3UTBC

Crystal structure of nucleosome core particle assembled with the 146b alpha-satellite sequence (ncp146b)
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
103
structure length
103
Chain Sequence
TRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords Histone H3.2
publication title The mechanics behind DNA sequence-dependent properties of the nucleosome
pubmed doi rcsb
source organism Xenopus laevis
total genus 31
structure length 103
sequence length 103
chains with identical sequence G
ec nomenclature
pdb deposition date 2011-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3utbC00
3X1SD 2RVQC 3V9RA 1EQZC 5AV5B 1M18B 4WU9C 2NQBA 1P34C 3WAAC 1AOID 4XZQC 3AV2C 1ZLAB 3MGQA 5GSUD 2JSSA 4WU8A 5B0YA 5DNNC 2NQBD 2CWEA 5CPJA 3X1VB 5B1MA 4LD9C 3UTAA 3B0DB 3MGQD 3AZIC 4YS3A 3WTPB 4Z66A 3MNNB 2CV5B 3LZ1B 4WU8D 2YFVA 3AZKA 3W96C 3W99A 1TZYA 5CPJD 2AROC 3NQUB 5B1MD 3UTAD 2HUEC 4XUJB 3UTBA 3W98D 3REKA 4YS3D 4Z66D 1N1JB 4H9OB 4H9PA 1S32B 3W97C 3LZ0B 3AZKD 5AVBB 3W99D 3X1UB 1TZYD 4YM6C 3VH5T 4J8WA 3UTBD 3WA9B 3REKD 1P3FB 4G92C 1P3BC 3C1CD 5B0ZB 4X23B 5CPKC 3AZHB 5B40A 5B31C 4J8WD 3AZMA 1M19C 3B6GA 1H3OB 3A6NC 3AFAB 3X1SC 5FUGB 3KSYA 3WKJA 3AZFB 5B40D 5DNMD 1P3GC 1Q9CA 5AV6C 3B6GD 5GSUC 5B24B 2IO5C 3X1TA 2F8NG 3AZEA 3MVDC 3WKJD 3MGPB 4G91C 3MGQC 4J8XA 5AV9A 1ID3C 3X1TD 4R8PB 5AV8B 4WU8C 5JRGC 1KX5B 2HIOD 3MGSA 4H9RB 5B1MC 4J8XD 3AZNC 5AV9D 4ZUXB 3W98C 1P3PA 1HQ3B 4E45A 1EQZA 4ZBJB 3KXBB 3AZKC 3MGSD 1P3IC 3KWQC 1P34A 3VH6T 3WAAA 3AV2A 3UTBC 5BNVA 2RVQD 1P3PD 5BO0A 4WV4B 3O62C 3C1CC 2NZDB 1BH9B 3NQJB 5DNNA 1P34D 3WAAD 3AV2D 4H9QB 1P3OA 1R4VA 4J8UC 3VH6A 3AZIA 1M1AC 1F66C 3AZJC 1P3LC 1BFMA 5DNND 5B40C 5DNMC 2AROA 1P3OD 3B6GC 5B32A 5G49B 3AZID 5CP6A 1KX3B 5GT3A 3W97A 3C1BB 4YM6A 2AROD 5CPIA 5B32D 1JFIB 3AN2A 1P3BA 5CP6D 4WU9B 4XZQB 5GT3D 5CPKA 3UT9C 5B31A 2HIOC 4YM6D 5CPID 4H9NB 3R45A 1U35C 5AVCB 4DRAA 3A6NA 3AN2D 4NFTA 3X1SA 4LD9B 5AY8B 5CPKD 5B31D 1P3GA 4KGCC 5AV6A 3AYWB 3A6ND 3W96B 2FJ7C 1P3PC 2HUEB 3MVDA 1HTAA 1P3GD 5AV6D 3KUYB 2L5AA 1ID3A 2BYMB 4CAYB 3REHA 3LJAC 3MVDD 3REJC 5JRGA 3AV1C 4WNNA 5B2JA 1P3KA 3RELB 3VH5W 1P3OC 3B0CT 3AZGC 3AZNA 1ID3D 3W98A 3LELA 3REHD 4QLCC 5F99B 1M19B 5JRGD 4J8VB 1P3IA 2PYOA 4XUJD 3KWQA 1KX4A 5B2JD 1P3KD 3MGRC 3AZND 5B32C 4Z5TC 5B1LC 3LELD 1S32D 1TAFA 5CP6C 3O62A 1AOIB 3C1CA 1B67A 2BYKB 5GT3C 5CHLB 1P3ID 5GSUB 2PYOD 3KWQD 1KX4D 5GT0C 5CPIC 3V9RB 4J8UA 3REIC 5GXQA 5B2IA 3AN2C 2NQBB 4KHAA 3O62D 1M1AA 1F66A 4JJNC 3AZJA 3MGQB 1P3LA 4Z2MH 5DNMA 4J8UD 5BT1D 4WU8B 5GXQD 5B2ID 4HGAB 5B0YB 4EO5B 5CPJB 5AV5C 1M1AD 1F66D 5B1MB 3UTAB 3AZJD 1P3LD 1WWSA 5BS7C 4YS3B 4AWLB 4Z66B 3B6FA 1P3MB 5B24D 2YFVB 3AZKB 3W99B 1TZYB 3UT9A 3UTBB 3REKB 2HIOA 3X1VC 3B0DC 1U35A 3B6FD 3VH6W 4H9PB 3WTPC 5B33A 3MNNC 4DRBA 3LZ1C 2CV5C 4J8WB 3REHC 3UT9D 4CSRA 4XUJC 4KGCA 5B2JC 1U35D 1P3KC 5B33D 3AZLA 2F8NA 3LELC 1S32C 5JA4A 3LZ0C 2FJ7A 5AVBC 3AZMB 3B6GB 2PYOC 4KGCD 1KX4C 3WA9C 5BNXA 1P3FC 3AZLD 2F8ND 3WKJB 5B0ZC 2FJ7D 3LJAA 3AZHC 3REJA 3AV1A 3X1TB 3AZGA 3AZEB 5BT1C 4UUZA 5GXQC 5B2IC 1P3AA 4QLCA 3LJAD 3REJD 3AZFC 5KDMA 4J8XB 3AV1D 5AV9B 2YFWA 3MGRA 3WTPE 3AZGD 5B24C 4Z5TA 5E5AA 5B1LA 1P3AD 3MGSB 5C3IB 4QLCD 3MGPC 5GT0A 4KUDA 3MGRD 1P3PB 1EQZB 3B6FC 4Z5TD 5E5AD 3REIA 5B1LD 4R8PC 5AV8C 3B0BA 1P34B 3WAAB 1BH8A 3AV2B 4JJNA 1KX5C 5GT0D 5BNVB 4KUDD 3TU4A 5BO0B 4ZUXC 3REID 5B33C 5AY8D 1HQ3C 5DNNB 4ZBJC 5AV5A 3KXBC 4JJND 1P3OB 1M18A 3AZIB 1ZLAA 5BS7A 3TU4D 4H9SC 3B0CW 3AZLC 5AV5D 2AROB 1M18D 5B32B 3X1VA 1ZLAD 5CP6B 4E44A 5GT3B 4NE5A 3W97B 3WTPA 3MNNA 2CV5A 3LZ1A 4YM6B 5CPIB 3X1VD 3AN2B 3NQUA 4XUJA 4G92B 1P3BB 3WTPD 5CPKB 3MNND 2CV5D 3LZ1D 1KX3C 1N1JA 4H9OA 5B31B 1S32A 1P3AC 3LZ0A 4J8VD 3R45B 5AVBA 3X1UA 3C1BC 3A6NB 4Z2MG 1KU5A 3WA9A 3X1SB 1P3FA 5E5AC 5B0ZA 4X23A 1P3GB 3LZ0D 3AZHA 5AVBD 5AV6B 3X1UD 5AVCC 2IO5B 3WA9D 4KUDC 1H3OA 1P3FD 3MVDB 3AFAA 5B0ZD 4X23D 4M6BA 5FUGA 5AY8C 3AZHD 1WWIA 3AZFA 4G91B 1B6WA 1ID3B 1P3MA 3TU4C 3AYWC 3REHB 5B24A 5B0YD 3AFAD 5JRGB 4NE6A 4WNNB 5B2JB 3MGPA 3AZFD 1P3KB 1M18C 3AZNB 3W98B 1P3MD 3KUYC 1ZLAC 3LELB 4NE3A 4R8PA 5AV8A 1P3IB 2PYOB 2LY8A 3KWQB 1KX4B 3MGPD 1KX5A 4H9RA 3RELC 1TAFB 2F8NK 3O62B 4ZUXA 3C1CB 4R8PD 5AV8D 1HQ3A 5F99C 3KXBA 1KX5D 3VH5A 4J8VC 4J8UB 5GXQB 5B2IB 1ULYA 4H9SA 4KHAB 4ZUXD 1M1AB 1F66B 3AZJB 1P3LB 2NZDA 1HQ3D 1AOIC 5B40B 5DNMB 3AZMD 3KXBD 1BH9A 3NQJA 3X1UC 4WZSB 4H9QA 2NZDD 2NQBC 4X23C 3B6FB 3AZED 5G49A 4HGAC 3UT9B 5B0YC 4EO5C 3AFAC 5CPJC 1KX3A 2HIOB 3UTAC 1U35B 3C1BA 4YS3C 4AWLC 4Z66C 5B33B 2F8NH 1P3MC 1JFIA 3W99C 4WU9A 1TZYC 1KX3D 4XZQA 4CSRB 4KGCB 3C1BD 3REKC 5B32G 4H9NA 3AZLB 2F8NB 5AVCA 1EQZD 5JA4B 2FJ7B 4WU9D 4XZQD 4LD9A 5AY8A 4J8WC 5BNXB 5AVCD 3AYWA 3W96A 3LJAB 3REJB 3AV1B 4LD9D 3AZMC 5B31G 1F1EA 3AZGB 4UUZB 3KUYA 1P3AB 3AYWD 4QLCB 3W96D 3WKJC 5KDMB 2BYMA 4CAYA 2NZDC 2YFWB 3MGRB 4Z5TB 5E5AB 3KUYD 5B1LB 3RELA 3X1TC 3W97D 3AZEC 5F99A 1M19A 5GT0B 4KUDB 4J8VA 4J8XC 5AV9C 1P3BD 3REIB 3RELD 1BH8B 4JJNB 3MGSC 5C3IC 1AOIA 5F99D 1M19D 2BYKA 3TU4B 5GSUA 1A7WA
