4Z66B

Nucleosome disassembly by rsc and swi/snf is enhanced by h3 acetylation near the nucleosome dyad axis
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
79
structure length
79
Chain Sequence
DNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords Histone H3.2
publication title Histone Acetylation near the Nucleosome Dyad Axis Enhances Nucleosome Disassembly by RSC and SWI/SNF.
pubmed doi rcsb
source organism Xenopus laevis
total genus 27
structure length 79
sequence length 79
chains with identical sequence F
ec nomenclature
pdb deposition date 2015-04-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4z66B00
4J8XB 3UTBB 3UTAA 1P3GA 2RVQD 4KUDD 3UTAC 3X1TA 4YS3A 1P3IB 5AVCA 5CPKA 5DNNB 4G92B 3X1TC 4Z66B 5AVCC 3AZJC 5CPKC 1ULYA 3REID 4X23B 5AY8A 1P3FC 3REJD 3WAAD 5F99B 2PYOB 3AZEA 3VH5A 1BH9A 4J8XA 1P3LD 3UTBD 4DRBA 1P3MD 4J8XC 3UTBC 5GT3B 1P3IA 3MVDA 5B24A 1P3IC 5DNND 3MVDC 4G92C 3WKJB 5B24C 4Z66C 4X23A 5CPIA 5B31B 2F8NB 4X23C 4ZUXB 4QLCA 3AN2A 4QLCC 4H9NA 5F99D 3AN2C 2PYOC 2NZDA 1BH8A 5GT3C 4LD9A 4J8UA 1F66B 4J8VA 3WTPA 5AVBA 4J8VC 3WKJC 3WTPC 5AVBC 3LJAD 5B31D 2F8ND 5KDMA 4WNNA 4ZUXC 1B67A 5B0ZA 1KX5D 1P3BB 3A6NB 1F66D 5BT1D 3AYWA 1M18B 3UT9A 1TZYA 4Z5TB 4WU8A 3AYWC 3UT9C 1HQ3D 1U35B 2AROB 4H9PA 3TU4A 3REHA 5AV5B 3NQUB 3KUYB 3REHC 5CP6B 4XUJA 5B40D 3A6ND 1P3BC 1S32A 4Z5TA 1M18C 1S32C 5BO0A 3AZLA 5CPJD 4Z5TC 3AZIB 1U35D 2AROD 4KGCA 1M19A 5AV5A 1R4VA 2IO5C 1M19C 3B6GB 5AV5C 1N1JA 3X1SD 3KUYD 5B33B 2JSSA 5CP6D 5AV8A 3B0CT 5B0YA 3AV2B 1P34B 3LZ0A 3LELD 2BYMB 2BYKB 3REKB 3KXBB 3AZNA 3AZIC 2FJ7B 2CWEA 3V9RB 3X1UA 2NQBB 4XZQA 3B6GC 4UUZA 3X1UC 5B2IA 4XZQC 5GT0B 5B33C 5B31G 2F8NG 3AFAD 3AV2A 1P34A 5B1LD 3AZMA 3AV2C 1P34C 4WV4B 3O62B 3AZMC 4E44A 3WTPE 3REKC 3KXBC 5G49B 2FJ7C 1KX4A 2NQBD 4NE3A 1KX4C 1ZLAB 5B32A 4JJNB 3AV1B 1ID3D 3KSYA 5GT0C 3AZFD 3O62A 3O62C 1WWSA 1P3KB 4NFTA 3C1BA 2HIOA 3MGSD 3MGRA 5AV9D 3REJB 5DNMA 1KX3A 1ZLAD 3C1BC 3VH6W 4JJND 3AV1D 5B1MB 3WAAB 1KX3C 3B6FA 5GSUB 4H9SA 4H9SC 1P3MB 4WU9D 2YFWB 4KUDA 1H3OB 5JRGD 2RVQC 1EQZD 4KUDC 4CSRB 3AZJA 1F1EA 3REIA 1P3FA 4CAYA 1HTAA 1P3KD 3LZ1D 1B6WA 3REIC 3REJA 3REJC 5B1MD 4H9RA 3WAAC 5GSUD 5FUGB 3AZGD 1P3LA 3UTBA 3KWQB 4G91B 1P3LC 1WWIA 1P3MC 4J8WB 5DNNA 3MGQD 4Z66A 1M1AB 5DNNC 5B2JB 3LJAB 5BNVB 4YS3D 5F99A 2PYOA 3VH5T 5F99C 5AY8D 3KWQD 1KX5B 5GT3A 4J8WD 4AWLB 3AZED 3WKJA 1M1AD 4H9QB 5B2JD 5B31A 2F8NA 4ZUXA 3LJAC 1HQ3B 5B31C 1KX5A 5CPID 3AZKB 5E5AB 1KX5C 3X1VB 5B40B 1F66A 1F66C 4EO5B 5BT1C 2NZDD 5CPJB 1HQ3C 4J8UD 4LD9D 3W96B 4R8PD 3X1SB 3AZKD 5E5AD 1P3BA 3X1VD 3A6NA 3X1VC 5B40C 3A6NC 5C3IB 1M18A 3LELB 1P3OB 3MNNB 5B0ZD 1U35A 5CPJC 2AROA 1JFIB 1U35C 3W96D 2AROC 3WA9B 3NQUA 1TZYD 3KUYA 5CP6A 4KHAB 3X1SC 3KUYC 5CP6C 3AFAB 5BS7C 3TU4D 5B1LB 5C3IC 3MNND 1P3OD 3LELC 1P3AB 3AZIA 3WA9D 5AV6B 1TAFB 3WA9C 3B6GA 4KHAA 2F8NK 3AZLD 5B33A 3AFAA 1ID3B 5B1LA 4Z2MH 3AFAC 2BYMA 3AZFB 5B1LC 5GXQB 5AV8D 2BYKA 1P3AD 3REKA 3R45B 3KXBA 1AOIB 2FJ7A 5B0YD 3VH6A 5AV6D 4ZBJB 3V9RA 3LZ0D 2NQBA 3B0CW 3MGSB 5AV9B 3W99B 2NQBC 2CV5B 5GT0A 3C1CB 3AZND 1ID3C 3AZFA 4WU9B 5JRGB 3AZFC 4NE6A 1EQZB 5GXQD 4YM6B 1AOID 1P3PB 5G49A 3LZ1B 3W97B 3MGSA 1ZLAA 3W99D 3MGSC 5AV9C 4JJNA 3AV1A 2CV5D 1ZLAC 4NE5A 3C1CD 4JJNC 3AV1C 2LY8A 2YFVB 3AZGB 3AZHB 3RELB 4WU9C 3W98D 5JRGC 5B32D 4YM6D 5JA4B 3MGQB 1EQZC 1P3PD 1P3KA 3MGPD 1P3GB 1P3KC 3LZ1C 3W97D 3X1TB 4YS3B 5CPKB 3WAAA 5B1MA 5GSUA 3AZGA 2YFVA 5B1MC 4Z2MG 5GSUC 3AZGC 5AY8B 2YFWA 3AZHD 1P3MA 3RELD 1H3OA 2HIOD 3MGRD 5DNMD 4CSRA 5JA4A 2HUEB 3AZEB 3B6FD 3MGQC 1BH9B 3UTAD 3NQJB 1P3GD 1P3GC 3X1TD 3MVDB 5AVCD 5B24B 4YS3C 3AZJD 5CPKD 5FUGA 1P3FD 3KWQA 5CPIB 3B0DB 5AY8C 4G91C 4QLCB 3KWQC 4J8WA 3AN2B 4H9NB 2HUEC 1M1AA 4J8WC 5B2JA 3AZEC 4J8XD 3NQJA 1M1AC 3LJAA 2NZDB 1BH8B 5B2JC 5BNVA 1P3ID 3MVDD 4LD9B 4J8UB 5B24D 4Z66D 4J8VB 3WTPB 5AVBB 4R8PB 4X23D 5KDMB 5CPIC 4QLCD 4WNNB 3B0DC 3AN2D 2PYOD 4H9QA 4AWLC 4E45A 5B0ZB 2NZDC 5GT3D 1HQ3A 3VH5W 4J8VD 4R8PA 4J8UC 3WKJD 3WTPD 5AVBD 3AYWB 4LD9C 3UT9B 5B32G 1TZYB 4R8PC 4WU8B 3AZKA 1KU5A 4ZUXD 5E5AA 5BNXB 3X1VA 3AZKC 2L5AA 5B40A 5E5AC 4H9PB 3TU4B 3REHB 4EO5C 5CPJA 5B0ZC 4XUJB 3W96A 2F8NH 3W96C 3AYWD 1S32B 3UT9D 4WU8D 3X1SA 5BO0B 5BNXA 1TZYC 1A7WA 3AZLB 4WU8C 3B0BA 5BS7A 2IO5B 4KGCB 1M19B 3REHD 3LELA 3TU4C 3MNNA 1P3OA 1N1JB 5AV8B 3MNNC 1P3OC 4XUJD 1P3BD 1JFIA 4XUJC 4HGAB 5B0YB 3WA9A 4H9OB 1M18D 1S32D 3LZ0B 4Z5TD 4DRAA 3AZLC 3AZNB 5CHLB 4KGCD 1M19D 4KGCC 5AV5D 3X1UB 4XZQB 4UUZB 1P3AA 5B2IB 5AV8C 1P3AC 4H9OA 1Q9CA 5AV6A 4HGAC 5B0YC 1TAFA 3AZMB 5AV6C 3LZ0C 3AZID 1ID3A 1BFMA 3AZNC 1KX4B 3B6GD 3X1UD 3W98B 5GXQA 4XZQD 5B33D 5B32B 4M6BA 3R45A 5B2ID 5GXQC 1AOIA 5B2IC 3VH6T 3MGPB 3AV2D 1AOIC 1P34D 3AZMD 3W99A 5AV9A 4ZBJC 2CV5A 3W99C 3C1CA 3REKD 3KXBD 2CV5C 2FJ7D 3C1CC 4WZSB 1KX4D 4WU9A 3C1BB 2HIOB 5JRGA 3MGRB 3W98A 1EQZA 5DNMB 1KX3B 4YM6A 3W98C 5GT0D 5B32C 3B6FB 4YM6C 1P3PA 3MGPA 3LZ1A 3UTAB 1P3PC 3W97A 3MGPC 4KUDB 3O62D 3W97C 5AVCB 3AZJB 3REIB 1P3FB 4CAYB 3AZHA 3RELA 3C1BD 3AZHC 3RELC 2HIOC 3MGRC 1KX3D 5DNMC 3MGQA 4H9RB 1P3LB 3B6FC
