3UTBC

Crystal structure of nucleosome core particle assembled with the 146b alpha-satellite sequence (ncp146b)
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
103
structure length
103
Chain Sequence
TRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.2
publication title The mechanics behind DNA sequence-dependent properties of the nucleosome
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Structural protein/dna
total genus 31
structure length 103
sequence length 103
chains with identical sequence G
ec nomenclature
pdb deposition date 2011-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3utbC00
5BNVB 5GSUA 5B33A 1P3FD 3VH6T 1P3PA 2FJ7A 5GXQB 3AYWD 1TZYA 1ID3B 1F66A 3LJAC 3W99B 3AZEC 1BH9A 3A6NB 3LELC 3AZMC 5AV6B 5CPKB 3AN2D 1ZLAD 4G91C 3REKA 1BFMA 5CP6C 1U35B 3AV1C 3WKJA 3KUYC 3NQJA 3W97C 2RVQC 2YFWA 4XZQC 5BNXB 5AV5C 3MGQC 4YS3A 3VH5T 3X1SA 5B0YA 3W96B 3LJAB 3B0CW 5GT0D 3UTAD 3MVDB 3AZEB 5CPID 1M19A 3LELB 4G91B 5AV8A 5CP6B 3MGRD 1TAFA 4NE5A 3WTPC 3X1TC 1P34D 5DNMD 4YM6B 5AV9A 4XUJD 1EQZA 3W97B 5AV5B 3MGQB 3W98C 4AWLC 4H9QB 5DNNB 3AZFA 1M1AC 5AVBB 4CAYB 4J8VB 2F8NG 3MGRC 4J8WD 4LD9D 3V9RB 3KXBC 1S32A 3WTPB 5F99C 3C1CD 3X1TB 3AFAC 2JSSA 1P3LD 5BNVA 5FUGB 5B24C 1M18C 5AY8D 2F8NK 3W98B 5B40D 5GXQA 4WU8D 4HGAC 5B2IC 1ID3A 3W99A 3MGSB 3WA9C 3A6NA 4Z5TD 1P3IC 4R8PD 5AV6A 3B0DC 5CPKA 4J8WC 5B31C 3KXBB 4J8UC 5F99B 1P3PD 1P3LC 2FJ7D 1U35A 3AFAB 3LZ1D 4KGCD 1B67A 1P3BD 1P3OD 4Z66D 3AZHD 4WU8C 1F66D 5BNXA 3RELC 5GT3C 3W96A 5B2IB 4H9SA 1HTAA 5JRGC 3LJAA 3UT9B 3MVDA 3AZEA 3LELA 3B0DB 4KUDC 2NZDD 4QLCB 3NQUB 5B31B 3X1VC 5B0ZC 3UTBC 4DRAA 5CP6A 3AZGC 2PYOD 4YS3D 1HQ3B 4YM6A 1KX3C 3X1SD 3W97A 1P3GC 5AV5A 4Z2MH 3MGQA 1M19D 4H9QA 5B1LB 5JRGB 5DNNA 4WU9D 3AZLB 1AOIC 1P3AB 5AVBA 3TU4C 3LZ0D 3KWQD 3REJB 4CAYA 4M6BA 4ZUXB 4J8VA 1H3OB 2L5AA 3V9RA 5AV9D 3AZGB 3WTPA 3X1TA 1KX5C 3WAAC 3AV2C 1KX3B 5B32C 5FUGA 3R45B 3W98A 1AOIB 5B1MC 3O62B 4Z2MG 3MGSA 3REHC 3TU4B 1S32D 2F8ND 3AZJC 3VH6W 3MNNC 5F99A 1ULYA 5BT1D 3AV2B 5CPJD 3AFAA 5B32B 1KX4C 5E5AC 3AZNB 1ID3D 3W99D 3C1BA 1P3KB 4WV4B 3A6ND 5B1MB 5B2IA 3UT9A 3B6GB 5AV6D 5CPKD 2CV5D 2NQBD 3AZJB 4QLCA 1U35D 3NQUA 3MNNB 3MGPC 5B31A 4E45A 3AZKB 3B6FC 4J8XC 3VH5W 1P3MD 3REID 1KX4B 5AVCC 1HQ3A 5E5AB 5B2JD 3MVDD 5B1LA 5JRGA 3AZLA 1P3FC 1P3AA 3AYWC 3REJA 4ZUXA 1H3OA 4YM6D 1P3MC 3AZGA 4J8XB 4JJND 3B6FB 1WWIA 3AN2C 1ZLAC 3AZMB 3AZID 4DRBA 1KX3A 5B2JC 3R45A 5DNND 4KHAB 2HIOD 5AVBD 2HUEC 1AOIA 3O62A 3AV1B 1P3FB 4J8VD 3KUYB 4H9PB 3TU4A 3AYWB 4EO5C 4XZQB 3X1UD 5GT0C 3UTAC 5CPIC 4CSRB 3AV2A 3AN2B 5B32A 5JA4B 3AZNA 1N1JB 3MGSD 1P3KA 2HUEB 1P34C 5B1MA 5DNMC 4XUJC 3B6GA 2YFVB 4EO5B 3AZJA 4AWLB 3MNNA 3AZKA 2AROD 1M1AB 3C1BD 4X23D 1KX4A 5E5AA 4LD9C 3UT9D 3MGRB 5GSUD 3C1CC 1P34B 5B33D 5DNMB 5AY8C 4QLCD 5B24B 1M18B 1TZYD 5B40C 3WTPE 4HGAB 1HQ3D 1JFIB 4Z5TC 3WA9B 3B6FA 4J8XA 2BYKB 4R8PC 1P3IB 3AZMA 3REKD 4J8WB 4WNNB 5B1LD 3AZLD 4KHAA 1P3PC 2FJ7C 4J8UB 4ZBJC 3LZ1C 1WWSA 1P3AD 1P3LB 3WKJD 4KGCC 3AV1A 1P3BC 1P3OC 4Z66C 5AY8B 3REJD 3AZHC 1P3FA 4ZUXD 3KUYA 1F66C 4H9PA 5B0YD 4WU8B 3AYWA 4UUZB 4XZQA 3RELB 5GT3B 4R8PB 4CSRA 2NZDC 3AN2A 4KUDB 5AV8D 5JA4A 3O62D 3X1VB 1N1JA 4ZBJB 5B0ZB 3LZ1B 3UTBB 2PYOC 4KGCB 1EQZD 4YS3C 1P3BB 1P3OB 4Z66B 3AZHB 3X1SC 2YFVA 1P3GB 1M19C 3AZFD 4WU9C 2IO5C 3LZ0C 1M1AA 3KWQC 3AZND 2NZDB 4H9RB 1P3KD 3B0BA 5AV9C 3MGRA 2PYOB 3B6GD 3KXBA 5CHLB 1P34A 4G92C 5DNMA 4WZSB 4H9OB 1KX5B 3WAAB 5GXQD 5B24A 1M18A 5BO0B 3AZKD 4WU9B 2IO5B 1JFIA 3LZ0B 3WA9A 3KWQB 3REHB 2BYKA 1S32C 1P3IA 5B31G 1KU5A 4J8WA 4WNNA 4E44A 5BT1C 4J8UA 3VH6A 5CPJC 1P3LA 5AY8A 1ID3C 3W99C 3W96D 4WU8A 3LJAD 4UUZA 3A6NC 3RELA 3AZED 5GT3A 5AV6C 5CPKC 3LELD 1B6WA 3AZMD 2CV5C 2NQBC 4R8PA 2F8NB 1U35C 4KUDA 5CP6D 1Q9CA 3MGPB 3AV1D 3X1VA 5B0ZA 5CPJB 3LZ1A 3UTBA 3KUYD 4KGCA 3REIC 3W97D 2RVQD 1P3BA 4XZQD 4Z66A 3AZHA 5AVCB 5AV5D 3W96C 3VH5A 4H9SC 3MGQD 1P3OA 3MVDC 1P3GA 2CV5B 2NQBB 2NZDA 2BYMB 4H9RA 3WTPD 3X1TD 4YM6C 2PYOA 4JJNC 1P3MB 3REIB 5B32G 1KX5A 3AZIC 4H9OA 3WAAA 1ZLAB 3W98D 5DNNC 5B2JB 5BO0A 2HIOC 5AVBC 4WU9A 1M1AD 2F8NH 4J8VC 5BS7C 3LZ0A 3KWQA 3REHA 3X1UC 3KXBD 5F99D 5GT0B 3AFAD 3UTAB 5CPIB 4JJNB 5B24D 3B0CT 1M18D 3AZIB 3MGSC 2HIOB 5B2ID 3WA9D 1P3ID 4NE3A 4XUJB 2F8NA 5B31D 3X1UB 4J8UD 4H9NB 3MGPA 4NE6A 2AROC 5CPJA 3C1BC 4X23C 5AVCA 3RELD 3UT9C 5GT3D 4LD9B 5GSUC 5JRGD 3C1CB 5B33C 5KDMB 4QLCC 2CV5A 4KUDD 1TZYC 2NQBA 5B40B 3X1VD 2BYMA 5B0ZD 3UTBD 3AZGD 5G49B 1BH8B 1HQ3C 2AROB 1P3MA 1KX3D 4Z5TB 3C1BB 3REIA 1R4VA 4X23B 1P3GD 3KSYA 3REKC 1ZLAA 5B1LC 3AZLC 5B2JA 1F1EA 5GSUB 1AOID 1P3AC 5B33B 1P3PB 2FJ7B 3WKJC 3TU4D 3REJC 5C3IC 4ZUXC 1TZYB 5B0YC 1F66B 1BH9B 1KX5D 3WAAD 5GT0A 3AV2D 3UTAA 5CPIA 4JJNA 5B32D 3AZIA 3REKB 5AV8C 2CWEA 3O62C 5B1MD 2HIOA 3WKJB 3NQJB 4NFTA 1EQZC 3REHD 2YFWB 4YS3B 2LY8A 5C3IB 4XUJA 3X1SB 5BS7A 5B0YB 3AZJD 3MNND 3AZFC 1M19B 3X1UA 4H9NA 1KX4D 3AZNC 5E5AD 1P3KC 5AV8B 1TAFB 3B6GC 4LD9A 5AV9B 1EQZB 3C1CA 5KDMA 4G92B 5GXQC 1A7WA 3MGPD 3AZKC 5B40A 3AZFB 3B6FD 4J8XD 5G49A 1BH8A 2AROA 5AVCD 4Z5TA 4X23A 1S32B
