1HQ3C

Crystal structure of the histone-core-octamer in kcl/phosphate
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
95
structure length
95
Chain Sequence
YRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords HISTONE H2A-IV
publication title Structure of the histone-core octamer in KCl/phosphate crystals at 2.15 A resolution.
pubmed doi rcsb
total genus 32
structure length 95
sequence length 95
chains with identical sequence G
ec nomenclature
pdb deposition date 2000-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1hq3C00
1S32B 4Z66B 5B40A 3REKB 3X1TD 5B40C 5CPIB 3MVDB 2IO5B 3W98A 1M1AA 3W98C 1P3OA 5AVBC 1M1AC 4XUJA 1BH8B 3AV1D 4XUJC 5B1MD 3AZJA 3W96A 3AZJC 1P3GC 3W96C 2PYOB 1EQZA 5DNMA 1EQZC 4CAYA 5B0YA 4H9OA 3VH6A 5CHLB 5B0YC 3AN2D 3W97D 4KHAB 3LELA 5FUGA 3LELC 5B2JB 5GXQD 1F66A 1F66C 4QLCB 1P3MA 3C1CB 3LJAA 1P3MC 5CPKA 1TZYB 5B1LB 1TZYC 1P3AB 5B24C 3AZMD 1M19B 1N1JA 3NQJA 5GSUD 5AVCB 2AROA 5AV6B 3O62B 3NQUA 2AROC 2YFWB 2FJ7D 4KGCA 4CSRB 2F8ND 4AWLC 1KX5D 3B0DC 1P3KA 4Z2MG 1P3KC 3X1UC 1HQ3D 3MGSD 4H9PA 5AY8A 4WU8D 2HIOD 1ZLAB 5AY8C 3MNNB 3MGRA 3AZFB 3MGRC 3AZHD 1Q9CA 2CV5D 5GT3C 1P3ID 5AV8D 1M18A 4YM6B 4R8PD 3AZGA 4YS3B 3KSYA 5CPJB 1M18C 3AFAA 3B6FA 3KUYA 5C3IB 3KUYC 5CPID 3MVDD 3UTBC 4J8UC 1U35C 3REHB 2NQBB 1P3PA 1P3PC 5AV9C 4J8VD 3AZNB 4J8XA 4J8XC 2PYOD 3V9RA 4H9QB 3LZ0A 3X1TB 5AV5B 4X23A 5BNVB 4X23C 3TU4A 3TU4C 3AYWA 1P3BA 3LZ1B 5B2JD 4Z5TD 2F8NG 3AV1A 3WA9A 4QLCD 3AV1C 2NZDB 5B1LD 5B1MC 3KWQA 1P3AD 3W99B 1M19D 2RVQD 5AVCD 5AV6D 3O62D 3AZKA 3AN2A 3AZKC 3AN2C 3A6ND 3UT9A 3W97C 4NFTA 1BH9A 5GXQA 5GXQC 1TAFA 4J8WB 3WAAA 4ZUXD 3WTPA 1AOIB 3AZMA 5GSUB 3AZMC 5G49A 5B32A 3MNND 5B31A 3AZFD 2FJ7A 4G92B 2FJ7C 1KX4A 2BYKA 4XZQA 5B2IA 5B0ZA 4XZQC 5B0ZC 3KXBB 2F8NB 4WV4B 3MGQA 5BNXA 1KX5B 5JRGB 5CPJD 4YM6D 1KU5A 4YS3D 3WTPE 3REJB 1HQ3B 4JJNA 1P34D 3MGSA 3B0BA 4WU8B 2HIOB 3MGSC 1ID3D 3WKJB 4WU8C 5GT0B 5DNNA 5F99A 3REHD 3AZID 3AZHA 3AZHC 1P3IB 2CV5C 1WWIA 5AV8B 3B6GB 4KUDD 5AV8C 3AZND 5CP6D 4R8PC 3UTAD 1S32A 3X1SB 4Z66A 1S32C 3REKA 5AV5D 4Z66C 3REKC 4H9NB 5CPIC 3MVDC 2IO5C 4G91B 5AVBA 3MGPD 