chains in the Genus database with same CATH superfamily
4J8XB 3UTBB 3UTAA 1P3GA 2RVQD 4KUDD 3UTAC 3X1TA 4YS3A 1P3IB 5AVCA 5CPKA 5DNNB 4G92B 3X1TC 4Z66B 5AVCC 3AZJC 5CPKC 1ULYA 3REID 4X23B 5AY8A 1P3FC 3REJD 2RIQA 3WAAD 2ZY3A 5F99B 2PYOB 3AZEA 3VH5A 1BH9A 4J8XA 1P3LD 3UTBD 4DRBA 1P3MD 4J8XC 3UTBC 5GT3B 1P3IA 3MVDA 3EG5B 5B24A 1P3IC 5DNND 3MVDC 4G92C 3WKJB 5B24C 4Z66C 4X23A 5CPIA 2W8SA 5B31B 2F8NB 2Y2LA 4X23C 4ZUXB 4QLCA 3AN2A 4QLCC 4H9NA 5F99D 3AN2C 2PYOC 2NZDA 1BH8A 5GT3C 4LD9A 4J8UA 1F66B 4J8VA 3WTPA 5AVBA 4J8VC 1Z2CB 3WKJC 3WTPC 5AVBC 3LJAD 5B31D 2F8ND 5KDMA 2Y2HA 4WNNA 1W2EA 1B67A 4ZUXC 2VQRA 5B0ZA 1KX5D 2XD1A 1P3BB 3A6NB 1F66D 3FDDA 5BT1D 3AYWA 1M18B 3UT9A 1TZYA 3IP4C 4Z5TB 4WU8A 3AYWC 3UT9C 1HQ3D 1U35B 2AROB 4H9PA 2Y2JA 3TU4A 3REHA 5AV5B 3NQUB 3KUYB 3REHC 5CP6B 4XUJA 5B40D 3A6ND 1P3BC 1S32A 4Z5TA 1M18C 1S32C 5BO0A 3AZLA 5CPJD 4Z5TC 3AZIB 1U35D 2AROD 4KGCA 2FFFB 1M19A 5AV5A 1R4VA 2IO5C 1M19C 3B6GB 5AV5C 1N1JA 3X1SD 3KUYD 5B33B 2JSSA 5CP6D 5AV8A 3B0CT 5B0YA 4DQYB 2UWXA 3AV2B 1P34B 3LZ0A 3LELD 2BYMB 2BYKB 3REKB 3KXBB 2BG1A 3AZNA 3AZIC 2FJ7B 3H0RC 2CWEA 3V9RB 3X1UA 2NQBB 4XZQA 3B6GC 4UUZA 3X1UC 5B2IA 4XZQC 5GT0B 5B33C 5B31G 2F8NG 3AFAD 3AV2A 1P34A 5B1LD 3AZMA 3AV2C 1P34C 4WV4B 3O62B 3AZMC 4E44A 3WTPE 3REKC 3KXBC 5G49B 2FJ7C 1KX4A 2NQBD 3H0MC 4NE3A 1KX4C 1ZLAB 5B32A 4JJNB 3AV1B 2Y2PA 1ID3D 3KSYA 5GT0C 3AZFD 3O62A 3O62C 1WWSA 3EPHA 1P3KB 4NFTA 3C1BA 2HIOA 3MGSD 3MGRA 5AV9D 3REJB 5DNMA 1KX3A 1ZLAD 3C1BC 3VH6W 4JJND 3AV1D 5B1MB 3WAAB 1KX3C 3B6FA 5GSUB 4H9SA 4H9SC 1P3MB 4WU9D 2YFWB 4KUDA 2F2AC 1H3OB 5JRGD 2RVQC 1EQZD 4KUDC 4CSRB 3AZJA 1F1EA 3REIA 1P3FA 4CAYA 1HTAA 1P3KD 3LZ1D 1B6WA 3REIC 3REJA 3REJC 5B1MD 4H9RA 3WAAC 5GSUD 5FUGB 3AZGD 1P3LA 3UTBA 3KWQB 4G91B 1P3LC 3AL0C 1WWIA 1P3MC 4J8WB 5DNNA 3MGQD 4Z66A 1M1AB 5DNNC 2ZM5A 5B2JB 3P5JB 3LJAB 5BNVB 4YS3D 5F99A 2PYOA 3VH5T 5F99C 5AY8D 3KWQD 1KX5B 5GT3A 4J8WD 4AWLB 3AZED 3WKJA 1M1AD 4H9QB 5B2JD 5B31A 2F8NA 4ZUXA 3LJAC 1HQ3B 5B31C 1KX5A 5CPID 3AZKB 5E5AB 1KX5C 3X1VB 5B40B 1F66A 1F66C 4EO5B 5BT1C 2NZDD 5CPJB 1HQ3C 4J8UD 4LD9D 3W96B 4R8PD 1PZRA 4WJ3C 3X1SB 3AZKD 5E5AD 1P3BA 3X1VD 3A6NA 3X1VC 5B40C 3A6NC 5C3IB 1M18A 3LELB 1P3OB 3MNNB 5B0ZD 1U35A 5CPJC 2AROA 1JFIB 1U35C 3W96D 2AROC 3WA9B 3NQUA 1TZYD 3KUYA 5CP6A 4KHAB 3X1SC 3KUYC 5CP6C 3AFAB 5BS7C 3TU4D 5B1LB 5C3IC 3MNND 1P3OD 3LELC 1P3AB 3AZIA 3WA9D 5AV6B 1TAFB 3WA9C 3B6GA 4KHAA 2F8NK 3AZLD 5B33A 2ZY2A 3AFAA 2G5HC 1ID3B 5B1LA 4Z2MH 3AFAC 2BYMA 3AZFB 5B1LC 2XD5A 5GXQB 5AV8D 2BYKA 1P3AD 3REKA 3R45B 3KXBA 1AOIB 2FJ7A 5B0YD 3VH6A 5AV6D 4ZBJB 3V9RA 3LZ0D 2NQBA 3B0CW 3MGSB 5AV9B 3W99B 2NQBC 2CV5B 5GT0A 3C1CB 3EPLA 3AZND 1ID3C 3AZFA 4WU9B 5JRGB 3AZFC 4NE6A 1EQZB 5GXQD 4YM6B 1AOID 1P3PB 5G49A 3LZ1B 3W97B 3MGSA 1ZLAA 3W99D 3MGSC 5AV9C 4JJNA 3AV1A 2CV5D 1ZLAC 4NE5A 3C1CD 4JJNC 3AV1C 2LY8A 2YFVB 3AZGB 3AZHB 3RELB 4WU9C 3W98D 5JRGC 5B32D 4YM6D 5JA4B 3MGQB 1EQZC 2ZY4A 1P3PD 3EPKA 3MGPD 1P3KA 4LD9C 2ZY5A 1P3GB 1P3KC 3LZ1C 3W97D 2G5IC 3X1TB 4YS3B 5CPKB 3WAAA 5B1MA 5GSUA 3AZGA 2YFVA 5B1MC 4Z2MG 5GSUC 3AZGC 5AY8B 2YFWA 3AZHD 1P3MA 3RELD 1H3OA 2HIOD 3MGRD 5DNMD 4CSRA 5JA4A 2HUEB 3AZEB 3B6FD 3MGQC 1BH9B 3UTAD 3NQJB 1P3GD 1P3GC 3X1TD 3MVDB 5AVCD 5B24B 4YS3C 3AZJD 5CPKD 5FUGA 1P3FD 3KWQA 2Y2MA 5CPIB 3B0DB 5AY8C 4G91C 4QLCB 3KWQC 4J8WA 3AN2B 4H9NB 2HUEC 1M1AA 4J8WC 5B2JA 3AZEC 4J8XD 3NQJA 1M1AC 3LJAA 2NZDB 1BH8B 5B2JC 5BNVA 1P3ID 3MVDD 4LD9B 4J8UB 5B24D 4Z66D 4J8VB 3WTPB 5AVBB 4R8PB 2DF4C 4X23D 5KDMB 5CPIC 4QLCD 4WNNB 3B0DC 3AN2D 2PYOD 4H9QA 4AWLC 4E45A 5B0ZB 2NZDC 5GT3D 2Y2IA 1HQ3A 3VH5W 4J8VD 4R8PA 2J8PA 3H0LC 3WTPD 5AVBD 4J8UC 3AYWB 3WKJD 3UT9B 5B32G 1TZYB 4R8PC 4WU8B 3AZKA 1KU5A 4ZUXD 5E5AA 5BNXB 3X1VA 3AZKC 2L5AA 5B40A 5E5AC 4H9PB 3TU4B 3REHB 4EO5C 5CPJA 5B0ZC 4XUJB 4UPKA 3W96A 2F8NH 3W96C 3AYWD 1S32B 3UT9D 4WU8D 3X1SA 5BO0B 5BNXA 