chains in the Genus database with same CATH superfamily
1W2EA 2F2AC 5BNVB 5GSUA 5B33A 1P3FD 3VH6T 1P3PA 2FJ7A 5GXQB 3AYWD 1TZYA 1ID3B 1F66A 3LJAC 3W99B 2Y2QA 3AZEC 1BH9A 3A6NB 2Y2NA 3LELC 3AZMC 5AV6B 5CPKB 3AN2D 1ZLAD 4G91C 3REKA 1BFMA 3H0MC 5CP6C 1U35B 3AV1C 3WKJA 3KUYC 3NQJA 3W97C 2RVQC 2YFWA 4XZQC 2W8SA 5BNXB 5AV5C 3MGQC 4YS3A 3VH5T 3X1SA 5B0YA 3W96B 3LJAB 3B0CW 5GT0D 3UTAD 3MVDB 3EG5B 3AZEB 5CPID 1M19A 3LELB 4G91B 2G5HC 5AV8A 5CP6B 3MGRD 1TAFA 4NE5A 3WTPC 3X1TC 1P34D 5DNMD 4YM6B 5AV9A 4XUJD 1EQZA 3W97B 5AV5B 3MGQB 3W98C 4AWLC 4H9QB 5DNNB 3AZFA 1M1AC 5AVBB 4CAYB 4J8VB 2F8NG 2ZM5A 3MGRC 4J8WD 4LD9D 3V9RB 3KXBC 1S32A 3WTPB 5F99C 3C1CD 3X1TB 3AFAC 2JSSA 1P3LD 5BNVA 5FUGB 5B24C 1M18C 5AY8D 2F8NK 3W98B 5B40D 5GXQA 4WU8D 4HGAC 5B2IC 1ID3A 3W99A 3MGSB 3WA9C 3FDDA 2ZY3A 4Z5TD 2ZY4A 3A6NA 1P3IC 4R8PD 5AV6A 3B0DC 5CPKA 4J8WC 3KFUG 5B31C 3KXBB 4J8UC 5F99B 1P3PD 1P3LC 2FJ7D 1U35A 3AFAB 3LZ1D 4KGCD 1B67A 1P3BD 1P3OD 4Z66D 3AZHD 4WU8C 1F66D 5BNXA 3EPKA 3RELC 5GT3C 3W96A 5B2IB 4H9SA 1HTAA 5JRGC 3LJAA 3UT9B 3MVDA 3AZEA 2Y2IA 3LELA 3B0DB 4KUDC 2NZDD 4QLCB 3NQUB 5B31B 3X1VC 5B0ZC 3UTBC 4DRAA 5CP6A 3AZGC 2PYOD 2XD5A 4YS3D 1HQ3B 4YM6A 1KX3C 3X1SD 3W97A 1P3GC 5AV5A 4Z2MH 2ZY5A 3MGQA 1M19D 4H9QA 5B1LB 5JRGB 5DNNA 4WU9D 3AZLB 1AOIC 1P3AB 2Y2LA 5AVBA 3TU4C 3LZ0D 3KWQD 3REJB 4CAYA 4M6BA 4ZUXB 4J8VA 1H3OB 2L5AA 3V9RA 2RIQA 5AV9D 3AZGB 3WTPA 3X1TA 1KX5C 3WAAC 3AV2C 1KX3B 5B32C 5FUGA 3R45B 3W98A 1AOIB 5B1MC 3O62B 4Z2MG 3MGSA 3REHC 3TU4B 2XD1A 3A1IA 1S32D 2F8ND 3AZJC 3VH6W 3MNNC 5F99A 1ULYA 5BT1D 3AV2B 5CPJD 3AFAA 5B32B 1KX4C 2FFFB 5E5AC 3AZNB 1ID3D 3W99D 3C1BA 1P3KB 4WV4B 3A6ND 5B1MB 3AL0C 5B2IA 3UT9A 3B6GB 2DQNC 5AV6D 5CPKD 2CV5D 2NQBD 3AZJB 4QLCA 1U35D 3NQUA 3MNNB 3MGPC 5B31A 4E45A 3AZKB 1Z2CB 3B6FC 4J8XC 3VH5W 1P3MD 3REID 1KX4B 5AVCC 1HQ3A 4WJ3C 5E5AB 5B2JD 3MVDD 2DF4C 5B1LA 5JRGA 3AZLA 2UWXA 1P3FC 1P3AA 3AYWC 3REJA 4ZUXA 1H3OA 4YM6D 1P3MC 3AZGA 4J8XB 4JJND 3B6FB 1WWIA 3AN2C 1ZLAC 3AZMB 3AZID 4DRBA 1KX3A 5B2JC 3R45A 5DNND 4KHAB 2HIOD 5AVBD 2HUEC 1AOIA 3O62A 3AV1B 1P3FB 4J8VD 3KUYB 4H9PB 3TU4A 3AYWB 4EO5C 4XZQB 3X1UD 5GT0C 3UTAC 5CPIC 3H0RC 2Y2PA 3H0LC 4CSRB 3AV2A 3AN2B 5B32A 5JA4B 3AZNA 1N1JB 3MGSD 1P3KA 2HUEB 1P34C 5B1MA 5DNMC 4XUJC 3B6GA 2YFVB 3F6TA 4EO5B 3AZJA 4AWLB 3MNNA 3AZKA 2AROD 1M1AB 3C1BD 4X23D 1KX4A 5E5AA 4LD9C 3UT9D 3MGRB 5GSUD 3C1CC 1P34B 5B33D 5DNMB 2G5IC 5AY8C 4QLCD 5B24B 1M18B 1TZYD 5B40C 3WTPE 4HGAB 2Y2MA 1HQ3D 1JFIB 4Z5TC 3WA9B 3B6FA 4J8XA 2BYKB 4R8PC 1P3IB 3AZMA 3REKD 4J8WB 2Y2HA 4WNNB 5B1LD 3AZLD 4KHAA 1P3PC 2FJ7C 4J8UB 4ZBJC 3LZ1C 1WWSA 1P3AD 1P3LB 3WKJD 4KGCC 3A1KA 3AV1A 1P3BC 1P3OC 4Z66C 5AY8B 3REJD 3AZHC 1P3FA 4ZUXD 3KUYA 1F66C 4H9PA 5B0YD 4WU8B 3AYWA 3EPHA 4UUZB 4XZQA 3RELB 5GT3B 4R8PB 4CSRA 2NZDC 3AN2A 4KUDB 5AV8D 5JA4A 3O62D 3X1VB 1N1JA 4ZBJB 5B0ZB 3LZ1B 3UTBB 2PYOC 4KGCB 1EQZD 4YS3C 1P3BB 1P3OB 4Z66B 3AZHB 3X1SC 2YFVA 2J8PA 1P3GB 1M19C 3AZFD 4WU9C 2IO5C 2Y2KA 3LZ0C 1M1AA 3KWQC 3AZND 2NZDB 4H9RB 1P3KD 3B0BA 5AV9C 3MGRA 2Y2GA 2PYOB 3B6GD 3KXBA 5CHLB 1P34A 4G92C 5DNMA 4WZSB 4H9OB 1KX5B 3WAAB 5GXQD 5B24A 1M18A 5BO0B 3AZKD 4WU9B 2IO5B 1JFIA 3LZ0B 3WA9A 3KWQB 3REHB 3P5JB 2BYKA 1S32C 1P3IA 5B31G 1KU5A 4J8WA 4WNNA 4E44A 5BT1C 4J8UA 3VH6A 5CPJC 1P3LA 2VQRA 5AY8A 1ID3C 3W99C 3W96D 4WU8A 3LJAD 4UUZA 3A6NC 3RELA 3AZED 5GT3A 5AV6C 5CPKC 3LELD 1B6WA 3AZMD 2CV5C 2NQBC 2JCHA 4R8PA 2F8NB 1U35C 4KUDA 5CP6D 1Q9CA 4UPKA 3MGPB 3AV1D 3X1VA 5B0ZA 5CPJB 3LZ1A 3UTBA 3KUYD 4KGCA 3REIC 3W97D 2RVQD 1P3BA 4XZQD 4Z66A 3AZHA 5AVCB 5AV5D 3W96C 3VH5A 4H9SC 3MGQD 1P3OA 3MVDC 1P3GA 2CV5B 4DQYB 2NQBB 2JE5A 2NZDA 2BYMB 4H9RA 3WTPD 3X1TD 4YM6C 3IP4C 2PYOA 4JJNC 1P3MB 3REIB 5B32G 1KX5A 3AZIC 4H9OA 3WAAA 1ZLAB 3W98D 5DNNC 5B2JB 2BG1A 5BO0A 2HIOC 5AVBC 4WU9A 1M1AD 2F8NH 4J8VC 5BS7C 3LZ0A 3KWQA 3REHA 3X1UC 3KXBD 5F99D 1T3UA 5GT0B 3AFAD 3UTAB 