4Z66B

Nucleosome disassembly by rsc and swi/snf is enhanced by h3 acetylation near the nucleosome dyad axis
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
79
structure length
79
Chain Sequence
DNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Histone Acetylation near the Nucleosome Dyad Axis Enhances Nucleosome Disassembly by RSC and SWI/SNF.
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Structural protein/dna
molecule keywords Histone H3.2
total genus 27
structure length 79
sequence length 79
chains with identical sequence F
ec nomenclature
pdb deposition date 2015-04-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4z66B00
3AV1B 5BNXA 3AZEB 2PYOA 3AYWA 1P3LB 2BYMB 5AV8A 4JJNB 3WTPE 4WU8C 5B40D 1P3AD 1KX3B 5B31G 4YM6D 3X1TC 5B24B 2HIOC 3LZ1A 5GXQB 1P34D 2CV5B 3LELA 1P3AC 3MGRC 5AVBC 3W96D 5GT0A 3WTPA 3C1CD 4J8VC 3REIA 3AZJC 4X23B 3O62C 3MNNB 5AY8B 5GSUA 3MVDB 4J8WA 5AVCD 1S32D 5GSUC 5B31A 4J8WC 1BFMA 4J8VD 1P3FB 5F99D 4KGCA 4NE6A 5JRGA 3REHD 5AV6D 1M18C 3B6FB 3MGRA 3WA9B 5B1MA 3X1UD 4QLCB 3RELD 3LZ0A 1H3OA 2BYKA 1HQ3B 1F66B 5BNXB 3B0CT 3W99D 1P3IA 1P3BD 3WKJC 4Z66C 3UT9C 4Z2MH 5BS7C 5B40A 1P3IB 3AZMA 5CPIC 4J8UD 3AZEA 3AZGA 4Z66D 1P34A 5B32D 4Z5TC 3AZGC 3X1VB 5GT0D 3B6GB 4CAYB 5B40C 3X1SA 4E45A 4EO5C 3TU4D 1KX4C 2RVQD 3X1VA 4XUJA 5CP6D 2NQBC 2F8NA 3KXBB 1U35D 3W98D 4J8UB 3MGRD 1P3GB 4H9NB 1TZYD 4LD9D 3TU4C 3AZJD 3AN2B 4XUJD 3WA9C 3W99B 3REKA 3B6FC 1U35C 5E5AA 3KXBC 4G92B 3AZKB 3KWQC 1BH8B 5F99C 3REKC 3RELB 1TZYB 5AV6C 3C1CA 3O62A 1P3GD 1M18D 3B6FD 3W98B 4CSRB 3WTPC 5AY8C 3LZ0B 5F99A 3MGPB 4J8VA 3AZIA 4KGCD 5JRGB 3AZFA 3MNNC 3RELC 5F99B 5CHLB 3VH6W 3R45B 1P3KD 3B6FA 1F1EA 3AZHD 4H9SC 3VH5W 4G92C 3AZKC 5AVCB 4YM6A 5FUGB 4WU9D 3B6GD 1Q9CA 1B6WA 5B24C 2NQBA 3AZHC 3W97A 5CPID 3W96B 3REJA 5B1LC 5B32B 5GXQD 1P34B 4WU9C 4Z66B 3W97D 4Z5TD 3X1SC 2F8ND 5CP6A 1HQ3C 1F66C 5B2IB 1KX3D 4H9QB 1P3ID 4WZSB 5B2JD 2YFVB 1M19D 3AZMC 4WV4B 3AYWD 5GT3A 1KX4D 5B2JC 1M19C 5GSUB 3MVDA 4J8WB 5B2IA 4WNNA 5JA4B 5BNVB 1ZLAB 3UTAA 3UT9A 4X23A 5AV6B 4KHAB 3AZFD 3UT9B 1P3FD 3MGPA 4J8VB 2HUEB 5B32G 4XZQD 4KUDD 3MVDD 3C1BC 3KWQD 4ZUXA 3MNNA 4CSRA 3AZIB 3UTAC 3C1CB 5E5AB 1P3OB 3UTBD 1P3GC 2CWEA 3B0BA 2AROD 4R8PC 5AVBA 5AV9D 3KWQA 3UTBC 2YFWB 3AFAC 4EO5B 3LZ1C 5AV5C 3REIC 5B40B 3MGQD 5AV5A 3REJB 3B6GC 4JJND 1HQ3A 5C3IB 1F66A 1P3LA 3AZLA 2CV5C 4R8PA 5GXQC 5B0YA 2NZDB 2IO5C 4NE5A 1TAFA 3AV1D 2FJ7B 3AZLD 3AZHA 3X1TB 1EQZD 4H9PA 3REIB 4Z66A 4ZUXC 3LZ1B 1P3IC 3B0CW 3AFAB 3LJAD 1KX5A 1AOIA 3VH6A 4J8XD 2CV5A 1KX3A 4E44A 3AZLC 4YS3B 5B1MD 3RELA 1P3LC 3KSYA 4ZUXD 4H9OA 4H9RA 3AZEC 4QLCC 2F8NG 3REHA 3UTAB 1P3KA 5BO0A 3AN2A 4QLCA 5BS7A 5GT3C 5CPJB 3NQJB 2BYKB 3W98A 5DNND 4XZQC 3NQJA 1P3FA 5GT3D 4DRBA 3WKJD 3V9RA 5AV8C 5B1LA 3WAAA 2PYOC 3KUYD 3LELD 1WWSA 3AFAD 5B0YB 1KU5A 4AWLB 5B2IC 3MGQC 3X1TD 4YS3C 5GT0C 3AZLB 5B0ZC 3LELB 2FJ7D 4JJNC 5KDMB 3UTBA 1P34C 3WAAB 4R8PB 4ZBJB 4AWLC 1KX5B 1AOIB 1P3MC 5DNMD 3W96C 5B0ZD 5AV6A 3C1CC 3X1TA 3AV1C 2PYOB 3REJD 1P3PA 2RVQC 3B0DC 4Z2MG 4WU8D 5CP6C 2NQBD 2NZDA 2BYMA 5AV8B 1P3MD 1S32A 5BO0B 4LD9C 5BNVA 2HIOD 4J8XC 3AZKA 3AV2A 5AV9B 3REJC 5CPJD 5B33D 1M1AC 5AVBD 1P3OD 5AY8A 3REKB 4J8UA 3O62D 5B33A 1M18A 4UUZA 3KWQB 4H9SA 4HGAB 3AV2D 5B31C 1M1AD 5B1MB 4LD9A 3WTPD 1N1JB 1S32C 3W99C 1P3BA 1P3OC 1BH9B 5DNNC 3LJAB 3AN2C 1P3KC 1B67A 1ID3C 3REHC 1R4VA 4J8UC 5B31D 3C1BB 1ZLAD 5B32C 5B1LB 1ID3D 2L5AA 4H9PB 3AYWB 4WU8A 1JFIA 5CPKB 3X1SD 3A6NB 3WKJA 3X1VC 5B2ID 1P3PB 3A6NC 2F8NB 4DRAA 3W96A 3W97B 3AZMB 3AZMD 4H9RB 5B32A 5AV5B 1HTAA 5DNMC 3AZGD 5CPIB 3UTBB 3X1SB 5E5AD 3A6ND 3AZNA 3AZID 4WU9B 3AFAA 3VH5T 4KUDB 3AZFC 2FJ7A 1P3KB 5E5AC 4WNNB 3KXBA 2JSSA 3MGSD 3AZIC 5BT1C 3AZFB 5B33C 3AZND 4KGCB 3LZ0D 3TU4A 5AVCC 5B31B 3C1BD 3AZNB 3MGSA 5GSUD 1TZYA 4J8WD 5AVCA 1KX4B 4XUJC 3MGSB 1U35A 5BT1D 2HIOA 1N1JA 3AV2C 3AZKD 3LZ0C 1M1AB 2YFWA 1H3OB 4UUZB 5AV9C 5B2JB 1M19B 3AN2D 3AZJB 3REKD 4G91B 1P3PC 5AVBB 3AZGB 3AV1A 3AZJA 1BH8A 5AV5D 5CP6B 4KGCC 4Z5TB 4Z5TA 2YFVA 1P3PD 4CAYA 1KX3C 1P3MB 3A6NA 4ZBJC 1KX5C 1AOIC 2NQBB 5CPKD 4WU8B 1JFIB 2F8NH 5GT0B 3X1VD 3KUYA 3VH5A 4WU9A 3AZHB 1ID3B 1KX5D 5B0YC 5B1LD 1TAFB 1AOID 3WAAD 5GXQA 5JRGD 3W97C 5B24A 3MGPD 5B1MC 1M18B 5KDMA 5B0YD 4G91C 1P3FC 5JRGC 1P3BB 3AYWC 4KUDA 4H9QA 3WTPB 4H9NA 3MGPC 3NQUB 3W98C 3AV2B 3W99A 1TZYC 5JA4A 1ZLAA 4XUJB 4X23C 2AROA 3O62B 3MGSC 3WA9D 4LD9B 3AZNC 3MGRB 5B2JA 3KXBD 1U35B 1M19A 2AROC 5B33B 3REHB 3V9RB 3B0DB 5AV9A 2LY8A 2HIOB 3TU4B 3C1BA 5G49A 4KUDC 3WA9A 5AV8D 5AY8D 5CPKA 3R45A 3MNND 2PYOD 1EQZA 5DNMA 3UTAD 5FUGA 5B0ZB 3LELC 1P3AA 1M1AA 4M6BA 5DNMB 4J8XA 4R8PD 2CV5D 4YS3D 1P3MA 2FJ7C 2F8NK 4J8XB 5B24D 2NZDC 1EQZC 3B6GA 3LZ1D 4YS3A 3REID 4YM6C 5CPKC 3MGQA 1ID3A 1A7WA 3KUYB 2NZDD 1HQ3D 3VH6T 1F66D 1P3LD 3WAAC 3AZED 4QLCD 3X1UB 3WKJB 5CPIA 1P3GA 5CPJC 5GT3B 4NE3A 1ULYA 3MGQB 5DNNA 5DNNB 3LJAC 1S32B 4NFTA 4HGAC 3X1UA 3LJAA 2AROB 4X23D 3NQUA 2HUEC 5CPJA 3X1UC 4KHAA 4H9OB 1BH9A 4ZUXB 3MVDC 4XZQA 1KX4A 1ZLAC 1P3OA 3KUYC 4XZQB 5G49B 1P3BC 2IO5B 3UT9D 4JJNA 4YM6B 5B0ZA 1P3AB 1EQZB 5C3IC 1WWIA