chains in the Genus database with same CATH superfamily
3X1SD 2RVQC 3V9RA 1EQZC 5AV5B 1M18B 4WU9C 2NQBA 1P34C 3WAAC 1AOID 4XZQC 3AV2C 1ZLAB 3MGQA 5GSUD 2G5IC 2JSSA 4WU8A 5B0YA 5DNNC 2NQBD 2CWEA 5CPJA 3X1VB 5B1MA 4LD9C 3UTAA 3B0DB 3MGQD 3AZIC 4YS3A 3WTPB 4Z66A 3MNNB 2CV5B 3LZ1B 2JCHA 4WU8D 2YFVA 3AZKA 3W96C 3W99A 2XD5A 1TZYA 5CPJD 2AROC 3NQUB 3P5JB 5B1MD 2HUEC 4XUJB 3UTAD 3UTBA 3W98D 3REKA 4YS3D 4Z66D 1N1JB 4H9OB 4H9PA 1S32B 3W97C 3LZ0B 3AZKD 5AVBB 3W99D 3X1UB 1TZYD 4YM6C 3VH5T 4J8WA 3A1KA 3UTBD 3WA9B 3REKD 1P3FB 4G92C 1P3BC 3C1CD 5B0ZB 4X23B 5CPKC 3AZHB 5B40A 5B31C 4J8WD 3AZMA 1M19C 2Y2IA 3B6GA 1H3OB 3EG5B 3A6NC 3AFAB 3X1SC 5FUGB 3KSYA 3WKJA 3AZFB 5B40D 5DNMD 2Y2LA 1P3GC 1Q9CA 2Y2QA 5AV6C 3B6GD 5GSUC 5B24B 3EPKA 2IO5C 3X1TA 2F8NG 3AZEA 3MVDC 3WKJD 3MGPB 4G91C 3MGQC 4J8XA 5AV9A 1ID3C 3X1TD 4R8PB 5AV8B 4WU8C 5JRGC 1KX5B 2HIOD 3MGSA 4H9RB 4WJ3C 5B1MC 4J8XD 3AZNC 5AV9D 4ZUXB 3W98C 1P3PA 1HQ3B 4E45A 4DQYB 1EQZA 4ZBJB 3KXBB 3AZKC 3MGSD 1P3IC 3KWQC 1P34A 3VH6T 3WAAA 3AV2A 1W2EA 3UTBC 5BNVA 2RVQD 1P3PD 5BO0A 4WV4B 3O62C 3C1CC 2NZDB 1BH9B 2Y2HA 3NQJB 5DNNA 1P34D 3WAAD 2ZM5A 4H9QB 3AV2D 1P3OA 1R4VA 4J8UC 3VH6A 3AZIA 1M1AC 1F66C 3AZJC 1P3LC 1BFMA 5DNND 5B40C 5DNMC 2AROA 1P3OD 3B6GC 5B32A 5G49B 3AZID 5CP6A 1KX3B 5GT3A 3W97A 3C1BB 4YM6A 2AROD 5CPIA 5B32D 1JFIB 3AN2A 1P3BA 5CP6D 4WU9B 4XZQB 5GT3D 2Y2PA 5CPKA 3UT9C 5B31A 2HIOC 4YM6D 5CPID 4H9NB 3R45A 1U35C 5AVCB 4DRAA 3A6NA 3AN2D 4NFTA 3X1SA 4LD9B 5AY8B 5CPKD 5B31D 1P3GA 4KGCC 1Z2CB 5AV6A 3AYWB 3A6ND 3W96B 2FJ7C 1P3PC 2HUEB 3MVDA 1HTAA 1P3GD 5AV6D 3KUYB 2L5AA 2Y2OA 3H0MC 1ID3A 3EPHA 2VQRA 2BYMB 4CAYB 3REHA 2Y2KA 3LJAC 3MVDD 3REJC 5JRGA 3AV1C 4WNNA 5B2JA 1P3KA 3RELB 3VH5W 1P3OC 3B0CT 3AZGC 3AZNA 1ID3D 3W98A 3LELA 3REHD 4QLCC 5F99B 1M19B 5JRGD 4J8VB 1P3IA 2PYOA 4XUJD 3KWQA 1KX4A 5B2JD 1P3KD 3MGRC 3AZND 5B32C 4Z5TC 5B1LC 3LELD 1S32D 1TAFA 5CP6C 3O62A 1AOIB 3C1CA 1B67A 2BYKB 5GT3C 5CHLB 1P3ID 5GSUB 2PYOD 3KWQD 1KX4D 5GT0C 5CPIC 3V9RB 4J8UA 3REIC 5GXQA 5B2IA 3AN2C 2DF4C 2NQBB 4KHAA 3O62D 1M1AA 1F66A 4JJNC 3AZJA 3MGQB 1P3LA 4Z2MH 5DNMA 4J8UD 5BT1D 4WU8B 5GXQD 5B2ID 4HGAB 5B0YB 4EO5B 5CPJB 5AV5C 1M1AD 1F66D 5B1MB 3UTAB 3AZJD 1P3LD 1WWSA 5BS7C 4YS3B 4AWLB 4Z66B 2UWXA 1P3MB 5B24D 3B6FA 2YFVB 3AZKB 3W99B 1TZYB 3EPLA 3UT9A 3UTBB 3REKB 2HIOA 3X1VC 3B0DC 1U35A 3B6FD 3VH6W 4H9PB 3WTPC 5B33A 3MNNC 4DRBA 3LZ1C 2CV5C 4J8WB 3REHC 3UT9D 4CSRA 4XUJC 4KGCA 5B2JC 1U35D 1P3KC 5B33D 3AZLA 2F8NA 3LELC 1S32C 5JA4A 3LZ0C 2FJ7A 5AVBC 3AZMB 3B6GB 2PYOC 4KGCD 1KX4C 3WA9C 5BNXA 1P3FC 3AZLD 2F8ND 3WKJB 5B0ZC 2FJ7D 3LJAA 3AZHC 3REJA 3AV1A 4UPKA 3X1TB 3AZGA 3AZEB 5BT1C 4UUZA 5GXQC 5B2IC 1P3AA 4QLCA 3LJAD 3REJD 3AZFC 5KDMA 4J8XB 3FDDA 5AV9B 3AV1D 2YFWA 3MGRA 3WTPE 3AZGD 5B24C 3F6TA 4Z5TA 5E5AA 5B1LA 1P3AD 3MGSB 5C3IB 2ZY4A 4QLCD 3MGPC 2ZY5A 5GT0A 4KUDA 3MGRD 3H0LC 1P3PB 1EQZB 3B6FC 4Z5TD 5E5AD 3REIA 5B1LD 4R8PC 5AV8C 3B0BA 1P34B 3WAAB 1BH8A 3AV2B 4JJNA 1KX5C 5GT0D 5BNVB 4KUDD 3TU4A 5BO0B 3A1IA 4ZUXC 3REID 3KFUG 5B33C 5AY8D 1HQ3C 5DNNB 4ZBJC 5AV5A 3KXBC 4JJND 1P3OB 1M18A 3AZIB 1ZLAA 5BS7A 3TU4D 3AL0C 4H9SC 3B0CW 3AZLC 5AV5D 2AROB 1M18D 5B32B 3X1VA 1ZLAD 1PZRA 5CP6B 4E44A 5GT3B 4NE5A 3W97B 3WTPA 3MNNA 2CV5A 3LZ1A 4YM6B 5CPIB 2Y2NA 2JE5A 2ZY2A 3AN2B 3NQUA 3X1VD 4XUJA 4G92B 2G5HC 1P3BB 3WTPD 5CPKB 3MNND 2CV5D 3LZ1D 1KX3C 1N1JA 4H9OA 5B31B 1S32A 1P3AC 3LZ0A 4J8VD 3R45B 5AVBA 3X1UA 3C1BC 3A6NB 2FFFB 4Z2MG 1KU5A 2W8SA 3WA9A 3X1SB 2RIQA 1P3FA 5E5AC 5B0ZA 4X23A 1P3GB 3LZ0D 3AZHA 5AVBD 5AV6B 3X1UD 5AVCC 2IO5B 3WA9D 4KUDC 1H3OA 2Y2GA 1P3FD 3MVDB 3AFAA 5B0ZD 4X23D 4M6BA 5FUGA 5AY8C 3AZHD 1WWIA 3AZFA 4G91B 1B6WA 1ID3B 1P3MA 3TU4C 3AYWC 2DQNC 3REHB 5B24A 5B0YD 3AFAD 5JRGB 2ZY3A 4NE6A 4WNNB 5B2JB 3MGPA 3AZFD 1P3KB 1M18C 3AZNB 3W98B 1P3MD 3KUYC 1ZLAC 3LELB 4NE3A 4R8PA 5AV8A 1P3IB 2PYOB 2LY8A 3KWQB 1KX4B 3MGPD 1KX5A 4H9RA 2J8PA 3RELC 