5CPIB 3EPLA 4JJNB 5B24D 3B0CT 1M18D 3AZIB 3EPJA 3MGSC 2HIOB 5B2ID 3WA9D 1P3ID 4NE3A 4XUJB 2F8NA 5B31D 3X1UB 4J8UD 4H9NB 3MGPA 4NE6A 2AROC 5CPJA 3C1BC 2Y2JA 4X23C 5AVCA 3RELD 3UT9C 5GT3D 4LD9B 5GSUC 5JRGD 3C1CB 5B33C 5KDMB 4QLCC 2CV5A 2Y2OA 4KUDD 1TZYC 2NQBA 5B40B 3X1VD 2BYMA 5B0ZD 3UTBD 3AZGD 5G49B 1BH8B 1HQ3C 2AROB 1P3MA 1KX3D 4Z5TB 3C1BB 3REIA 1R4VA 4X23B 1P3GD 3KSYA 3REKC 2ZY2A 1ZLAA 5B1LC 3AZLC 5B2JA 1F1EA 5GSUB 1AOID 1P3AC 5B33B 1P3PB 2FJ7B 3WKJC 3TU4D 3REJC 5C3IC 4ZUXC 1TZYB 5B0YC 1F66B 1BH9B 1KX5D 3WAAD 5GT0A 3AV2D 3UTAA 5CPIA 4JJNA 5B32D 3AZIA 3REKB 5AV8C 2CWEA 3O62C 5B1MD 2HIOA 3WKJB 3NQJB 4NFTA 1EQZC 3REHD 2YFWB 4YS3B 2LY8A 5C3IB 4XUJA 3X1SB 5BS7A 5B0YB 3AZJD 3MNND 3AZFC 1M19B 3X1UA 4H9NA 1KX4D 3AZNC 5E5AD 1PZRA 1P3KC 5AV8B 1TAFB 3B6GC 4LD9A 5AV9B 1EQZB 3C1CA 5KDMA 4G92B 5GXQC 1A7WA 3MGPD 3AZKC 5B40A 3AZFB 3B6FD 4J8XD 5G49A 1BH8A 2AROA 5AVCD 4Z5TA 4X23A 1S32B
chains in the Genus database with same CATH topology
1W2EA 2F2AC 5BNVB 5GSUA 5B33A 1P3FD 3VH6T 1P3PA 2FJ7A 5GXQB 3AYWD 1TZYA 1ID3B 1F66A 3LJAC 3W99B 2Y2QA 3AZEC 1BH9A 3A6NB 2Y2NA 3LELC 3AZMC 5AV6B 5CPKB 3AN2D 1ZLAD 4G91C 3REKA 1BFMA 3H0MC 5CP6C 1U35B 3AV1C 3WKJA 3KUYC 3NQJA 3W97C 2RVQC 2YFWA 4XZQC 2W8SA 5BNXB 5AV5C 3MGQC 4YS3A 3VH5T 3X1SA 5B0YA 3W96B 3LJAB 3B0CW 5GT0D 3UTAD 3MVDB 3EG5B 3AZEB 5CPID 1M19A 3LELB 4G91B 2G5HC 5AV8A 5CP6B 3MGRD 1TAFA 4NE5A 3WTPC 3X1TC 1P34D 5DNMD 4YM6B 5AV9A 4XUJD 1EQZA 3W97B 5AV5B 3MGQB 3W98C 4AWLC 4H9QB 5DNNB 3AZFA 1M1AC 5AVBB 4CAYB 4J8VB 2F8NG 2ZM5A 3MGRC 4J8WD 4LD9D 3V9RB 3KXBC 1S32A 3WTPB 5F99C 3C1CD 3X1TB 3AFAC 2JSSA 1P3LD 5BNVA 5FUGB 5B24C 1M18C 5AY8D 2F8NK 3W98B 5B40D 5GXQA 4WU8D 4HGAC 5B2IC 1ID3A 3W99A 3MGSB 3WA9C 3FDDA 2ZY3A 4Z5TD 2ZY4A 3A6NA 1P3IC 4R8PD 5AV6A 3B0DC 5CPKA 4J8WC 3KFUG 5B31C 3KXBB 4J8UC 5F99B 1P3PD 1P3LC 2FJ7D 1U35A 3AFAB 3LZ1D 4KGCD 1B67A 1P3BD 1P3OD 4Z66D 3AZHD 4WU8C 1F66D 5BNXA 3EPKA 3RELC 5GT3C 3W96A 5B2IB 4H9SA 1HTAA 5JRGC 3LJAA 3UT9B 3MVDA 3AZEA 2Y2IA 3LELA 3B0DB 4KUDC 2NZDD 4QLCB 3NQUB 5B31B 3X1VC 5B0ZC 3UTBC 4DRAA 5CP6A 3AZGC 2PYOD 2XD5A 4YS3D 1HQ3B 4YM6A 1KX3C 3X1SD 3W97A 1P3GC 5AV5A 4Z2MH 2ZY5A 3MGQA 1M19D 4H9QA 5B1LB 5JRGB 5DNNA 4WU9D 3AZLB 1AOIC 1P3AB 2Y2LA 5AVBA 3TU4C 3LZ0D 3KWQD 3REJB 4CAYA 4M6BA 4ZUXB 4J8VA 1H3OB 2L5AA 3V9RA 2RIQA 5AV9D 3AZGB 3WTPA 3X1TA 1KX5C 3WAAC 3AV2C 1KX3B 5B32C 5FUGA 3R45B 3W98A 1AOIB 5B1MC 3O62B 4Z2MG 3MGSA 3REHC 3TU4B 2XD1A 3A1IA 1S32D 2F8ND 3AZJC 3VH6W 3MNNC 5F99A 1ULYA 5BT1D 3AV2B 5CPJD 3AFAA 5B32B 1KX4C 2FFFB 5E5AC 3AZNB 1ID3D 3W99D 3C1BA 1P3KB 4WV4B 3A6ND 5B1MB 3AL0C 5B2IA 3UT9A 3B6GB 2DQNC 5AV6D 5CPKD 2CV5D 2NQBD 3AZJB 4QLCA 1U35D 3NQUA 3MNNB 3MGPC 5B31A 4E45A 3AZKB 1Z2CB 3B6FC 4J8XC 3VH5W 1P3MD 3REID 1KX4B 5AVCC 1HQ3A 4WJ3C 5E5AB 5B2JD 3MVDD 2DF4C 5B1LA 5JRGA 3AZLA 2UWXA 1P3FC 1P3AA 3AYWC 3REJA 4ZUXA 1H3OA 4YM6D 1P3MC 3AZGA 4J8XB 4JJND 3B6FB 1WWIA 3AN2C 1ZLAC 3AZMB 3AZID 4DRBA 1KX3A 5B2JC 3R45A 5DNND 4KHAB 2HIOD 5AVBD 2HUEC 1AOIA 3O62A 3AV1B 1P3FB 4J8VD 3KUYB 4H9PB 3TU4A 3AYWB 4EO5C 4XZQB 3X1UD 5GT0C 3UTAC 5CPIC 3H0RC 2Y2PA 3H0LC 4CSRB 3AV2A 3AN2B 5B32A 5JA4B 3AZNA 1N1JB 3MGSD 1P3KA 2HUEB 1P34C 5B1MA 5DNMC 4XUJC 3B6GA 2YFVB 3F6TA 4EO5B 3AZJA 4AWLB 3MNNA 3AZKA 2AROD 1M1AB 3C1BD 4X23D 1KX4A 5E5AA 4LD9C 3UT9D 3MGRB 5GSUD 3C1CC 1P34B 5B33D 5DNMB 2G5IC 5AY8C 4QLCD 5B24B 1M18B 1TZYD 5B40C 3WTPE 4HGAB 2Y2MA 1HQ3D 1JFIB 4Z5TC 3WA9B 3B6FA 4J8XA 2BYKB 4R8PC 1P3IB 3AZMA 3REKD 4J8WB 2Y2HA 4WNNB 5B1LD 3AZLD 4KHAA 1P3PC 2FJ7C 4J8UB 4ZBJC 3LZ1C 1WWSA 1P3AD 1P3LB 3WKJD 4KGCC 3A1KA 3AV1A 1P3BC 1P3OC 4Z66C 5AY8B 3REJD 3AZHC 1P3FA 4ZUXD 3KUYA 1F66C 4H9PA 5B0YD 4WU8B 3AYWA 3EPHA 4UUZB 4XZQA 3RELB 5GT3B 4R8PB 4CSRA 2NZDC 3AN2A 4KUDB 5AV8D 5JA4A 3O62D 3X1VB 1N1JA 4ZBJB 5B0ZB 3LZ1B 3UTBB 2PYOC 4KGCB 1EQZD 4YS3C 1P3BB 1P3OB 4Z66B 3AZHB 3X1SC 2YFVA 2J8PA 1P3GB 1M19C 3AZFD 4WU9C 2IO5C 2Y2KA 3LZ0C 1M1AA 3KWQC 3AZND 2NZDB 4H9RB 1P3KD 3B0BA 5AV9C 3MGRA 2Y2GA 2PYOB 3B6GD 3KXBA 5CHLB 1P34A 4G92C 5DNMA 4WZSB 4H9OB 1KX5B 3WAAB 5GXQD 5B24A 1M18A 5BO0B 3AZKD 4WU9B 2IO5B 1JFIA 3LZ0B 3WA9A 3KWQB 3REHB 3P5JB 2BYKA 1S32C 1P3IA 5B31G 1KU5A 4J8WA 4WNNA 4E44A 5BT1C 4J8UA 3VH6A 5CPJC 1P3LA 2VQRA 5AY8A 1ID3C 3W99C 3W96D 4WU8A 3LJAD 4UUZA 3A6NC 3RELA 3AZED 5GT3A 5AV6C 5CPKC 3LELD 1B6WA 3AZMD 2CV5C 2NQBC 2JCHA 4R8PA 2F8NB 1U35C 4KUDA 5CP6D 1Q9CA 4UPKA 3MGPB 3AV1D 3X1VA 5B0ZA 5CPJB 3LZ1A 3UTBA 3KUYD 4KGCA 3REIC 3W97D 2RVQD 1P3BA 4XZQD 4Z66A 