX D;  1F66 D;  3W97 B;  3AZI D;  5B33 B;  3VH6 A;  3AZN B;  2F8N D;  5F99 D;  1KX5 A;  4QLC D;  4J8U D;  1KX4 A;  5B31 A;  1H3O A;  4H9O B;  3WKJ D;  3MGQ B;  3WAA D;  4J8X C;  1HQ3 C;  3X1T A;  4Z66 A;  4R8P A;  2PYO C;  1S32 B;  1Q9C A;  5GSU D;  1KX3 D;  5AVC A;  3AZH B;  5DNM D;  5AV9 C;  3AFA C;  1P34 A;  1TAF B;  4UUZ A;  2ARO A;  2BYM A;  3VH6 T;  3AV2 D;  5CPK B;  2NZD D;  5G49 B;  2F8N B;  4H9S A;  3KXB D;  3W96 D;  3REL B;  3REI A;  4J8W D;  1ZLA B;  5CHL B;  4JJN D;  3LJA C;  3MNN D;  3AZK B;  5CPJ C;  3X1V B;  2CV5 B;  5C3I C;  3WAA B;  3AZL C;  5E5A B;  5GT3 A;  3REH C;  1ID3 B;  5B2J C;  3X1S D;  1M18 D;  3B6F D;  1U35 C;  4ZBJ C;  1P3K A;  3AZG C;  3LEL C;  5B0Z D;  4H9P A;  5B1L C;  3UT9 A;  3V9R B;  4KUD C;  5B0Y A;  2IO5 B;  5CP6 B;  3KUY C;  5B2I B;  3MNN B;  5AVB B;  3MVD B;  4X23 C;  5CPK A;  5G49 A;  5DNN A;  3REL A;  1P3B B;  3B6F B;  1WWS A;  3MGP C;  1HQ3 D;  3LZ1 C;  5B40 A;  2PYO D;  2CV5 A;  1KX5 C;  1KX4 C;  1P3O D;  5E5A A;  5B31 C;  2F8N K;  3UTA B;  4YM6 C;  1ID3 A;  3AFA D;  5B32 B;  1R4V A;  4WNN A;  3X1T C;  4R8P C;  4Z66 C;  3W98 D;  3KSY A;  3X1U B;  3MGR B;  3WA9 B;  3V9R A;  1M19 A;  1AOI A;  5JA4 A;  3LJA D;  5AV5 A;  1KU5 A;  2ARO C;  5GXQ B;  3O62 A;  5B2I A;  4H9S C;  1P3L D;  5AVB A;  2YFW B;  3REH D;  5B24 D;  3REI C;  4G91 C;  3AZG D;  1P3B A;  4CAY A;  3MGS D;  4LD9 D;  4HGA B;  5BT1 C;  5GT3 C;  4KUD D;  3W98 B;  1M1A B;  1P3K C;  3KUY D;  3UTA A;  3LZ0 B;  5B32 A;  4X23 D;  3UT9 C;  3REK B;  4WU9 C;  1P3L B;  3B6G B;  3TU4 D;  5B0Y C;  3MGR A;  3MGP D;  4KGC B;  3LZ1 D;  3B0B A;  4WU8 A;  5CPK C;  1KX4 D;  5B31 D;  5DNN C;  3REL C;  4YM6 D;  3A6N D;  5CPI A;  3AZJ B;  1P3A B;  3W99 A;  2RVQ D;  2YFV B;  5B40 C;  3AZE B;  4YS3 B;  3TU4 B;  3C1B B;  1M1A A;  4XZQ B;  5AY8 D;  3LZ0 A;  1P3I C;  3C1C B;  1JFI B;  3REI D;  2BYK A;  2NQB B;  1M19 C;  4NFT A;  1AOI C;  5AV5 C;  3B6G A;  4Z5T A;  1P3F A;  3O62 C;  5B2I C;  3WTP D;  5BT1 D;  5GT3 D;  3UTB D;  5AVB C;  3B0C W;  2HUE B;  5KDM B;  3REJ B;  1P3P D;  3KWQ B;  3AV1 D;  2FJ7 D;  3AZM D;  4WU9 D;  3UT9 D;  3AYW A;  3AZJ A;  1P3G D;  3AN2 A;  4KHA A;  3AZF D;  1TZY B;  2YFV A;  5B32 