1TAFB 2F8NK 3O62B 4ZUXA 3C1CB 4R8PD 5AV8D 1HQ3A 5F99C 3KXBA 1KX5D 3VH5A 4J8VC 4J8UB 3H0RC 5GXQB 5B2IB 1ULYA 4H9SA 4KHAB 4ZUXD 1M1AB 1F66B 3AZJB 1P3LB 2NZDA 1HQ3D 1AOIC 5B40B 5DNMB 3AZMD 3KXBD 1BH9A 3NQJA 3X1UC 4WZSB 1T3UA 4H9QA 2NZDD 2NQBC 4X23C 2Y2JA 3B6FB 3AZED 5G49A 3EPJA 4HGAC 3UT9B 5B0YC 4EO5C 3AFAC 5CPJC 1KX3A 2HIOB 3UTAC 1U35B 3C1BA 4YS3C 4AWLC 4Z66C 5B33B 2F8NH 1P3MC 1JFIA 3IP4C 3W99C 4WU9A 1TZYC 1KX3D 4XZQA 4CSRB 4KGCB 3C1BD 3REKC 5B32G 4H9NA 3AZLB 2F8NB 5AVCA 1EQZD 5JA4B 2FJ7B 4WU9D 2XD1A 4XZQD 4LD9A 5AY8A 4J8WC 5BNXB 5AVCD 3AYWA 3W96A 3LJAB 3REJB 3AV1B 4LD9D 3AZMC 5B31G 1F1EA 3AZGB 4UUZB 3KUYA 1P3AB 3AYWD 4QLCB 3W96D 3WKJC 5KDMB 2BYMA 4CAYA 2NZDC 2YFWB 3MGRB 2Y2MA 4Z5TB 5E5AB 3KUYD 5B1LB 3RELA 3X1TC 3W97D 3AZEC 2BG1A 2F2AC 5F99A 1M19A 5GT0B 4KUDB 4J8VA 4J8XC 5AV9C 1P3BD 3REIB 3RELD 1BH8B 4JJNB 3MGSC 5C3IC 1AOIA 5F99D 1M19D 2BYKA 3TU4B 5GSUA 1A7WA
chains in the Genus database with same CATH topology
3X1SD 2RVQC 3V9RA 1EQZC 5AV5B 1M18B 4WU9C 2NQBA 1P34C 3WAAC 1AOID 4XZQC 3AV2C 1ZLAB 3MGQA 5GSUD 2G5IC 2JSSA 4WU8A 5B0YA 5DNNC 2NQBD 2CWEA 5CPJA 3X1VB 5B1MA 4LD9C 3UTAA 3B0DB 3MGQD 3AZIC 4YS3A 3WTPB 4Z66A 3MNNB 2CV5B 3LZ1B 2JCHA 4WU8D 2YFVA 3AZKA 3W96C 3W99A 2XD5A 1TZYA 5CPJD 2AROC 3NQUB 3P5JB 5B1MD 2HUEC 4XUJB 3UTAD 3UTBA 3W98D 3REKA 4YS3D 4Z66D 1N1JB 4H9OB 4H9PA 1S32B 3W97C 3LZ0B 3AZKD 5AVBB 3W99D 3X1UB 1TZYD 4YM6C 3VH5T 4J8WA 3A1KA 3UTBD 3WA9B 3REKD 1P3FB 4G92C 1P3BC 3C1CD 5B0ZB 4X23B 5CPKC 3AZHB 5B40A 5B31C 4J8WD 3AZMA 1M19C 2Y2IA 3B6GA 1H3OB 3EG5B 3A6NC 3AFAB 3X1SC 5FUGB 3KSYA 3WKJA 3AZFB 5B40D 5DNMD 2Y2LA 1P3GC 1Q9CA 2Y2QA 5AV6C 3B6GD 5GSUC 5B24B 3EPKA 2IO5C 3X1TA 2F8NG 3AZEA 3MVDC 3WKJD 3MGPB 4G91C 3MGQC 4J8XA 5AV9A 1ID3C 3X1TD 4R8PB 5AV8B 4WU8C 5JRGC 1KX5B 2HIOD 3MGSA 4H9RB 4WJ3C 5B1MC 4J8XD 3AZNC 5AV9D 4ZUXB 3W98C 1P3PA 1HQ3B 4E45A 4DQYB 1EQZA 4ZBJB 3KXBB 3AZKC 3MGSD 1P3IC 3KWQC 1P34A 3VH6T 3WAAA 3AV2A 1W2EA 3UTBC 5BNVA 2RVQD 1P3PD 5BO0A 4WV4B 3O62C 3C1CC 2NZDB 1BH9B 2Y2HA 3NQJB 5DNNA 1P34D 3WAAD 2ZM5A 4H9QB 3AV2D 1P3OA 1R4VA 4J8UC 3VH6A 3AZIA 1M1AC 1F66C 3AZJC 1P3LC 1BFMA 5DNND 5B40C 5DNMC 2AROA 1P3OD 3B6GC 5B32A 5G49B 3AZID 5CP6A 1KX3B 5GT3A 3W97A 3C1BB 4YM6A 2AROD 5CPIA 5B32D 1JFIB 3AN2A 1P3BA 5CP6D 4WU9B 4XZQB 5GT3D 2Y2PA 5CPKA 3UT9C 5B31A 2HIOC 4YM6D 5CPID 4H9NB 3R45A 1U35C 5AVCB 4DRAA 3A6NA 3AN2D 4NFTA 3X1SA 4LD9B 5AY8B 5CPKD 5B31D 1P3GA 4KGCC 1Z2CB 5AV6A 3AYWB 3A6ND 3W96B 2FJ7C 1P3PC 2HUEB 3MVDA 1HTAA 1P3GD 5AV6D 3KUYB 2L5AA 2Y2OA 3H0MC 1ID3A 3EPHA 2VQRA 2BYMB 4CAYB 3REHA 2Y2KA 3LJAC 3MVDD 3REJC 5JRGA 3AV1C 4WNNA 5B2JA 1P3KA 3RELB 3VH5W 1P3OC 3B0CT 3AZGC 3AZNA 1ID3D 3W98A 3LELA 3REHD 4QLCC 5F99B 1M19B 5JRGD 4J8VB 1P3IA 2PYOA 4XUJD 3KWQA 1KX4A 5B2JD 1P3KD 3MGRC 3AZND 5B32C 4Z5TC 5B1LC 3LELD 1S32D 1TAFA 5CP6C 3O62A 1AOIB 3C1CA 1B67A 2BYKB 5GT3C 5CHLB 1P3ID 5GSUB 2PYOD 3KWQD 1KX4D 5GT0C 5CPIC 3V9RB 4J8UA 3REIC 5GXQA 5B2IA 3AN2C 2DF4C 2NQBB 4KHAA 3O62D 1M1AA 1F66A 4JJNC 3AZJA 3MGQB 1P3LA 4Z2MH 5DNMA 4J8UD 5BT1D 4WU8B 5GXQD 5B2ID 4HGAB 5B0YB 4EO5B 5CPJB 5AV5C 1M1AD 1F66D 5B1MB 3UTAB 3AZJD 1P3LD 1WWSA 5BS7C 4YS3B 4AWLB 4Z66B 2UWXA 1P3MB 5B24D 3B6FA 2YFVB 3AZKB 3W99B 1TZYB 3EPLA 3UT9A 3UTBB 3REKB 2HIOA 3X1VC 3B0DC 1U35A 3B6FD 3VH6W 4H9PB 3WTPC 5B33A 3MNNC 4DRBA 3LZ1C 2CV5C 4J8WB 3REHC 3UT9D 4CSRA 4XUJC 4KGCA 5B2JC 1U35D 1P3KC 5B33D 3AZLA 2F8NA 3LELC 1S32C 5JA4A 3LZ0C 2FJ7A 5AVBC 3AZMB 3B6GB 2PYOC 4KGCD 1KX4C 3WA9C 5BNXA 1P3FC 3AZLD 2F8ND 3WKJB 5B0ZC 2FJ7D 3LJAA 3AZHC 3REJA 3AV1A 4UPKA 3X1TB 3AZGA 3AZEB 5BT1C 4UUZA 5GXQC 5B2IC 1P3AA 4QLCA 3LJAD 3REJD 3AZFC 5KDMA 4J8XB 3FDDA 5AV9B 3AV1D 2YFWA 3MGRA 3WTPE 3AZGD 5B24C 3F6TA 4Z5TA 5E5AA 5B1LA 1P3AD 3MGSB 5C3IB 2ZY4A 4QLCD 3MGPC 2ZY5A 5GT0A 4KUDA 3MGRD 3H0LC 1P3PB 1EQZB 3B6FC 4Z5TD 5E5AD 3REIA 5B1LD 4R8PC 5AV8C 3B0BA 1P34B 3WAAB 1BH8A 3AV2B 4JJNA 1KX5C 5GT0D 5BNVB 4KUDD 3TU4A 5BO0B 3A1IA 4ZUXC 3REID 3KFUG 5B33C 5AY8D 1HQ3C 5DNNB 4ZBJC 5AV5A 3KXBC 4JJND 1P3OB 1M18A 3AZIB 1ZLAA 5BS7A 3TU4D 3AL0C 4H9SC 3B0CW 3AZLC 5AV5D 2AROB 1M18D 5B32B 3X1VA 1ZLAD 1PZRA 5CP6B 4E44A 5GT3B 4NE5A 3W97B 3WTPA 3MNNA 2CV5A 3LZ1A 4YM6B 5CPIB 2Y2NA 2JE5A 2ZY2A 3AN2B 3NQUA 3X1VD 4XUJA 4G92B 2G5HC 1P3BB 3WTPD 5CPKB 3MNND 2CV5D 3LZ1D 1KX3C 1N1JA 4H9OA 5B31B 1S32A 1P3AC 3LZ0A 4J8VD 3R45B 5AVBA 3X1UA 3C1BC 3A6NB 2FFFB 4Z2MG 1KU5A 2W8SA 3WA9A 3X1SB 2RIQA 1P3FA 5E5AC 5B0ZA 4X23A 1P3GB 3LZ0D 3AZHA 5AVBD 5AV6B 3X1UD 5AVCC 2IO5B 