3AZHA 5AVCB 5AV5D 3W96C 3VH5A 4H9SC 3MGQD 1P3OA 3MVDC 1P3GA 2CV5B 4DQYB 2NQBB 2JE5A 2NZDA 2BYMB 4H9RA 3WTPD 3X1TD 4YM6C 3IP4C 2PYOA 4JJNC 1P3MB 3REIB 5B32G 1KX5A 3AZIC 4H9OA 3WAAA 1ZLAB 3W98D 5DNNC 5B2JB 2BG1A 5BO0A 2HIOC 5AVBC 4WU9A 1M1AD 2F8NH 4J8VC 5BS7C 3LZ0A 3KWQA 3REHA 3X1UC 3KXBD 5F99D 1T3UA 5GT0B 3AFAD 3UTAB 5CPIB 3EPLA 4JJNB 5B24D 3B0CT 1M18D 3AZIB 3EPJA 3MGSC 2HIOB 5B2ID 3WA9D 1P3ID 4NE3A 4XUJB 2F8NA 5B31D 3X1UB 4J8UD 4H9NB 3MGPA 4NE6A 2AROC 5CPJA 3C1BC 2Y2JA 4X23C 5AVCA 3RELD 3UT9C 5GT3D 4LD9B 5GSUC 5JRGD 3C1CB 5B33C 5KDMB 4QLCC 2CV5A 2Y2OA 4KUDD 1TZYC 2NQBA 5B40B 3X1VD 2BYMA 5B0ZD 3UTBD 3AZGD 5G49B 1BH8B 1HQ3C 2AROB 1P3MA 1KX3D 4Z5TB 3C1BB 3REIA 1R4VA 4X23B 1P3GD 3KSYA 3REKC 2ZY2A 1ZLAA 5B1LC 3AZLC 5B2JA 1F1EA 5GSUB 1AOID 1P3AC 5B33B 1P3PB 2FJ7B 3WKJC 3TU4D 3REJC 5C3IC 4ZUXC 1TZYB 5B0YC 1F66B 1BH9B 1KX5D 3WAAD 5GT0A 3AV2D 3UTAA 5CPIA 4JJNA 5B32D 3AZIA 3REKB 5AV8C 2CWEA 3O62C 5B1MD 2HIOA 3WKJB 3NQJB 4NFTA 1EQZC 3REHD 2YFWB 4YS3B 2LY8A 5C3IB 4XUJA 3X1SB 5BS7A 5B0YB 3AZJD 3MNND 3AZFC 1M19B 3X1UA 4H9NA 1KX4D 3AZNC 5E5AD 1PZRA 1P3KC 5AV8B 1TAFB 3B6GC 4LD9A 5AV9B 1EQZB 3C1CA 5KDMA 4G92B 5GXQC 1A7WA 3MGPD 3AZKC 5B40A 3AZFB 3B6FD 4J8XD 5G49A 1BH8A 2AROA 5AVCD 4Z5TA 4X23A 1S32B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5BNV B;  5GSU A;  5B33 A;  1P3F D;  3VH6 T;  1P3P A;  2FJ7 A;  5GXQ B;  3AYW D;  1TZY A;  1ID3 B;  1F66 A;  3LJA C;  3W99 B;  3AZE C;  1BH9 A;  3A6N B;  3LEL C;  3AZM C;  5AV6 B;  5CPK B;  3AN2 D;  1ZLA D;  4G91 C;  3REK A;  1BFM A;  5CP6 C;  1U35 B;  3AV1 C;  3WKJ A;  3KUY C;  3NQJ A;  3W97 C;  2RVQ C;  2YFW A;  4XZQ C;  5BNX B;  5AV5 C;  3MGQ C;  4YS3 A;  3VH5 T;  3X1S A;  5B0Y A;  3W96 B;  3LJA B;  3B0C W;  5GT0 D;  3UTA D;  3MVD B;  3AZE B;  5CPI D;  1M19 A;  3LEL B;  4G91 B;  5AV8 A;  5CP6 B;  3MGR D;  1TAF A;  4NE5 A;  3WTP C;  3X1T C;  1P34 D;  5DNM D;  4YM6 B;  5AV9 A;  4XUJ D;  1EQZ A;  3W97 B;  5AV5 B;  3MGQ B;  3W98 C;  4AWL C;  4H9Q B;  5DNN B;  3AZF A;  1M1A C;  5AVB B;  4CAY B;  4J8V B;  2F8N G;  3MGR C;  4J8W D;  4LD9 D;  3V9R B;  3KXB C;  1S32 A;  3WTP B;  5F99 C;  3C1C D;  3X1T B;  3AFA C;  2JSS A;  1P3L D;  5BNV A;  5FUG B;  5B24 C;  1M18 C;  5AY8 D;  2F8N K;  3W98 B;  5B40 D;  5GXQ A;  4WU8 D;  4HGA C;  5B2I C;  1ID3 A;  3W99 A;  3MGS B;  3WA9 C;  3A6N A;  4Z5T D;  1P3I C;  4R8P D;  5AV6 A;  3B0D C;  5CPK A;  4J8W C;  5B31 C;  3KXB B;  4J8U C;  5F99 B;  1P3P D;  1P3L C;  2FJ7 D;  1U35 A;  3AFA B;  3LZ1 D;  4KGC D;  1B67 A;  1P3B D;  1P3O D;  4Z66 D;  3AZH D;  4WU8 C;  1F66 D;  5BNX A;  3REL C;  5GT3 C;  3W96 A;  5B2I B;  4H9S A;  1HTA A;  5JRG C;  3LJA A;  3UT9 B;  3MVD A;  3AZE A;  3LEL A;  3B0D B;  4KUD C;  2NZD D;  4QLC B;  3NQU B;  5B31 B;  3X1V C;  5B0Z C;  3UTB C;  4DRA A;  5CP6 A;  3AZG C;  2PYO D;  4YS3 D;  1HQ3 B;  4YM6 A;  1KX3 C;  3X1S D;  3W97 A;  1P3G C;  5AV5 A;  4Z2M H;  3MGQ A;  1M19 D;  4H9Q A;  5B1L B;  5JRG B;  5DNN A;  4WU9 D;  3AZL B;  1AOI C;  1P3A B;  5AVB A;  3TU4 C;  3LZ0 D;  3KWQ D;  3REJ B;  4CAY A;  4M6B A;  4ZUX B;  4J8V A;  1H3O B;  2L5A A;  3V9R A;  5AV9 D;  3AZG B;  3WTP A;  3X1T A;  1KX5 C;  3WAA C;  3AV2 C;  1KX3 B;  5B32 C;  5FUG A;  3R45 B;  3W98 A;  1AOI B;  5B1M C;  3O62 B;  4Z2M G;  3MGS A;  3REH C;  3TU4 B;  1S32 D;  2F8N D;  3AZJ C;  3VH6 W;  3MNN C;  5F99 A;  1ULY A;  5BT1 D;  3AV2 B;  5CPJ D;  3AFA A;  5B32 B;  1KX4 C;  5E5A C;  3AZN B;  1ID3 D;  3W99 D;  3C1B A;  1P3K B;  4WV4 B;  3A6N D;  5B1M B;  5B2I A;  3UT9 A;  3B6G B;  5AV6 D;  5CPK D;  2CV5 D;  2NQB D;  3AZJ B;  4QLC A;  1U35 D;  3NQU A;  3MNN B;  3MGP C;  5B31 A;  4E45 A;  3AZK B;  3B6F C;  4J8X C;  3VH5 W;  1P3M D;  3REI D;  1KX4 B;  5AVC C;  1HQ3 A;  5E5A B;  5B2J D;  3MVD D;  5B1L A;  5JRG A;  3AZL A;  1P3F C;  1P3A A;  3AYW C;  3REJ A;  4ZUX A;  1H3O A;  4YM6 D;  1P3M C;  3AZG A;  4J8X B;  4JJN D;  3B6F B;  1WWI A;  3AN2 C;  1ZLA C;  3AZM B;  3AZI D;  4DRB A;  1KX3 A;  5B2J C;  3R45 A;  5DNN D;  4KHA B;  2HIO D;  5AVB D;  2HUE C;  1AOI A;  3O62 A;  3AV1 B;  1P3F B;  4J8V D;  3KUY B;  4H9P B;  3TU4 A;  3AYW B;  4EO5 C;  4XZQ B;  3X1U D;  5GT0 C;  3UTA C;  5CPI C;  4CSR B;  3AV2 A;  3AN2 B;  5B32 A;  5JA4 B;  3AZN A;  1N1J B;  3MGS D;  1P3K A;  2HUE B;  1P34 C;  5B1M A;  5DNM C;  4XUJ C;  3B6G A;  2YFV B;  4EO5 B;  3AZJ A;  4AWL B;  3MNN A;  3AZK A;  2ARO D;  1M1A B;  3C1B D;  4X23 D;  1KX4 A;  5E5A A;  4LD9 