G;  4ZUX B;  3AZE A;  1F66 B;  4YS3 A;  3UTA C;  3AZI B;  5B1M C;  4J8V C;  5BNX B;  5BO0 B;  1EQZ A;  5F99 B;  5GT0 D;  4QLC B;  4J8U B;  1JFI A;  5AV8 D;  2NQB A;  1P3P B;  3W97 A;  4EO5 B;  3WKJ B;  1P3M D;  5B33 A;  5B40 D;  2FJ7 B;  3AZN A;  5BS7 A;  4WU8 C;  4AWL C;  3AZF B;  1KX3 B;  5GSU B;  5DNM B;  4XUJ D;  5CPI C;  3REJ A;  3W99 C;  3KWQ A;  4H9O A;  3MGQ A;  2HIO D;  5JRG C;  1P3I D;  3AV2 B;  2NZD B;  3R45 B;  1AOI D;  3KXB B;  1S32 A;  5AV5 D;  3W96 B;  3AZH A;  4ZUX A;  5AV6 C;  5GT0 B;  1M1A C;  4J8W B;  1BFM A;  1F66 A;  4JJN B;  3LZ0 C;  3AZI A;  1TAF A;  1P3M B;  5BNX A;  5BO0 A;  3AZN C;  2F8N A;  3B6G C;  4Z5T C;  3X1S B;  1M18 B;  4QLC A;  4J8X D;  4G92 C;  4H9R B;  3AZK A;  1P3F C;  1ZLA A;  3X1V A;  3WAA A;  5B0Z B;  5AV9 D;  4M6B A;  1KX3 A;  4NE6 A;  5B1M D;  5DNM A;  4J8V D;  3AZJ C;  3AYW C;  3AN2 C;  5AVC C;  3AV2 A;  2NZD A;  3R45 A;  5BNV B;  5CPJ D;  3B0D C;  3KXB A;  3W96 A;  1P34 C;  3AZL D;  5CP6 A;  1HQ3 B;  4J8W A;  4J8X B;  4WU8 D;  4JJN A;  1EQZ C;  3MNN A;  3MVD A;  2PYO B;  5B2J D;  1U35 D;  2NQB C;  1P3O B;  3W97 C;  2F8N H;  5JRG D;  5B33 C;  3AFA B;  3LEL D;  3B6F A;  1M18 A;  5B1L D; 
#chains in the Genus database with same CATH topology
 4H9R A;  3NQJ B;  2HUE C;  5B0Z A;  5AV6 D;  3REJ C;  1B6W A;  3LJA B;  3MGQ C;  4E44 A;  5C3I B;  1BH8 B;  1S32 C;  3A1I A;  4Z5T D;  3WTP E;  4ZUX C;  3X1U A;  3REH B;  3AZH C;  5B24 B;  1U35 B;  2F8N G;  3WA9 A;  5BNV A;  3AZI C;  3AZG B;  1KX5 D;  5GXQ A;  3MGS B;  2DF4 C;  4LD9 B;  2YFW A;  3NQU B;  4NE5 A;  4KUD B;  4QLC C;  4E45 A;  1ZLA C;  3AZK C;  3X1T D;  1P3O A;  3AYW D;  3KUY B;  3AN2 D;  4Z66 D;  3X1V C;  4R8P D;  2CV5 C;  3B0C T;  3WAA C;  5AVC D;  4X23 B;  5E5A C;  1N1J B;  1ID3 C;  3W98 A;  1P34 D;  2ARO D;  5DNM C;  3MGP B;  3LZ1 B;  2NZD C;  1BH9 B;  3REK A;  1KX4 B;  1Z2C B;  2W8S A;  5B31 B;  1P3L A;  3W96 C;  2Y2Q A;  5B33 D;  4YM6 B;  2IO5 C;  5B24 A;  3A6N B;  5CP6 C;  4J8W C;  4KGC A;  4JJN C;  3X1T B;  3MNN C;  3MVD C;  3EPJ A;  4Z66 B;  2CWE A;  3MGS A;  1P3K D;  4LD9 A;  3NQU A;  1A7W A;  4DRA A;  3MGQ D;  4KUD A;  1P3B C;  3B6F C;  4UUZ B;  1M18 C;  1P3A A;  4WZS B;  5AY8 