chains in the Genus database with same CATH superfamily
3AV1B 5BNXA 3AZEB 2BG1A 2PYOA 3AYWA 1P3LB 2BYMB 5AV8A 4JJNB 3KFUG 3WTPE 4WU8C 1PZRA 5B40D 1P3AD 1KX3B 5B31G 4YM6D 3X1TC 5B24B 2HIOC 2VQRA 3LZ1A 5GXQB 1P34D 2RIQA 2CV5B 3LELA 1P3AC 3MGRC 5AVBC 3W96D 5GT0A 3WTPA 3C1CD 4J8VC 3REIA 3AZJC 4X23B 3O62C 3MNNB 3H0LC 1T3UA 5AY8B 5GSUA 3MVDB 4J8WA 5AVCD 1S32D 5GSUC 5B31A 4J8WC 1BFMA 4J8VD 1P3FB 5F99D 4KGCA 4NE6A 5JRGA 3REHD 5AV6D 1M18C 3B6FB 3MGRA 3WA9B 5B1MA 3X1UD 4QLCB 3RELD 2Y2QA 3LZ0A 1H3OA 2BYKA 1HQ3B 1F66B 5BNXB 3B0CT 3W99D 1P3IA 1P3BD 3WKJC 4Z66C 3UT9C 4Z2MH 5BS7C 5B40A 1P3IB 3AZMA 5CPIC 4J8UD 3AZEA 3AZGA 4Z66D 2UWXA 1P34A 5B32D 4Z5TC 3EPJA 3AZGC 3X1VB 5GT0D 3B6GB 4CAYB 5B40C 3X1SA 4E45A 4EO5C 3TU4D 1KX4C 2RVQD 3X1VA 4XUJA 5CP6D 2NQBC 2F8NA 3KXBB 1U35D 3W98D 4J8UB 3MGRD 1P3GB 4H9NB 1TZYD 4LD9D 3TU4C 3AZJD 3AN2B 4XUJD 3WA9C 3W99B 3REKA 3B6FC 1U35C 5E5AA 3KXBC 4G92B 3AZKB 3KWQC 1BH8B 5F99C 3REKC 3RELB 1TZYB 5AV6C 3C1CA 3O62A 1P3GD 1M18D 3B6FD 3W98B 4CSRB 3WTPC 5AY8C 3LZ0B 3FDDA 5F99A 3MGPB 4J8VA 3AZIA 4KGCD 5JRGB 3EPLA 3AZFA 3MNNC 3RELC 5F99B 5CHLB 3VH6W 3R45B 1P3KD 3B6FA 1F1EA 3AZHD 4H9SC 3VH5W 4G92C 3AZKC 5AVCB 4YM6A 5FUGB 4WU9D 2DQNC 3B6GD 1Q9CA 1B6WA 5B24C 2NQBA 3AZHC 3W97A 5CPID 3W96B 3REJA 5B1LC 5B32B 5GXQD 1P34B 4WU9C 4Z66B 3W97D 4Z5TD 2Y2GA 3X1SC 2F8ND 5CP6A 1HQ3C 1F66C 2G5HC 5B2IB 1KX3D 4H9QB 1P3ID 4WZSB 5B2JD 2YFVB 1M19D 3AZMC 4WV4B 3AYWD 5GT3A 1KX4D 2Y2NA 5B2JC 1M19C 5GSUB 3MVDA 4J8WB 5B2IA 4WNNA 5JA4B 5BNVB 1ZLAB 3UTAA 3UT9A 4X23A 5AV6B 4KHAB 3AZFD 3UT9B 2FFFB 3MGPA 4J8VB 2HUEB 5B32G 1P3FD 4XZQD 4KUDD 3MVDD 3C1BC 3KWQD 4ZUXA 3MNNA 4CSRA 3AZIB 3UTAC 3C1CB 5E5AB 1P3OB 2Y2JA 3UTBD 1P3GC 2CWEA 3B0BA 2AROD 4R8PC 5AVBA 2Y2IA 5AV9D 3KWQA 3UTBC 2YFWB 3AFAC 4EO5B 3LZ1C 5AV5C 3REIC 5B40B 3MGQD 5AV5A 3REJB 3B6GC 4JJND 1HQ3A 5C3IB 1F66A 1P3LA 3AZLA 4DQYB 1Z2CB 2CV5C 4R8PA 5GXQC 5B0YA 2NZDB 2IO5C 4NE5A 1TAFA 3AV1D 2FJ7B 3AZLD 3AZHA 2Y2OA 3X1TB 1EQZD 4H9PA 3REIB 2ZM5A 4Z66A 4ZUXC 2G5IC 3LZ1B 1P3IC 3B0CW 3AFAB 3LJAD 1KX5A 1AOIA 3VH6A 4J8XD 2CV5A 1KX3A 4E44A 3AZLC 4YS3B 5B1MD 3RELA 1P3LC 3KSYA 4ZUXD 4H9OA 4H9RA 3AZEC 4QLCC 3EPKA 3H0MC 2F8NG 3REHA 3UTAB 1P3KA 5BO0A 3AN2A 4QLCA 5BS7A 5GT3C 5CPJB 3NQJB 2BYKB 3W98A 3EPHA 5DNND 4XZQC 3NQJA 1P3FA 5GT3D 4DRBA 3WKJD 3V9RA 5AV8C 5B1LA 3WAAA 2PYOC 3KUYD 3LELD 1WWSA 3AFAD 5B0YB 1KU5A 4AWLB 5B2IC 3MGQC 3X1TD 4YS3C 5GT0C 3AZLB 5B0ZC 3LELB 2FJ7D 4JJNC 5KDMB 3UTBA 3EG5B 1P34C 3WAAB 4R8PB 2J8PA 4ZBJB 4AWLC 1KX5B 1P3MC 1AOIB 5DNMD 3W96C 5B0ZD 5AV6A 3C1CC 3X1TA 3AV1C 2PYOB 3REJD 1P3PA 2RVQC 3B0DC 4Z2MG 4WU8D 5CP6C 4UPKA 2NQBD 2BYMA 5AV8B 1P3MD 2NZDA 3H0RC 1S32A 5BO0B 4LD9C 5BNVA 2HIOD 1W2EA 4J8XC 3AZKA 3AV2A 5AV9B 2Y2MA 3REJC 5CPJD 2XD5A 5B33D 1M1AC 5AVBD 1P3OD 5AY8A 2Y2HA 3REKB 4J8UA 3O62D 5B33A 1M18A 4UUZA 3KWQB 4H9SA 4HGAB 3AV2D 5B31C 1M1AD 5B1MB 4LD9A 3WTPD 1N1JB 1S32C 3W99C 1P3BA 1P3OC 1BH9B 5DNNC 3LJAB 3AN2C 1P3KC 1B67A 1ID3C 3REHC 1R4VA 4J8UC 5B31D 3C1BB 1ZLAD 5B32C 5B1LB 1ID3D 2L5AA 2ZY5A 4H9PB 3AYWB 4WU8A 3A1KA 1JFIA 5CPKB 3X1SD 3A6NB 3WKJA 3X1VC 5B2ID 1P3PB 3A6NC 2F8NB 4DRAA 3W96A 3W97B 3AZMB 3AZMD 4H9RB 5B32A 5AV5B 1HTAA 5DNMC 3AZGD 5CPIB 3UTBB 3X1SB 5E5AD 3A6ND 2JCHA 3AZNA 3AZID 4WU9B 3AFAA 3AL0C 3VH5T 3IP4C 4KUDB 3AZFC 2FJ7A 1P3KB 5E5AC 4WNNB 3KXBA 2JSSA 3MGSD 3AZIC 5BT1C 3AZFB 5B33C 3AZND 4KGCB 3LZ0D 3TU4A 2Y2LA 5B31B 5AVCC 3C1BD 3AZNB 3MGSA 5GSUD 1TZYA 4J8WD 5AVCA 2DF4C 4XUJC 3MGSB 1U35A 1KX4B 5BT1D 2HIOA 1N1JA 3AV2C 3AZKD 3LZ0C 1M1AB 2YFWA 1H3OB 4UUZB 3P5JB 5B2JB 5AV9C 3AN2D 3AZJB 3REKD 1M19B 4G91B 1P3PC 5AVBB 3AZGB 3AV1A 3AZJA 1BH8A 5AV5D 5CP6B 4KGCC 4Z5TB 2W8SA 4Z5TA 2YFVA 1P3PD 4CAYA 1KX3C 1P3MB 3A6NA 4ZBJC 1KX5C 1AOIC 2NQBB 5CPKD 4WU8B 1JFIB 2F8NH 2XD1A 5GT0B 3X1VD 3KUYA 3VH5A 4WU9A 3AZHB 1ID3B 1KX5D 5B0YC 5B1LD 1TAFB 1AOID 3WAAD 5GXQA 