1TZYC 1A7WA 3AZLB 4WU8C 3B0BA 5BS7A 2IO5B 4KGCB 1M19B 3REHD 3LELA 3TU4C 3MNNA 2Y2NA 1P3OA 1N1JB 5AV8B 3MNNC 1P3OC 4XUJD 1P3BD 1JFIA 4XUJC 4HGAB 5B0YB 3WA9A 4H9OB 1M18D 1S32D 3LZ0B 4Z5TD 4DRAA 3AZLC 3AZNB 5CHLB 4KGCD 1M19D 4KGCC 2JE5A 5AV5D 3X1UB 3A1IA 2Y2OA 4XZQB 3KFUG 4UUZB 1P3AA 5B2IB 5AV8C 3EPJA 1P3AC 4H9OA 1Q9CA 5AV6A 4HGAC 5B0YC 1TAFA 3AZMB 5AV6C 3F6TA 3LZ0C 3AZID 1ID3A 1BFMA 3AZNC 1KX4B 3A1KA 3B6GD 3X1UD 3W98B 4XZQD 5B33D 5GXQA 5B32B 4M6BA 3R45A 5B2ID 5GXQC 1AOIA 5B2IC 3VH6T 3MGPB 3AV2D 1AOIC 1P34D 3AZMD 3W99A 5AV9A 2DQNC 4ZBJC 2CV5A 3W99C 2Y2GA 3C1CA 3REKD 3KXBD 2Y2QA 2CV5C 2FJ7D 3C1CC 4WZSB 1KX4D 4WU9A 1T3UA 3C1BB 2HIOB 5JRGA 3MGRB 3W98A 1EQZA 5DNMB 1KX3B 4YM6A 3W98C 5GT0D 5B32C 3B6FB 4YM6C 1P3PA 3MGPA 3LZ1A 3UTAB 1P3PC 3W97A 3MGPC 4KUDB 3O62D 3W97C 5AVCB 3AZJB 2JCHA 3REIB 1P3FB 4CAYB 2Y2KA 3AZHA 3RELA 3C1BD 3AZHC 3RELC 2HIOC 3MGRC 1KX3D 5DNMC 3MGQA 4H9RB 1P3LB 3B6FC
chains in the Genus database with same CATH topology
4J8XB 3UTBB 3UTAA 1P3GA 2RVQD 4KUDD 3UTAC 3X1TA 4YS3A 1P3IB 5AVCA 5CPKA 5DNNB 4G92B 3X1TC 4Z66B 5AVCC 3AZJC 5CPKC 1ULYA 3REID 4X23B 5AY8A 1P3FC 3REJD 2RIQA 3WAAD 2ZY3A 5F99B 2PYOB 3AZEA 3VH5A 1BH9A 4J8XA 1P3LD 3UTBD 4DRBA 1P3MD 4J8XC 3UTBC 5GT3B 1P3IA 3MVDA 3EG5B 5B24A 1P3IC 5DNND 3MVDC 4G92C 3WKJB 5B24C 4Z66C 4X23A 5CPIA 2W8SA 5B31B 2F8NB 2Y2LA 4X23C 4ZUXB 4QLCA 3AN2A 4QLCC 4H9NA 5F99D 3AN2C 2PYOC 2NZDA 1BH8A 5GT3C 4LD9A 4J8UA 1F66B 4J8VA 3WTPA 5AVBA 4J8VC 1Z2CB 3WKJC 3WTPC 5AVBC 3LJAD 5B31D 2F8ND 5KDMA 2Y2HA 4WNNA 1W2EA 1B67A 4ZUXC 2VQRA 5B0ZA 1KX5D 2XD1A 1P3BB 3A6NB 1F66D 3FDDA 5BT1D 3AYWA 1M18B 3UT9A 1TZYA 3IP4C 4Z5TB 4WU8A 3AYWC 3UT9C 1HQ3D 1U35B 2AROB 4H9PA 2Y2JA 3TU4A 3REHA 5AV5B 3NQUB 3KUYB 3REHC 5CP6B 4XUJA 5B40D 3A6ND 1P3BC 1S32A 4Z5TA 1M18C 1S32C 5BO0A 3AZLA 5CPJD 4Z5TC 3AZIB 1U35D 2AROD 4KGCA 2FFFB 1M19A 5AV5A 1R4VA 2IO5C 1M19C 3B6GB 5AV5C 1N1JA 3X1SD 3KUYD 5B33B 2JSSA 5CP6D 5AV8A 3B0CT 5B0YA 4DQYB 2UWXA 3AV2B 1P34B 3LZ0A 3LELD 2BYMB 2BYKB 3REKB 3KXBB 2BG1A 3AZNA 3AZIC 2FJ7B 3H0RC 2CWEA 3V9RB 3X1UA 2NQBB 4XZQA 3B6GC 4UUZA 3X1UC 5B2IA 4XZQC 5GT0B 5B33C 5B31G 2F8NG 3AFAD 3AV2A 1P34A 5B1LD 3AZMA 3AV2C 1P34C 4WV4B 3O62B 3AZMC 4E44A 3WTPE 3REKC 3KXBC 5G49B 2FJ7C 1KX4A 2NQBD 3H0MC 4NE3A 1KX4C 1ZLAB 5B32A 4JJNB 3AV1B 2Y2PA 1ID3D 3KSYA 5GT0C 3AZFD 3O62A 3O62C 1WWSA 3EPHA 1P3KB 4NFTA 3C1BA 2HIOA 3MGSD 3MGRA 5AV9D 3REJB 5DNMA 1KX3A 1ZLAD 3C1BC 3VH6W 4JJND 3AV1D 5B1MB 3WAAB 1KX3C 3B6FA 5GSUB 4H9SA 4H9SC 1P3MB 4WU9D 2YFWB 4KUDA 2F2AC 1H3OB 5JRGD 2RVQC 1EQZD 4KUDC 4CSRB 3AZJA 1F1EA 3REIA 1P3FA 4CAYA 1HTAA 1P3KD 3LZ1D 1B6WA 3REIC 3REJA 3REJC 5B1MD 4H9RA 3WAAC 5GSUD 5FUGB 3AZGD 1P3LA 3UTBA 3KWQB 4G91B 1P3LC 3AL0C 1WWIA 1P3MC 4J8WB 5DNNA 3MGQD 4Z66A 1M1AB 5DNNC 2ZM5A 5B2JB 3P5JB 3LJAB 5BNVB 4YS3D 5F99A 2PYOA 3VH5T 5F99C 5AY8D 3KWQD 1KX5B 5GT3A 4J8WD 4AWLB 3AZED 3WKJA 1M1AD 4H9QB 5B2JD 5B31A 2F8NA 4ZUXA 3LJAC 1HQ3B 5B31C 1KX5A 5CPID 3AZKB 5E5AB 1KX5C 3X1VB 5B40B 1F66A 1F66C 4EO5B 5BT1C 2NZDD 5CPJB 1HQ3C 4J8UD 4LD9D 3W96B 4R8PD 1PZRA 4WJ3C 3X1SB 3AZKD 5E5AD 1P3BA 3X1VD 3A6NA 3X1VC 5B40C 3A6NC 5C3IB 1M18A 3LELB 1P3OB 3MNNB 5B0ZD 1U35A 5CPJC 2AROA 1JFIB 1U35C 3W96D 2AROC 3WA9B 3NQUA 1TZYD 3KUYA 5CP6A 4KHAB 3X1SC 3KUYC 5CP6C 3AFAB 5BS7C 3TU4D 5B1LB 5C3IC 3MNND 1P3OD 3LELC 1P3AB 3AZIA 3WA9D 5AV6B 1TAFB 3WA9C 3B6GA 4KHAA 2F8NK 3AZLD 5B33A 2ZY2A 3AFAA 2G5HC 1ID3B 5B1LA 4Z2MH 3AFAC 2BYMA 3AZFB 5B1LC 2XD5A 5GXQB 5AV8D 2BYKA 1P3AD 3REKA 3R45B 3KXBA 1AOIB 2FJ7A 5B0YD 3VH6A 5AV6D 4ZBJB 3V9RA 3LZ0D 2NQBA 3B0CW 3MGSB 5AV9B 3W99B 2NQBC 2CV5B 5GT0A 3C1CB 3EPLA 3AZND 1ID3C 3AZFA 4WU9B 5JRGB 3AZFC 4NE6A 1EQZB 5GXQD 4YM6B 1AOID 1P3PB 5G49A 3LZ1B 3W97B 3MGSA 1ZLAA 3W99D 3MGSC 5AV9C 4JJNA 3AV1A 2CV5D 1ZLAC 4NE5A 3C1CD 4JJNC 3AV1C 2LY8A 2YFVB 3AZGB 3AZHB 3RELB 4WU9C 3W98D 5JRGC 5B32D 4YM6D 5JA4B 3MGQB 1EQZC 2ZY4A 1P3PD 3EPKA 3MGPD 1P3KA 4LD9C 2ZY5A 1P3GB 1P3KC 3LZ1C 3W97D 2G5IC 3X1TB 4YS3B 5CPKB 3WAAA 5B1MA 5GSUA 3AZGA 2YFVA 5B1MC 4Z2MG 5GSUC 3AZGC 5AY8B 2YFWA 3AZHD 1P3MA 3RELD 1H3OA 2HIOD 3MGRD 5DNMD 4CSRA 5JA4A 2HUEB 3AZEB 3B6FD 3MGQC 1BH9B 3UTAD 3NQJB 1P3GD 1P3GC 3X1TD 3MVDB 5AVCD 5B24B 4YS3C 3AZJD 5CPKD 5FUGA 1P3FD 3KWQA 2Y2MA 5CPIB 3B0DB 5AY8C 4G91C 4QLCB 3KWQC 4J8WA 3AN2B 4H9NB 2HUEC 1M1AA 4J8WC 5B2JA 3AZEC 4J8XD 3NQJA 1M1AC 3LJAA 2NZDB 1BH8B 5B2JC 5BNVA 1P3ID 3MVDD 4LD9B 4J8UB 5B24D 4Z66D 4J8VB 3WTPB 5AVBB 4R8PB 2DF4C 4X23D 5KDMB 5CPIC 4QLCD 4WNNB 3B0DC 