B;  2XD5 A;  1S32 D;  1F1E A;  1ULY A;  5B0Y D;  5B0Z C;  4X23 A;  1B67 A;  3REI B;  3AZH D;  1N1J A;  3TU4 A;  5B32 C;  2Y2P A;  3C1B A;  4G91 B;  5CPK D;  3MGP A;  3EPH A;  4XZQ A;  3WTP B;  3LZ1 A;  5GT3 B;  3UTB B;  5DNN D;  3REL D;  3C1C A;  3X1U C;  2Y2J A;  1BH9 A;  3MGR C;  3WA9 C;  2XD1 A;  1ZLA D;  3AZK D;  1P3K B;  3AV1 B;  3X1V D;  4YM6 A;  2CV5 D;  3VH5 A;  5GXQ C;  3A6N A;  3AZM B;  4H9P B;  3UT9 B;  4WU9 B;  1P3G B;  5E5A D;  1ID3 D;  5KDM A;  5B0Y B;  1P3O C;  2JCH A;  4CSR B;  4HGA C;  1M19 D;  1TZY A;  5AY8 A;  5DNN B;  3W98 C;  5AV8 B;  3O62 D;  5CP6 D;  5B2I D;  3MVD D;  5AVB D;  5B40 B;  3VH5 T;  4H9N B;  3REK C;  5F99 A;  3WTP A;  3UTB A;  1P3L C;  1WWI A;  2JSS A;  1P3B D;  4J8U A;  4XUJ B;  5B24 C;  4WNN B;  1P3P A;  4KGC C;  3WKJ A;  2HIO B;  3AV1 A;  1P3I B;  2FJ7 A;  3VH6 W;  4DRB A;  3AZM A;  4WU9 A;  3MGS C;  4LD9 C;  1P3G A;  1M19 B;  3EPL A;  1AOI B;  2Y2G A;  5JA4 B;  5AV5 B;  3UTA D;  5GSU A;  3AZF A;  2DQN C;  5B32 D;  3EPK A;  1P3A C;  3O62 B;  3VH5 W;  3X1U D;  3MGR D;  3AZE C;  4CSR A;  3WA9 D;  4YS3 C;  3TU4 C;  3C1B C;  5GT0 A;  1HTA A;  4CAY B;  5GXQ D;  5AV8 A;  5B31 G;  4XZQ C;  1P3M A;  3C1C C;  4H9N A;  5AV9 B;  5CPI D;  3W99 D;  2RIQ A;  3X1S A;  5BS7 C;  5B1M B;  4XUJ A;  3A6N C;  4J8V B;  2HIO A;  2RVQ C;  2Y2N A;  1P3I A;  1M1A D;  3KWQ C;  4WV4 B;  5CPJ B;  3LZ0 D;  2Y2O A;  3AZL B;  4WU8 B;  3REK D;  4AWL B;  1TZY C;  5AY8 C;  3B6G D;  5B2J B;  4Z2M H;  4ZBJ B;  5FUG B;  5CPI B;  1P3F D;  1F66 C;  3W99 B;  4KGC D;  5JRG B;  3LEL B;  5B1L B;  1HQ3 A;  4J8X A;  3H0M C;  3P5J B;  5F99 C;  3WTP C;  3UTB C;  2PYO A;  5AV6 B;  4J8U C;  5AV9 A;  3AZJ D;  1P3A D;  4H9Q B;  1P3P C;  4EO5 C;  2F2A C;  3WKJ C;  3AV1 C;  3AFA A;  2FJ7 C;  5B1M A;  4J8V A;  3NQJ A;  3AZM C;  3AZE D;  2BYK B;  1P3G C;  4YS3 D;  3AZF C;  4Z2M G;  1KX3 C;  5GSU C;  4Z5T B;  3C1B D;  4G92 B;  1P3F B;  4NE3 A;  3LJA A;  5CPJ A;  4XZQ D;  1EQZ D;  3AV2 C;  1KX5 B;  1BH8 A;  3C1C D;  3AZL A;  2NQB D;  2LY8 A;  3W97 D;  1H3O B;  3KXB C;  3REH A;  5B2J A;  3AZN D;  5GT0 C;  1U35 A;  5FUG A;  5AV8 C;  3AYW B;  3AN2 B;  4R8P B;  1P3M C;  4KHA B;  5JRG A;  3AZG A;  3LEL