4LD9D 3LZ1D 5BT1D 4J8VB 1R4VA 4J8VC 1P3GA 4WNNB 2NZDD 3AZED 2PYOC 3W99D 3VH5T 4KHAA 3RELD 4E45A 1KX3D 5B2JC 4Z5TB 2L5AA 3X1VD 4QLCA 2CWEA 3C1CA 4QLCC 4J8WD 3C1CC 1TZYA 1JFIB 5B1LA 3VH6W 5BO0B 5B1LC 2LY8A 5B24A 1AOID 1P3AC 1M19A 1M19C 2RVQC 5AVCC 2YFWA 5AV6C 3O62C 3A6NB 1P3FB 3A6NC 4HGAB 4E44A 3KXBD 5DNMB 4ZUXB 5JRGD 3X1UA 5FUGB 3REJD 1P3LD 1A7WA 1ZLAA 3WKJD 5GT0D 1ZLAC 3MNNC 3AZFC 5CPKB 4WU9D 1N1JB 3NQJB 5GT3A 3NQUB 3B6GD 4ZBJB 4YM6A 5CPJA 3VH6T 4YS3A 4YM6C 5CPJC 4YS3C 4KGCB 4EO5B 1P34B 3X1SD 3REID 1ID3B 3UTBA 2BYMB 4J8UA 5C3IC 1U35A 5B33D 3AZIB 3REHC 2NQBA 4H9SC 2NQBC 5AV9A 4KUDB 1BFMA 5CP6B 3AZNC 5KDMA 3UTAB 4H9QA 3X1TA 5AV5A 5BNVA 5AV5C 3X1TC 3B6FB 3MGPB 3C1BB 4LD9B 3LZ1A 3LZ1C 5JA4B 1F1EA 5BT1C 3W98D 1M1AD 2JSSA 5B1MA 1P3OD 2NZDC 3AZEB 3W99C 1HTAA 4NE6A 3AZJD 3W97A 1P3FD 3RELB 3RELC 1KX3B 5DNMD 3LZ0B 3X1VB 1H3OB 3X1VC 5B0YD 3AYWB 4J8WC 2HUEB 1P3BB 3LELD 2YFVB 5GSUA 1AOIC 5GSUC 1F66D 3WA9B 1P3MD 3LJAD 5CPKD 4G92C 5BS7C 3KWQB 2F8NA 3KXBC 1KX5A 2AROD 1KX5C 5JRGA 3UT9B 4KGCD 5JRGC 5E5AB 4Z2MH 4H9RB 1HQ3A 1P3LB 3REJC 1HQ3C 4WU8A 2HIOA 1TAFB 2HIOC 3WKJC 3WAAB 5GT0C 1P3KD 4WU9B 4WU9C 3WTPB 3VH5W 3AZLB 3R45A 2CV5A 5B32B 1P3IA 5B31B 3MGRD 5AV8A 1P3IC 3B6GC 4R8PA 1KX4B 5B2IB 4DRBA 3REIB 3X1SA 5BNXB 3X1SC 5CPIA 2F8NK 3MVDA 4H9NA 3AV2B 1M18D 3AZGD 3B6FD 4G91C 5B33B 3AFAD 3C1BD 4JJNB 3KUYD 1BH8A 5DNNB 4J8VA 5F99B 4WNNA 4UUZB 2PYOA 5B2JA 3LZ0D 4Z5TA 5B40B 1WWSA 4Z5TC 4X23D 2F8NH 3TU4D 3W98B 1M1AB 5AVBB 3AYWD 1P3OB 1JFIA 1P3OC 5BO0A 1P3BD 1P3AA 4XUJB 3WA9D 5AVCA 5AV6A 3O62A 3AZJB 4DRAA 1P3GB 3W96B 3A6NA 1P3FA 1P3FC 3KWQD 4CSRA 4HGAC 1EQZB 4CAYB 5DNMC 5B0YB 3AZKD 4H9OB 4ZUXA 4ZUXC 3UT9D 3LELB 5E5AD 1F66B 1P3MB 3MNNA 3LJAB 3AZFA 3WAAD 3LJAC 5CPKC 5B24B 3WTPD 3AZLD 5B32D 2AROB 5B31D 1KX4D 4M6BA 4ZBJC 5B2ID 4XZQD 5B0ZD 4KGCC 4AWLB 1P34A 4EO5C 3MGQD 1P34C 1ID3A 1ID3C 2BYMA 3B0DB 3AV2D 1P3KB 3X1UB 4NE5A 3REHA 3AZIA 3AZIC 4H9SA 4JJND 4H9PB 5AY8B 3B0CW 3MGRB 5DNND 4KUDA 4KUDC 5F99D 3AZNA 5CP6A 5CP6C 3UTAA 5GT3B 3UTAC 1M18B 3AZGB 3MGPA 3AFAB 3C1BA 3AZGC 3MGPC 3C1BC 3AFAC 3B6FC 4LD9A 4LD9C 1S32D 3KUYB 5JA4A 5B40D 