3WA9D 4KUDC 1H3OA 2Y2GA 1P3FD 3MVDB 3AFAA 5B0ZD 4X23D 4M6BA 5FUGA 5AY8C 3AZHD 1WWIA 3AZFA 4G91B 1B6WA 1ID3B 1P3MA 3TU4C 3AYWC 2DQNC 3REHB 5B24A 5B0YD 3AFAD 5JRGB 2ZY3A 4NE6A 4WNNB 5B2JB 3MGPA 3AZFD 1P3KB 1M18C 3AZNB 3W98B 1P3MD 3KUYC 1ZLAC 3LELB 4NE3A 4R8PA 5AV8A 1P3IB 2PYOB 2LY8A 3KWQB 1KX4B 3MGPD 1KX5A 4H9RA 2J8PA 3RELC 1TAFB 2F8NK 3O62B 4ZUXA 3C1CB 4R8PD 5AV8D 1HQ3A 5F99C 3KXBA 1KX5D 3VH5A 4J8VC 4J8UB 3H0RC 5GXQB 5B2IB 1ULYA 4H9SA 4KHAB 4ZUXD 1M1AB 1F66B 3AZJB 1P3LB 2NZDA 1HQ3D 1AOIC 5B40B 5DNMB 3AZMD 3KXBD 1BH9A 3NQJA 3X1UC 4WZSB 1T3UA 4H9QA 2NZDD 2NQBC 4X23C 2Y2JA 3B6FB 3AZED 5G49A 3EPJA 4HGAC 3UT9B 5B0YC 4EO5C 3AFAC 5CPJC 1KX3A 2HIOB 3UTAC 1U35B 3C1BA 4YS3C 4AWLC 4Z66C 5B33B 2F8NH 1P3MC 1JFIA 3IP4C 3W99C 4WU9A 1TZYC 1KX3D 4XZQA 4CSRB 4KGCB 3C1BD 3REKC 5B32G 4H9NA 3AZLB 2F8NB 5AVCA 1EQZD 5JA4B 2FJ7B 4WU9D 2XD1A 4XZQD 4LD9A 5AY8A 4J8WC 5BNXB 5AVCD 3AYWA 3W96A 3LJAB 3REJB 3AV1B 4LD9D 3AZMC 5B31G 1F1EA 3AZGB 4UUZB 3KUYA 1P3AB 3AYWD 4QLCB 3W96D 3WKJC 5KDMB 2BYMA 4CAYA 2NZDC 2YFWB 3MGRB 2Y2MA 4Z5TB 5E5AB 3KUYD 5B1LB 3RELA 3X1TC 3W97D 3AZEC 2BG1A 2F2AC 5F99A 1M19A 5GT0B 4KUDB 4J8VA 4J8XC 5AV9C 1P3BD 3REIB 3RELD 1BH8B 4JJNB 3MGSC 5C3IC 1AOIA 5F99D 1M19D 2BYKA 3TU4B 5GSUA 1A7WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3X1S D;  2RVQ C;  3V9R A;  1EQZ C;  5AV5 B;  1M18 B;  4WU9 C;  2NQB A;  1P34 C;  3WAA C;  1AOI D;  4XZQ C;  3AV2 C;  1ZLA B;  3MGQ A;  5GSU D;  2JSS A;  4WU8 A;  5B0Y A;  5DNN C;  2NQB D;  2CWE A;  5CPJ A;  3X1V B;  5B1M A;  4LD9 C;  3UTA A;  3B0D B;  3MGQ D;  3AZI C;  4YS3 A;  3WTP B;  4Z66 A;  3MNN B;  2CV5 B;  3LZ1 B;  4WU8 D;  2YFV A;  3AZK A;  3W96 C;  3W99 A;  1TZY A;  5CPJ D;  2ARO C;  3NQU B;  5B1M D;  3UTA D;  2HUE C;  4XUJ B;  3UTB A;  3W98 D;  3REK A;  4YS3 D;  4Z66 D;  1N1J B;  4H9O B;  4H9P A;  1S32 B;  3W97 C;  3LZ0 B;  3AZK D;  5AVB B;  3W99 D;  3X1U B;  1TZY D;  4YM6 C;  3VH5 T;  4J8W A;  3UTB D;  3WA9 B;  3REK D;  1P3F B;  4G92 C;  1P3B C;  3C1C D;  5B0Z B;  4X23 B;  5CPK C;  3AZH B;  5B40 A;  5B31 C;  4J8W D;  3AZM A;  1M19 C;  3B6G A;  1H3O B;  3A6N C;  3AFA B;  3X1S C;  5FUG B;  3KSY A;  3WKJ A;  3AZF B;  5B40 D;  5DNM D;  1P3G C;  1Q9C A;  5AV6 C;  3B6G D;  5GSU C;  5B24 B;  2IO5 C;  3X1T A;  2F8N G;  3AZE A;  3MVD C;  3WKJ D;  3MGP B;  4G91 C;  3MGQ C;  4J8X A;  5AV9 A;  1ID3 C;  3X1T D;  4R8P B;  5AV8 B;  4WU8 C;  5JRG C;  1KX5 B;  2HIO D;  3MGS A;  4H9R B;  5B1M C;  4J8X D;  3AZN C;  5AV9 D;  4ZUX B;  3W98 C;  1P3P A;  1HQ3 B;  4E45 A;  1EQZ A;  4ZBJ B;  3KXB B;  3AZK C;  3MGS D;  1P3I C;  3KWQ C;  1P34 A;  3VH6 T;  3WAA A;  3AV2 A;  3UTB C;  5BNV A;  2RVQ D;  1P3P D;  5BO0 A;  4WV4 B;  3O62 C;  3C1C C;  2NZD B;  1BH9 B;  3NQJ B;  5DNN A;  1P34 D;  3WAA D;  3AV2 D;  4H9Q B;  1P3O A;  1R4V A;  4J8U C;  3VH6 A;  3AZI A;  1M1A C;  1F66 C;  3AZJ C;  1P3L C;  1BFM A;  5DNN D;  5B40 C;  5DNM C;  2ARO A;  1P3O D;  3B6G C;  5B32 A;  5G49 B;  3AZI D;  5CP6 A;  1KX3 B;  5GT3 A;  3W97 A;  3C1B B;  4YM6 A;  2ARO D;  5CPI A;  5B32 D;  1JFI B;  3AN2 A;  1P3B A;  5CP6 D;  4WU9 B;  4XZQ B;  5GT3 D;  5CPK A;  3UT9 C;  5B31 A;  2HIO C;  4YM6 D;  5CPI D;  4H9N B;  3R45 A;  1U35 C;  5AVC B;  4DRA A;  3A6N A;  3AN2 D;  4NFT A;  3X1S A;  4LD9 B;  5AY8 B;  5CPK D;  5B31 D;  1P3G A;  4KGC C;  5AV6 A;  3AYW B;  3A6N D;  3W96 B;  2FJ7 C;  1P3P C;  2HUE B;  3MVD A;  1HTA A;  1P3G D;  5AV6 D;  3KUY B;  2L5A A;  1ID3 A;  2BYM B;  4CAY B;  3REH A;  3LJA C;  3MVD D;  3REJ C;  5JRG A;  3AV1 C;  4WNN A;  5B2J A;  1P3K A;  3REL B;  3VH5 W;  1P3O C;  3B0C T;  3AZG C;  3AZN A;  1ID3 D;  3W98 A;  3LEL A;  3REH D;  4QLC C;  5F99 B;  1M19 B;  5JRG D;  4J8V B;  1P3I A;  2PYO A;  4XUJ D;  3KWQ A;  1KX4 A;  5B2J D;  1P3K D;  3MGR C;  3AZN D;  5B32 C;  4Z5T C;  5B1L C;  3LEL D;  1S32 D;  1TAF A;  5CP6 C;  3O62 A;  1AOI B;  3C1C A;  1B67 A;  2BYK B;  5GT3 C;  5CHL B;  1P3I D;  5GSU B;  2PYO D;  3KWQ D;  1KX4 D;  5GT0 C;  5CPI C;  3V9R B;  4J8U A;  3REI C;  5GXQ A;  5B2I A;  3AN2 C;  2NQB B;  4KHA A;  3O62 D;  1M1A A;  1F66 A;  4JJN C;  3AZJ A;  3MGQ B;  1P3L A;  4Z2M H;  5DNM A;  4J8U D;  5BT1 D;  4WU8 B;  5GXQ D;  5B2I D;  4HGA B;  5B0Y B;  4EO5 B;  5CPJ B;  5AV5 C;  1M1A D;  1F66 D;  5B1M B;  3UTA B;  3AZJ D;  1P3L D;  1WWS A;  5BS7 C;  4YS3 B;  4AWL B;  4Z66 B;  3B6F A;  1P3M B;  5B24 D;  2YFV B;  3AZK B;  3W99 B;  1TZY B;  3UT9 A;  3UTB B;  3REK B;  