5JRGD 3W97C 5B24A 3MGPD 5B1MC 1M18B 2JE5A 5KDMA 5B0YD 4G91C 1P3FC 5JRGC 1P3BB 3AYWC 4KUDA 4H9QA 3WTPB 4H9NA 3MGPC 3NQUB 3W98C 3AV2B 3W99A 1TZYC 5JA4A 1ZLAA 4XUJB 4X23C 2AROA 3O62B 3MGSC 3WA9D 4LD9B 3A1IA 2Y2PA 3AZNC 3MGRB 5B2JA 3KXBD 1U35B 1M19A 2AROC 5B33B 3REHB 3V9RB 2ZY4A 3B0DB 5AV9A 2LY8A 2HIOB 3TU4B 3C1BA 5G49A 4KUDC 3WA9A 5AV8D 5AY8D 5CPKA 3R45A 3MNND 2PYOD 1EQZA 5DNMA 3UTAD 5FUGA 5B0ZB 3LELC 1P3AA 3F6TA 2F2AC 1M1AA 4M6BA 5DNMB 4J8XA 4R8PD 2CV5D 2ZY2A 4YS3D 1P3MA 2FJ7C 2F8NK 4J8XB 5B24D 2NZDC 2ZY3A 1EQZC 3B6GA 3LZ1D 4YS3A 3REID 4YM6C 5CPKC 3MGQA 2Y2KA 1ID3A 1A7WA 3KUYB 2NZDD 1HQ3D 3VH6T 1F66D 1P3LD 3WAAC 3AZED 4QLCD 3X1UB 3WKJB 5CPIA 1P3GA 5CPJC 5GT3B 4NE3A 1ULYA 3MGQB 5DNNA 5DNNB 3LJAC 1S32B 4WJ3C 4NFTA 4HGAC 3X1UA 3LJAA 2AROB 4X23D 3NQUA 2HUEC 5CPJA 3X1UC 4KHAA 4H9OB 1BH9A 4ZUXB 3MVDC 4XZQA 1KX4A 1ZLAC 1P3OA 3KUYC 4XZQB 5G49B 1P3BC 2IO5B 3UT9D 4JJNA 4YM6B 5B0ZA 1P3AB 1EQZB 5C3IC 1WWIA
chains in the Genus database with same CATH topology
3AV1B 5BNXA 3AZEB 2BG1A 2PYOA 3AYWA 1P3LB 2BYMB 5AV8A 4JJNB 3KFUG 3WTPE 4WU8C 1PZRA 5B40D 1P3AD 1KX3B 5B31G 4YM6D 3X1TC 5B24B 2HIOC 2VQRA 3LZ1A 5GXQB 1P34D 2RIQA 2CV5B 3LELA 1P3AC 3MGRC 5AVBC 3W96D 5GT0A 3WTPA 3C1CD 4J8VC 3REIA 3AZJC 4X23B 3O62C 3MNNB 3H0LC 1T3UA 5AY8B 5GSUA 3MVDB 4J8WA 5AVCD 1S32D 5GSUC 5B31A 4J8WC 1BFMA 4J8VD 1P3FB 5F99D 4KGCA 4NE6A 5JRGA 3REHD 5AV6D 1M18C 3B6FB 3MGRA 3WA9B 5B1MA 3X1UD 4QLCB 3RELD 2Y2QA 3LZ0A 1H3OA 2BYKA 1HQ3B 1F66B 5BNXB 3B0CT 3W99D 1P3IA 1P3BD 3WKJC 4Z66C 3UT9C 4Z2MH 5BS7C 5B40A 1P3IB 3AZMA 5CPIC 4J8UD 3AZEA 3AZGA 4Z66D 2UWXA 1P34A 5B32D 4Z5TC 3EPJA 3AZGC 3X1VB 5GT0D 3B6GB 4CAYB 5B40C 3X1SA 4E45A 4EO5C 3TU4D 1KX4C 2RVQD 3X1VA 4XUJA 5CP6D 2NQBC 2F8NA 3KXBB 1U35D 3W98D 4J8UB 3MGRD 1P3GB 4H9NB 1TZYD 4LD9D 3TU4C 3AZJD 3AN2B 4XUJD 3WA9C 3W99B 3REKA 3B6FC 1U35C 5E5AA 3KXBC 4G92B 3AZKB 3KWQC 1BH8B 5F99C 3REKC 3RELB 1TZYB 5AV6C 3C1CA 3O62A 1P3GD 1M18D 3B6FD 3W98B 4CSRB 3WTPC 5AY8C 3LZ0B 3FDDA 5F99A 3MGPB 4J8VA 3AZIA 4KGCD 5JRGB 3EPLA 3AZFA 3MNNC 3RELC 5F99B 5CHLB 3VH6W 3R45B 1P3KD 3B6FA 1F1EA 3AZHD 4H9SC 3VH5W 4G92C 3AZKC 5AVCB 4YM6A 5FUGB 4WU9D 2DQNC 3B6GD 1Q9CA 1B6WA 5B24C 2NQBA 3AZHC 3W97A 5CPID 3W96B 3REJA 5B1LC 5B32B 5GXQD 1P34B 4WU9C 4Z66B 3W97D 4Z5TD 2Y2GA 3X1SC 2F8ND 5CP6A 1HQ3C 1F66C 2G5HC 5B2IB 1KX3D 4H9QB 1P3ID 4WZSB 5B2JD 2YFVB 1M19D 3AZMC 4WV4B 3AYWD 5GT3A 1KX4D 2Y2NA 5B2JC 1M19C 5GSUB 3MVDA 4J8WB 5B2IA 4WNNA 5JA4B 5BNVB 1ZLAB 3UTAA 3UT9A 4X23A 5AV6B 4KHAB 3AZFD 3UT9B 2FFFB 3MGPA 4J8VB 2HUEB 5B32G 1P3FD 4XZQD 4KUDD 3MVDD 3C1BC 3KWQD 4ZUXA 3MNNA 4CSRA 3AZIB 3UTAC 3C1CB 5E5AB 1P3OB 2Y2JA 3UTBD 1P3GC 2CWEA 3B0BA 2AROD 4R8PC 5AVBA 2Y2IA 5AV9D 3KWQA 3UTBC 2YFWB 3AFAC 4EO5B 3LZ1C 5AV5C 3REIC 5B40B 3MGQD 5AV5A 3REJB 3B6GC 4JJND 1HQ3A 5C3IB 1F66A 1P3LA 3AZLA 4DQYB 1Z2CB 2CV5C 4R8PA 5GXQC 5B0YA 2NZDB 2IO5C 4NE5A 1TAFA 3AV1D 2FJ7B 3AZLD 3AZHA 2Y2OA 3X1TB 1EQZD 4H9PA 3REIB 2ZM5A 4Z66A 4ZUXC 2G5IC 3LZ1B 1P3IC 3B0CW 3AFAB 3LJAD 1KX5A 1AOIA 3VH6A 4J8XD 2CV5A 1KX3A 4E44A 3AZLC 4YS3B 5B1MD 3RELA 1P3LC 3KSYA 4ZUXD 4H9OA 4H9RA 3AZEC 4QLCC 3EPKA 3H0MC 2F8NG 3REHA 3UTAB 1P3KA 5BO0A 3AN2A 4QLCA 5BS7A 5GT3C 5CPJB 3NQJB 2BYKB 3W98A 3EPHA 5DNND 4XZQC 3NQJA 1P3FA 5GT3D 4DRBA 3WKJD 3V9RA 5AV8C 5B1LA 3WAAA 2PYOC 3KUYD 3LELD 1WWSA 3AFAD 5B0YB 1KU5A 4AWLB 5B2IC 3MGQC 3X1TD 4YS3C 5GT0C 3AZLB 5B0ZC 3LELB 2FJ7D 4JJNC 5KDMB 3UTBA 3EG5B 1P34C 3WAAB 4R8PB 2J8PA 4ZBJB 4AWLC 1KX5B 1P3MC 1AOIB 5DNMD 3W96C 5B0ZD 5AV6A 3C1CC 3X1TA 3AV1C 2PYOB 3REJD 1P3PA 2RVQC 3B0DC 4Z2MG 4WU8D 5CP6C 4UPKA 2NQBD 2BYMA 5AV8B 1P3MD 2NZDA 3H0RC 1S32A 5BO0B 4LD9C 5BNVA 2HIOD 1W2EA 4J8XC 3AZKA 3AV2A 5AV9B 2Y2MA 3REJC 5CPJD 2XD5A 5B33D 1M1AC 5AVBD 1P3OD 5AY8A 2Y2HA 3REKB 4J8UA 3O62D 5B33A 1M18A 4UUZA 3KWQB 4H9SA 4HGAB 3AV2D 5B31C 1M1AD 5B1MB 4LD9A 3WTPD 1N1JB 1S32C 3W99C 1P3BA 1P3OC 1BH9B 5DNNC 3LJAB 3AN2C 1P3KC 1B67A 1ID3C 3REHC 1R4VA 4J8UC 5B31D 3C1BB 1ZLAD 5B32C 5B1LB 1ID3D 2L5AA 2ZY5A 4H9PB 3AYWB 4WU8A 3A1KA 1JFIA 5CPKB 3X1SD 3A6NB 3WKJA 3X1VC 5B2ID 1P3PB 3A6NC 2F8NB 4DRAA 3W96A 3W97B 3AZMB 3AZMD 4H9RB 5B32A 5AV5B 1HTAA 5DNMC 3AZGD 5CPIB 3UTBB 3X1SB 5E5AD 3A6ND 2JCHA 3AZNA 3AZID 4WU9B 3AFAA 3AL0C 3VH5T 3IP4C 4KUDB 3AZFC 2FJ7A 1P3KB 5E5AC 4WNNB 3KXBA 2JSSA 3MGSD 3AZIC 5BT1C 3AZFB 5B33C 3AZND 4KGCB 3LZ0D 3TU4A 2Y2LA 5B31B 5AVCC 3C1BD 3AZNB 3MGSA 5GSUD 1TZYA 4J8WD 5AVCA 2DF4C 4XUJC 3MGSB 1U35A 1KX4B 5BT1D 2HIOA 1N1JA 3AV2C 3AZKD 3LZ0C 