3AN2D 2PYOD 4H9QA 4AWLC 4E45A 5B0ZB 2NZDC 5GT3D 2Y2IA 1HQ3A 3VH5W 4J8VD 4R8PA 2J8PA 3H0LC 3WTPD 5AVBD 4J8UC 3AYWB 3WKJD 3UT9B 5B32G 1TZYB 4R8PC 4WU8B 3AZKA 1KU5A 4ZUXD 5E5AA 5BNXB 3X1VA 3AZKC 2L5AA 5B40A 5E5AC 4H9PB 3TU4B 3REHB 4EO5C 5CPJA 5B0ZC 4XUJB 4UPKA 3W96A 2F8NH 3W96C 3AYWD 1S32B 3UT9D 4WU8D 3X1SA 5BO0B 5BNXA 1TZYC 1A7WA 3AZLB 4WU8C 3B0BA 5BS7A 2IO5B 4KGCB 1M19B 3REHD 3LELA 3TU4C 3MNNA 2Y2NA 1P3OA 1N1JB 5AV8B 3MNNC 1P3OC 4XUJD 1P3BD 1JFIA 4XUJC 4HGAB 5B0YB 3WA9A 4H9OB 1M18D 1S32D 3LZ0B 4Z5TD 4DRAA 3AZLC 3AZNB 5CHLB 4KGCD 1M19D 4KGCC 2JE5A 5AV5D 3X1UB 3A1IA 2Y2OA 4XZQB 3KFUG 4UUZB 1P3AA 5B2IB 5AV8C 3EPJA 1P3AC 4H9OA 1Q9CA 5AV6A 4HGAC 5B0YC 1TAFA 3AZMB 5AV6C 3F6TA 3LZ0C 3AZID 1ID3A 1BFMA 3AZNC 1KX4B 3A1KA 3B6GD 3X1UD 3W98B 4XZQD 5B33D 5GXQA 5B32B 4M6BA 3R45A 5B2ID 5GXQC 1AOIA 5B2IC 3VH6T 3MGPB 3AV2D 1AOIC 1P34D 3AZMD 3W99A 5AV9A 2DQNC 4ZBJC 2CV5A 3W99C 2Y2GA 3C1CA 3REKD 3KXBD 2Y2QA 2CV5C 2FJ7D 3C1CC 4WZSB 1KX4D 4WU9A 1T3UA 3C1BB 2HIOB 5JRGA 3MGRB 3W98A 1EQZA 5DNMB 1KX3B 4YM6A 3W98C 5GT0D 5B32C 3B6FB 4YM6C 1P3PA 3MGPA 3LZ1A 3UTAB 1P3PC 3W97A 3MGPC 4KUDB 3O62D 3W97C 5AVCB 3AZJB 2JCHA 3REIB 1P3FB 4CAYB 2Y2KA 3AZHA 3RELA 3C1BD 3AZHC 3RELC 2HIOC 3MGRC 1KX3D 5DNMC 3MGQA 4H9RB 1P3LB 3B6FC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4J8X B;  3UTB B;  3UTA A;  1P3G A;  2RVQ D;  4KUD D;  3UTA C;  3X1T A;  4YS3 A;  1P3I B;  5AVC A;  5CPK A;  5DNN B;  4G92 B;  3X1T C;  4Z66 B;  5AVC C;  3AZJ C;  5CPK C;  1ULY A;  3REI D;  4X23 B;  5AY8 A;  1P3F C;  3REJ D;  3WAA D;  5F99 B;  2PYO B;  3AZE A;  3VH5 A;  1BH9 A;  4J8X A;  1P3L D;  3UTB D;  4DRB A;  1P3M D;  4J8X C;  3UTB C;  5GT3 B;  1P3I A;  3MVD A;  5B24 A;  1P3I C;  5DNN D;  3MVD C;  4G92 C;  3WKJ B;  5B24 C;  4Z66 C;  4X23 A;  5CPI A;  5B31 B;  2F8N B;  4X23 C;  4ZUX B;  4QLC A;  3AN2 A;  4QLC C;  4H9N A;  5F99 D;  3AN2 C;  2PYO C;  2NZD A;  1BH8 A;  5GT3 C;  4LD9 A;  4J8U A;  1F66 B;  4J8V A;  3WTP A;  5AVB A;  4J8V C;  3WKJ C;  3WTP C;  5AVB C;  3LJA D;  5B31 D;  2F8N D;  5KDM A;  4WNN A;  4ZUX C;  1B67 A;  5B0Z A;  1KX5 D;  1P3B B;  3A6N B;  1F66 D;  5BT1 D;  3AYW A;  1M18 B;  3UT9 A;  1TZY A;  4Z5T B;  4WU8 A;  3AYW C;  3UT9 C;  1HQ3 D;  1U35 B;  2ARO B;  4H9P A;  3TU4 A;  3REH A;  5AV5 B;  3NQU B;  3KUY B;  3REH C;  5CP6 B;  4XUJ A;  5B40 D;  3A6N D;  1P3B C;  1S32 A;  4Z5T A;  1M18 C;  1S32 C;  5BO0 A;  3AZL A;  5CPJ D;  4Z5T C;  3AZI B;  1U35 D;  2ARO D;  4KGC A;  1M19 A;  5AV5 A;  1R4V A;  2IO5 C;  1M19 C;  3B6G B;  5AV5 C;  1N1J A;  3X1S D;  3KUY D;  5B33 B;  2JSS A;  5CP6 D;  5AV8 A;  3B0C T;  5B0Y A;  3AV2 B;  1P34 B;  3LZ0 A;  3LEL D;  2BYM B;  2BYK B;  3REK B;  3KXB B;  3AZN A;  3AZI C;  2FJ7 B;  2CWE A;  3V9R B;  3X1U A;  2NQB B;  4XZQ A;  3B6G C;  4UUZ A;  3X1U C;  5B2I A;  4XZQ C;  5GT0 B;  5B33 C;  5B31 G;  2F8N G;  3AFA D;  3AV2 A;  1P34 A;  5B1L D;  3AZM A;  3AV2 C;  1P34 C;  4WV4 B;  3O62 B;  3AZM C;  4E44 A;  3WTP E;  3REK C;  3KXB C;  5G49 B;  2FJ7 C;  1KX4 A;  2NQB D;  4NE3 A;  1KX4 C;  1ZLA B;  5B32 A;  4JJN B;  3AV1 B;  1ID3 D;  3KSY A;  5GT0 C;  3AZF D;  3O62 A;  3O62 C;  1WWS A;  1P3K B;  4NFT A;  3C1B A;  2HIO A;  3MGS D;  3MGR A;  5AV9 D;  3REJ B;  5DNM A;  1KX3 A;  1ZLA D;  3C1B C;  3VH6 W;  4JJN D;  3AV1 D;  5B1M B;  3WAA B;  1KX3 C;  3B6F A;  5GSU B;  4H9S A;  4H9S C;  1P3M B;  4WU9 D;  2YFW B;  4KUD A;  1H3O B;  5JRG D;  2RVQ C;  1EQZ D;  4KUD C;  4CSR B;  3AZJ A;  1F1E A;  3REI A;  1P3F A;  4CAY A;  1HTA A;  1P3K D;  3LZ1 D;  1B6W A;  3REI C;  3REJ A;  3REJ C;  5B1M D;  4H9R A;  3WAA C;  5GSU D;  5FUG B;  3AZG D;  1P3L A;  3UTB A;  3KWQ B;  4G91 B;  1P3L C;  1WWI A;  1P3M C;  4J8W B;  5DNN A;  3MGQ D;  4Z66 A;  1M1A B;  5DNN C;  5B2J B;  3LJA B;  5BNV B;  4YS3 D;  5F99 A;  2PYO A;  3VH5 T;  5F99 C;  5AY8 D;  3KWQ D;  1KX5 B;  5GT3 A;  4J8W D;  4AWL B;  3AZE D;  3WKJ A;  1M1A D;  4H9Q B;  5B2J D;  5B31 A;  2F8N A;  4ZUX A;  3LJA C;  1HQ3 B;  5B31 C;  1KX5 A;  5CPI D;  3AZK B;  5E5A B;  1KX5 C;  3X1V B;  5B40 B;  1F66 A;  1F66 C;  4EO5 B;  5BT1 C;  2NZD D;  5CPJ B;  1HQ3 C;  4J8U D;  4LD9 D;  3W96 B;  4R8P D;  3X1S B;  3AZK D;  5E5A D;  1P3B A;  3X1V D;  3A6N A;  3X1V C;  5B40 C;  3A6N C;  5C3I B;  1M18 A;  3LEL B;  1P3O B;  3MNN B;  5B0Z D;  1U35 A;  5CPJ C;  2ARO A;  1JFI B;  1U35 C;  3W96 D;  2ARO C;  3WA9 B;  3NQU A;  1TZY D;  3KUY A;  5CP6 A;  4KHA B;  3X1S C;  3KUY