2HIO A;  3X1V C;  3B0D C;  1U35 A;  3B6F D;  3VH6 W;  4H9P B;  3WTP C;  5B33 A;  3MNN C;  4DRB A;  3LZ1 C;  2CV5 C;  4J8W B;  3REH C;  3UT9 D;  4CSR A;  4XUJ C;  4KGC A;  5B2J C;  1U35 D;  1P3K C;  5B33 D;  3AZL A;  2F8N A;  3LEL C;  1S32 C;  5JA4 A;  3LZ0 C;  2FJ7 A;  5AVB C;  3AZM B;  3B6G B;  2PYO C;  4KGC D;  1KX4 C;  3WA9 C;  5BNX A;  1P3F C;  3AZL D;  2F8N D;  3WKJ B;  5B0Z C;  2FJ7 D;  3LJA A;  3AZH C;  3REJ A;  3AV1 A;  3X1T B;  3AZG A;  3AZE B;  5BT1 C;  4UUZ A;  5GXQ C;  5B2I C;  1P3A A;  4QLC A;  3LJA D;  3REJ D;  3AZF C;  5KDM A;  4J8X B;  3AV1 D;  5AV9 B;  2YFW A;  3MGR A;  3WTP E;  3AZG D;  5B24 C;  4Z5T A;  5E5A A;  5B1L A;  1P3A D;  3MGS B;  5C3I B;  4QLC D;  3MGP C;  5GT0 A;  4KUD A;  3MGR D;  1P3P B;  1EQZ B;  3B6F C;  4Z5T D;  5E5A D;  3REI A;  5B1L D;  4R8P C;  5AV8 C;  3B0B A;  1P34 B;  3WAA B;  1BH8 A;  3AV2 B;  4JJN A;  1KX5 C;  5GT0 D;  5BNV B;  4KUD D;  3TU4 A;  5BO0 B;  4ZUX C;  3REI D;  5B33 C;  5AY8 D;  1HQ3 C;  5DNN B;  4ZBJ C;  5AV5 A;  3KXB C;  4JJN D;  1P3O B;  1M18 A;  3AZI B;  1ZLA A;  5BS7 A;  3TU4 D;  4H9S C;  3B0C W;  3AZL C;  5AV5 D;  2ARO B;  1M18 D;  5B32 B;  3X1V A;  1ZLA D;  5CP6 B;  4E44 A;  5GT3 B;  4NE5 A;  3W97 B;  3WTP A;  3MNN A;  2CV5 A;  3LZ1 A;  4YM6 B;  5CPI B;  3X1V D;  3AN2 B;  3NQU A;  4XUJ A;  4G92 B;  1P3B B;  3WTP D;  5CPK B;  3MNN D;  2CV5 D;  3LZ1 D;  1KX3 C;  1N1J A;  4H9O A;  5B31 B;  1S32 A;  1P3A C;  3LZ0 A;  4J8V D;  3R45 B;  5AVB A;  3X1U A;  3C1B C;  3A6N B;  4Z2M G;  1KU5 A;  3WA9 A;  3X1S B;  1P3F A;  5E5A C;  5B0Z A;  4X23 A;  1P3G B;  3LZ0 D;  3AZH A;  5AVB D;  5AV6 B;  3X1U D;  5AVC C;  2IO5 B;  3WA9 D;  4KUD C;  1H3O A;  1P3F D;  3MVD B;  3AFA A;  5B0Z D;  4X23 D;  4M6B A;  5FUG A;  5AY8 C;  3AZH D;  1WWI A;  3AZF A;  4G91 B;  1B6W A;  1ID3 B;  1P3M A;  3TU4 C;  3AYW C;  3REH B;  5B24 A;  5B0Y D;  3AFA D;  5JRG B;  4NE6 A;  4WNN B;  5B2J B;  3MGP A;  3AZF D;  1P3K B;  1M18 C;  3AZN B;  3W98 B;  1P3M D;  3KUY C;  1ZLA C;  3LEL B;  4NE3 A;  4R8P A;  5AV8 A;  1P3I B;  2PYO B;  2LY8 A;  3KWQ B;  1KX4 B;  3MGP D;  1KX5 A;  4H9R A;  3REL C;  1TAF B;  2F8N K;  3O62 B;  4ZUX A;  3C1C B;  4R8P D;  5AV8 D;  1HQ3 A;  5F99 C;  3KXB A;  1KX5 D;  3VH5 A;  4J8V C;  4J8U B;  5GXQ B;  5B2I B;  1ULY A;  4H9S A;  4KHA B;  4ZUX D;  1M1A B;  1F66 B;  3AZJ B;  1P3L B;  2NZD A;  1HQ3 D;  1AOI C;  5B40 B;  5DNM B;  3AZM D;  3KXB D;  1BH9 A;  3NQJ A;  3X1U C;  4WZS B;  4H9Q A;  2NZD D;  2NQB C;  4X23 C;  3B6F B;  3AZE D;  5G49 A;  4HGA C;  3UT9 B;  5B0Y C;  4EO5 C;  3AFA C;  5CPJ C;  1KX3 A;  2HIO B;  3UTA C;  1U35 B;  3C1B A;  4YS3 C;  4AWL C;  4Z66 C;  5B33 B;  2F8N H;  1P3M C;  1JFI A;  3W99 C;  4WU9 A;  1TZY C;  1KX3 D;  4XZQ A;  4CSR B;  4KGC B;  3C1B D;  3REK C;  5B32 G;  4H9N A;  3AZL B;  2F8N B;  5AVC A;  1EQZ D;  5JA4 B;  2FJ7 B;  4WU9 D;  4XZQ D;  4LD9 A;  5AY8 A;  4J8W C;  5BNX B;  5AVC D;  3AYW A;  3W96 A;  3LJA B;  3REJ B;  3AV1 B;  4LD9 D;  3AZM C;  5B31 G;  1F1E A;  3AZG B;  4UUZ B;  3KUY A;  1P3A B;  3AYW D;  4QLC B;  3W96 D;  3WKJ C;  5KDM B;  2BYM A;  4CAY A;  2NZD C;  2YFW B;  3MGR B;  4Z5T B;  5E5A B;  3KUY D;  5B1L B;  3REL A;  3X1T C;  3W97 D;  3AZE C;  5F99 A;  1M19 A;  5GT0 B;  4KUD B;  4J8V A;  4J8X C;  5AV9 C;  1P3B D;  3REI B;  3REL D;  1BH8 B;  4JJN B;  3MGS C;  5C3I C;  1AOI A;  5F99 D;  1M19 D;  2BYK A;  3TU4 B;  5GSU A;  1A7W A; 
#chains in the Genus database with same CATH topology
 3X1S D;  2RVQ C;  3V9R A;  1EQZ C;  5AV5 B;  1M18 B;  4WU9 C;  2NQB A;  1P34 C;  3WAA C;  1AOI D;  4XZQ C;  3AV2 C;  1ZLA B;  3MGQ A;  5GSU D;  2G5I C;  2JSS A;  4WU8 A;  5B0Y A;  5DNN C;  2NQB D;  2CWE A;  5CPJ A;  3X1V B;  5B1M A;  4LD9 C;  3UTA A;  3B0D B;  3MGQ D;  3AZI C;  4YS3 A;  3WTP B;  4Z66 A;  3MNN B;  2CV5 B;  3LZ1 B;  2JCH A;  4WU8 D;  2YFV A;  3AZK A;  3W96 C;  3W99 A;  2XD5 A;  1TZY A;  5CPJ D;  2ARO C;  3NQU B;  3P5J B;  5B1M D;  2HUE C;  4XUJ B;  3UTA D;  3UTB A;  3W98 D;  3REK A;  4YS3 D;  4Z66 D;  1N1J B;  4H9O B;  4H9P A;  1S32 B;  3W97 C;  3LZ0 B;  3AZK D;  5AVB B;  3W99 D;  3X1U B;  1TZY D;  4YM6 C;  3VH5 T;  4J8W A;  3A1K A;  3UTB D;  3WA9 B;  3REK D;  1P3F B;  4G92 C;  1P3B C;  3C1C D;  5B0Z B;  4X23 B;  5CPK C;  3AZH B;  5B40 A;  5B31 C;  4J8W D;  3AZM A;  1M19 C;  2Y2I A;  3B6G A;  1H3O B;  3EG5 B;  3A6N C;  3AFA B;  3X1S C;  5FUG B;  3KSY A;  3WKJ A;  3AZF B;  5B40 D;  