4Z66D 3REKD 3UTBB 4J8UB 1U35B 5AVBD 2NZDA 3AZEA 1B67A 3AZEC 1P3PB 3W99A 5AV9B 4XUJD 4NE3A 1B6WA 1P3GD 3W96D 4J8XB 3RELA 5KDMB 3V9RB 1KX3A 1ULYA 1EQZD 1KX3C 3X1VA 3B0CT 1H3OA 3LZ0C 4X23B 3TU4B 4J8WA 5B32G 3AYWC 5B31G 2HUEC 2YFVA 1P3BC 1AOIA 3AV1B 3WA9C 3C1CD 5B1MB 1TZYD 5BS7A 5B24D 3KXBA 3KWQC 3AZKB 3AN2B 3W97B 1BH9B 5E5AA 3UT9C 3REJA 4H9RA 5E5AC 5GXQB 4WZSB 1P3LA 1P3LC 3WKJA 5GT0A 3WAAC 3X1UD 4WU9A 3AZMB 3WTPC 3AZLA 5G49B 3AZLC 5AY8D 1ZLAD 5B32C 2FJ7B 3B6GA 5B31C 2BYKB 4XZQB 1KX4C 5B0ZB 5B2IC 3MGQB 5GT3D 3REIA 3MGQC 3REIC 3AV2A 3VH5A 3AV2C 5B33A 5B33C 3MGSB 4JJNC 3UTBD 4J8UD 1U35D 5DNNC 5F99C 4UUZA 3R45B 3AZHB 2NQBD 2CV5B 1P3PD 5AV9D 4R8PB 4J8XD
chains in the Genus database with same CATH superfamily
2DQNC 1S32B 4Z66B 5B40A 3REKB 3X1TD 5B40C 2BG1A 3MVDB 2IO5B 5CPIB 3W98A 1M1AA 3W98C 1P3OA 5AVBC 1M1AC 4XUJA 1BH8B 3AV1D 4XUJC 5B1MD 3AZJA 3W96A 3AZJC 1P3GC 3W96C 2PYOB 1EQZA 5DNMA 1EQZC 4CAYA 5B0YA 4H9OA 3VH6A 5CHLB 5B0YC 3AN2D 3W97D 4KHAB 3LELA 3EG5B 5FUGA 3LELC 5B2JB 5GXQD 3H0MC 1F66A 1F66C 4QLCB 1P3MA 3C1CB 3LJAA 1P3MC 5CPKA 1TZYB 5B1LB 1TZYC 1P3AB 5B24C 3AZMD 1M19B 1N1JA 3NQJA 5GSUD 5AVCB 5AV6B 2AROA 3O62B 3NQUA 2AROC 2YFWB 2FJ7D 4KGCA 4CSRB 2F8ND 4AWLC 1KX5D 2RIQA 2Y2JA 3B0DC 1P3KA 4Z2MG 1P3KC 3X1UC 1HQ3D 3MGSD 4H9PA 5AY8A 4WU8D 2HIOD 1ZLAB 5AY8C 3MNNB 3MGRA 3AZFB 3MGRC 3AZHD 1Q9CA 2CV5D 5GT3C 1P3ID 5AV8D 1M18A 4YM6B 4R8PD 3AZGA 4YS3B 3KSYA 5CPJB 1M18C 3AFAA 3B6FA 3A1IA 3KUYA 5C3IB 3KUYC 5CPID 2ZY5A 3MVDD 3UTBC 4J8UC 1U35C 2Y2LA 3REHB 2NQBB 1P3PA 1P3PC 5AV9C 4J8VD 3AZNB 4J8XA 3H0LC 4J8XC 2PYOD 3V9RA 4H9QB 3LZ0A 3X1TB 5AV5B 4X23A 5BNVB 4X23C 3TU4A 3TU4C 3AYWA 1P3BA 3LZ1B 5B2JD 4Z5TD 2F8NG 3AV1A 3WA9A 4QLCD 3AV1C 2NZDB 5B1LD 5B1MC 1T3UA 3KWQA 1P3AD 2Y2PA 1M19D 3W99B 2RVQD 5AVCD 5AV6D 3O62D 3AZKA 3FDDA 3AN2A 3AZKC 3AN2C 2F2AC 2VQRA 3A6ND 4NFTA 1BH9A 3UT9A 3W97C 5GXQA 5GXQC 2Y2NA 1TAFA 4J8WB 3WAAA 4ZUXD 3WTPA 1AOIB 3AZMA 5GSUB 3AZMC 5G49A 5B32A 3MNND 5B31A 3AZFD 2FJ7A 4WJ3C 4G92B 2FJ7C 1KX4A 2BYKA 2XD5A 4XZQA 5B2IA 5B0ZA 4XZQC 5B0ZC 3KXBB 2F8NB 4WV4B 3F6TA 3MGQA 5BNXA 1KX5B 1Z2CB 5JRGB 5CPJD 4YM6D 1KU5A 