C;  3UT9 D;  3MGR B;  5GSU D;  3C1C C;  1P34 B;  5B33 D;  5DNM B;  5AY8 C;  4QLC D;  5B24 B;  1M18 B;  1TZY D;  5B40 C;  3WTP E;  4HGA B;  1HQ3 D;  1JFI B;  4Z5T C;  3WA9 B;  3B6F A;  4J8X A;  2BYK B;  4R8P C;  1P3I B;  3AZM A;  3REK D;  4J8W B;  4WNN B;  5B1L D;  3AZL D;  4KHA A;  1P3P C;  2FJ7 C;  4J8U B;  4ZBJ C;  3LZ1 C;  1WWS A;  1P3A D;  1P3L B;  3WKJ D;  4KGC C;  3AV1 A;  1P3B C;  1P3O C;  4Z66 C;  5AY8 B;  3REJ D;  3AZH C;  1P3F A;  4ZUX D;  3KUY A;  1F66 C;  4H9P A;  5B0Y D;  4WU8 B;  3AYW A;  4UUZ B;  4XZQ A;  3REL B;  5GT3 B;  4R8P B;  4CSR A;  2NZD C;  3AN2 A;  4KUD B;  5AV8 D;  5JA4 A;  3O62 D;  3X1V B;  1N1J A;  4ZBJ B;  5B0Z B;  3LZ1 B;  3UTB B;  2PYO C;  4KGC B;  1EQZ D;  4YS3 C;  1P3B B;  1P3O B;  4Z66 B;  3AZH B;  3X1S C;  2YFV A;  1P3G B;  1M19 C;  3AZF D;  4WU9 C;  2IO5 C;  3LZ0 C;  1M1A A;  3KWQ C;  3AZN D;  2NZD B;  4H9R B;  1P3K D;  3B0B A;  5AV9 C;  3MGR A;  2PYO B;  3B6G D;  3KXB A;  5CHL B;  1P34 A;  4G92 C;  5DNM A;  4WZS B;  4H9O B;  1KX5 B;  3WAA B;  5GXQ D;  5B24 A;  1M18 A;  5BO0 B;  3AZK D;  4WU9 B;  2IO5 B;  1JFI A;  3LZ0 B;  3WA9 A;  3KWQ B;  3REH B;  2BYK A;  1S32 C;  1P3I A;  5B31 G;  1KU5 A;  4J8W A;  4WNN A;  4E44 A;  5BT1 C;  4J8U A;  3VH6 A;  5CPJ C;  1P3L A;  5AY8 A;  1ID3 C;  3W99 C;  3W96 D;  4WU8 A;  3LJA D;  4UUZ A;  3A6N C;  3REL A;  3AZE D;  5GT3 A;  5AV6 C;  5CPK C;  3LEL D;  1B6W A;  3AZM D;  2CV5 C;  2NQB C;  4R8P A;  2F8N B;  1U35 C;  4KUD A;  5CP6 D;  1Q9C A;  3MGP B;  3AV1 D;  3X1V A;  5B0Z A;  5CPJ B;  3LZ1 A;  3UTB A;  3KUY D;  4KGC A;  3REI C;  3W97 D;  2RVQ D;  1P3B A;  4XZQ D;  4Z66 A;  3AZH A;  5AVC B;  5AV5 D;  3W96 C;  3VH5 A;  4H9S C;  3MGQ D;  1P3O A;  3MVD C;  1P3G A;  2CV5 B;  2NQB B;  2NZD A;  2BYM B;  4H9R A;  3WTP D;  3X1T D;  4YM6 C;  2PYO A;  4JJN C;  1P3M B;  3REI B;  5B32 G;  1KX5 A;  3AZI C;  4H9O A;  3WAA A;  1ZLA B;  3W98 D;  5DNN C;  5B2J B;  5BO0 A;  2HIO C;  5AVB C;  4WU9 A;  1M1A D;  2F8N H;  4J8V C;  5BS7 C;  3LZ0 A;  3KWQ A;  3REH A;  3X1U C;  3KXB D;  5F99 D;  5GT0 B;  3AFA D;  3UTA B;  5CPI B;  4JJN B;  5B24 D;  3B0C T;  1M18 D;  3AZI B;  3MGS C;  2HIO B;  5B2I D;  3WA9 D;  1P3I D;  4NE3 A;  4XUJ B;  2F8N A;  5B31 D;  3X1U B;  4J8U D;  4H9N B;  3MGP A;  4NE6 A;  2ARO C;  5CPJ A;  3C1B C;  4X23 C;  5AVC A;  3REL D;  3UT9 C;  5GT3 D;  4LD9 B;  5GSU C;  5JRG D;  3C1C B;  5B33 C;  5KDM B;  4QLC C;  2CV5 A;  4KUD D;  1TZY C;  2NQB A;  5B40 B;  3X1V D;  2BYM A;  5B0Z D;  3UTB D;  3AZG D;  5G49 B;  1BH8 B;  1HQ3 C;  2ARO B;  1P3M A;  1KX3 D;  4Z5T B;  3C1B B;  3REI A;  1R4V A;  4X23 B;  1P3G D;  3KSY A;  3REK C;  1ZLA A;  5B1L C;  3AZL C;  5B2J A;  1F1E A;  5GSU B;  1AOI D;  1P3A C;  5B33 B;  1P3P B;  2FJ7 B;  3WKJ C;  3TU4 D;  3REJ C;  5C3I C;  4ZUX C;  1TZY B;  5B0Y C;  1F66 B;  1BH9 B;  1KX5 D;  3WAA D;  5GT0 A;  3AV2 D;  3UTA A;  5CPI A;  4JJN A;  5B32 D;  3AZI A;  3REK B;  5AV8 C;  2CWE A;  3O62 C;  5B1M D;  2HIO A;  3WKJ B;  3NQJ B;  4NFT A;  1EQZ C;  3REH D;  2YFW B;  4YS3 B;  2LY8 A;  5C3I B;  4XUJ A;  3X1S B;  5BS7 A;  5B0Y B;  3AZJ D;  3MNN D;  3AZF C;  1M19 B;  3X1U A;  4H9N A;  1KX4 D;  3AZN C;  5E5A D;  1P3K C;  5AV8 B;  1TAF B;  3B6G C;  4LD9 A;  5AV9 B;  1EQZ B;  3C1C A;  5KDM A;  4G92 B;  5GXQ C;  1A7W A;  3MGP D;  3AZK C;  5B40 A;  3AZF B;  3B6F D;  4J8X D;  5G49 A;  1BH8 A;  2ARO A;  5AVC D;  4Z5T A;  4X23 A;  1S32 B; 
#chains in the Genus database with same CATH topology
 1W2E A;  2F2A C;  5BNV B;  5GSU A;  5B33 A;  1P3F D;  3VH6 T;  1P3P A;  2FJ7 A;  5GXQ B;  3AYW D;  1TZY A;  1ID3 B;  1F66 A;  3LJA C;  3W99 B;  2Y2Q A;  3AZE C;  1BH9 A;  3A6N B;  2Y2N A;  3LEL C;  3AZM C;  5AV6 B;  5CPK B;  3AN2 D;  1ZLA D;  4G91 C;  3REK A;  1BFM A;  3H0M C;  5CP6 C;  1U35 B;  3AV1 C;  3WKJ A;  3KUY C;  3NQJ A;  3W97 C;  2RVQ C;  2YFW A;  4XZQ C;  2W8S A;  5BNX B;  5AV5 C;  3MGQ C;  4YS3 A;  3VH5 T;  3X1S A;  5B0Y A;  3W96 B;  3LJA B;  3B0C W;  5GT0 D;  3UTA D;  3MVD B;  3EG5 B;  3AZE B;  5CPI D;  1M19 A;  3LEL B;  4G91 B;  2G5H C;  5AV8 A;  5CP6 B;  3MGR D;  1TAF A;  4NE5 A;  3WTP C;  3X1T C;  1P34 D;  5DNM D;  4YM6 B;  5AV9 A;  4XUJ D;  1EQZ A;  3W97 B;  5AV5 B;  3MGQ B;  3W98 C;  4AWL C;  4H9Q B;  5DNN B;  3AZF A;  1M1A C;  5AVB B;  4CAY B;  4J8V B;  2F8N G;  2ZM5 A;  3MGR C;  4J8W D;  4LD9 D;  3V9R B;  3KXB C;  1S32 A;  3WTP B;  5F99 C;  3C1C D;  3X1T B;  3AFA C;  2JSS