A;  5AVC B;  5B1L A;  3REJ D;  2L5A A;  3KWQ D;  3B0D B;  2ZY3 A;  3X1S C;  1P34 B;  2ARO B;  2BYM B;  5AV6 A;  4XUJ C;  4H9Q A;  3KUY A;  1EQZ B;  2HIO C;  1TZY D;  4ZUX D;  1F66 D;  3W97 B;  2Y2I A;  3AZI D;  5B33 B;  3VH6 A;  2J8P A;  3AZN B;  2F8N D;  5F99 D;  1KX5 A;  4QLC D;  4J8U D;  1KX4 A;  5B31 A;  1H3O A;  4H9O B;  3WKJ D;  3MGQ B;  3WAA D;  4J8X C;  1HQ3 C;  2ZM5 A;  3X1T A;  2FFF B;  4Z66 A;  4R8P A;  2PYO C;  1S32 B;  1Q9C A;  5GSU D;  1KX3 D;  5AVC A;  3AZH B;  5DNM D;  5AV9 C;  3FDD A;  3AFA C;  1P34 A;  1TAF B;  4UUZ A;  2ARO A;  2BYM A;  3VH6 T;  3AV2 D;  5CPK B;  2NZD D;  5G49 B;  2F8N B;  4H9S A;  3KXB D;  3W96 D;  3REL B;  3REI A;  4J8W D;  1ZLA B;  5CHL B;  4JJN D;  3LJA C;  3MNN D;  3AZK B;  5CPJ C;  3X1V B;  2CV5 B;  5C3I C;  3WAA B;  3AZL C;  2Y2H A;  5E5A B;  5GT3 A;  2Y2K A;  2JE5 A;  3REH C;  1ID3 B;  5B2J C;  3X1S D;  1M18 D;  3B6F D;  1U35 C;  4ZBJ C;  2Y2M A;  1P3K A;  3AZG C;  3LEL C;  3KFU G;  5B0Z D;  4H9P A;  5B1L C;  3UT9 A;  3V9R B;  4KUD C;  3F6T A;  5B0Y A;  2IO5 B;  5CP6 B;  3KUY C;  5B2I B;  3MNN B;  5AVB B;  3MVD B;  4DQY B;  4X23 C;  5CPK A;  5G49 A;  5DNN A;  3REL A;  4WJ3 C;  1P3B B;  3B6F B;  1WWS A;  3MGP C;  1HQ3 D;  3LZ1 C;  2Y2L A;  5B40 A;  2PYO D;  2CV5 A;  1KX5 C;  1KX4 C;  1P3O D;  5E5A A;  5B31 C;  2F8N K;  3UTA B;  4YM6 C;  1ID3 A;  3AFA D;  5B32 B;  1R4V A;  4WNN A;  3X1T C;  4R8P C;  4Z66 C;  3W98 D;  3KSY A;  3X1U B;  3MGR B;  3WA9 B;  3V9R A;  1M19 A;  1AOI A;  5JA4 A;  3LJA D;  5AV5 A;  1KU5 A;  2ARO C;  5GXQ B;  2ZY5 A;  3O62 A;  2BG1 A;  5B2I A;  4H9S C;  1P3L D;  5AVB A;  2YFW B;  2VQR A;  3REH D;  5B24 D;  3REI C;  3H0L C;  4G91 C;  3AZG D;  1P3B A;  4CAY A;  3MGS D;  4LD9 D;  4HGA B;  5BT1 C;  5GT3 C;  3IP4 C;  4KUD D;  3W98 B;  2ZY4 A;  1M1A B;  2ZY2 A;  1P3K C;  3KUY D;  3UTA A;  3LZ0 B;  3EG5 B;  5B32 A;  4X23 D;  3UT9 C;  3REK B;  4WU9 C;  1P3L B;  3B6G B;  3TU4 D;  5B0Y C;  3MGR A;  3MGP D;  1W2E A;  4KGC B;  3LZ1 D;  3B0B A;  4WU8 A;  5CPK C;  1KX4 D;  5B31 D;  5DNN C;  3REL C;  4YM6 D;  3A6N D;  5CPI A;  3AZJ B;  1P3A B;  3W99 A;  2RVQ D;  2YFV B;  5B40 C;  3AZE B;  4YS3 B;  3TU4 B;  3C1B B;  1M1A A;  4XZQ B;  5AY8 D;  3LZ0 A;  1P3I C;  3C1C B;  1JFI B;  3REI D;  2BYK A;  2NQB B;  1M19 C;  4NFT A;  1AOI C;  5AV5 C;  3B6G A;  4Z5T A;  2UWX A;  1P3F A;  3O62 C;  5B2I C;  3WTP D;  5BT1 D;  5GT3 D;  3UTB D;  5AVB C;  3B0C W;  2HUE B;  4UPK A;  5KDM B;  3REJ B;  1P3P D;  3KWQ B;  3AV1 D;  2FJ7 D;  2G5I C;  4WU9 D;  3UT9 D;  3AYW A;  3AZJ A;  3AZM D;  3AN2 A;  1P3G D;  4KHA A;  3AZF D;  1TZY B;  2YFV A;  5B32 G;  4ZUX B;  3AZE A;  1F66 B;  4YS3 A;  3UTA C;  3AZI B;  5B1M C;  4J8V C;  5BNX B;  5BO0 B;  1EQZ A;  5F99 B;  5GT0 D;  4QLC B;  4J8U B;  1JFI A;  1PZR A;  5AV8 D;  2NQB A;  1P3P B;  3W97 A;  4EO5 B;  3WKJ B;  1P3M D;  5B33 A;  5B40 D;  2FJ7 B;  3AZN A;  5BS7 A;  4WU8 C;  4AWL C;  3AZF B;  1KX3 B;  5GSU B;  3AL0 C;  3H0R C;  5DNM B;  4XUJ D;  2G5H C;  5CPI C;  3W99 C;  3REJ A;  3KWQ A;  4H9O A;  3MGQ A;  2HIO D;  5JRG C;  1P3I D;  3AV2 B;  2NZD B;  3R45 B;  1T3U A;  1AOI D;  3KXB B;  1S32 A;  5AV5 D;  3W96 B;  3AZH A;  4ZUX A;  5AV6 C;  5GT0 B;  1M1A C;  4J8W B;  1BFM A;  1F66 A;  4JJN B;  3LZ0 C;  3AZI A;  1TAF A;  1P3M B;  5BNX A;  5BO0 A;  3AZN C;  2F8N A;  3B6G C;  4Z5T C;  3X1S B;  1M18 B;  4QLC A;  4J8X D;  4G92 C;  4H9R B;  3AZK A;  1P3F C;  1ZLA A;  3X1V A;  3WAA A;  5B0Z B;  5AV9 D;  4M6B A;  1KX3 A;  4NE6 A;  5B1M D;  5DNM A;  4J8V D;  3AZJ C;  3AYW C;  3A1K A;  3AN2 C;  5AVC C;  3AV2 A;  2NZD A;  3R45 A;  5BNV B;  5CPJ D;  3B0D C;  3KXB A;  3W96 A;  1P34 C;  3AZL D;  5CP6 A;  1HQ3 B;  4J8W A;  4J8X B;  4WU8 D;  4JJN A;  1EQZ C;  3MNN A;  3MVD A;  2PYO B;  5B2J D;  1U35 D;  2NQB C;  1P3O B;  3W97 C;  2F8N H;  5JRG D;  5B33 C;  3AFA B;  3LEL D;  3B6F A;  1M18 A;  5B1L D; 
#chains in the Genus database with same CATH homology
 4H9R A;  3NQJ B;  2HUE C;  5B0Z A;  5AV6 D;  3REJ C;  1B6W A;  3LJA B;  3MGQ C;  4E44 A;  5C3I B;  1BH8 B;  1S32 C;  3A1I A;  4Z5T D;  3WTP E;  4ZUX C;  3X1U A;  3REH B;  3AZH C;  5B24 B;  1U35 B;  2F8N G;  3WA9 A;  5BNV A;  3AZI C;  3AZG B;  1KX5 D;  5GXQ A;  3MGS B;  2DF4 C;  4LD9 B;  2YFW A;  3NQU B;  4NE5 A;  4KUD B;  4QLC C;  4E45 A;  1ZLA C;  3AZK C;  3X1T D;  1P3O A;  3AYW D;  3KUY B;  3AN2 D;  4Z66 D;  3X1V C;  4R8P D;  2CV5 C;  3B0C T;  3WAA