1M1AB 2YFWA 1H3OB 4UUZB 3P5JB 5B2JB 5AV9C 3AN2D 3AZJB 3REKD 1M19B 4G91B 1P3PC 5AVBB 3AZGB 3AV1A 3AZJA 1BH8A 5AV5D 5CP6B 4KGCC 4Z5TB 2W8SA 4Z5TA 2YFVA 1P3PD 4CAYA 1KX3C 1P3MB 3A6NA 4ZBJC 1KX5C 1AOIC 2NQBB 5CPKD 4WU8B 1JFIB 2F8NH 2XD1A 5GT0B 3X1VD 3KUYA 3VH5A 4WU9A 3AZHB 1ID3B 1KX5D 5B0YC 5B1LD 1TAFB 1AOID 3WAAD 5GXQA 5JRGD 3W97C 5B24A 3MGPD 5B1MC 1M18B 2JE5A 5KDMA 5B0YD 4G91C 1P3FC 5JRGC 1P3BB 3AYWC 4KUDA 4H9QA 3WTPB 4H9NA 3MGPC 3NQUB 3W98C 3AV2B 3W99A 1TZYC 5JA4A 1ZLAA 4XUJB 4X23C 2AROA 3O62B 3MGSC 3WA9D 4LD9B 3A1IA 2Y2PA 3AZNC 3MGRB 5B2JA 3KXBD 1U35B 1M19A 2AROC 5B33B 3REHB 3V9RB 2ZY4A 3B0DB 5AV9A 2LY8A 2HIOB 3TU4B 3C1BA 5G49A 4KUDC 3WA9A 5AV8D 5AY8D 5CPKA 3R45A 3MNND 2PYOD 1EQZA 5DNMA 3UTAD 5FUGA 5B0ZB 3LELC 1P3AA 3F6TA 2F2AC 1M1AA 4M6BA 5DNMB 4J8XA 4R8PD 2CV5D 2ZY2A 4YS3D 1P3MA 2FJ7C 2F8NK 4J8XB 5B24D 2NZDC 2ZY3A 1EQZC 3B6GA 3LZ1D 4YS3A 3REID 4YM6C 5CPKC 3MGQA 2Y2KA 1ID3A 1A7WA 3KUYB 2NZDD 1HQ3D 3VH6T 1F66D 1P3LD 3WAAC 3AZED 4QLCD 3X1UB 3WKJB 5CPIA 1P3GA 5CPJC 5GT3B 4NE3A 1ULYA 3MGQB 5DNNA 5DNNB 3LJAC 1S32B 4WJ3C 4NFTA 4HGAC 3X1UA 3LJAA 2AROB 4X23D 3NQUA 2HUEC 5CPJA 3X1UC 4KHAA 4H9OB 1BH9A 4ZUXB 3MVDC 4XZQA 1KX4A 1ZLAC 1P3OA 3KUYC 4XZQB 5G49B 1P3BC 2IO5B 3UT9D 4JJNA 4YM6B 5B0ZA 1P3AB 1EQZB 5C3IC 1WWIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AV1 B;  5BNX A;  3AZE B;  2PYO A;  3AYW A;  1P3L B;  2BYM B;  5AV8 A;  4JJN B;  3WTP E;  4WU8 C;  5B40 D;  1P3A D;  1KX3 B;  5B31 G;  4YM6 D;  3X1T C;  5B24 B;  2HIO C;  3LZ1 A;  5GXQ B;  1P34 D;  2CV5 B;  3LEL A;  1P3A C;  3MGR C;  5AVB C;  3W96 D;  5GT0 A;  3WTP A;  3C1C D;  4J8V C;  3REI A;  3AZJ C;  4X23 B;  3O62 C;  3MNN B;  5AY8 B;  5GSU A;  3MVD B;  4J8W A;  5AVC D;  1S32 D;  5GSU C;  5B31 A;  4J8W C;  1BFM A;  4J8V D;  1P3F B;  5F99 D;  4KGC A;  4NE6 A;  5JRG A;  3REH D;  5AV6 D;  1M18 C;  3B6F B;  3MGR A;  3WA9 B;  5B1M A;  3X1U D;  4QLC B;  3REL D;  3LZ0 A;  1H3O A;  2BYK A;  1HQ3 B;  1F66 B;  5BNX B;  3B0C T;  3W99 D;  1P3I A;  1P3B D;  3WKJ C;  4Z66 C;  3UT9 C;  4Z2M H;  5BS7 C;  5B40 A;  1P3I B;  3AZM A;  5CPI C;  4J8U D;  3AZE A;  3AZG A;  4Z66 D;  1P34 A;  5B32 D;  4Z5T C;  3AZG C;  3X1V B;  5GT0 D;  3B6G B;  4CAY B;  5B40 C;  3X1S A;  4E45 A;  4EO5 C;  3TU4 D;  1KX4 C;  2RVQ D;  3X1V A;  4XUJ A;  5CP6 D;  2NQB C;  2F8N A;  3KXB B;  1U35 D;  3W98 D;  4J8U B;  3MGR D;  1P3G B;  4H9N B;  1TZY D;  4LD9 D;  3TU4 C;  3AZJ D;  3AN2 B;  4XUJ D;  3WA9 C;  3W99 B;  3REK A;  3B6F C;  1U35 C;  5E5A A;  3KXB C;  4G92 B;  3AZK B;  3KWQ C;  1BH8 B;  5F99 C;  3REK C;  3REL B;  1TZY B;  5AV6 C;  3C1C A;  3O62 A;  1P3G D;  1M18 D;  3B6F D;  3W98 B;  4CSR B;  3WTP C;  5AY8 C;  3LZ0 B;  5F99 A;  3MGP B;  4J8V A;  3AZI A;  4KGC D;  5JRG B;  3AZF A;  3MNN C;  3REL C;  5F99 B;  5CHL B;  3VH6 W;  3R45 B;  1P3K D;  3B6F A;  1F1E A;  3AZH D;  4H9S C;  3VH5 W;  4G92 C;  3AZK C;  5AVC B;  4YM6 A;  5FUG B;  4WU9 D;  3B6G D;  1Q9C A;  1B6W A;  5B24 C;  2NQB A;  3AZH C;  3W97 A;  5CPI D;  3W96 B;  3REJ A;  5B1L C;  5B32 B;  5GXQ D;  1P34 B;  4WU9 C;  4Z66 B;  3W97 D;  4Z5T D;  3X1S C;  2F8N D;  5CP6 A;  1HQ3 C;  1F66 C;  5B2I B;  1KX3 D;  4H9Q B;  1P3I D;  4WZS B;  5B2J D;  2YFV B;  1M19 D;  3AZM C;  4WV4 B;  3AYW D;  5GT3 A;  1KX4 D;  5B2J C;  1M19 C;  5GSU B;  3MVD A;  4J8W B;  5B2I A;  4WNN A;  5JA4 B;  5BNV B;  1ZLA B;  3UTA A;  3UT9 A;  4X23 A;  5AV6 B;  4KHA B;  3AZF D;  3UT9 B;  1P3F D;  3MGP A;  4J8V B;  2HUE B;  5B32 G;  4XZQ D;  4KUD D;  3MVD D;  3C1B C;  3KWQ D;  4ZUX A;  3MNN A;  4CSR A;  3AZI B;  3UTA C;  3C1C B;  5E5A B;  1P3O B;  3UTB D;  1P3G C;  2CWE A;  3B0B A;  2ARO D;  4R8P C;  5AVB A;  5AV9 D;  3KWQ A;  3UTB C;  2YFW B;  3AFA C;  4EO5 B;  3LZ1 C;  5AV5 C;  3REI C;  5B40 B;  3MGQ D;  5AV5 A;  3REJ B;  3B6G C;  4JJN D;  1HQ3 A;  5C3I B;  1F66 A;  1P3L A;  3AZL A;  2CV5 C;  4R8P A;  5GXQ C;  5B0Y A;  2NZD B;  2IO5 C;  4NE5 A;  1TAF A;  3AV1 D;  2FJ7 B;  3AZL D;  3AZH A;  3X1T B;  1EQZ D;  4H9P A;  3REI B;  4Z66 A;  4ZUX C;  3LZ1 B;  1P3I C;  3B0C W;  3AFA B;  3LJA D;  1KX5 A;  1AOI A;  3VH6 A;  4J8X D;  2CV5 A;  1KX3 A;  4E44 A;  3AZL C;  4YS3 B;  5B1M D;  3REL A;  1P3L C;  3KSY A;  4ZUX D;  4H9O A;  4H9R A;  3AZE C;  4QLC C;  2F8N G;  3REH A;  3UTA B;  1P3K A;  5BO0 A;  3AN2 A;  4QLC A;  5BS7 A;  5GT3 C;  5CPJ B;  3NQJ B;  2BYK B;  3W98 A;  5DNN D;  4XZQ C;  3NQJ A;  1P3F A;  5GT3 D;  4DRB A;  3WKJ D;  3V9R