4YS3D 3WTPE 3REJB 1HQ3B 4JJNA 1P34D 3MGSA 3B0BA 2Y2KA 2HIOB 4WU8B 3MGSC 1ID3D 4WU8C 5GT0B 5DNNA 3WKJB 5F99A 3REHD 3AZID 3AZHA 3AZHC 1P3IB 2CV5C 1WWIA 5AV8B 3B6GB 4KUDD 5AV8C 3AZND 5CP6D 4R8PC 2UWXA 3UTAD 1S32A 2XD1A 3X1SB 4Z66A 1S32C 3REKA 5AV5D 4Z66C 3REKC 2W8SA 4H9NB 5CPIC 3MVDC 2IO5C 4G91B 5AVBA 3MGPD 3KFUG 4LD9D 3LZ1D 1PZRA 5BT1D 2ZY2A 4J8VB 1R4VA 2JE5A 4J8VC 4WNNB 1P3GA 2NZDD 3AZED 2PYOC 3W99D 4DQYB 3VH5T 4KHAA 3RELD 4E45A 1KX3D 5B2JC 4Z5TB 2L5AA 3X1VD 4QLCA 2CWEA 3C1CA 4QLCC 4J8WD 3C1CC 1TZYA 1JFIB 5B1LA 3VH6W 5BO0B 5B1LC 2LY8A 5B24A 1AOID 1P3AC 1M19A 3EPHA 1M19C 2RVQC 5AVCC 2YFWA 5AV6C 3O62C 3A6NB 1P3FB 3A6NC 4HGAB 4E44A 3KXBD 5DNMB 4ZUXB 5JRGD 3X1UA 5FUGB 3REJD 1P3LD 1A7WA 1ZLAA 3WKJD 5GT0D 1ZLAC 3MNNC 3AZFC 5CPKB 4WU9D 1N1JB 3NQJB 2ZM5A 5GT3A 3NQUB 3B6GD 4ZBJB 4YM6A 5CPJA 3VH6T 2Y2QA 4YM6C 4YS3A 4YS3C 5CPJC 4KGCB 4EO5B 1P34B 3X1SD 3REID 1ID3B 3UTBA 2BYMB 4J8UA 5C3IC 1U35A 5B33D 3AZIB 3REHC 2NQBA 4H9SC 2NQBC 5AV9A 4KUDB 1BFMA 5CP6B 3AZNC 5KDMA 3UTAB 4H9QA 3X1TA 5AV5A 5BNVA 5AV5C 3X1TC 3B6FB 3MGPB 3C1BB 4LD9B 3LZ1A 2DF4C 3LZ1C 5JA4B 1F1EA 5BT1C 3W98D 1M1AD 2JSSA 5B1MA 1P3OD 2NZDC 3AZEB 3W99C 1HTAA 4NE6A 3AZJD 3W97A 1P3FD 3RELB 3RELC 1KX3B 5DNMD 3LZ0B 3X1VB 1H3OB 3X1VC 5B0YD 3AYWB 4J8WC 2HUEB 1P3BB 3LELD 2YFVB 5GSUA 1AOIC 5GSUC 1F66D 3WA9B 1P3MD 3LJAD 5CPKD 2Y2IA 4G92C 5BS7C 3KWQB 4UPKA 2F8NA 2G5HC 3KXBC 1KX5A 2AROD 1KX5C 5JRGA 3UT9B 4KGCD 5JRGC 5E5AB 4Z2MH 4H9RB 1HQ3A 3A1KA 1P3LB 3REJC 1HQ3C 4WU8A 2HIOA 1TAFB 2HIOC 3WKJC 3WAAB 5GT0C 2J8PA 1P3KD 4WU9B 4WU9C 3WTPB 3VH5W 3EPJA 3R45A 3AZLB 2Y2GA 2CV5A 5B32B 1P3IA 5B31B 3MGRD 5AV8A 1P3IC 3B6GC 4R8PA 1KX4B 5B2IB 2G5IC 4DRBA 3REIB 3X1SA 5BNXB 3X1SC 5CPIA 2F8NK 3MVDA 3IP4C 4H9NA 3AV2B 1M18D 3AZGD 3B6FD 2Y2OA 4G91C 5B33B 3AFAD 3C1BD 4JJNB 3KUYD 1BH8A 5DNNB 4J8VA 5F99B 4WNNA 4UUZB 2Y2MA 2PYOA 5B2JA 3LZ0D 4Z5TA 5B40B 1WWSA 4Z5TC 4X23D 2F8NH 3TU4D 3W98B 1M1AB 5AVBB 3AYWD 1P3OB 1JFIA 1P3OC 5BO0A 1P3BD 1P3AA 4XUJB 3WA9D 5AVCA 5AV6A 3O62A 2FFFB 3AZJB 4DRAA 1P3GB 2Y2HA 3A6NA 3W96B 1P3FA 1P3FC 3KWQD 4CSRA 4HGAC 1EQZB 4CAYB 5DNMC 5B0YB 3AZKD 4H9OB 4ZUXA 