C;  5CP6 C;  3AFA B;  5BS7 C;  3TU4 D;  5B1L B;  5C3I C;  3MNN D;  1P3O D;  3LEL C;  1P3A B;  3AZI A;  3WA9 D;  5AV6 B;  1TAF B;  3WA9 C;  3B6G A;  4KHA A;  2F8N K;  3AZL D;  5B33 A;  3AFA A;  1ID3 B;  5B1L A;  4Z2M H;  3AFA C;  2BYM A;  3AZF B;  5B1L C;  5GXQ B;  5AV8 D;  2BYK A;  1P3A D;  3REK A;  3R45 B;  3KXB A;  1AOI B;  2FJ7 A;  5B0Y D;  3VH6 A;  5AV6 D;  4ZBJ B;  3V9R A;  3LZ0 D;  2NQB A;  3B0C W;  3MGS B;  5AV9 B;  3W99 B;  2NQB C;  2CV5 B;  5GT0 A;  3C1C B;  3AZN D;  1ID3 C;  3AZF A;  4WU9 B;  5JRG B;  3AZF C;  4NE6 A;  1EQZ B;  5GXQ D;  4YM6 B;  1AOI D;  1P3P B;  5G49 A;  3LZ1 B;  3W97 B;  3MGS A;  1ZLA A;  3W99 D;  3MGS C;  5AV9 C;  4JJN A;  3AV1 A;  2CV5 D;  1ZLA C;  4NE5 A;  3C1C D;  4JJN C;  3AV1 C;  2LY8 A;  2YFV B;  3AZG B;  3AZH B;  3REL B;  4WU9 C;  3W98 D;  5JRG C;  5B32 D;  4YM6 D;  5JA4 B;  3MGQ B;  1EQZ C;  1P3P D;  1P3K A;  3MGP D;  1P3G B;  1P3K C;  3LZ1 C;  3W97 D;  3X1T B;  4YS3 B;  5CPK B;  3WAA A;  5B1M A;  5GSU A;  3AZG A;  2YFV A;  5B1M C;  4Z2M G;  5GSU C;  3AZG C;  5AY8 B;  2YFW A;  3AZH D;  1P3M A;  3REL D;  1H3O A;  2HIO D;  3MGR D;  5DNM D;  4CSR A;  5JA4 A;  2HUE B;  3AZE B;  3B6F D;  3MGQ C;  1BH9 B;  3UTA D;  3NQJ B;  1P3G D;  1P3G C;  3X1T D;  3MVD B;  5AVC D;  5B24 B;  4YS3 C;  3AZJ D;  5CPK D;  5FUG A;  1P3F D;  3KWQ A;  5CPI B;  3B0D B;  5AY8 C;  4G91 C;  4QLC B;  3KWQ C;  4J8W A;  3AN2 B;  4H9N B;  2HUE C;  1M1A A;  4J8W C;  5B2J A;  3AZE C;  4J8X D;  3NQJ A;  1M1A C;  3LJA A;  2NZD B;  1BH8 B;  5B2J C;  5BNV A;  1P3I D;  3MVD D;  4LD9 B;  4J8U B;  5B24 D;  4Z66 D;  4J8V B;  3WTP B;  5AVB B;  4R8P B;  4X23 D;  5KDM B;  5CPI C;  4QLC D;  4WNN B;  3B0D C;  3AN2 D;  2PYO D;  4H9Q A;  4AWL C;  4E45 A;  5B0Z B;  2NZD C;  5GT3 D;  1HQ3 A;  3VH5 W;  4J8V D;  4R8P A;  4J8U C;  3WKJ D;  3WTP D;  5AVB D;  3AYW B;  4LD9 C;  3UT9 B;  5B32 G;  1TZY B;  4R8P C;  4WU8 B;  3AZK A;  1KU5 A;  4ZUX D;  5E5A A;  5BNX B;  3X1V A;  3AZK C;  2L5A A;  5B40 A;  5E5A C;  4H9P B;  3TU4 B;  3REH B;  4EO5 C;  5CPJ A;  5B0Z C;  4XUJ B;  3W96 A;  2F8N H;  3W96 C;  3AYW D;  1S32 B;  3UT9 D;  4WU8 D;  3X1S A;  5BO0 B;  5BNX A;  1TZY C;  1A7W A;  3AZL B;  4WU8 C;  3B0B A;  5BS7 A;  2IO5 B;  4KGC B;  1M19 B;  3REH D;  3LEL A;  3TU4 C;  3MNN A;  1P3O A;  1N1J B;  5AV8 B;  3MNN C;  1P3O C;  4XUJ D;  1P3B D;  1JFI A;  4XUJ C;  4HGA B;  5B0Y B;  3WA9 A;  4H9O B;  1M18 D;  1S32 D;  3LZ0 B;  4Z5T D;  4DRA A;  3AZL C;  3AZN B;  5CHL B;  4KGC D;  1M19 D;  4KGC C;  5AV5 D;  3X1U B;  4XZQ B;  4UUZ B;  1P3A A;  5B2I B;  5AV8 C;  1P3A C;  4H9O A;  1Q9C A;  5AV6 A;  4HGA C;  5B0Y C;  1TAF A;  3AZM B;  5AV6 C;  3LZ0 C;  3AZI D;  1ID3 A;  1BFM A;  3AZN C;  1KX4 B;  3B6G D;  3X1U D;  3W98 B;  5GXQ A;  4XZQ D;  5B33 D;  5B32 B;  4M6B A;  3R45 A;  5B2I D;  5GXQ C;  1AOI A;  5B2I C;  3VH6 T;  3MGP B;  3AV2 D;  1AOI C;  1P34 D;  3AZM D;  3W99 A;  5AV9 A;  4ZBJ C;  2CV5 A;  3W99 C;  3C1C A;  3REK D;  3KXB D;  2CV5 C;  2FJ7 D;  3C1C C;  4WZS B;  1KX4 D;  4WU9 A;  3C1B B;  2HIO B;  5JRG A;  3MGR B;  3W98 A;  1EQZ A;  5DNM B;  1KX3 B;  4YM6 A;  3W98 C;  5GT0 D;  5B32 C;  3B6F B;  4YM6 C;  1P3P A;  3MGP A;  3LZ1 A;  3UTA B;  1P3P C;  3W97 A;  3MGP C;  4KUD B;  3O62 D;  3W97 C;  5AVC B;  3AZJ B;  3REI B;  1P3F B;  4CAY B;  3AZH A;  3REL A;  3C1B D;  3AZH C;  3REL C;  2HIO C;  3MGR C;  1KX3 D;  5DNM C;  3MGQ A;  4H9R B;  1P3L B;  3B6F C; 
#chains in the Genus database with same CATH topology
 4J8X B;  3UTB B;  3UTA A;  1P3G A;  2RVQ D;  4KUD D;  3UTA C;  3X1T A;  4YS3 A;  1P3I B;  5AVC A;  5CPK A;  5DNN B;  4G92 B;  3X1T C;  4Z66 B;  5AVC C;  3AZJ C;  5CPK C;  1ULY A;  3REI D;  4X23 B;  5AY8 A;  1P3F C;  3REJ D;  2RIQ A;  3WAA D;  2ZY3 A;  5F99 B;  2PYO B;  3AZE A;  3VH5 A;  1BH9 A;  4J8X A;  1P3L D;  3UTB D;  4DRB A;  1P3M D;  4J8X C;  3UTB C;  5GT3 B;  1P3I A;  3MVD A;  3EG5 B;  5B24 A;  1P3I C;  5DNN D;  3MVD C;  4G92 C;  3WKJ B;  5B24 C;  4Z66 C;  4X23 A;  5CPI A;  2W8S A;  5B31 B;  2F8N B;  2Y2L A;  4X23 C;  4ZUX B;  4QLC A;  3AN2 A;  4QLC C;  4H9N A;  5F99 D;  3AN2 C;  2PYO C;  2NZD A;  1BH8 A;  5GT3 C;  4LD9 A;  4J8U A;  1F66 B;  4J8V A;  3WTP A;  5AVB A;  4J8V C;  1Z2C B;  3WKJ C;  3WTP C;  5AVB C;  3LJA D;  5B31 D;  2F8N D;  5KDM A;  2Y2H A;  4WNN A;  1W2E A;  1B67 A;  4ZUX C;  2VQR A;  5B0Z A;  1KX5 D;  2XD1 A;  1P3B B;  3A6N B;  1F66 D;  3FDD A;  5BT1 D;  3AYW A;  1M18 B;  3UT9 A;  1TZY A;  3IP4 C;  4Z5T B;  4WU8 A;  3AYW C;  3UT9 C;  1HQ3 D;  1U35 B;  2ARO B;  4H9P A;  2Y2J A;  3TU4 A;  3REH A;  5AV5 B;  3NQU B;  3KUY B;  3REH C;  5CP6 B;  4XUJ A;  5B40 D;  3A6N D;  1P3B C;  1S32 A;  4Z5T A;  1M18 C;  1S32 C;  5BO0 A;  3AZL A;  5CPJ D;  4Z5T C;  3AZI B;  1U35 D;  2ARO D;  4KGC A;  2FFF B;  1M19 A;  5AV5 A;  1R4V A;  2IO5 C;  1M19 C;  3B6G B;  5AV5 C;  1N1J A;  3X1S D;  3KUY D;  5B33 B;  2JSS A;  5CP6 D;  5AV8 A;  3B0C T;  5B0Y A;  4DQY B;  2UWX A;  3AV2 B;  1P34 B;  3LZ0 A;  3LEL D;  2BYM B;  2BYK B;  3REK B;  3KXB B;  2BG1 A;  3AZN A;  3AZI C;  2FJ7 B;  3H0R C;  2CWE A;  3V9R B;  3X1U A;  2NQB B;  4XZQ A;  3B6G C;  4UUZ A;  3X1U C;  5B2I A;  4XZQ C;  5GT0 B;  5B33 C;  5B31 G;  2F8N G;  3AFA D;  3AV2 A;  1P34 A;  5B1L D;  3AZM A;  3AV2 C;  1P34 C;  4WV4 B;  3O62 B;  3AZM C;  4E44 A;  3WTP E;  3REK C;  3KXB C;  5G49 B;  2FJ7 C;  1KX4 A;  2NQB D;  3H0M C;  4NE3 A;  1KX4 C;  1ZLA B;  5B32 A;  4JJN B;  3AV1 B;  2Y2P A;  1ID3 D;  3KSY A;  5GT0 C;  3AZF D;  3O62 A;  3O62 C;  1WWS A;  3EPH A;  1P3K B;  4NFT A;  3C1B A;  2HIO A;  3MGS D;  3MGR A;  5AV9 D;  3REJ B;  5DNM A;  1KX3 A;  1ZLA D;  3C1B C;  3VH6 W;  4JJN D;  3AV1 D;  5B1M B;  3WAA B;  1KX3 C;  3B6F A;  5GSU B;  4H9S A;  4H9S C;  1P3M B;  4WU9 D;  2YFW B;  4KUD A;  2F2A C;  1H3O B;  5JRG D;  2RVQ C;  1EQZ D;  4KUD C;  4CSR B;  3AZJ A;  1F1E A;  3REI A;  1P3F A;  4CAY A;  1HTA A;  1P3K D;  3LZ1 D;  1B6W A;  3REI C;  3REJ A;  3REJ C;  5B1M D;  4H9R A;  3WAA C;  5GSU D;  5FUG B;  3AZG D;  1P3L A;  3UTB A;  3KWQ B;  4G91 B;  1P3L C;  3AL0 C;  1WWI A;  1P3M C;  4J8W B;  5DNN A;  3MGQ D;  4Z66 A;  1M1A B;  5DNN C;  2ZM5 A;  5B2J B;  3P5J B;  3LJA B;  5BNV B;  4YS3 D;  5F99 A;  2PYO A;  3VH5 T;  5F99 C;  5AY8 D;  3KWQ D;  1KX5 B;  5GT3 A;  4J8W D;  4AWL B;  3AZE D;  3WKJ A;  1M1A D;  4H9Q B;  5B2J D;  5B31 A;  2F8N A;  4ZUX A;  3LJA C;  1HQ3 B;  5B31 C;  1KX5 A;  5CPI D;  3AZK B;  5E5A B;  1KX5 C;  3X1V B;  5B40 B;  1F66 A;  1F66 C;  4EO5 B;  5BT1 C;  2NZD D;  5CPJ B;  1HQ3 C;  4J8U D;  4LD9 D;  3W96 B;  4R8P D;  1PZR A;  4WJ3 C;  3X1S B;  3AZK D;  5E5A D;  1P3B A;  3X1V D;  3A6N A;  3X1V C;  5B40 C;  3A6N C;  5C3I B;  1M18 A;  3LEL B;  1P3O B;  3MNN B;  5B0Z D;  1U35 A;  5CPJ C;  2ARO A;  1JFI B;  1U35 C;  3W96 D;  2ARO C;  3WA9 B;  3NQU A;  1TZY D;  3KUY A;  5CP6 A;  4KHA B;  3X1S C;  3KUY C;  5CP6 C;  3AFA B;  5BS7 C;  3TU4 D;  5B1L B;  5C3I C;  3MNN D;  1P3O D;  3LEL C;  1P3A B;  3AZI A;  3WA9 D;  5AV6 B;  1TAF B;  3WA9 C;  3B6G A;  4KHA A;  2F8N K;  3AZL D;  5B33 A;  2ZY2 A;  3AFA A;  2G5H C;  1ID3 B;  5B1L A;  4Z2M H;  3AFA C;  2BYM A;  3AZF B;  5B1L C;  2XD5 A;  5GXQ B;  5AV8 D;  2BYK A;  1P3A D;  3REK A;  3R45 B;  3KXB A;  1AOI B;  2FJ7 A;  5B0Y D;  3VH6 A;  5AV6 D;  4ZBJ B;  3V9R A;  3LZ0 D;  2NQB A;  3B0C W;  3MGS B;  5AV9 B;  3W99 B;  2NQB C;  2CV5 B;  5GT0 A;  3C1C B;  3EPL A;  3AZN D;  1ID3 C;  3AZF A;  4WU9 B;  5JRG B;  3AZF C;  4NE6 A;  1EQZ B;  5GXQ D;  4YM6 B;  1AOI D;  1P3P B;  5G49 A;  3LZ1 B;  3W97 B;  3MGS A;  1ZLA A;  3W99 D;  3MGS C;  5AV9 C;  4JJN A;  3AV1 A;  2CV5 D;  1ZLA C;  4NE5 A;  3C1C D;  4JJN C;  3AV1 C;  2LY8 A;  2YFV B;  3AZG B;  3AZH B;  3REL B;  4WU9 C;  3W98 D;  5JRG C;  5B32 D;  4YM6 D;  5JA4 B;  3MGQ B;  1EQZ C;  2ZY4 A;  1P3P D;  3EPK A;  3MGP D;  1P3K A;  4LD9 C;  2ZY5 A;  1P3G B;  1P3K C;  3LZ1 C;  3W97 D;  2G5I C;  3X1T B;  4YS3 B;  5CPK B;  3WAA A;  5B1M A;  5GSU A;  3AZG A;  2YFV A;  5B1M C;  4Z2M G;  5GSU C;  3AZG C;  5AY8 B;  2YFW A;  3AZH D;  1P3M A;  3REL D;  1H3O A;  2HIO D;  3MGR D;  5DNM D;  4CSR A;  5JA4 A;  2HUE B;  3AZE B;  3B6F D;  3MGQ C;  1BH9 B;  3UTA D;  3NQJ B;  1P3G D;  1P3G C;  3X1T D;  3MVD B;  5AVC D;  5B24 B;  4YS3 C;  3AZJ D;  5CPK D;  5FUG A;  1P3F D;  3KWQ A;  2Y2M A;  5CPI B;  3B0D B;  5AY8 C;  4G91 C;  4QLC B;  3KWQ C;  4J8W A;  3AN2 B;  4H9N B;  2HUE C;  1M1A A;  4J8W C;  5B2J A;  3AZE C;  4J8X D;  3NQJ A;  1M1A C;  3LJA A;  2NZD B;  1BH8 B;  5B2J C;  5BNV A;  1P3I D;  3MVD D;  4LD9 B;  4J8U B;  5B24 D;  4Z66 D;  4J8V B;  3WTP B;  5AVB B;  4R8P B;  2DF4 C;  4X23 D;  5KDM B;  5CPI C;  4QLC D;  4WNN B;  3B0D C;  3AN2 D;  2PYO D;  4H9Q A;  4AWL C;  4E45 A;  5B0Z B;  2NZD C;  5GT3 D;  2Y2I A;  1HQ3 A;  3VH5 W;  4J8V D;  4R8P A;  2J8P A;  3H0L C;  3WTP D;  5AVB D;  4J8U C;  3AYW B;  3WKJ D;  3UT9 B;  5B32 G;  