A;  5AV8 C;  5B1L A;  3WAA A;  2PYO C;  3KUY D;  3LEL D;  1WWS A;  3AFA D;  5B0Y B;  1KU5 A;  4AWL B;  5B2I C;  3MGQ C;  3X1T D;  4YS3 C;  5GT0 C;  3AZL B;  5B0Z C;  3LEL B;  2FJ7 D;  4JJN C;  5KDM B;  3UTB A;  1P34 C;  3WAA B;  4R8P B;  4ZBJ B;  4AWL C;  1KX5 B;  1AOI B;  1P3M C;  5DNM D;  3W96 C;  5B0Z D;  5AV6 A;  3C1C C;  3X1T A;  3AV1 C;  2PYO B;  3REJ D;  1P3P A;  2RVQ C;  3B0D C;  4Z2M G;  4WU8 D;  5CP6 C;  2NQB D;  2NZD A;  2BYM A;  5AV8 B;  1P3M D;  1S32 A;  5BO0 B;  4LD9 C;  5BNV A;  2HIO D;  4J8X C;  3AZK A;  3AV2 A;  5AV9 B;  3REJ C;  5CPJ D;  5B33 D;  1M1A C;  5AVB D;  1P3O D;  5AY8 A;  3REK B;  4J8U A;  3O62 D;  5B33 A;  1M18 A;  4UUZ A;  3KWQ B;  4H9S A;  4HGA B;  3AV2 D;  5B31 C;  1M1A D;  5B1M B;  4LD9 A;  3WTP D;  1N1J B;  1S32 C;  3W99 C;  1P3B A;  1P3O C;  1BH9 B;  5DNN C;  3LJA B;  3AN2 C;  1P3K C;  1B67 A;  1ID3 C;  3REH C;  1R4V A;  4J8U C;  5B31 D;  3C1B B;  1ZLA D;  5B32 C;  5B1L B;  1ID3 D;  2L5A A;  4H9P B;  3AYW B;  4WU8 A;  1JFI A;  5CPK B;  3X1S D;  3A6N B;  3WKJ A;  3X1V C;  5B2I D;  1P3P B;  3A6N C;  2F8N B;  4DRA A;  3W96 A;  3W97 B;  3AZM B;  3AZM D;  4H9R B;  5B32 A;  5AV5 B;  1HTA A;  5DNM C;  3AZG D;  5CPI B;  3UTB B;  3X1S B;  5E5A D;  3A6N D;  3AZN A;  3AZI D;  4WU9 B;  3AFA A;  3VH5 T;  4KUD B;  3AZF C;  2FJ7 A;  1P3K B;  5E5A C;  4WNN B;  3KXB A;  2JSS A;  3MGS D;  3AZI C;  5BT1 C;  3AZF B;  5B33 C;  3AZN D;  4KGC B;  3LZ0 D;  3TU4 A;  5AVC C;  5B31 B;  3C1B D;  3AZN B;  3MGS A;  5GSU D;  1TZY A;  4J8W D;  5AVC A;  1KX4 B;  4XUJ C;  3MGS B;  1U35 A;  5BT1 D;  2HIO A;  1N1J A;  3AV2 C;  3AZK D;  3LZ0 C;  1M1A B;  2YFW A;  1H3O B;  4UUZ B;  5AV9 C;  5B2J B;  1M19 B;  3AN2 D;  3AZJ B;  3REK D;  4G91 B;  1P3P C;  5AVB B;  3AZG B;  3AV1 A;  3AZJ A;  1BH8 A;  5AV5 D;  5CP6 B;  4KGC C;  4Z5T B;  4Z5T A;  2YFV A;  1P3P D;  4CAY A;  1KX3 C;  1P3M B;  3A6N A;  4ZBJ C;  1KX5 C;  1AOI C;  2NQB B;  5CPK D;  4WU8 B;  1JFI B;  2F8N H;  5GT0 B;  3X1V D;  3KUY A;  3VH5 A;  4WU9 A;  3AZH B;  1ID3 B;  1KX5 D;  5B0Y C;  5B1L D;  1TAF B;  1AOI D;  3WAA D;  5GXQ A;  5JRG D;  3W97 C;  5B24 A;  3MGP D;  5B1M C;  1M18 B;  5KDM A;  5B0Y D;  4G91 C;  1P3F C;  5JRG C;  1P3B B;  3AYW C;  4KUD A;  4H9Q A;  3WTP B;  4H9N A;  3MGP C;  3NQU B;  3W98 C;  3AV2 B;  3W99 A;  1TZY C;  5JA4 A;  1ZLA A;  4XUJ B;  4X23 C;  2ARO A;  3O62 B;  3MGS C;  3WA9 D;  4LD9 B;  3AZN C;  3MGR B;  5B2J A;  3KXB D;  1U35 B;  1M19 A;  2ARO C;  5B33 B;  3REH B;  3V9R B;  3B0D B;  5AV9 A;  2LY8 A;  2HIO B;  3TU4 B;  3C1B A;  5G49 A;  4KUD C;  3WA9 A;  5AV8 D;  5AY8 D;  5CPK A;  3R45 A;  3MNN D;  2PYO D;  1EQZ A;  5DNM A;  3UTA D;  5FUG A;  5B0Z B;  3LEL C;  1P3A A;  1M1A A;  4M6B A;  5DNM B;  4J8X A;  4R8P D;  2CV5 D;  4YS3 D;  1P3M A;  2FJ7 C;  2F8N K;  4J8X B;  5B24 D;  2NZD C;  1EQZ C;  3B6G A;  3LZ1 D;  4YS3 A;  3REI D;  4YM6 C;  5CPK C;  3MGQ A;  1ID3 A;  1A7W A;  3KUY B;  2NZD D;  1HQ3 D;  3VH6 T;  1F66 D;  1P3L D;  3WAA C;  3AZE D;  4QLC D;  3X1U B;  3WKJ B;  5CPI A;  1P3G A;  5CPJ C;  5GT3 B;  4NE3 A;  1ULY A;  3MGQ B;  5DNN A;  5DNN B;  3LJA C;  1S32 B;  4NFT A;  4HGA C;  3X1U A;  3LJA A;  2ARO B;  4X23 D;  3NQU A;  2HUE C;  5CPJ A;  3X1U C;  4KHA A;  4H9O B;  1BH9 A;  4ZUX B;  3MVD C;  4XZQ A;  1KX4 A;  1ZLA C;  1P3O A;  3KUY C;  4XZQ B;  5G49 B;  1P3B C;  2IO5 B;  3UT9 D;  4JJN A;  4YM6 B;  5B0Z A;  1P3A B;  1EQZ B;  5C3I C;  1WWI A; 
#chains in the Genus database with same CATH topology
 3AV1 B;  5BNX A;  3AZE B;  2BG1 A;  2PYO A;  3AYW A;  1P3L B;  2BYM B;  5AV8 A;  4JJN B;  3KFU G;  3WTP E;  4WU8 C;  1PZR A;  5B40 D;  1P3A D;  1KX3 B;  5B31 G;  4YM6 D;  3X1T C;  5B24 B;  2HIO C;  2VQR A;  3LZ1 A;  5GXQ B;  1P34 D;  2RIQ A;  2CV5 B;  3LEL A;  1P3A C;  3MGR C;  5AVB C;  3W96 D;  5GT0 A;  3WTP A;  3C1C D;  4J8V C;  3REI A;  3AZJ C;  4X23 B;  3O62 C;  3MNN B;  3H0L C;  1T3U A;  5AY8 B;  5GSU A;  3MVD B;  4J8W A;  5AVC D;  1S32 D;  5GSU C;  5B31 A;  4J8W C;  1BFM A;  4J8V D;  1P3F B;  5F99 D;  4KGC A;  4NE6 A;  5JRG A;  3REH D;  5AV6 D;  1M18 C;  3B6F B;  3MGR A;  3WA9 B;  5B1M A;  3X1U D;  4QLC B;  3REL D;  2Y2Q A;  3LZ0 A;  1H3O A;  2BYK A;  1HQ3 B;  1F66 B;  5BNX B;  3B0C T;  3W99 D;  1P3I A;  1P3B D;  3WKJ C;  4Z66 C;  3UT9 C;  4Z2M H;  5BS7 C;  5B40 A;  1P3I B;  3AZM A;  5CPI C;  4J8U D;  3AZE A;  3AZG A;  4Z66 D;  2UWX A;  1P34 A;  5B32 D;  4Z5T C;  3EPJ A;  