5DNM D;  2Y2L A;  1P3G C;  1Q9C A;  2Y2Q A;  5AV6 C;  3B6G D;  5GSU C;  5B24 B;  3EPK A;  2IO5 C;  3X1T A;  2F8N G;  3AZE A;  3MVD C;  3WKJ D;  3MGP B;  4G91 C;  3MGQ C;  4J8X A;  5AV9 A;  1ID3 C;  3X1T D;  4R8P B;  5AV8 B;  4WU8 C;  5JRG C;  1KX5 B;  2HIO D;  3MGS A;  4H9R B;  4WJ3 C;  5B1M C;  4J8X D;  3AZN C;  5AV9 D;  4ZUX B;  3W98 C;  1P3P A;  1HQ3 B;  4E45 A;  4DQY B;  1EQZ A;  4ZBJ B;  3KXB B;  3AZK C;  3MGS D;  1P3I C;  3KWQ C;  1P34 A;  3VH6 T;  3WAA A;  3AV2 A;  1W2E A;  3UTB C;  5BNV A;  2RVQ D;  1P3P D;  5BO0 A;  4WV4 B;  3O62 C;  3C1C C;  2NZD B;  1BH9 B;  2Y2H A;  3NQJ B;  5DNN A;  1P34 D;  3WAA D;  2ZM5 A;  4H9Q B;  3AV2 D;  1P3O A;  1R4V A;  4J8U C;  3VH6 A;  3AZI A;  1M1A C;  1F66 C;  3AZJ C;  1P3L C;  1BFM A;  5DNN D;  5B40 C;  5DNM C;  2ARO A;  1P3O D;  3B6G C;  5B32 A;  5G49 B;  3AZI D;  5CP6 A;  1KX3 B;  5GT3 A;  3W97 A;  3C1B B;  4YM6 A;  2ARO D;  5CPI A;  5B32 D;  1JFI B;  3AN2 A;  1P3B A;  5CP6 D;  4WU9 B;  4XZQ B;  5GT3 D;  2Y2P A;  5CPK A;  3UT9 C;  5B31 A;  2HIO C;  4YM6 D;  5CPI D;  4H9N B;  3R45 A;  1U35 C;  5AVC B;  4DRA A;  3A6N A;  3AN2 D;  4NFT A;  3X1S A;  4LD9 B;  5AY8 B;  5CPK D;  5B31 D;  1P3G A;  4KGC C;  1Z2C B;  5AV6 A;  3AYW B;  3A6N D;  3W96 B;  2FJ7 C;  1P3P C;  2HUE B;  3MVD A;  1HTA A;  1P3G D;  5AV6 D;  3KUY B;  2L5A A;  2Y2O A;  3H0M C;  1ID3 A;  3EPH A;  2VQR A;  2BYM B;  4CAY B;  3REH A;  2Y2K A;  3LJA C;  3MVD D;  3REJ C;  5JRG A;  3AV1 C;  4WNN A;  5B2J A;  1P3K A;  3REL B;  3VH5 W;  1P3O C;  3B0C T;  3AZG C;  3AZN A;  1ID3 D;  3W98 A;  3LEL A;  3REH D;  4QLC C;  5F99 B;  1M19 B;  5JRG D;  4J8V B;  1P3I A;  2PYO A;  4XUJ D;  3KWQ A;  1KX4 A;  5B2J D;  1P3K D;  3MGR C;  3AZN D;  5B32 C;  4Z5T C;  5B1L C;  3LEL D;  1S32 D;  1TAF A;  5CP6 C;  3O62 A;  1AOI B;  3C1C A;  1B67 A;  2BYK B;  5GT3 C;  5CHL B;  1P3I D;  5GSU B;  2PYO D;  3KWQ D;  1KX4 D;  5GT0 C;  5CPI C;  3V9R B;  4J8U A;  3REI C;  5GXQ A;  5B2I A;  3AN2 C;  2DF4 C;  2NQB B;  4KHA A;  3O62 D;  1M1A A;  1F66 A;  4JJN C;  3AZJ A;  3MGQ B;  1P3L A;  4Z2M H;  5DNM A;  4J8U D;  5BT1 D;  4WU8 B;  5GXQ D;  5B2I D;  4HGA B;  5B0Y B;  4EO5 B;  5CPJ B;  5AV5 C;  1M1A D;  1F66 D;  5B1M B;  3UTA B;  3AZJ D;  1P3L D;  1WWS A;  5BS7 C;  4YS3 B;  4AWL B;  4Z66 B;  2UWX A;  1P3M B;  5B24 D;  3B6F A;  2YFV B;  3AZK B;  3W99 B;  1TZY B;  3EPL A;  3UT9 A;  3UTB B;  3REK B;  2HIO A;  3X1V C;  3B0D C;  1U35 A;  3B6F D;  3VH6 W;  4H9P B;  3WTP C;  5B33 A;  3MNN C;  4DRB A;  3LZ1 C;  2CV5 C;  4J8W B;  3REH C;  3UT9 D;  4CSR A;  4XUJ C;  4KGC A;  5B2J C;  1U35 D;  1P3K C;  5B33 D;  3AZL A;  2F8N A;  3LEL C;  1S32 C;  5JA4 A;  3LZ0 C;  2FJ7 A;  5AVB C;  3AZM B;  3B6G B;  2PYO C;  4KGC D;  1KX4 C;  3WA9 C;  5BNX A;  1P3F C;  3AZL D;  2F8N D;  3WKJ B;  5B0Z C;  2FJ7 D;  3LJA A;  3AZH C;  3REJ A;  3AV1 A;  4UPK A;  3X1T B;  3AZG A;  3AZE B;  5BT1 C;  4UUZ A;  5GXQ C;  5B2I C;  1P3A A;  4QLC A;  3LJA D;  3REJ D;  3AZF C;  5KDM A;  4J8X B;  3FDD A;  5AV9 B;  3AV1 D;  2YFW A;  3MGR A;  3WTP E;  3AZG D;  5B24 C;  3F6T A;  4Z5T A;  5E5A A;  5B1L A;  1P3A D;  3MGS B;  5C3I B;  2ZY4 A;  4QLC D;  3MGP C;  2ZY5 A;  5GT0 A;  4KUD A;  3MGR D;  3H0L C;  1P3P B;  1EQZ B;  3B6F C;  4Z5T D;  5E5A D;  3REI A;  5B1L D;  4R8P C;  5AV8 C;  3B0B A;  1P34 B;  3WAA B;  1BH8 A;  3AV2 B;  4JJN A;  1KX5 C;  5GT0 D;  5BNV B;  4KUD D;  3TU4 A;  5BO0 B;  3A1I A;  4ZUX C;  3REI D;  3KFU G;  5B33 C;  5AY8 D;  1HQ3 C;  5DNN B;  4ZBJ C;  5AV5 A;  3KXB C;  4JJN D;  1P3O B;  1M18 A;  3AZI B;  1ZLA A;  5BS7 A;  3TU4 D;  3AL0 C;  4H9S C;  3B0C W;  3AZL C;  5AV5 D;  2ARO B;  1M18 D;  5B32 B;  3X1V A;  1ZLA D;  1PZR A;  5CP6 B;  4E44 A;  5GT3 B;  4NE5 A;  3W97 B;  3WTP A;  3MNN A;  2CV5 A;  3LZ1 A;  4YM6 B;  5CPI B;  2Y2N A;  2JE5 A;  2ZY2 A;  3AN2 B;  3NQU A;  3X1V D;  4XUJ A;  4G92 B;  2G5H C;  1P3B B;  3WTP D;  5CPK B;  3MNN D;  2CV5 D;  3LZ1 D;  1KX3 C;  1N1J A;  4H9O A;  5B31 B;  1S32 A;  1P3A C;  3LZ0 A;  4J8V D;  3R45 B;  5AVB A;  3X1U A;  3C1B C;  3A6N B;  2FFF B;  4Z2M G;  1KU5 A;  2W8S A;  3WA9 A;  3X1S B;  2RIQ A;  1P3F A;  5E5A C;  5B0Z A;  4X23 A;  1P3G B;  3LZ0 D;  3AZH A;  5AVB D;  5AV6 B;  3X1U D;  5AVC C;  2IO5 B;  3WA9 D;  4KUD C;  1H3O A;  2Y2G A;  1P3F D;  3MVD B;  3AFA A;  5B0Z D;  4X23 D;  4M6B A;  5FUG A;  5AY8 C;  3AZH D;  1WWI A;  3AZF A;  4G91 B;  1B6W A;  1ID3 B;  1P3M A;  3TU4 C;  3AYW