1TZY B;  4R8P C;  4WU8 B;  3AZK A;  1KU5 A;  4ZUX D;  5E5A A;  5BNX B;  3X1V A;  3AZK C;  2L5A A;  5B40 A;  5E5A C;  4H9P B;  3TU4 B;  3REH B;  4EO5 C;  5CPJ A;  5B0Z C;  4XUJ B;  4UPK A;  3W96 A;  2F8N H;  3W96 C;  3AYW D;  1S32 B;  3UT9 D;  4WU8 D;  3X1S A;  5BO0 B;  5BNX A;  1TZY C;  1A7W A;  3AZL B;  4WU8 C;  3B0B A;  5BS7 A;  2IO5 B;  4KGC B;  1M19 B;  3REH D;  3LEL A;  3TU4 C;  3MNN A;  2Y2N A;  1P3O A;  1N1J B;  5AV8 B;  3MNN C;  1P3O C;  4XUJ D;  1P3B D;  1JFI A;  4XUJ C;  4HGA B;  5B0Y B;  3WA9 A;  4H9O B;  1M18 D;  1S32 D;  3LZ0 B;  4Z5T D;  4DRA A;  3AZL C;  3AZN B;  5CHL B;  4KGC D;  1M19 D;  4KGC C;  2JE5 A;  5AV5 D;  3X1U B;  3A1I A;  2Y2O A;  4XZQ B;  3KFU G;  4UUZ B;  1P3A A;  5B2I B;  5AV8 C;  3EPJ A;  1P3A C;  4H9O A;  1Q9C A;  5AV6 A;  4HGA C;  5B0Y C;  1TAF A;  3AZM B;  5AV6 C;  3F6T A;  3LZ0 C;  3AZI D;  1ID3 A;  1BFM A;  3AZN C;  1KX4 B;  3A1K A;  3B6G D;  3X1U D;  3W98 B;  4XZQ D;  5B33 D;  5GXQ A;  5B32 B;  4M6B A;  3R45 A;  5B2I D;  5GXQ C;  1AOI A;  5B2I C;  3VH6 T;  3MGP B;  3AV2 D;  1AOI C;  1P34 D;  3AZM D;  3W99 A;  5AV9 A;  2DQN C;  4ZBJ C;  2CV5 A;  3W99 C;  2Y2G A;  3C1C A;  3REK D;  3KXB D;  2Y2Q A;  2CV5 C;  2FJ7 D;  3C1C C;  4WZS B;  1KX4 D;  4WU9 A;  1T3U A;  3C1B B;  2HIO B;  5JRG A;  3MGR B;  3W98 A;  1EQZ A;  5DNM B;  1KX3 B;  4YM6 A;  3W98 C;  5GT0 D;  5B32 C;  3B6F B;  4YM6 C;  1P3P A;  3MGP A;  3LZ1 A;  3UTA B;  1P3P C;  3W97 A;  3MGP C;  4KUD B;  3O62 D;  3W97 C;  5AVC B;  3AZJ B;  2JCH A;  3REI B;  1P3F B;  4CAY B;  2Y2K A;  3AZH A;  3REL A;  3C1B D;  3AZH C;  3REL C;  2HIO C;  3MGR C;  1KX3 D;  5DNM C;  3MGQ A;  4H9R B;  1P3L B;  3B6F C; 
#chains in the Genus database with same CATH homology
 4J8X B;  3UTB B;  3UTA A;  1P3G A;  2RVQ D;  4KUD D;  3UTA C;  3X1T A;  4YS3 A;  1P3I B;  5AVC A;  5CPK A;  5DNN B;  4G92 B;  3X1T C;  4Z66 B;  5AVC C;  3AZJ C;  5CPK C;  1ULY A;  3REI D;  4X23 B;  5AY8 A;  1P3F C;  3REJ D;  2RIQ A;  3WAA D;  2ZY3 A;  5F99 B;  2PYO B;  3AZE A;  3VH5 A;  1BH9 A;  4J8X A;  1P3L D;  3UTB D;  4DRB A;  1P3M D;  4J8X C;  3UTB C;  5GT3 B;  1P3I A;  3MVD A;  3EG5 B;  5B24 A;  1P3I C;  5DNN D;  3MVD C;  4G92 C;  3WKJ B;  5B24 C;  4Z66 C;  4X23 A;  5CPI A;  2W8S A;  5B31 B;  2F8N B;  2Y2L A;  4X23 C;  4ZUX B;  4QLC A;  3AN2 A;  4QLC C;  4H9N A;  5F99 D;  3AN2 C;  2PYO C;  2NZD A;  1BH8 A;  5GT3 C;  4LD9 A;  4J8U A;  1F66 B;  4J8V A;  3WTP A;  5AVB A;  4J8V C;  1Z2C B;  3WKJ C;  3WTP C;  5AVB C;  3LJA D;  5B31 D;  2F8N D;  5KDM A;  2Y2H A;  4WNN A;  1W2E A;  1B67 A;  4ZUX C;  2VQR A;  5B0Z A;  1KX5 D;  2XD1 A;  1P3B B;  3A6N B;  1F66 D;  3FDD A;  5BT1 D;  3AYW A;  1M18 B;  3UT9 A;  1TZY A;  3IP4 C;  4Z5T B;  4WU8 A;  3AYW C;  3UT9 C;  1HQ3 D;  1U35 B;  2ARO B;  4H9P A;  2Y2J A;  3TU4 A;  3REH A;  5AV5 B;  3NQU B;  3KUY B;  3REH C;  5CP6 B;  4XUJ A;  5B40 D;  3A6N D;  1P3B C;  1S32 A;  4Z5T A;  1M18 C;  1S32 C;  5BO0 A;  3AZL A;  5CPJ D;  4Z5T C;  3AZI B;  1U35 D;  2ARO D;  4KGC A;  2FFF B;  1M19 A;  5AV5 A;  1R4V A;  2IO5 C;  1M19 C;  3B6G B;  5AV5 C;  1N1J A;  3X1S D;  3KUY D;  5B33 B;  2JSS A;  5CP6 D;  5AV8 A;  3B0C T;  5B0Y A;  4DQY B;  2UWX A;  3AV2 B;  1P34 B;  3LZ0 A;  3LEL D;  2BYM B;  2BYK B;  3REK B;  3KXB B;  2BG1 A;  3AZN A;  3AZI C;  2FJ7 B;  3H0R C;  2CWE A;  3V9R B;  3X1U A;  2NQB B;  4XZQ A;  3B6G C;  4UUZ A;  3X1U C;  5B2I A;  4XZQ C;  5GT0 B;  5B33 C;  5B31 G;  2F8N G;  3AFA D;  3AV2 A;  1P34 A;  5B1L D;  3AZM A;  3AV2 C;  1P34 C;  4WV4 B;  3O62 B;  3AZM C;  4E44 A;  3WTP E;  3REK C;  3KXB C;  5G49 B;  2FJ7 C;  1KX4 A;  2NQB D;  3H0M C;  4NE3 A;  1KX4 C;  1ZLA B;  5B32 A;  4JJN B;  3AV1 B;  2Y2P A;  1ID3 D;  3KSY A;  5GT0 C;  3AZF D;  3O62 A;  3O62 C;  1WWS A;  3EPH A;  1P3K B;  4NFT A;  3C1B A;  2HIO A;  3MGS D;  3MGR A;  5AV9 D;  3REJ B;  5DNM A;  1KX3 A;  1ZLA D;  3C1B C;  3VH6 W;  4JJN D;  3AV1 D;  5B1M B;  3WAA B;  1KX3 C;  3B6F A;  5GSU B;  4H9S A;  4H9S C;  1P3M B;  4WU9 D;  2YFW B;  4KUD A;  2F2A C;  1H3O B;  5JRG D;  2RVQ C;  1EQZ D;  4KUD C;  4CSR B;  3AZJ A;  1F1E A;  3REI A;  1P3F A;  4CAY A;  1HTA A;  1P3K D;  3LZ1 D;  1B6W A;  3REI C;  3REJ A;  3REJ C;  5B1M D;  4H9R A;  3WAA C;  5GSU D;  5FUG B;  3AZG D;  1P3L A;  3UTB A;  3KWQ B;  4G91 B;  1P3L C;  3AL0 C;  1WWI A;  1P3M C;  4J8W B;  5DNN A;  3MGQ D;  4Z66 A;  1M1A B;  5DNN C;  2ZM5 A;  5B2J B;  3P5J B;  3LJA B;  5BNV