3AZG C;  3X1V B;  5GT0 D;  3B6G B;  4CAY B;  5B40 C;  3X1S A;  4E45 A;  4EO5 C;  3TU4 D;  1KX4 C;  2RVQ D;  3X1V A;  4XUJ A;  5CP6 D;  2NQB C;  2F8N A;  3KXB B;  1U35 D;  3W98 D;  4J8U B;  3MGR D;  1P3G B;  4H9N B;  1TZY D;  4LD9 D;  3TU4 C;  3AZJ D;  3AN2 B;  4XUJ D;  3WA9 C;  3W99 B;  3REK A;  3B6F C;  1U35 C;  5E5A A;  3KXB C;  4G92 B;  3AZK B;  3KWQ C;  1BH8 B;  5F99 C;  3REK C;  3REL B;  1TZY B;  5AV6 C;  3C1C A;  3O62 A;  1P3G D;  1M18 D;  3B6F D;  3W98 B;  4CSR B;  3WTP C;  5AY8 C;  3LZ0 B;  3FDD A;  5F99 A;  3MGP B;  4J8V A;  3AZI A;  4KGC D;  5JRG B;  3EPL A;  3AZF A;  3MNN C;  3REL C;  5F99 B;  5CHL B;  3VH6 W;  3R45 B;  1P3K D;  3B6F A;  1F1E A;  3AZH D;  4H9S C;  3VH5 W;  4G92 C;  3AZK C;  5AVC B;  4YM6 A;  5FUG B;  4WU9 D;  2DQN C;  3B6G D;  1Q9C A;  1B6W A;  5B24 C;  2NQB A;  3AZH C;  3W97 A;  5CPI D;  3W96 B;  3REJ A;  5B1L C;  5B32 B;  5GXQ D;  1P34 B;  4WU9 C;  4Z66 B;  3W97 D;  4Z5T D;  2Y2G A;  3X1S C;  2F8N D;  5CP6 A;  1HQ3 C;  1F66 C;  2G5H C;  5B2I B;  1KX3 D;  4H9Q B;  1P3I D;  4WZS B;  5B2J D;  2YFV B;  1M19 D;  3AZM C;  4WV4 B;  3AYW D;  5GT3 A;  1KX4 D;  2Y2N A;  5B2J C;  1M19 C;  5GSU B;  3MVD A;  4J8W B;  5B2I A;  4WNN A;  5JA4 B;  5BNV B;  1ZLA B;  3UTA A;  3UT9 A;  4X23 A;  5AV6 B;  4KHA B;  3AZF D;  3UT9 B;  2FFF B;  3MGP A;  4J8V B;  2HUE B;  5B32 G;  1P3F D;  4XZQ D;  4KUD D;  3MVD D;  3C1B C;  3KWQ D;  4ZUX A;  3MNN A;  4CSR A;  3AZI B;  3UTA C;  3C1C B;  5E5A B;  1P3O B;  2Y2J A;  3UTB D;  1P3G C;  2CWE A;  3B0B A;  2ARO D;  4R8P C;  5AVB A;  2Y2I A;  5AV9 D;  3KWQ A;  3UTB C;  2YFW B;  3AFA C;  4EO5 B;  3LZ1 C;  5AV5 C;  3REI C;  5B40 B;  3MGQ D;  5AV5 A;  3REJ B;  3B6G C;  4JJN D;  1HQ3 A;  5C3I B;  1F66 A;  1P3L A;  3AZL A;  4DQY B;  1Z2C B;  2CV5 C;  4R8P A;  5GXQ C;  5B0Y A;  2NZD B;  2IO5 C;  4NE5 A;  1TAF A;  3AV1 D;  2FJ7 B;  3AZL D;  3AZH A;  2Y2O A;  3X1T B;  1EQZ D;  4H9P A;  3REI B;  2ZM5 A;  4Z66 A;  4ZUX C;  2G5I C;  3LZ1 B;  1P3I C;  3B0C W;  3AFA B;  3LJA D;  1KX5 A;  1AOI A;  3VH6 A;  4J8X D;  2CV5 A;  1KX3 A;  4E44 A;  3AZL C;  4YS3 B;  5B1M D;  3REL A;  1P3L C;  3KSY A;  4ZUX D;  4H9O A;  4H9R A;  3AZE C;  4QLC C;  3EPK A;  3H0M C;  2F8N G;  3REH A;  3UTA B;  1P3K A;  5BO0 A;  3AN2 A;  4QLC A;  5BS7 A;  5GT3 C;  5CPJ B;  3NQJ B;  2BYK B;  3W98 A;  3EPH A;  5DNN D;  4XZQ C;  3NQJ A;  1P3F A;  5GT3 D;  4DRB A;  3WKJ D;  3V9R A;  5AV8 C;  5B1L A;  3WAA A;  2PYO C;  3KUY D;  3LEL D;  1WWS A;  3AFA D;  5B0Y B;  1KU5 A;  4AWL B;  5B2I C;  3MGQ C;  3X1T D;  4YS3 C;  5GT0 C;  3AZL B;  5B0Z C;  3LEL B;  2FJ7 D;  4JJN C;  5KDM B;  3UTB A;  3EG5 B;  1P34 C;  3WAA B;  4R8P B;  2J8P A;  4ZBJ B;  4AWL C;  1KX5 B;  1P3M C;  1AOI B;  5DNM D;  3W96 C;  5B0Z D;  5AV6 A;  3C1C C;  3X1T A;  3AV1 C;  2PYO B;  3REJ D;  1P3P A;  2RVQ C;  3B0D C;  4Z2M G;  4WU8 D;  5CP6 C;  4UPK A;  2NQB D;  2BYM A;  5AV8 B;  1P3M D;  2NZD A;  3H0R C;  1S32 A;  5BO0 B;  4LD9 C;  5BNV A;  2HIO D;  1W2E A;  4J8X C;  3AZK A;  3AV2 A;  5AV9 B;  2Y2M A;  3REJ C;  5CPJ D;  2XD5 A;  5B33 D;  1M1A C;  5AVB D;  1P3O D;  5AY8 A;  2Y2H A;  3REK B;  4J8U A;  3O62 D;  5B33 A;  1M18 A;  4UUZ A;  3KWQ B;  4H9S A;  4HGA B;  3AV2 D;  5B31 C;  1M1A D;  5B1M B;  4LD9 A;  3WTP D;  1N1J B;  1S32 C;  3W99 C;  1P3B A;  1P3O C;  1BH9 B;  5DNN C;  3LJA B;  3AN2 C;  1P3K C;  1B67 A;  1ID3 C;  3REH C;  1R4V A;  4J8U C;  5B31 D;  3C1B B;  1ZLA D;  5B32 C;  5B1L B;  1ID3 D;  2L5A A;  2ZY5 A;  4H9P B;  3AYW B;  4WU8 A;  3A1K A;  1JFI A;  5CPK B;  3X1S D;  3A6N B;  3WKJ A;  3X1V C;  5B2I D;  1P3P B;  3A6N C;  2F8N B;  4DRA A;  3W96 A;  3W97 B;  3AZM B;  3AZM D;  4H9R B;  5B32 A;  5AV5 B;  1HTA A;  5DNM C;  3AZG D;  5CPI B;  3UTB B;  3X1S B;  5E5A D;  3A6N D;  2JCH A;  3AZN A;  3AZI D;  4WU9 B;  3AFA A;  3AL0 C;  3VH5 T;  3IP4 C;  4KUD B;  3AZF C;  2FJ7 A;  1P3K B;  5E5A C;  4WNN B;  3KXB A;  2JSS A;  3MGS D;  3AZI C;  5BT1 C;  3AZF B;  5B33 C;  3AZN D;  4KGC B;  3LZ0 D;  3TU4 A;  2Y2L A;  5B31 B;  5AVC C;  3C1B D;  3AZN B;  3MGS A;  5GSU D;  1TZY A;  4J8W D;  5AVC A;  2DF4 C;  4XUJ C;  3MGS B;  1U35 A;  1KX4 B;  5BT1 D;  2HIO A;  1N1J A;  3AV2 C;  3AZK D;  3LZ0 C;  1M1A B;  2YFW A;  1H3O B;  4UUZ B;  3P5J B;  5B2J B;  5AV9 C;  3AN2 D;  3AZJ B;  3REK D;  1M19 B;  4G91 B;  1P3P C;  5AVB B;  3AZG B;  3AV1 A;  3AZJ A;  1BH8 A;  5AV5 D;  5CP6 B;  4KGC C;  4Z5T B;  2W8S A;  4Z5T A;  