A;  1P3L D;  5BNV A;  5FUG B;  5B24 C;  1M18 C;  5AY8 D;  2F8N K;  3W98 B;  5B40 D;  5GXQ A;  4WU8 D;  4HGA C;  5B2I C;  1ID3 A;  3W99 A;  3MGS B;  3WA9 C;  3FDD A;  2ZY3 A;  4Z5T D;  2ZY4 A;  3A6N A;  1P3I C;  4R8P D;  5AV6 A;  3B0D C;  5CPK A;  4J8W C;  3KFU G;  5B31 C;  3KXB B;  4J8U C;  5F99 B;  1P3P D;  1P3L C;  2FJ7 D;  1U35 A;  3AFA B;  3LZ1 D;  4KGC D;  1B67 A;  1P3B D;  1P3O D;  4Z66 D;  3AZH D;  4WU8 C;  1F66 D;  5BNX A;  3EPK A;  3REL C;  5GT3 C;  3W96 A;  5B2I B;  4H9S A;  1HTA A;  5JRG C;  3LJA A;  3UT9 B;  3MVD A;  3AZE A;  2Y2I A;  3LEL A;  3B0D B;  4KUD C;  2NZD D;  4QLC B;  3NQU B;  5B31 B;  3X1V C;  5B0Z C;  3UTB C;  4DRA A;  5CP6 A;  3AZG C;  2PYO D;  2XD5 A;  4YS3 D;  1HQ3 B;  4YM6 A;  1KX3 C;  3X1S D;  3W97 A;  1P3G C;  5AV5 A;  4Z2M H;  2ZY5 A;  3MGQ A;  1M19 D;  4H9Q A;  5B1L B;  5JRG B;  5DNN A;  4WU9 D;  3AZL B;  1AOI C;  1P3A B;  2Y2L A;  5AVB A;  3TU4 C;  3LZ0 D;  3KWQ D;  3REJ B;  4CAY A;  4M6B A;  4ZUX B;  4J8V A;  1H3O B;  2L5A A;  3V9R A;  2RIQ A;  5AV9 D;  3AZG B;  3WTP A;  3X1T A;  1KX5 C;  3WAA C;  3AV2 C;  1KX3 B;  5B32 C;  5FUG A;  3R45 B;  3W98 A;  1AOI B;  5B1M C;  3O62 B;  4Z2M G;  3MGS A;  3REH C;  3TU4 B;  2XD1 A;  3A1I A;  1S32 D;  2F8N D;  3AZJ C;  3VH6 W;  3MNN C;  5F99 A;  1ULY A;  5BT1 D;  3AV2 B;  5CPJ D;  3AFA A;  5B32 B;  1KX4 C;  2FFF B;  5E5A C;  3AZN B;  1ID3 D;  3W99 D;  3C1B A;  1P3K B;  4WV4 B;  3A6N D;  5B1M B;  3AL0 C;  5B2I A;  3UT9 A;  3B6G B;  2DQN C;  5AV6 D;  5CPK D;  2CV5 D;  2NQB D;  3AZJ B;  4QLC A;  1U35 D;  3NQU A;  3MNN B;  3MGP C;  5B31 A;  4E45 A;  3AZK B;  1Z2C B;  3B6F C;  4J8X C;  3VH5 W;  1P3M D;  3REI D;  1KX4 B;  5AVC C;  1HQ3 A;  4WJ3 C;  5E5A B;  5B2J D;  3MVD D;  2DF4 C;  5B1L A;  5JRG A;  3AZL A;  2UWX A;  1P3F C;  1P3A A;  3AYW C;  3REJ A;  4ZUX A;  1H3O A;  4YM6 D;  1P3M C;  3AZG A;  4J8X B;  4JJN D;  3B6F B;  1WWI A;  3AN2 C;  1ZLA C;  3AZM B;  3AZI D;  4DRB A;  1KX3 A;  5B2J C;  3R45 A;  5DNN D;  4KHA B;  2HIO D;  5AVB D;  2HUE C;  1AOI A;  3O62 A;  3AV1 B;  1P3F B;  4J8V D;  3KUY B;  4H9P B;  3TU4 A;  3AYW B;  4EO5 C;  4XZQ B;  3X1U D;  5GT0 C;  3UTA C;  5CPI C;  3H0R C;  2Y2P A;  3H0L C;  4CSR B;  3AV2 A;  3AN2 B;  5B32 A;  5JA4 B;  3AZN A;  1N1J B;  3MGS D;  1P3K A;  2HUE B;  1P34 C;  5B1M A;  5DNM C;  4XUJ C;  3B6G A;  2YFV B;  3F6T A;  4EO5 B;  3AZJ A;  4AWL B;  3MNN A;  3AZK A;  2ARO D;  1M1A B;  3C1B D;  4X23 D;  1KX4 A;  5E5A A;  4LD9 C;  3UT9 D;  3MGR B;  5GSU D;  3C1C C;  1P34 B;  5B33 D;  5DNM B;  2G5I C;  5AY8 C;  4QLC D;  5B24 B;  1M18 B;  1TZY D;  5B40 C;  3WTP E;  4HGA B;  2Y2M A;  1HQ3 D;  1JFI B;  4Z5T C;  3WA9 B;  3B6F A;  4J8X A;  2BYK B;  4R8P C;  1P3I B;  3AZM A;  3REK D;  4J8W B;  2Y2H A;  4WNN B;  5B1L D;  3AZL D;  4KHA A;  1P3P C;  2FJ7 C;  4J8U B;  4ZBJ C;  3LZ1 C;  1WWS A;  1P3A D;  1P3L B;  3WKJ D;  4KGC C;  3A1K A;  3AV1 A;  1P3B C;  1P3O C;  4Z66 C;  5AY8 B;  3REJ D;  3AZH C;  1P3F A;  4ZUX D;  3KUY A;  1F66 C;  4H9P A;  5B0Y D;  4WU8 B;  3AYW A;  3EPH A;  4UUZ B;  4XZQ A;  3REL B;  5GT3 B;  4R8P B;  4CSR A;  2NZD C;  3AN2 A;  4KUD B;  5AV8 D;  5JA4 A;  3O62 D;  3X1V B;  1N1J A;  4ZBJ B;  5B0Z B;  3LZ1 B;  3UTB B;  2PYO C;  4KGC B;  1EQZ D;  4YS3 C;  1P3B B;  1P3O B;  4Z66 B;  3AZH B;  3X1S C;  2YFV A;  2J8P A;  1P3G B;  1M19 C;  3AZF D;  4WU9 C;  2IO5 C;  2Y2K A;  3LZ0 C;  1M1A A;  3KWQ C;  3AZN D;  2NZD B;  4H9R B;  1P3K D;  3B0B A;  5AV9 C;  3MGR A;  2Y2G A;  2PYO B;  3B6G D;  3KXB A;  5CHL B;  1P34 A;  4G92 C;  5DNM A;  4WZS B;  4H9O B;  1KX5 B;  3WAA B;  5GXQ D;  5B24 A;  1M18 A;  5BO0 B;  3AZK D;  4WU9 B;  2IO5 B;  1JFI A;  3LZ0 B;  3WA9 A;  3KWQ B;  3REH B;  3P5J B;  2BYK A;  1S32 C;  1P3I A;  5B31 G;  1KU5 A;  4J8W A;  4WNN A;  4E44 A;  5BT1 C;  4J8U A;  3VH6 A;  5CPJ C;  1P3L A;  2VQR A;  5AY8 A;  1ID3 C;  3W99 C;  3W96 D;  4WU8 A;  3LJA D;  4UUZ A;  3A6N C;  3REL A;  3AZE D;  5GT3 A;  5AV6 C;  5CPK C;  3LEL D;  1B6W A;  3AZM D;  2CV5 C;  2NQB C;  2JCH A;  4R8P A;  2F8N B;  1U35 C;  4KUD A;  5CP6 D;  1Q9C A;  4UPK A;  3MGP B;  3AV1 D;  3X1V A;  5B0Z A;  5CPJ B;  3LZ1 A;  3UTB A;  3KUY D;  4KGC A;  3REI C;  3W97 D;  2RVQ D;  1P3B A;  4XZQ D;  4Z66 A;  3AZH A;  5AVC B;  5AV5 D;  3W96 C;  3VH5 A;  4H9S C;  3MGQ D;  1P3O A;  3MVD C;  1P3G A;  2CV5 B;  4DQY B;  2NQB B;  2JE5 A;  2NZD A;  2BYM B;  4H9R A;  3WTP D;  3X1T D;  4YM6 C;  3IP4 C;  