B;  4YS3 D;  5F99 A;  2PYO A;  3VH5 T;  5F99 C;  5AY8 D;  3KWQ D;  1KX5 B;  5GT3 A;  4J8W D;  4AWL B;  3AZE D;  3WKJ A;  1M1A D;  4H9Q B;  5B2J D;  5B31 A;  2F8N A;  4ZUX A;  3LJA C;  1HQ3 B;  5B31 C;  1KX5 A;  5CPI D;  3AZK B;  5E5A B;  1KX5 C;  3X1V B;  5B40 B;  1F66 A;  1F66 C;  4EO5 B;  5BT1 C;  2NZD D;  5CPJ B;  1HQ3 C;  4J8U D;  4LD9 D;  3W96 B;  4R8P D;  1PZR A;  4WJ3 C;  3X1S B;  3AZK D;  5E5A D;  1P3B A;  3X1V D;  3A6N A;  3X1V C;  5B40 C;  3A6N C;  5C3I B;  1M18 A;  3LEL B;  1P3O B;  3MNN B;  5B0Z D;  1U35 A;  5CPJ C;  2ARO A;  1JFI B;  1U35 C;  3W96 D;  2ARO C;  3WA9 B;  3NQU A;  1TZY D;  3KUY A;  5CP6 A;  4KHA B;  3X1S C;  3KUY C;  5CP6 C;  3AFA B;  5BS7 C;  3TU4 D;  5B1L B;  5C3I C;  3MNN D;  1P3O D;  3LEL C;  1P3A B;  3AZI A;  3WA9 D;  5AV6 B;  1TAF B;  3WA9 C;  3B6G A;  4KHA A;  2F8N K;  3AZL D;  5B33 A;  2ZY2 A;  3AFA A;  2G5H C;  1ID3 B;  5B1L A;  4Z2M H;  3AFA C;  2BYM A;  3AZF B;  5B1L C;  2XD5 A;  5GXQ B;  5AV8 D;  2BYK A;  1P3A D;  3REK A;  3R45 B;  3KXB A;  1AOI B;  2FJ7 A;  5B0Y D;  3VH6 A;  5AV6 D;  4ZBJ B;  3V9R A;  3LZ0 D;  2NQB A;  3B0C W;  3MGS B;  5AV9 B;  3W99 B;  2NQB C;  2CV5 B;  5GT0 A;  3C1C B;  3EPL A;  3AZN D;  1ID3 C;  3AZF A;  4WU9 B;  5JRG B;  3AZF C;  4NE6 A;  1EQZ B;  5GXQ D;  4YM6 B;  1AOI D;  1P3P B;  5G49 A;  3LZ1 B;  3W97 B;  3MGS A;  1ZLA A;  3W99 D;  3MGS C;  5AV9 C;  4JJN A;  3AV1 A;  2CV5 D;  1ZLA C;  4NE5 A;  3C1C D;  4JJN C;  3AV1 C;  2LY8 A;  2YFV B;  3AZG B;  3AZH B;  3REL B;  4WU9 C;  3W98 D;  5JRG C;  5B32 D;  4YM6 D;  5JA4 B;  3MGQ B;  1EQZ C;  2ZY4 A;  1P3P D;  3EPK A;  3MGP D;  1P3K A;  4LD9 C;  2ZY5 A;  1P3G B;  1P3K C;  3LZ1 C;  3W97 D;  2G5I C;  3X1T B;  4YS3 B;  5CPK B;  3WAA A;  5B1M A;  5GSU A;  3AZG A;  2YFV A;  5B1M C;  4Z2M G;  5GSU C;  3AZG C;  5AY8 B;  2YFW A;  3AZH D;  1P3M A;  3REL D;  1H3O A;  2HIO D;  3MGR D;  5DNM D;  4CSR A;  5JA4 A;  2HUE B;  3AZE B;  3B6F D;  3MGQ C;  1BH9 B;  3UTA D;  3NQJ B;  1P3G D;  1P3G C;  3X1T D;  3MVD B;  5AVC D;  5B24 B;  4YS3 C;  3AZJ D;  5CPK D;  5FUG A;  1P3F D;  3KWQ A;  2Y2M A;  5CPI B;  3B0D B;  5AY8 C;  4G91 C;  4QLC B;  3KWQ C;  4J8W A;  3AN2 B;  4H9N B;  2HUE C;  1M1A A;  4J8W C;  5B2J A;  3AZE C;  4J8X D;  3NQJ A;  1M1A C;  3LJA A;  2NZD B;  1BH8 B;  5B2J C;  5BNV A;  1P3I D;  3MVD D;  4LD9 B;  4J8U B;  5B24 D;  4Z66 D;  4J8V B;  3WTP B;  5AVB B;  4R8P B;  2DF4 C;  4X23 D;  5KDM B;  5CPI C;  4QLC D;  4WNN B;  3B0D C;  3AN2 D;  2PYO D;  4H9Q A;  4AWL C;  4E45 A;  5B0Z B;  2NZD C;  5GT3 D;  2Y2I A;  1HQ3 A;  3VH5 W;  4J8V D;  4R8P A;  2J8P A;  3H0L C;  3WTP D;  5AVB D;  4J8U C;  3AYW B;  3WKJ D;  3UT9 B;  5B32 G;  1TZY B;  4R8P C;  4WU8 B;  3AZK A;  1KU5 A;  4ZUX D;  5E5A A;  5BNX B;  3X1V A;  3AZK C;  2L5A A;  5B40 A;  5E5A C;  4H9P B;  3TU4 B;  3REH B;  4EO5 C;  5CPJ A;  5B0Z C;  4XUJ B;  4UPK A;  3W96 A;  2F8N H;  3W96 C;  3AYW D;  1S32 B;  3UT9 D;  4WU8 D;  3X1S A;  5BO0 B;  5BNX A;  1TZY C;  1A7W A;  3AZL B;  4WU8 C;  3B0B A;  5BS7 A;  2IO5 B;  4KGC B;  1M19 B;  3REH D;  3LEL A;  3TU4 C;  3MNN A;  2Y2N A;  1P3O A;  1N1J B;  5AV8 B;  3MNN C;  1P3O C;  4XUJ D;  1P3B D;  1JFI A;  4XUJ C;  4HGA B;  5B0Y B;  3WA9 A;  4H9O B;  1M18 D;  1S32 D;  3LZ0 B;  4Z5T D;  4DRA A;  3AZL C;  3AZN B;  5CHL B;  4KGC D;  1M19 D;  4KGC C;  2JE5 A;  5AV5 D;  3X1U B;  3A1I A;  2Y2O A;  4XZQ B;  3KFU G;  4UUZ B;  1P3A A;  5B2I B;  5AV8 C;  3EPJ A;  1P3A C;  4H9O A;  1Q9C A;  5AV6 A;  4HGA C;  5B0Y C;  1TAF A;  3AZM B;  5AV6 C;  3F6T A;  3LZ0 C;  3AZI D;  1ID3 A;  1BFM A;  3AZN C;  1KX4 B;  3A1K A;  3B6G D;  3X1U D;  3W98 B;  4XZQ D;  5B33 D;  5GXQ A;  5B32 B;  4M6B A;  3R45 A;  5B2I D;  5GXQ C;  1AOI A;  5B2I C;  3VH6 T;  3MGP B;  3AV2 D;  1AOI C;  1P34 D;  3AZM D;  3W99 A;  5AV9 A;  2DQN C;  4ZBJ C;  2CV5 A;  3W99 C;  2Y2G A;  3C1C A;  3REK D;  3KXB D;  2Y2Q A;  2CV5 C;  2FJ7 D;  3C1C C;  4WZS B;  1KX4 D;  4WU9 A;  1T3U A;  3C1B B;  2HIO B;  5JRG A;  3MGR B;  3W98 A;  1EQZ A;  5DNM B;  1KX3 B;  4YM6 A;  3W98 C;  5GT0 D;  5B32 C;  3B6F B;  4YM6 C;  1P3P A;  3MGP A;  3LZ1 A;  3UTA B;  1P3P C;  3W97 A;  3MGP C;  4KUD B;  3O62 D;  3W97 C;  5AVC B;  3AZJ B;  2JCH A;  3REI B;  1P3F B;  4CAY B;  2Y2K A;  3AZH A;  3REL A;  3C1B D;  3AZH C;  3REL C;  2HIO C;  3MGR C;  1KX3 D;  5DNM C;  3MGQ A;  4H9R B;  1P3L B;  3B6F C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...