4ZUXC 3UT9D 3LELB 5E5AD 1F66B 1P3MB 3MNNA 3LJAB 3AZFA 3WAAD 3LJAC 5CPKC 5B24B 3WTPD 3EPLA 3AZLD 5B32D 2AROB 5B31D 1KX4D 4M6BA 3H0RC 4ZBJC 5B2ID 5B0ZD 4XZQD 4KGCC 4AWLB 1P34A 3EPKA 4EO5C 3MGQD 1P34C 1ID3A 1ID3C 2BYMA 3B0DB 3AV2D 1P3KB 3X1UB 4NE5A 3REHA 3AZIA 3AZIC 4H9SA 4JJND 4H9PB 5AY8B 3B0CW 3MGRB 5DNND 4KUDA 4KUDC 5F99D 3AZNA 5CP6A 5CP6C 3UTAA 5GT3B 3UTAC 1M18B 3AZGB 3MGPA 3AFAB 3C1BA 3AZGC 3MGPC 3C1BC 3AFAC 3B6FC 4LD9A 4LD9C 1S32D 3KUYB 5JA4A 5B40D 4Z66D 3REKD 3UTBB 4J8UB 1U35B 5AVBD 2NZDA 3AZEA 2ZY3A 1B67A 3AZEC 1P3PB 3W99A 5AV9B 4XUJD 4NE3A 1B6WA 1P3GD 3W96D 4J8XB 3RELA 5KDMB 3V9RB 1KX3A 1ULYA 1EQZD 1KX3C 3X1VA 3B0CT 1H3OA 3LZ0C 4X23B 3TU4B 4J8WA 5B32G 3AYWC 5B31G 2HUEC 2YFVA 1P3BC 1AOIA 3AV1B 3WA9C 3C1CD 5B1MB 1TZYD 5BS7A 5B24D 3KXBA 3KWQC 3AZKB 3AN2B 3P5JB 3W97B 1BH9B 5E5AA 3UT9C 3REJA 4H9RA 5E5AC 5GXQB 4WZSB 1P3LA 1P3LC 3WKJA 5GT0A 3WAAC 3X1UD 4WU9A 3AZMB 3WTPC 3AZLA 5G49B 3AZLC 5AY8D 1ZLAD 5B32C 2FJ7B 3B6GA 5B31C 2BYKB 4XZQB 1KX4C 5B0ZB 5B2IC 3MGQB 5GT3D 3REIA 3MGQC 3REIC 3AV2A 3VH5A 3AV2C 5B33A 5B33C 3MGSB 2ZY4A 4JJNC 2JCHA 1W2EA 3UTBD 4J8UD 1U35D 5DNNC 5F99C 4UUZA 3R45B 3AZHB 2NQBD 2CV5B 1P3PD 3AL0C 5AV9D 4R8PB 4J8XD
chains in the Genus database with same CATH topology
2DQNC 1S32B 4Z66B 5B40A 3REKB 3X1TD 5B40C 2BG1A 3MVDB 2IO5B 5CPIB 3W98A 1M1AA 3W98C 1P3OA 5AVBC 1M1AC 4XUJA 1BH8B 3AV1D 4XUJC 5B1MD 3AZJA 3W96A 3AZJC 1P3GC 3W96C 2PYOB 1EQZA 5DNMA 1EQZC 4CAYA 5B0YA 4H9OA 3VH6A 5CHLB 5B0YC 3AN2D 3W97D 4KHAB 3LELA 3EG5B 5FUGA 3LELC 5B2JB 5GXQD 3H0MC 1F66A 1F66C 4QLCB 1P3MA 3C1CB 3LJAA 1P3MC 5CPKA 1TZYB 5B1LB 1TZYC 1P3AB 5B24C 3AZMD 1M19B 1N1JA 3NQJA 5GSUD 5AVCB 5AV6B 2AROA 3O62B 3NQUA 2AROC 2YFWB 2FJ7D 4KGCA 4CSRB 2F8ND 4AWLC 1KX5D 2RIQA 2Y2JA 3B0DC 1P3KA 4Z2MG 1P3KC 3X1UC 1HQ3D 3MGSD 4H9PA 5AY8A 4WU8D 2HIOD 1ZLAB 5AY8C 3MNNB 3MGRA 3AZFB 3MGRC 3AZHD 1Q9CA 2CV5D 5GT3C 1P3ID 5AV8D 1M18A 4YM6B 4R8PD 3AZGA 4YS3B 3KSYA 5CPJB 1M18C 3AFAA 3B6FA 3A1IA 3KUYA 5C3IB 3KUYC 5CPID 2ZY5A 3MVDD 3UTBC 4J8UC 1U35C 2Y2LA 3REHB 2NQBB 1P3PA 1P3PC 5AV9C 4J8VD 3AZNB 4J8XA 3H0LC 4J8XC 2PYOD 3V9RA 4H9QB 3LZ0A 3X1TB 