2PYO A;  4JJN C;  1P3M B;  3REI B;  5B32 G;  1KX5 A;  3AZI C;  4H9O A;  3WAA A;  1ZLA B;  3W98 D;  5DNN C;  5B2J B;  2BG1 A;  5BO0 A;  2HIO C;  5AVB C;  4WU9 A;  1M1A D;  2F8N H;  4J8V C;  5BS7 C;  3LZ0 A;  3KWQ A;  3REH A;  3X1U C;  3KXB D;  5F99 D;  1T3U A;  5GT0 B;  3AFA D;  3UTA B;  5CPI B;  3EPL A;  4JJN B;  5B24 D;  3B0C T;  1M18 D;  3AZI B;  3EPJ A;  3MGS C;  2HIO B;  5B2I D;  3WA9 D;  1P3I D;  4NE3 A;  4XUJ B;  2F8N A;  5B31 D;  3X1U B;  4J8U D;  4H9N B;  3MGP A;  4NE6 A;  2ARO C;  5CPJ A;  3C1B C;  2Y2J A;  4X23 C;  5AVC A;  3REL D;  3UT9 C;  5GT3 D;  4LD9 B;  5GSU C;  5JRG D;  3C1C B;  5B33 C;  5KDM B;  4QLC C;  2CV5 A;  2Y2O A;  4KUD D;  1TZY C;  2NQB A;  5B40 B;  3X1V D;  2BYM A;  5B0Z D;  3UTB D;  3AZG D;  5G49 B;  1BH8 B;  1HQ3 C;  2ARO B;  1P3M A;  1KX3 D;  4Z5T B;  3C1B B;  3REI A;  1R4V A;  4X23 B;  1P3G D;  3KSY A;  3REK C;  2ZY2 A;  1ZLA A;  5B1L C;  3AZL C;  5B2J A;  1F1E A;  5GSU B;  1AOI D;  1P3A C;  5B33 B;  1P3P B;  2FJ7 B;  3WKJ C;  3TU4 D;  3REJ C;  5C3I C;  4ZUX C;  1TZY B;  5B0Y C;  1F66 B;  1BH9 B;  1KX5 D;  3WAA D;  5GT0 A;  3AV2 D;  3UTA A;  5CPI A;  4JJN A;  5B32 D;  3AZI A;  3REK B;  5AV8 C;  2CWE A;  3O62 C;  5B1M D;  2HIO A;  3WKJ B;  3NQJ B;  4NFT A;  1EQZ C;  3REH D;  2YFW B;  4YS3 B;  2LY8 A;  5C3I B;  4XUJ A;  3X1S B;  5BS7 A;  5B0Y B;  3AZJ D;  3MNN D;  3AZF C;  1M19 B;  3X1U A;  4H9N A;  1KX4 D;  3AZN C;  5E5A D;  1PZR A;  1P3K C;  5AV8 B;  1TAF B;  3B6G C;  4LD9 A;  5AV9 B;  1EQZ B;  3C1C A;  5KDM A;  4G92 B;  5GXQ C;  1A7W A;  3MGP D;  3AZK C;  5B40 A;  3AZF B;  3B6F D;  4J8X D;  5G49 A;  1BH8 A;  2ARO A;  5AVC D;  4Z5T A;  4X23 A;  1S32 B; 
#chains in the Genus database with same CATH homology
 1W2E A;  2F2A C;  5BNV B;  5GSU A;  5B33 A;  1P3F D;  3VH6 T;  1P3P A;  2FJ7 A;  5GXQ B;  3AYW D;  1TZY A;  1ID3 B;  1F66 A;  3LJA C;  3W99 B;  2Y2Q A;  3AZE C;  1BH9 A;  3A6N B;  2Y2N A;  3LEL C;  3AZM C;  5AV6 B;  5CPK B;  3AN2 D;  1ZLA D;  4G91 C;  3REK A;  1BFM A;  3H0M C;  5CP6 C;  1U35 B;  3AV1 C;  3WKJ A;  3KUY C;  3NQJ A;  3W97 C;  2RVQ C;  2YFW A;  4XZQ C;  2W8S A;  5BNX B;  5AV5 C;  3MGQ C;  4YS3 A;  3VH5 T;  3X1S A;  5B0Y A;  3W96 B;  3LJA B;  3B0C W;  5GT0 D;  3UTA D;  3MVD B;  3EG5 B;  3AZE B;  5CPI D;  1M19 A;  3LEL B;  4G91 B;  2G5H C;  5AV8 A;  5CP6 B;  3MGR D;  1TAF A;  4NE5 A;  3WTP C;  3X1T C;  1P34 D;  5DNM D;  4YM6 B;  5AV9 A;  4XUJ D;  1EQZ A;  3W97 B;  5AV5 B;  3MGQ B;  3W98 C;  4AWL C;  4H9Q B;  5DNN B;  3AZF A;  1M1A C;  5AVB B;  4CAY B;  4J8V B;  2F8N G;  2ZM5 A;  3MGR C;  4J8W D;  4LD9 D;  3V9R B;  3KXB C;  1S32 A;  3WTP B;  5F99 C;  3C1C D;  3X1T B;  3AFA C;  2JSS A;  1P3L D;  5BNV A;  5FUG B;  5B24 C;  1M18 C;  5AY8 D;  2F8N K;  3W98 B;  5B40 D;  5GXQ A;  4WU8 D;  4HGA C;  5B2I C;  1ID3 A;  3W99 A;  3MGS B;  3WA9 C;  3FDD A;  2ZY3 A;  4Z5T D;  2ZY4 A;  3A6N A;  1P3I C;  4R8P D;  5AV6 A;  3B0D C;  5CPK A;  4J8W C;  3KFU G;  5B31 C;  3KXB B;  4J8U C;  5F99 B;  1P3P D;  1P3L C;  2FJ7 D;  1U35 A;  3AFA B;  3LZ1 D;  4KGC D;  1B67 A;  1P3B D;  1P3O D;  4Z66 D;  3AZH D;  4WU8 C;  1F66 D;  5BNX A;  3EPK A;  3REL C;  5GT3 C;  3W96 A;  5B2I B;  4H9S A;  1HTA A;  5JRG C;  3LJA A;  3UT9 B;  3MVD A;  3AZE A;  2Y2I A;  3LEL A;  3B0D B;  4KUD C;  2NZD D;  4QLC B;  3NQU B;  5B31 B;  3X1V C;  5B0Z C;  3UTB C;  4DRA A;  5CP6 A;  3AZG C;  2PYO D;  2XD5 A;  4YS3 D;  1HQ3 B;  4YM6 A;  1KX3 C;  3X1S D;  3W97 A;  1P3G C;  5AV5 A;  4Z2M H;  2ZY5 A;  3MGQ A;  1M19 D;  4H9Q A;  5B1L B;  5JRG B;  5DNN A;  4WU9 D;  3AZL B;  1AOI C;  1P3A B;  2Y2L A;  5AVB A;  3TU4 C;  3LZ0 D;  3KWQ D;  3REJ B;  4CAY A;  4M6B A;  4ZUX B;  4J8V A;  1H3O B;  2L5A A;  3V9R A;  2RIQ A;  5AV9 D;  3AZG B;  3WTP A;  3X1T A;  1KX5 C;  3WAA C;  3AV2 C;  1KX3 B;  5B32 C;  5FUG A;  3R45 B;  3W98 A;  1AOI B;  5B1M C;  3O62 B;  4Z2M G;  3MGS A;  3REH C;  3TU4 B;  2XD1 A;  3A1I A;  1S32 D;  2F8N D;  3AZJ C;  3VH6 W;  3MNN C;  5F99 A;  1ULY A;  5BT1 D;  3AV2 B;  5CPJ D;  3AFA A;  5B32 B;  1KX4 C;  2FFF B;  5E5A C;  3AZN B;  1ID3 D;  3W99 D;  3C1B A;  1P3K B;  4WV4 B;  3A6N D;  5B1M B;  3AL0 C;  5B2I A;  3UT9 A;  3B6G B;  2DQN C;  5AV6 D;  5CPK D;  2CV5 D;  2NQB D;  3AZJ B;  4QLC A;  1U35 D;  3NQU A;  3MNN B;  3MGP C;  5B31 A;  4E45 A;  3AZK B;  1Z2C B;  3B6F C;  4J8X C;  3VH5 W;  1P3M D;  3REI D;  1KX4 B;  5AVC C;  1HQ3 A;  4WJ3 C;  5E5A B;  5B2J D;  3MVD