C;  5AVC D;  4X23 B;  5E5A C;  1N1J B;  1ID3 C;  3W98 A;  1P34 D;  2ARO D;  5DNM C;  3MGP B;  3LZ1 B;  2NZD C;  1BH9 B;  3REK A;  1KX4 B;  1Z2C B;  2W8S A;  5B31 B;  1P3L A;  3W96 C;  2Y2Q A;  5B33 D;  4YM6 B;  2IO5 C;  5B24 A;  3A6N B;  5CP6 C;  4J8W C;  4KGC A;  4JJN C;  3X1T B;  3MNN C;  3MVD C;  3EPJ A;  4Z66 B;  2CWE A;  3MGS A;  1P3K D;  4LD9 A;  3NQU A;  1A7W A;  4DRA A;  3MGQ D;  4KUD A;  1P3B C;  3B6F C;  4UUZ B;  1M18 C;  1P3A A;  4WZS B;  5AY8 B;  2XD5 A;  1S32 D;  1F1E A;  1ULY A;  5B0Y D;  5B0Z C;  4X23 A;  1B67 A;  3REI B;  3AZH D;  1N1J A;  3TU4 A;  5B32 C;  2Y2P A;  3C1B A;  4G91 B;  5CPK D;  3MGP A;  3EPH A;  4XZQ A;  3WTP B;  3LZ1 A;  5GT3 B;  3UTB B;  5DNN D;  3REL D;  3C1C A;  3X1U C;  2Y2J A;  1BH9 A;  3MGR C;  3WA9 C;  2XD1 A;  1ZLA D;  3AZK D;  1P3K B;  3AV1 B;  3X1V D;  4YM6 A;  2CV5 D;  3VH5 A;  5GXQ C;  3A6N A;  3AZM B;  4H9P B;  3UT9 B;  4WU9 B;  1P3G B;  5E5A D;  1ID3 D;  5KDM A;  5B0Y B;  1P3O C;  2JCH A;  4CSR B;  4HGA C;  1M19 D;  1TZY A;  5AY8 A;  5DNN B;  3W98 C;  5AV8 B;  3O62 D;  5CP6 D;  5B2I D;  3MVD D;  5AVB D;  5B40 B;  3VH5 T;  4H9N B;  3REK C;  5F99 A;  3WTP A;  3UTB A;  1P3L C;  1WWI A;  2JSS A;  1P3B D;  4J8U A;  4XUJ B;  5B24 C;  4WNN B;  1P3P A;  4KGC C;  3WKJ A;  2HIO B;  3AV1 A;  1P3I B;  2FJ7 A;  3VH6 W;  4DRB A;  3AZM A;  4WU9 A;  3MGS C;  4LD9 C;  1P3G A;  1M19 B;  3EPL A;  1AOI B;  2Y2G A;  5JA4 B;  5AV5 B;  3UTA D;  5GSU A;  3AZF A;  2DQN C;  5B32 D;  3EPK A;  1P3A C;  3O62 B;  3VH5 W;  3X1U D;  3MGR D;  3AZE C;  4CSR A;  3WA9 D;  4YS3 C;  3TU4 C;  3C1B C;  5GT0 A;  1HTA A;  4CAY B;  5GXQ D;  5AV8 A;  5B31 G;  4XZQ C;  1P3M A;  3C1C C;  4H9N A;  5AV9 B;  5CPI D;  3W99 D;  2RIQ A;  3X1S A;  5BS7 C;  5B1M B;  4XUJ A;  3A6N C;  4J8V B;  2HIO A;  2RVQ C;  2Y2N A;  1P3I A;  1M1A D;  3KWQ C;  4WV4 B;  5CPJ B;  3LZ0 D;  2Y2O A;  3AZL B;  4WU8 B;  3REK D;  4AWL B;  1TZY C;  5AY8 C;  3B6G D;  5B2J B;  4Z2M H;  4ZBJ B;  5FUG B;  5CPI B;  1P3F D;  1F66 C;  3W99 B;  4KGC D;  5JRG B;  3LEL B;  5B1L B;  1HQ3 A;  4J8X A;  3H0M C;  3P5J B;  5F99 C;  3WTP C;  3UTB C;  2PYO A;  5AV6 B;  4J8U C;  5AV9 A;  3AZJ D;  1P3A D;  4H9Q B;  1P3P C;  4EO5 