2YFV A;  1P3P D;  4CAY A;  1KX3 C;  1P3M B;  3A6N A;  4ZBJ C;  1KX5 C;  1AOI C;  2NQB B;  5CPK D;  4WU8 B;  1JFI B;  2F8N H;  2XD1 A;  5GT0 B;  3X1V D;  3KUY A;  3VH5 A;  4WU9 A;  3AZH B;  1ID3 B;  1KX5 D;  5B0Y C;  5B1L D;  1TAF B;  1AOI D;  3WAA D;  5GXQ A;  5JRG D;  3W97 C;  5B24 A;  3MGP D;  5B1M C;  1M18 B;  2JE5 A;  5KDM A;  5B0Y D;  4G91 C;  1P3F C;  5JRG C;  1P3B B;  3AYW C;  4KUD A;  4H9Q A;  3WTP B;  4H9N A;  3MGP C;  3NQU B;  3W98 C;  3AV2 B;  3W99 A;  1TZY C;  5JA4 A;  1ZLA A;  4XUJ B;  4X23 C;  2ARO A;  3O62 B;  3MGS C;  3WA9 D;  4LD9 B;  3A1I A;  2Y2P A;  3AZN C;  3MGR B;  5B2J A;  3KXB D;  1U35 B;  1M19 A;  2ARO C;  5B33 B;  3REH B;  3V9R B;  2ZY4 A;  3B0D B;  5AV9 A;  2LY8 A;  2HIO B;  3TU4 B;  3C1B A;  5G49 A;  4KUD C;  3WA9 A;  5AV8 D;  5AY8 D;  5CPK A;  3R45 A;  3MNN D;  2PYO D;  1EQZ A;  5DNM A;  3UTA D;  5FUG A;  5B0Z B;  3LEL C;  1P3A A;  3F6T A;  2F2A C;  1M1A A;  4M6B A;  5DNM B;  4J8X A;  4R8P D;  2CV5 D;  2ZY2 A;  4YS3 D;  1P3M A;  2FJ7 C;  2F8N K;  4J8X B;  5B24 D;  2NZD C;  2ZY3 A;  1EQZ C;  3B6G A;  3LZ1 D;  4YS3 A;  3REI D;  4YM6 C;  5CPK C;  3MGQ A;  2Y2K A;  1ID3 A;  1A7W A;  3KUY B;  2NZD D;  1HQ3 D;  3VH6 T;  1F66 D;  1P3L D;  3WAA C;  3AZE D;  4QLC D;  3X1U B;  3WKJ B;  5CPI A;  1P3G A;  5CPJ C;  5GT3 B;  4NE3 A;  1ULY A;  3MGQ B;  5DNN A;  5DNN B;  3LJA C;  1S32 B;  4WJ3 C;  4NFT A;  4HGA C;  3X1U A;  3LJA A;  2ARO B;  4X23 D;  3NQU A;  2HUE C;  5CPJ A;  3X1U C;  4KHA A;  4H9O B;  1BH9 A;  4ZUX B;  3MVD C;  4XZQ A;  1KX4 A;  1ZLA C;  1P3O A;  3KUY C;  4XZQ B;  5G49 B;  1P3B C;  2IO5 B;  3UT9 D;  4JJN A;  4YM6 B;  5B0Z A;  1P3A B;  1EQZ B;  5C3I C;  1WWI A; 
#chains in the Genus database with same CATH homology
 3AV1 B;  5BNX A;  3AZE B;  2BG1 A;  2PYO A;  3AYW A;  1P3L B;  2BYM B;  5AV8 A;  4JJN B;  3KFU G;  3WTP E;  4WU8 C;  1PZR A;  5B40 D;  1P3A D;  1KX3 B;  5B31 G;  4YM6 D;  3X1T C;  5B24 B;  2HIO C;  2VQR A;  3LZ1 A;  5GXQ B;  1P34 D;  2RIQ A;  2CV5 B;  3LEL A;  1P3A C;  3MGR C;  5AVB C;  3W96 D;  5GT0 A;  3WTP A;  3C1C D;  4J8V C;  3REI A;  3AZJ C;  4X23 B;  3O62 C;  3MNN B;  3H0L C;  1T3U A;  5AY8 B;  5GSU A;  3MVD B;  4J8W A;  5AVC D;  1S32 D;  5GSU C;  5B31 A;  4J8W C;  1BFM A;  4J8V D;  1P3F B;  5F99 D;  4KGC A;  4NE6 A;  5JRG A;  3REH D;  5AV6 D;  1M18 C;  3B6F B;  3MGR A;  3WA9 B;  5B1M A;  3X1U D;  4QLC B;  3REL D;  2Y2Q A;  3LZ0 A;  1H3O A;  2BYK A;  1HQ3 B;  1F66 B;  5BNX B;  3B0C T;  3W99 D;  1P3I A;  1P3B D;  3WKJ C;  4Z66 C;  3UT9 C;  4Z2M H;  5BS7 C;  5B40 A;  1P3I B;  3AZM A;  5CPI C;  4J8U D;  3AZE A;  3AZG A;  4Z66 D;  2UWX A;  1P34 A;  5B32 D;  4Z5T C;  3EPJ A;  3AZG C;  3X1V B;  5GT0 D;  3B6G B;  4CAY B;  5B40 C;  3X1S A;  4E45 A;  4EO5 C;  3TU4 D;  1KX4 C;  2RVQ D;  3X1V A;  4XUJ A;  5CP6 D;  2NQB C;  2F8N A;  3KXB B;  1U35 D;  3W98 D;  4J8U B;  3MGR D;  1P3G B;  4H9N B;  1TZY D;  4LD9 D;  3TU4 C;  3AZJ D;  3AN2 B;  4XUJ D;  3WA9 C;  3W99 B;  3REK A;  3B6F C;  1U35 C;  5E5A A;  3KXB C;  4G92 B;  3AZK B;  3KWQ C;  1BH8 B;  5F99 C;  3REK C;  3REL B;  1TZY B;  5AV6 C;  3C1C A;  3O62 A;  1P3G D;  1M18 D;  3B6F D;  3W98 B;  4CSR B;  3WTP C;  5AY8 C;  3LZ0 B;  3FDD A;  5F99 A;  3MGP B;  4J8V A;  3AZI A;  4KGC D;  5JRG B;  3EPL A;  3AZF A;  3MNN C;  3REL C;  5F99 B;  5CHL B;  3VH6 W;  3R45 B;  1P3K D;  3B6F A;  1F1E A;  3AZH D;  4H9S C;  3VH5 W;  4G92 C;  3AZK C;  5AVC B;  4YM6 A;  5FUG B;  4WU9 D;  2DQN C;  3B6G D;  1Q9C A;  1B6W A;  5B24 C;  2NQB A;  3AZH C;  3W97 A;  5CPI D;  3W96 B;  3REJ A;  5B1L C;  5B32 B;  5GXQ D;  1P34 B;  4WU9 C;  4Z66 B;  3W97 D;  4Z5T D;  2Y2G A;  3X1S C;  2F8N D;  5CP6 A;  1HQ3 C;  1F66 C;  2G5H C;  5B2I B;  1KX3 D;  4H9Q B;  1P3I D;  4WZS B;  5B2J D;  2YFV B;  1M19 D;  3AZM C;  4WV4 B;  3AYW D;  5GT3 A;  1KX4 D;  2Y2N A;  5B2J C;  1M19 C;  5GSU B;  3MVD A;  4J8W B;  5B2I A;  4WNN A;  5JA4 B;  5BNV B;  1ZLA B;  3UTA A;  3UT9 A;  4X23 A;  5AV6 B;  4KHA B;  3AZF D;  3UT9 B;  2FFF B;  3MGP A;  4J8V B;  2HUE B;  5B32 G;  1P3F D;  4XZQ D;  4KUD D;  3MVD D;  3C1B C;  3KWQ D;  4ZUX A;  3MNN A;  4CSR A;  3AZI B;  3UTA C;  3C1C B;  5E5A B;  1P3O B;  2Y2J A;  3UTB D;  1P3G C;  2CWE A;  3B0B A;  2ARO D;  4R8P C;  5AVB A;  2Y2I A;  5AV9 D;  3KWQ A;  3UTB C;  2YFW B;  3AFA C;  4EO5 B;  3LZ1 C;  5AV5 C;  3REI C;  5B40 B;  3MGQ D;  5AV5 A;  3REJ B;  3B6G C;  4JJN D;  1HQ3 A;  5C3I B;  1F66 A;  