C;  2DQN C;  3REH B;  5B24 A;  5B0Y D;  3AFA D;  5JRG B;  2ZY3 A;  4NE6 A;  4WNN B;  5B2J B;  3MGP A;  3AZF D;  1P3K B;  1M18 C;  3AZN B;  3W98 B;  1P3M D;  3KUY C;  1ZLA C;  3LEL B;  4NE3 A;  4R8P A;  5AV8 A;  1P3I B;  2PYO B;  2LY8 A;  3KWQ B;  1KX4 B;  3MGP D;  1KX5 A;  4H9R A;  2J8P A;  3REL C;  1TAF B;  2F8N K;  3O62 B;  4ZUX A;  3C1C B;  4R8P D;  5AV8 D;  1HQ3 A;  5F99 C;  3KXB A;  1KX5 D;  3VH5 A;  4J8V C;  4J8U B;  3H0R C;  5GXQ B;  5B2I B;  1ULY A;  4H9S A;  4KHA B;  4ZUX D;  1M1A B;  1F66 B;  3AZJ B;  1P3L B;  2NZD A;  1HQ3 D;  1AOI C;  5B40 B;  5DNM B;  3AZM D;  3KXB D;  1BH9 A;  3NQJ A;  3X1U C;  4WZS B;  1T3U A;  4H9Q A;  2NZD D;  2NQB C;  4X23 C;  2Y2J A;  3B6F B;  3AZE D;  5G49 A;  3EPJ A;  4HGA C;  3UT9 B;  5B0Y C;  4EO5 C;  3AFA C;  5CPJ C;  1KX3 A;  2HIO B;  3UTA C;  1U35 B;  3C1B A;  4YS3 C;  4AWL C;  4Z66 C;  5B33 B;  2F8N H;  1P3M C;  1JFI A;  3IP4 C;  3W99 C;  4WU9 A;  1TZY C;  1KX3 D;  4XZQ A;  4CSR B;  4KGC B;  3C1B D;  3REK C;  5B32 G;  4H9N A;  3AZL B;  2F8N B;  5AVC A;  1EQZ D;  5JA4 B;  2FJ7 B;  4WU9 D;  2XD1 A;  4XZQ D;  4LD9 A;  5AY8 A;  4J8W C;  5BNX B;  5AVC D;  3AYW A;  3W96 A;  3LJA B;  3REJ B;  3AV1 B;  4LD9 D;  3AZM C;  5B31 G;  1F1E A;  3AZG B;  4UUZ B;  3KUY A;  1P3A B;  3AYW D;  4QLC B;  3W96 D;  3WKJ C;  5KDM B;  2BYM A;  4CAY A;  2NZD C;  2YFW B;  3MGR B;  2Y2M A;  4Z5T B;  5E5A B;  3KUY D;  5B1L B;  3REL A;  3X1T C;  3W97 D;  3AZE C;  2BG1 A;  2F2A C;  5F99 A;  1M19 A;  5GT0 B;  4KUD B;  4J8V A;  4J8X C;  5AV9 C;  1P3B D;  3REI B;  3REL D;  1BH8 B;  4JJN B;  3MGS C;  5C3I C;  1AOI A;  5F99 D;  1M19 D;  2BYK A;  3TU4 B;  5GSU A;  1A7W A; 
#chains in the Genus database with same CATH homology
 3X1S D;  2RVQ C;  3V9R A;  1EQZ C;  5AV5 B;  1M18 B;  4WU9 C;  2NQB A;  1P34 C;  3WAA C;  1AOI D;  4XZQ C;  3AV2 C;  1ZLA B;  3MGQ A;  5GSU D;  2G5I C;  2JSS A;  4WU8 A;  5B0Y A;  5DNN C;  2NQB D;  2CWE A;  5CPJ A;  3X1V B;  5B1M A;  4LD9 C;  3UTA A;  3B0D B;  3MGQ D;  3AZI C;  4YS3 A;  3WTP B;  4Z66 A;  3MNN B;  2CV5 B;  3LZ1 B;  2JCH A;  4WU8 D;  2YFV A;  3AZK A;  3W96 C;  3W99 A;  2XD5 A;  1TZY A;  5CPJ D;  2ARO C;  3NQU B;  3P5J B;  5B1M D;  2HUE C;  4XUJ B;  3UTA D;  3UTB A;  3W98 D;  3REK A;  4YS3 D;  4Z66 D;  1N1J B;  4H9O B;  4H9P A;  1S32 B;  3W97 C;  3LZ0 B;  3AZK D;  5AVB B;  3W99 D;  3X1U B;  1TZY D;  4YM6 C;  3VH5 T;  4J8W A;  3A1K A;  3UTB D;  3WA9 B;  3REK D;  1P3F B;  4G92 C;  1P3B C;  3C1C D;  5B0Z B;  4X23 B;  5CPK C;  3AZH B;  5B40 A;  5B31 C;  4J8W D;  3AZM A;  1M19 C;  2Y2I A;  3B6G A;  1H3O B;  3EG5 B;  3A6N C;  3AFA B;  3X1S C;  5FUG B;  3KSY A;  3WKJ A;  3AZF B;  5B40 D;  5DNM D;  2Y2L A;  1P3G C;  1Q9C A;  2Y2Q A;  5AV6 C;  3B6G D;  5GSU C;  5B24 B;  3EPK A;  2IO5 C;  3X1T A;  2F8N G;  3AZE A;  3MVD C;  3WKJ D;  3MGP B;  4G91 C;  3MGQ C;  4J8X A;  5AV9 A;  1ID3 C;  3X1T D;  4R8P B;  5AV8 B;  4WU8 C;  5JRG C;  1KX5 B;  2HIO D;  3MGS A;  4H9R B;  4WJ3 C;  5B1M C;  4J8X D;  3AZN C;  5AV9 D;  4ZUX B;  3W98 C;  1P3P A;  1HQ3 B;  4E45 A;  4DQY B;  1EQZ A;  4ZBJ B;  3KXB B;  3AZK C;  3MGS D;  1P3I C;  3KWQ C;  1P34 A;  3VH6 T;  3WAA A;  3AV2 A;  1W2E A;  3UTB C;  5BNV A;  2RVQ D;  1P3P D;  5BO0 A;  4WV4 B;  3O62 C;  3C1C C;  2NZD B;  1BH9 B;  2Y2H A;  3NQJ B;  5DNN A;  1P34 D;  3WAA D;  2ZM5 A;  4H9Q B;  3AV2 D;  1P3O A;  1R4V A;  4J8U C;  3VH6 A;  3AZI A;  1M1A C;  1F66 C;  3AZJ C;  1P3L C;  1BFM A;  5DNN D;  5B40 C;  5DNM C;  2ARO A;  1P3O D;  3B6G C;  5B32 A;  5G49 B;  3AZI D;  5CP6 A;  1KX3 B;  5GT3 A;  3W97 A;  3C1B B;  4YM6 A;  2ARO D;  5CPI A;  5B32 D;  1JFI B;  3AN2 A;  1P3B A;  5CP6 D;  4WU9 B;  4XZQ B;  5GT3 D;  2Y2P A;  5CPK A;  3UT9 C;  5B31 A;  2HIO C;  4YM6 D;  5CPI D;  4H9N B;  3R45 A;  1U35 C;  5AVC B;  4DRA A;  3A6N A;  3AN2 D;  4NFT A;  3X1S A;  4LD9 B;  5AY8 B;  5CPK D;  5B31 D;  1P3G A;  4KGC C;  1Z2C B;  5AV6 A;  3AYW B;  3A6N D;  3W96 B;  2FJ7 C;  1P3P C;  2HUE B;  3MVD A;  1HTA A;  1P3G D;  5AV6 D;  3KUY B;  2L5A A;  2Y2O A;  3H0M C;  1ID3 A;  3EPH A;  2VQR A;  2BYM B;  4CAY B;  3REH A;  2Y2K A;  3LJA C;  3MVD D;  3REJ C;  5JRG A;  3AV1 C;  4WNN A;  5B2J A;  1P3K A;  3REL B;  3VH5 W;  1P3O C;  3B0C T;  3AZG C;  3AZN A;  1ID3 D;  3W98 A;  3LEL A;  3REH D;  4QLC C;  5F99 B;  1M19 B;  5JRG D;  4J8V B;  1P3I A;  2PYO A;  4XUJ D;  3KWQ A;  1KX4 A;  5B2J D;  1P3K D;  3MGR C;  3AZN D;  5B32 