C;  2F2A C;  3WKJ C;  3AV1 C;  3AFA A;  2FJ7 C;  5B1M A;  4J8V A;  3NQJ A;  3AZM C;  3AZE D;  2BYK B;  1P3G C;  4YS3 D;  3AZF C;  4Z2M G;  1KX3 C;  5GSU C;  4Z5T B;  3C1B D;  4G92 B;  1P3F B;  4NE3 A;  3LJA A;  5CPJ A;  4XZQ D;  1EQZ D;  3AV2 C;  1KX5 B;  1BH8 A;  3C1C D;  3AZL A;  2NQB D;  2LY8 A;  3W97 D;  1H3O B;  3KXB C;  3REH A;  5B2J A;  3AZN D;  5GT0 C;  1U35 A;  5FUG A;  5AV8 C;  3AYW B;  3AN2 B;  4R8P B;  1P3M C;  4KHA B;  5JRG A;  3AZG A;  3LEL A;  5AVC B;  5B1L A;  3REJ D;  2L5A A;  3KWQ D;  3B0D B;  2ZY3 A;  3X1S C;  1P34 B;  2ARO B;  2BYM B;  5AV6 A;  4XUJ C;  4H9Q A;  3KUY A;  1EQZ B;  2HIO C;  1TZY D;  4ZUX D;  1F66 D;  3W97 B;  2Y2I A;  3AZI D;  5B33 B;  3VH6 A;  2J8P A;  3AZN B;  2F8N D;  5F99 D;  1KX5 A;  4QLC D;  4J8U D;  1KX4 A;  5B31 A;  1H3O A;  4H9O B;  3WKJ D;  3MGQ B;  3WAA D;  4J8X C;  1HQ3 C;  2ZM5 A;  3X1T A;  2FFF B;  4Z66 A;  4R8P A;  2PYO C;  1S32 B;  1Q9C A;  5GSU D;  1KX3 D;  5AVC A;  3AZH B;  5DNM D;  5AV9 C;  3FDD A;  3AFA C;  1P34 A;  1TAF B;  4UUZ A;  2ARO A;  2BYM A;  3VH6 T;  3AV2 D;  5CPK B;  2NZD D;  5G49 B;  2F8N B;  4H9S A;  3KXB D;  3W96 D;  3REL B;  3REI A;  4J8W D;  1ZLA B;  5CHL B;  4JJN D;  3LJA C;  3MNN D;  3AZK B;  5CPJ C;  3X1V B;  2CV5 B;  5C3I C;  3WAA B;  3AZL C;  2Y2H A;  5E5A B;  5GT3 A;  2Y2K A;  2JE5 A;  3REH C;  1ID3 B;  5B2J C;  3X1S D;  1M18 D;  3B6F D;  1U35 C;  4ZBJ C;  2Y2M A;  1P3K A;  3AZG C;  3LEL C;  3KFU G;  5B0Z D;  4H9P A;  5B1L C;  3UT9 A;  3V9R B;  4KUD C;  3F6T A;  5B0Y A;  2IO5 B;  5CP6 B;  3KUY C;  5B2I B;  3MNN B;  5AVB B;  3MVD B;  4DQY B;  4X23 C;  5CPK A;  5G49 A;  5DNN A;  3REL A;  4WJ3 C;  1P3B B;  3B6F B;  1WWS A;  3MGP C;  1HQ3 D;  3LZ1 C;  2Y2L A;  5B40 A;  2PYO D;  2CV5 A;  1KX5 C;  1KX4 C;  1P3O D;  5E5A A;  5B31 C;  2F8N K;  3UTA B;  4YM6 C;  1ID3 A;  3AFA D;  5B32 B;  1R4V A;  4WNN A;  3X1T C;  4R8P C;  4Z66 C;  3W98 D;  3KSY A;  3X1U B;  3MGR B;  3WA9 B;  3V9R A;  1M19 A;  1AOI A;  5JA4 A;  3LJA D;  5AV5 A;  1KU5 A;  2ARO C;  5GXQ B;  2ZY5 A;  3O62 A;  2BG1 A;  5B2I A;  4H9S C;  1P3L D;  5AVB A;  2YFW B;  2VQR A;  3REH D;  5B24 D;  3REI C;  3H0L C;  4G91 C;  3AZG D;  1P3B A;  4CAY A;  3MGS D;  