1P3L A;  3AZL A;  4DQY B;  1Z2C B;  2CV5 C;  4R8P A;  5GXQ C;  5B0Y A;  2NZD B;  2IO5 C;  4NE5 A;  1TAF A;  3AV1 D;  2FJ7 B;  3AZL D;  3AZH A;  2Y2O A;  3X1T B;  1EQZ D;  4H9P A;  3REI B;  2ZM5 A;  4Z66 A;  4ZUX C;  2G5I C;  3LZ1 B;  1P3I C;  3B0C W;  3AFA B;  3LJA D;  1KX5 A;  1AOI A;  3VH6 A;  4J8X D;  2CV5 A;  1KX3 A;  4E44 A;  3AZL C;  4YS3 B;  5B1M D;  3REL A;  1P3L C;  3KSY A;  4ZUX D;  4H9O A;  4H9R A;  3AZE C;  4QLC C;  3EPK A;  3H0M C;  2F8N G;  3REH A;  3UTA B;  1P3K A;  5BO0 A;  3AN2 A;  4QLC A;  5BS7 A;  5GT3 C;  5CPJ B;  3NQJ B;  2BYK B;  3W98 A;  3EPH A;  5DNN D;  4XZQ C;  3NQJ A;  1P3F A;  5GT3 D;  4DRB A;  3WKJ D;  3V9R A;  5AV8 C;  5B1L A;  3WAA A;  2PYO C;  3KUY D;  3LEL D;  1WWS A;  3AFA D;  5B0Y B;  1KU5 A;  4AWL B;  5B2I C;  3MGQ C;  3X1T D;  4YS3 C;  5GT0 C;  3AZL B;  5B0Z C;  3LEL B;  2FJ7 D;  4JJN C;  5KDM B;  3UTB A;  3EG5 B;  1P34 C;  3WAA B;  4R8P B;  2J8P A;  4ZBJ B;  4AWL C;  1KX5 B;  1P3M C;  1AOI B;  5DNM D;  3W96 C;  5B0Z D;  5AV6 A;  3C1C C;  3X1T A;  3AV1 C;  2PYO B;  3REJ D;  1P3P A;  2RVQ C;  3B0D C;  4Z2M G;  4WU8 D;  5CP6 C;  4UPK A;  2NQB D;  2BYM A;  5AV8 B;  1P3M D;  2NZD A;  3H0R C;  1S32 A;  5BO0 B;  4LD9 C;  5BNV A;  2HIO D;  1W2E A;  4J8X C;  3AZK A;  3AV2 A;  5AV9 B;  2Y2M A;  3REJ C;  5CPJ D;  2XD5 A;  5B33 D;  1M1A C;  5AVB D;  1P3O D;  5AY8 A;  2Y2H A;  3REK B;  4J8U A;  3O62 D;  5B33 A;  1M18 A;  4UUZ A;  3KWQ B;  4H9S A;  4HGA B;  3AV2 D;  5B31 C;  1M1A D;  5B1M B;  4LD9 A;  3WTP D;  1N1J B;  1S32 C;  3W99 C;  1P3B A;  1P3O C;  1BH9 B;  5DNN C;  3LJA B;  3AN2 C;  1P3K C;  1B67 A;  1ID3 C;  3REH C;  1R4V A;  4J8U C;  5B31 D;  3C1B B;  1ZLA D;  5B32 C;  5B1L B;  1ID3 D;  2L5A A;  2ZY5 A;  4H9P B;  3AYW B;  4WU8 A;  3A1K A;  1JFI A;  5CPK B;  3X1S D;  3A6N B;  3WKJ A;  3X1V C;  5B2I D;  1P3P B;  3A6N C;  2F8N B;  4DRA A;  3W96 A;  3W97 B;  3AZM B;  3AZM D;  4H9R B;  5B32 A;  5AV5 B;  1HTA A;  5DNM C;  3AZG D;  5CPI B;  3UTB B;  3X1S B;  5E5A D;  3A6N D;  2JCH A;  3AZN A;  3AZI D;  4WU9 B;  3AFA A;  3AL0 C;  3VH5 T;  3IP4 C;  4KUD B;  3AZF C;  2FJ7 A;  1P3K B;  5E5A C;  4WNN B;  3KXB A;  2JSS A;  3MGS D;  3AZI C;  5BT1 C;  3AZF B;  5B33 C;  3AZN D;  4KGC B;  3LZ0 D;  3TU4 A;  2Y2L A;  5B31 B;  5AVC C;  3C1B D;  3AZN B;  3MGS A;  5GSU D;  1TZY A;  4J8W D;  5AVC A;  2DF4 C;  4XUJ C;  3MGS B;  1U35 A;  1KX4 B;  5BT1 D;  2HIO A;  1N1J A;  3AV2 C;  3AZK D;  3LZ0 C;  1M1A B;  2YFW A;  1H3O B;  4UUZ B;  3P5J B;  5B2J B;  5AV9 C;  3AN2 D;  3AZJ B;  3REK D;  1M19 B;  4G91 B;  1P3P C;  5AVB B;  3AZG B;  3AV1 A;  3AZJ A;  1BH8 A;  5AV5 D;  5CP6 B;  4KGC C;  4Z5T B;  2W8S A;  4Z5T A;  2YFV A;  1P3P D;  4CAY A;  1KX3 C;  1P3M B;  3A6N A;  4ZBJ C;  1KX5 C;  1AOI C;  2NQB B;  5CPK D;  4WU8 B;  1JFI B;  2F8N H;  2XD1 A;  5GT0 B;  3X1V D;  3KUY A;  3VH5 A;  4WU9 A;  3AZH B;  1ID3 B;  1KX5 D;  5B0Y C;  5B1L D;  1TAF B;  1AOI D;  3WAA D;  5GXQ A;  5JRG D;  3W97 C;  5B24 A;  3MGP D;  5B1M C;  1M18 B;  2JE5 A;  5KDM A;  5B0Y D;  4G91 C;  1P3F C;  5JRG C;  1P3B B;  3AYW C;  4KUD A;  4H9Q A;  3WTP B;  4H9N A;  3MGP C;  3NQU B;  3W98 C;  3AV2 B;  3W99 A;  1TZY C;  5JA4 A;  1ZLA A;  4XUJ B;  4X23 C;  2ARO A;  3O62 B;  3MGS C;  3WA9 D;  4LD9 B;  3A1I A;  2Y2P A;  3AZN C;  3MGR B;  5B2J A;  3KXB D;  1U35 B;  1M19 A;  2ARO C;  5B33 B;  3REH B;  3V9R B;  2ZY4 A;  3B0D B;  5AV9 A;  2LY8 A;  2HIO B;  3TU4 B;  3C1B A;  5G49 A;  4KUD C;  3WA9 A;  5AV8 D;  5AY8 D;  5CPK A;  3R45 A;  3MNN D;  2PYO D;  1EQZ A;  5DNM A;  3UTA D;  5FUG A;  5B0Z B;  3LEL C;  1P3A A;  3F6T A;  2F2A C;  1M1A A;  4M6B A;  5DNM B;  4J8X A;  4R8P D;  2CV5 D;  2ZY2 A;  4YS3 D;  1P3M A;  2FJ7 C;  2F8N K;  4J8X B;  5B24 D;  2NZD C;  2ZY3 A;  1EQZ C;  3B6G A;  3LZ1 D;  4YS3 A;  3REI D;  4YM6 C;  5CPK C;  3MGQ A;  2Y2K A;  1ID3 A;  1A7W A;  3KUY B;  2NZD D;  1HQ3 D;  3VH6 T;  1F66 D;  1P3L D;  3WAA C;  3AZE D;  4QLC D;  3X1U B;  3WKJ B;  5CPI A;  1P3G A;  5CPJ C;  5GT3 B;  4NE3 A;  1ULY A;  3MGQ B;  5DNN A;  5DNN B;  3LJA C;  1S32 B;  4WJ3 C;  4NFT A;  4HGA C;  3X1U A;  3LJA A;  2ARO B;  4X23 D;  3NQU A;  2HUE C;  5CPJ A;  3X1U C;  4KHA A;  4H9O B;  1BH9 A;  4ZUX B;  3MVD C;  4XZQ A;  1KX4 A;  1ZLA C;  1P3O A;  3KUY C;  4XZQ B;  5G49 B;  1P3B C;  2IO5 B;  3UT9 D;  4JJN A;  4YM6 B;  5B0Z A;  1P3A B;  1EQZ B;  5C3I C;  1WWI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...