D;  2DF4 C;  5B1L A;  5JRG A;  3AZL A;  2UWX A;  1P3F C;  1P3A A;  3AYW C;  3REJ A;  4ZUX A;  1H3O A;  4YM6 D;  1P3M C;  3AZG A;  4J8X B;  4JJN D;  3B6F B;  1WWI A;  3AN2 C;  1ZLA C;  3AZM B;  3AZI D;  4DRB A;  1KX3 A;  5B2J C;  3R45 A;  5DNN D;  4KHA B;  2HIO D;  5AVB D;  2HUE C;  1AOI A;  3O62 A;  3AV1 B;  1P3F B;  4J8V D;  3KUY B;  4H9P B;  3TU4 A;  3AYW B;  4EO5 C;  4XZQ B;  3X1U D;  5GT0 C;  3UTA C;  5CPI C;  3H0R C;  2Y2P A;  3H0L C;  4CSR B;  3AV2 A;  3AN2 B;  5B32 A;  5JA4 B;  3AZN A;  1N1J B;  3MGS D;  1P3K A;  2HUE B;  1P34 C;  5B1M A;  5DNM C;  4XUJ C;  3B6G A;  2YFV B;  3F6T A;  4EO5 B;  3AZJ A;  4AWL B;  3MNN A;  3AZK A;  2ARO D;  1M1A B;  3C1B D;  4X23 D;  1KX4 A;  5E5A A;  4LD9 C;  3UT9 D;  3MGR B;  5GSU D;  3C1C C;  1P34 B;  5B33 D;  5DNM B;  2G5I C;  5AY8 C;  4QLC D;  5B24 B;  1M18 B;  1TZY D;  5B40 C;  3WTP E;  4HGA B;  2Y2M A;  1HQ3 D;  1JFI B;  4Z5T C;  3WA9 B;  3B6F A;  4J8X A;  2BYK B;  4R8P C;  1P3I B;  3AZM A;  3REK D;  4J8W B;  2Y2H A;  4WNN B;  5B1L D;  3AZL D;  4KHA A;  1P3P C;  2FJ7 C;  4J8U B;  4ZBJ C;  3LZ1 C;  1WWS A;  1P3A D;  1P3L B;  3WKJ D;  4KGC C;  3A1K A;  3AV1 A;  1P3B C;  1P3O C;  4Z66 C;  5AY8 B;  3REJ D;  3AZH C;  1P3F A;  4ZUX D;  3KUY A;  1F66 C;  4H9P A;  5B0Y D;  4WU8 B;  3AYW A;  3EPH A;  4UUZ B;  4XZQ A;  3REL B;  5GT3 B;  4R8P B;  4CSR A;  2NZD C;  3AN2 A;  4KUD B;  5AV8 D;  5JA4 A;  3O62 D;  3X1V B;  1N1J A;  4ZBJ B;  5B0Z B;  3LZ1 B;  3UTB B;  2PYO C;  4KGC B;  1EQZ D;  4YS3 C;  1P3B B;  1P3O B;  4Z66 B;  3AZH B;  3X1S C;  2YFV A;  2J8P A;  1P3G B;  1M19 C;  3AZF D;  4WU9 C;  2IO5 C;  2Y2K A;  3LZ0 C;  1M1A A;  3KWQ C;  3AZN D;  2NZD B;  4H9R B;  1P3K D;  3B0B A;  5AV9 C;  3MGR A;  2Y2G A;  2PYO B;  3B6G D;  3KXB A;  5CHL B;  1P34 A;  4G92 C;  5DNM A;  4WZS B;  4H9O B;  1KX5 B;  3WAA B;  5GXQ D;  5B24 A;  1M18 A;  5BO0 B;  3AZK D;  4WU9 B;  2IO5 B;  1JFI A;  3LZ0 B;  3WA9 A;  3KWQ B;  3REH B;  3P5J B;  2BYK A;  1S32 C;  1P3I A;  5B31 G;  1KU5 A;  4J8W A;  4WNN A;  4E44 A;  5BT1 C;  4J8U A;  3VH6 A;  5CPJ C;  1P3L A;  2VQR A;  5AY8 A;  1ID3 C;  3W99 C;  3W96 D;  4WU8 A;  3LJA D;  4UUZ A;  3A6N C;  3REL A;  3AZE D;  5GT3 A;  5AV6 C;  5CPK C;  3LEL D;  1B6W A;  3AZM D;  2CV5 C;  2NQB C;  2JCH A;  4R8P A;  2F8N B;  1U35 C;  4KUD A;  5CP6 D;  1Q9C A;  4UPK A;  3MGP B;  3AV1 D;  3X1V A;  5B0Z A;  5CPJ B;  3LZ1 A;  3UTB A;  3KUY D;  4KGC A;  3REI C;  3W97 D;  2RVQ D;  1P3B A;  4XZQ D;  4Z66 A;  3AZH A;  5AVC B;  5AV5 D;  3W96 C;  3VH5 A;  4H9S C;  3MGQ D;  1P3O A;  3MVD C;  1P3G A;  2CV5 B;  4DQY B;  2NQB B;  2JE5 A;  2NZD A;  2BYM B;  4H9R A;  3WTP D;  3X1T D;  4YM6 C;  3IP4 C;  2PYO A;  4JJN C;  1P3M B;  3REI B;  5B32 G;  1KX5 A;  3AZI C;  4H9O A;  3WAA A;  1ZLA B;  3W98 D;  5DNN C;  5B2J B;  2BG1 A;  5BO0 A;  2HIO C;  5AVB C;  4WU9 A;  1M1A D;  2F8N H;  4J8V C;  5BS7 C;  3LZ0 A;  3KWQ A;  3REH A;  3X1U C;  3KXB D;  5F99 D;  1T3U A;  5GT0 B;  3AFA D;  3UTA B;  5CPI B;  3EPL A;  4JJN B;  5B24 D;  3B0C T;  1M18 D;  3AZI B;  3EPJ A;  3MGS C;  2HIO B;  5B2I D;  3WA9 D;  1P3I D;  4NE3 A;  4XUJ B;  2F8N A;  5B31 D;  3X1U B;  4J8U D;  4H9N B;  3MGP A;  4NE6 A;  2ARO C;  5CPJ A;  3C1B C;  2Y2J A;  4X23 C;  5AVC A;  3REL D;  3UT9 C;  5GT3 D;  4LD9 B;  5GSU C;  5JRG D;  3C1C B;  5B33 C;  5KDM B;  4QLC C;  2CV5 A;  2Y2O A;  4KUD D;  1TZY C;  2NQB A;  5B40 B;  3X1V D;  2BYM A;  5B0Z D;  3UTB D;  3AZG D;  5G49 B;  1BH8 B;  1HQ3 C;  2ARO B;  1P3M A;  1KX3 D;  4Z5T B;  3C1B B;  3REI A;  1R4V A;  4X23 B;  1P3G D;  3KSY A;  3REK C;  2ZY2 A;  1ZLA A;  5B1L C;  3AZL C;  5B2J A;  1F1E A;  5GSU B;  1AOI D;  1P3A C;  5B33 B;  1P3P B;  2FJ7 B;  3WKJ C;  3TU4 D;  3REJ C;  5C3I C;  4ZUX C;  1TZY B;  5B0Y C;  1F66 B;  1BH9 B;  1KX5 D;  3WAA D;  5GT0 A;  3AV2 D;  3UTA A;  5CPI A;  4JJN A;  5B32 D;  3AZI A;  3REK B;  5AV8 C;  2CWE A;  3O62 C;  5B1M D;  2HIO A;  3WKJ B;  3NQJ B;  4NFT A;  1EQZ C;  3REH D;  2YFW B;  4YS3 B;  2LY8 A;  5C3I B;  4XUJ A;  3X1S B;  5BS7 A;  5B0Y B;  3AZJ D;  3MNN D;  3AZF C;  1M19 B;  3X1U A;  4H9N A;  1KX4 D;  3AZN C;  5E5A D;  1PZR A;  1P3K C;  5AV8 B;  1TAF B;  3B6G C;  4LD9 A;  5AV9 B;  1EQZ B;  3C1C A;  5KDM A;  4G92 B;  5GXQ C;  1A7W A;  3MGP D;  3AZK C;  5B40 A;  3AZF B;  3B6F D;  4J8X D;  5G49 A;  1BH8 A;  2ARO A;  5AVC D;  4Z5T A;  4X23 A;  1S32 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...