5AV5B 4X23A 5BNVB 4X23C 3TU4A 3TU4C 3AYWA 1P3BA 3LZ1B 5B2JD 4Z5TD 2F8NG 3AV1A 3WA9A 4QLCD 3AV1C 2NZDB 5B1LD 5B1MC 1T3UA 3KWQA 1P3AD 2Y2PA 1M19D 3W99B 2RVQD 5AVCD 5AV6D 3O62D 3AZKA 3FDDA 3AN2A 3AZKC 3AN2C 2F2AC 2VQRA 3A6ND 4NFTA 1BH9A 3UT9A 3W97C 5GXQA 5GXQC 2Y2NA 1TAFA 4J8WB 3WAAA 4ZUXD 3WTPA 1AOIB 3AZMA 5GSUB 3AZMC 5G49A 5B32A 3MNND 5B31A 3AZFD 2FJ7A 4WJ3C 4G92B 2FJ7C 1KX4A 2BYKA 2XD5A 4XZQA 5B2IA 5B0ZA 4XZQC 5B0ZC 3KXBB 2F8NB 4WV4B 3F6TA 3MGQA 5BNXA 1KX5B 1Z2CB 5JRGB 5CPJD 4YM6D 1KU5A 4YS3D 3WTPE 3REJB 1HQ3B 4JJNA 1P34D 3MGSA 3B0BA 2Y2KA 2HIOB 4WU8B 3MGSC 1ID3D 4WU8C 5GT0B 5DNNA 3WKJB 5F99A 3REHD 3AZID 3AZHA 3AZHC 1P3IB 2CV5C 1WWIA 5AV8B 3B6GB 4KUDD 5AV8C 3AZND 5CP6D 4R8PC 2UWXA 3UTAD 1S32A 2XD1A 3X1SB 4Z66A 1S32C 3REKA 5AV5D 4Z66C 3REKC 2W8SA 4H9NB 5CPIC 3MVDC 2IO5C 4G91B 5AVBA 3MGPD 3KFUG 4LD9D 3LZ1D 1PZRA 5BT1D 2ZY2A 4J8VB 1R4VA 2JE5A 4J8VC 4WNNB 1P3GA 2NZDD 3AZED 2PYOC 3W99D 4DQYB 3VH5T 4KHAA 3RELD 4E45A 1KX3D 5B2JC 4Z5TB 2L5AA 3X1VD 4QLCA 2CWEA 3C1CA 4QLCC 4J8WD 3C1CC 1TZYA 1JFIB 5B1LA 3VH6W 5BO0B 5B1LC 2LY8A 5B24A 1AOID 1P3AC 1M19A 3EPHA 1M19C 2RVQC 5AVCC 2YFWA 5AV6C 3O62C 3A6NB 1P3FB 3A6NC 4HGAB 4E44A 3KXBD 5DNMB 4ZUXB 5JRGD 3X1UA 5FUGB 3REJD 1P3LD 1A7WA 1ZLAA 3WKJD 5GT0D 1ZLAC 3MNNC 3AZFC 5CPKB 4WU9D 1N1JB 3NQJB 2ZM5A 5GT3A 3NQUB 3B6GD 4ZBJB 4YM6A 5CPJA 3VH6T 2Y2QA 4YM6C 4YS3A 4YS3C 5CPJC 4KGCB 4EO5B 1P34B 3X1SD 3REID 1ID3B 3UTBA 2BYMB 4J8UA 5C3IC 1U35A 5B33D 3AZIB 3REHC 2NQBA 4H9SC 2NQBC 5AV9A 4KUDB 1BFMA 5CP6B 3AZNC 5KDMA 3UTAB 4H9QA 3X1TA 5AV5A 5BNVA 5AV5C 3X1TC 3B6FB 3MGPB 3C1BB 4LD9B 3LZ1A 2DF4C 3LZ1C 5JA4B 1F1EA 5BT1C 3W98D 1M1AD 2JSSA 5B1MA 1P3OD 2NZDC 3AZEB 3W99C 1HTAA 4NE6A 3AZJD 3W97A 1P3FD 3RELB 3RELC 1KX3B 5DNMD 3LZ0B 3X1VB 1H3OB 3X1VC 5B0YD 3AYWB 4J8WC 2HUEB 1P3BB 3LELD 2YFVB 5GSUA 1AOIC 5GSUC 1F66D 3WA9B 1P3MD 3LJAD 5CPKD 2Y2IA 4G92C 5BS7C 3KWQB 4UPKA 2F8NA 2G5HC 3KXBC 1KX5A 2AROD 1KX5C 5JRGA 3UT9B 4KGCD 5JRGC 5E5AB 4Z2MH 4H9RB 1HQ3A 3A1KA 1P3LB 3REJC 1HQ3C 4WU8A 2HIOA 1TAFB 2HIOC 3WKJC 3WAAB 5GT0C 2J8PA 1P3KD 4WU9B 4WU9C 3WTPB 3VH5W 3EPJA 3R45A 3AZLB 2Y2GA 2CV5A 5B32B 1P3IA 