4LD9 D;  4HGA B;  5BT1 C;  5GT3 C;  3IP4 C;  4KUD D;  3W98 B;  2ZY4 A;  1M1A B;  2ZY2 A;  1P3K C;  3KUY D;  3UTA A;  3LZ0 B;  3EG5 B;  5B32 A;  4X23 D;  3UT9 C;  3REK B;  4WU9 C;  1P3L B;  3B6G B;  3TU4 D;  5B0Y C;  3MGR A;  3MGP D;  1W2E A;  4KGC B;  3LZ1 D;  3B0B A;  4WU8 A;  5CPK C;  1KX4 D;  5B31 D;  5DNN C;  3REL C;  4YM6 D;  3A6N D;  5CPI A;  3AZJ B;  1P3A B;  3W99 A;  2RVQ D;  2YFV B;  5B40 C;  3AZE B;  4YS3 B;  3TU4 B;  3C1B B;  1M1A A;  4XZQ B;  5AY8 D;  3LZ0 A;  1P3I C;  3C1C B;  1JFI B;  3REI D;  2BYK A;  2NQB B;  1M19 C;  4NFT A;  1AOI C;  5AV5 C;  3B6G A;  4Z5T A;  2UWX A;  1P3F A;  3O62 C;  5B2I C;  3WTP D;  5BT1 D;  5GT3 D;  3UTB D;  5AVB C;  3B0C W;  2HUE B;  4UPK A;  5KDM B;  3REJ B;  1P3P D;  3KWQ B;  3AV1 D;  2FJ7 D;  2G5I C;  4WU9 D;  3UT9 D;  3AYW A;  3AZJ A;  3AZM D;  3AN2 A;  1P3G D;  4KHA A;  3AZF D;  1TZY B;  2YFV A;  5B32 G;  4ZUX B;  3AZE A;  1F66 B;  4YS3 A;  3UTA C;  3AZI B;  5B1M C;  4J8V C;  5BNX B;  5BO0 B;  1EQZ A;  5F99 B;  5GT0 D;  4QLC B;  4J8U B;  1JFI A;  1PZR A;  5AV8 D;  2NQB A;  1P3P B;  3W97 A;  4EO5 B;  3WKJ B;  1P3M D;  5B33 A;  5B40 D;  2FJ7 B;  3AZN A;  5BS7 A;  4WU8 C;  4AWL C;  3AZF B;  1KX3 B;  5GSU B;  3AL0 C;  3H0R C;  5DNM B;  4XUJ D;  2G5H C;  5CPI C;  3W99 C;  3REJ A;  3KWQ A;  4H9O A;  3MGQ A;  2HIO D;  5JRG C;  1P3I D;  3AV2 B;  2NZD B;  3R45 B;  1T3U A;  1AOI D;  3KXB B;  1S32 A;  5AV5 D;  3W96 B;  3AZH A;  4ZUX A;  5AV6 C;  5GT0 B;  1M1A C;  4J8W B;  1BFM A;  1F66 A;  4JJN B;  3LZ0 C;  3AZI A;  1TAF A;  1P3M B;  5BNX A;  5BO0 A;  3AZN C;  2F8N A;  3B6G C;  4Z5T C;  3X1S B;  1M18 B;  4QLC A;  4J8X D;  4G92 C;  4H9R B;  3AZK A;  1P3F C;  1ZLA A;  3X1V A;  3WAA A;  5B0Z B;  5AV9 D;  4M6B A;  1KX3 A;  4NE6 A;  5B1M D;  5DNM A;  4J8V D;  3AZJ C;  3AYW C;  3A1K A;  3AN2 C;  5AVC C;  3AV2 A;  2NZD A;  3R45 A;  5BNV B;  5CPJ D;  3B0D C;  3KXB A;  3W96 A;  1P34 C;  3AZL D;  5CP6 A;  1HQ3 B;  4J8W A;  4J8X B;  4WU8 D;  4JJN A;  1EQZ C;  3MNN A;  3MVD A;  2PYO B;  5B2J D;  1U35 D;  2NQB C;  1P3O B;  3W97 C;  2F8N H;  5JRG D;  5B33 C;  3AFA B;  3LEL D;  3B6F A;  1M18 A;  5B1L D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...