C;  4Z5T C;  5B1L C;  3LEL D;  1S32 D;  1TAF A;  5CP6 C;  3O62 A;  1AOI B;  3C1C A;  1B67 A;  2BYK B;  5GT3 C;  5CHL B;  1P3I D;  5GSU B;  2PYO D;  3KWQ D;  1KX4 D;  5GT0 C;  5CPI C;  3V9R B;  4J8U A;  3REI C;  5GXQ A;  5B2I A;  3AN2 C;  2DF4 C;  2NQB B;  4KHA A;  3O62 D;  1M1A A;  1F66 A;  4JJN C;  3AZJ A;  3MGQ B;  1P3L A;  4Z2M H;  5DNM A;  4J8U D;  5BT1 D;  4WU8 B;  5GXQ D;  5B2I D;  4HGA B;  5B0Y B;  4EO5 B;  5CPJ B;  5AV5 C;  1M1A D;  1F66 D;  5B1M B;  3UTA B;  3AZJ D;  1P3L D;  1WWS A;  5BS7 C;  4YS3 B;  4AWL B;  4Z66 B;  2UWX A;  1P3M B;  5B24 D;  3B6F A;  2YFV B;  3AZK B;  3W99 B;  1TZY B;  3EPL A;  3UT9 A;  3UTB B;  3REK B;  2HIO A;  3X1V C;  3B0D C;  1U35 A;  3B6F D;  3VH6 W;  4H9P B;  3WTP C;  5B33 A;  3MNN C;  4DRB A;  3LZ1 C;  2CV5 C;  4J8W B;  3REH C;  3UT9 D;  4CSR A;  4XUJ C;  4KGC A;  5B2J C;  1U35 D;  1P3K C;  5B33 D;  3AZL A;  2F8N A;  3LEL C;  1S32 C;  5JA4 A;  3LZ0 C;  2FJ7 A;  5AVB C;  3AZM B;  3B6G B;  2PYO C;  4KGC D;  1KX4 C;  3WA9 C;  5BNX A;  1P3F C;  3AZL D;  2F8N D;  3WKJ B;  5B0Z C;  2FJ7 D;  3LJA A;  3AZH C;  3REJ A;  3AV1 A;  4UPK A;  3X1T B;  3AZG A;  3AZE B;  5BT1 C;  4UUZ A;  5GXQ C;  5B2I C;  1P3A A;  4QLC A;  3LJA D;  3REJ D;  3AZF C;  5KDM A;  4J8X B;  3FDD A;  5AV9 B;  3AV1 D;  2YFW A;  3MGR A;  3WTP E;  3AZG D;  5B24 C;  3F6T A;  4Z5T A;  5E5A A;  5B1L A;  1P3A D;  3MGS B;  5C3I B;  2ZY4 A;  4QLC D;  3MGP C;  2ZY5 A;  5GT0 A;  4KUD A;  3MGR D;  3H0L C;  1P3P B;  1EQZ B;  3B6F C;  4Z5T D;  5E5A D;  3REI A;  5B1L D;  4R8P C;  5AV8 C;  3B0B A;  1P34 B;  3WAA B;  1BH8 A;  3AV2 B;  4JJN A;  1KX5 C;  5GT0 D;  5BNV B;  4KUD D;  3TU4 A;  5BO0 B;  3A1I A;  4ZUX C;  3REI D;  3KFU G;  5B33 C;  5AY8 D;  1HQ3 C;  5DNN B;  4ZBJ C;  5AV5 A;  3KXB C;  4JJN D;  1P3O B;  1M18 A;  3AZI B;  1ZLA A;  5BS7 A;  3TU4 D;  3AL0 C;  4H9S C;  3B0C W;  3AZL C;  5AV5 D;  2ARO B;  1M18 D;  5B32 B;  3X1V A;  1ZLA D;  1PZR A;  5CP6 B;  4E44 A;  5GT3 B;  4NE5 A;  3W97 B;  3WTP A;  3MNN A;  2CV5 A;  3LZ1 A;  4YM6 B;  5CPI B;  2Y2N A;  2JE5 A;  2ZY2 A;  3AN2 B;  3NQU A;  3X1V D;  4XUJ A;  4G92 B;  2G5H C;  1P3B B;  3WTP D;  5CPK B;  3MNN D;  2CV5 D;  3LZ1 D;  1KX3 C;  1N1J A;  4H9O A;  5B31 B;  1S32 A;  1P3A C;  3LZ0 A;  4J8V D;  3R45 B;  5AVB A;  3X1U A;  3C1B C;  3A6N B;  2FFF B;  4Z2M G;  1KU5 A;  2W8S A;  3WA9 A;  3X1S B;  2RIQ A;  1P3F A;  5E5A C;  5B0Z A;  4X23 A;  1P3G B;  3LZ0 D;  3AZH A;  5AVB D;  5AV6 B;  3X1U D;  5AVC C;  2IO5 B;  3WA9 D;  4KUD C;  1H3O A;  2Y2G A;  1P3F D;  3MVD B;  3AFA A;  5B0Z D;  4X23 D;  4M6B A;  5FUG A;  5AY8 C;  3AZH D;  1WWI A;  3AZF A;  4G91 B;  1B6W A;  1ID3 B;  1P3M A;  3TU4 C;  3AYW C;  2DQN C;  3REH B;  5B24 A;  5B0Y D;  3AFA D;  5JRG B;  2ZY3 A;  4NE6 A;  4WNN B;  5B2J B;  3MGP A;  3AZF D;  1P3K B;  1M18 C;  3AZN B;  3W98 B;  1P3M D;  3KUY C;  1ZLA C;  3LEL B;  4NE3 A;  4R8P A;  5AV8 A;  1P3I B;  2PYO B;  2LY8 A;  3KWQ B;  1KX4 B;  3MGP D;  1KX5 A;  4H9R A;  2J8P A;  3REL C;  1TAF B;  2F8N K;  3O62 B;  4ZUX A;  3C1C B;  4R8P D;  5AV8 D;  1HQ3 A;  5F99 C;  3KXB A;  1KX5 D;  3VH5 A;  4J8V C;  4J8U B;  3H0R C;  5GXQ B;  5B2I B;  1ULY A;  4H9S A;  4KHA B;  4ZUX D;  1M1A B;  1F66 B;  3AZJ B;  1P3L B;  2NZD A;  1HQ3 D;  1AOI C;  5B40 B;  5DNM B;  3AZM D;  3KXB D;  1BH9 A;  3NQJ A;  3X1U C;  4WZS B;  1T3U A;  4H9Q A;  2NZD D;  2NQB C;  4X23 C;  2Y2J A;  3B6F B;  3AZE D;  5G49 A;  3EPJ A;  4HGA C;  3UT9 B;  5B0Y C;  4EO5 C;  3AFA C;  5CPJ C;  1KX3 A;  2HIO B;  3UTA C;  1U35 B;  3C1B A;  4YS3 C;  4AWL C;  4Z66 C;  5B33 B;  2F8N H;  1P3M C;  1JFI A;  3IP4 C;  3W99 C;  4WU9 A;  1TZY C;  1KX3 D;  4XZQ A;  4CSR B;  4KGC B;  3C1B D;  3REK C;  5B32 G;  4H9N A;  3AZL B;  2F8N B;  5AVC A;  1EQZ D;  5JA4 B;  2FJ7 B;  4WU9 D;  2XD1 A;  4XZQ D;  4LD9 A;  5AY8 A;  4J8W C;  5BNX B;  5AVC D;  3AYW A;  3W96 A;  3LJA B;  3REJ B;  3AV1 B;  4LD9 D;  3AZM C;  5B31 G;  1F1E A;  3AZG B;  4UUZ B;  3KUY A;  1P3A B;  3AYW D;  4QLC B;  3W96 D;  3WKJ C;  5KDM B;  2BYM A;  4CAY A;  2NZD C;  2YFW B;  3MGR B;  2Y2M A;  4Z5T B;  5E5A B;  3KUY D;  5B1L B;  3REL A;  3X1T C;  3W97 D;  3AZE C;  2BG1 A;  2F2A C;  5F99 A;  1M19 A;  5GT0 B;  4KUD B;  4J8V A;  4J8X C;  5AV9 C;  1P3B D;  3REI B;  3REL D;  1BH8 B;  4JJN B;  3MGS C;  5C3I C;  1AOI A;  5F99 D;  1M19 D;  2BYK A;  3TU4 B;  5GSU A;  1A7W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...