5B31B 3MGRD 5AV8A 1P3IC 3B6GC 4R8PA 1KX4B 5B2IB 2G5IC 4DRBA 3REIB 3X1SA 5BNXB 3X1SC 5CPIA 2F8NK 3MVDA 3IP4C 4H9NA 3AV2B 1M18D 3AZGD 3B6FD 2Y2OA 4G91C 5B33B 3AFAD 3C1BD 4JJNB 3KUYD 1BH8A 5DNNB 4J8VA 5F99B 4WNNA 4UUZB 2Y2MA 2PYOA 5B2JA 3LZ0D 4Z5TA 5B40B 1WWSA 4Z5TC 4X23D 2F8NH 3TU4D 3W98B 1M1AB 5AVBB 3AYWD 1P3OB 1JFIA 1P3OC 5BO0A 1P3BD 1P3AA 4XUJB 3WA9D 5AVCA 5AV6A 3O62A 2FFFB 3AZJB 4DRAA 1P3GB 2Y2HA 3A6NA 3W96B 1P3FA 1P3FC 3KWQD 4CSRA 4HGAC 1EQZB 4CAYB 5DNMC 5B0YB 3AZKD 4H9OB 4ZUXA 4ZUXC 3UT9D 3LELB 5E5AD 1F66B 1P3MB 3MNNA 3LJAB 3AZFA 3WAAD 3LJAC 5CPKC 5B24B 3WTPD 3EPLA 3AZLD 5B32D 2AROB 5B31D 1KX4D 4M6BA 3H0RC 4ZBJC 5B2ID 5B0ZD 4XZQD 4KGCC 4AWLB 1P34A 3EPKA 4EO5C 3MGQD 1P34C 1ID3A 1ID3C 2BYMA 3B0DB 3AV2D 1P3KB 3X1UB 4NE5A 3REHA 3AZIA 3AZIC 4H9SA 4JJND 4H9PB 5AY8B 3B0CW 3MGRB 5DNND 4KUDA 4KUDC 5F99D 3AZNA 5CP6A 5CP6C 3UTAA 5GT3B 3UTAC 1M18B 3AZGB 3MGPA 3AFAB 3C1BA 3AZGC 3MGPC 3C1BC 3AFAC 3B6FC 4LD9A 4LD9C 1S32D 3KUYB 5JA4A 5B40D 4Z66D 3REKD 3UTBB 4J8UB 1U35B 5AVBD 2NZDA 3AZEA 2ZY3A 1B67A 3AZEC 1P3PB 3W99A 5AV9B 4XUJD 4NE3A 1B6WA 1P3GD 3W96D 4J8XB 3RELA 5KDMB 3V9RB 1KX3A 1ULYA 1EQZD 1KX3C 3X1VA 3B0CT 1H3OA 3LZ0C 4X23B 3TU4B 4J8WA 5B32G 3AYWC 5B31G 2HUEC 2YFVA 1P3BC 1AOIA 3AV1B 3WA9C 3C1CD 5B1MB 1TZYD 5BS7A 5B24D 3KXBA 3KWQC 3AZKB 3AN2B 3P5JB 3W97B 1BH9B 5E5AA 3UT9C 3REJA 4H9RA 5E5AC 5GXQB 4WZSB 1P3LA 1P3LC 3WKJA 5GT0A 3WAAC 3X1UD 4WU9A 3AZMB 3WTPC 3AZLA 5G49B 3AZLC 5AY8D 1ZLAD 5B32C 2FJ7B 3B6GA 5B31C 2BYKB 4XZQB 1KX4C 5B0ZB 5B2IC 3MGQB 5GT3D 3REIA 3MGQC 3REIC 3AV2A 3VH5A 3AV2C 5B33A 5B33C 3MGSB 2ZY4A 4JJNC 2JCHA 1W2EA 3UTBD 4J8UD 1U35D 5DNNC 5F99C 4UUZA 3R45B 3AZHB 2NQBD 2CV5B 1P3PD 3AL0C 5AV9D 4R8PB 4J8XD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1S32 B;  4Z66 B;  5B40 A;  3REK B;  3X1T D;  5B40 C;  5CPI B;  3MVD B;  2IO5 B;  3W98 A;  1M1A A;  3W98 C;  1P3O A;  5AVB C;  1M1A C;  4XUJ A;  1BH8 B;  3AV1 D;  4XUJ C;  5B1M D;  3AZJ A;  3W96 A;  3AZJ C;  1P3G C;  3W96 C;  2PYO B;  1EQZ A;  5DNM A;  1EQZ C;  4CAY A;  5B0Y A;  4H9O A;  3VH6 A;  5CHL B;  5B0Y C;  3AN2 D;  3W97 D;  4KHA B;  3LEL A;  5FUG A;  3LEL C;  5B2J B;  5GXQ D;  1F66 A;  1F66 C;  4QLC B;  1P3M A;  3C1C B;  3LJA A;  1P3M C;  5CPK A;  1TZY B;  5B1L B;  1TZY C;  1P3A B;  5B24 C;  3AZM D;  1M19 B;  1N1J A;  3NQJ A;  5GSU D;  5AVC B;  2ARO A;  5AV6 B;  3O62 B;  3NQU A;  2ARO C;  2YFW B;  2FJ7 D;  4KGC A;  4CSR B;  2F8N D;  4AWL C;  1KX5 D;  3B0D C;  1P3K A;  4Z2M G;  1P3K C;  3X1U C;  1HQ3 D;  3MGS D;  4H9P A;  5AY8 A;  4WU8 D;  2HIO D;  1ZLA B;  5AY8 C;  3MNN B;  3MGR A;  3AZF B;  3MGR C;  3AZH D;  1Q9C A;  2CV5 D;  5GT3 C;  1P3I D;  5AV8 D;  1M18 A;  4YM6 B;  4R8P D;  3AZG A;  4YS3 B;  3KSY A;  5CPJ B;  1M18 C;  3AFA A;  3B6F A;  3KUY A;  5C3I B;  3KUY C;  5CPI D;  3MVD D;  3UTB C;  4J8U C;  1U35 C;  3REH B;  2NQB B;  1P3P A;  1P3P C;  5AV9 C;  4J8V D;  3AZN B;  4J8X A;  4J8X C;  2PYO D;  3V9R A;  4H9Q B;  3LZ0 A;  3X1T B;  5AV5 B;  4X23 A;  5BNV B;  4X23 C;  3TU4 A;  3TU4 C;  3AYW A;  1P3B A;  3LZ1 B;  5B2J D;  4Z5T D;  2F8N G;  3AV1 A;  3WA9 A;  4QLC D;  3AV1 C;  2NZD B;  5B1L D;  5B1M C;  3KWQ A;  1P3A D;  3W99 B;  1M19 D;  2RVQ D;  5AVC D;  5AV6 D;  3O62 D;  3AZK A;  3AN2 A;  3AZK C;  3AN2 C;  3A6N D;  3UT9 A;  3W97 C;  4NFT A;  1BH9 A;  5GXQ A;  5GXQ C;  1TAF A;  4J8W B;  3WAA A;  4ZUX D;  3WTP A;  1AOI B;  3AZM A;  5GSU B;  3AZM C;  5G49 A;  5B32 A;  3MNN D;  5B31 A;  3AZF D;  2FJ7 A;  4G92 B;  2FJ7 C;  1KX4 A;  2BYK A;  4XZQ A;  5B2I A;  5B0Z A;  4XZQ C;  5B0Z C;  3KXB B;  2F8N B;  4WV4 B;  3MGQ A;  5BNX A;  1KX5 B;  5JRG B;  5CPJ D;  4YM6 D;  1KU5 A;  4YS3 D;  3WTP E;  3REJ B;  1HQ3 B;  4JJN A;  1P34 D;  3MGS A;  3B0B A;  4WU8 B;  2HIO B;  3MGS C;  1ID3 D;  3WKJ B;  4WU8 C;  5GT0 B;  5DNN A;  5F99 A;  3REH D;  3AZI D;  3AZH A;  3AZH C;  1P3I B;  2CV5 C;  1WWI A;  5AV8 B;  3B6G B;  4KUD D;  5AV8 C;  3AZN D;  5CP6 D;  4R8P C;  3UTA D;  1S32 A;  3X1S B;  4Z66 A;  1S32 C;  3REK A;  5AV5 D;  4Z66 C;  3REK C;  4H9N B;  5CPI C;  3MVD C;  2IO5 C;  4G91 B;  5AVB A;  3MGP D;  4LD9 D;  3LZ1 D;  5BT1 D;  4J8V B;  1R4V A;  4J8V C;  1P3G A;  4WNN B;  2NZD D;  3AZE D;  2PYO C;  3W99 D;  3VH5 T;  4KHA A;  3REL D;  4E45 A;  1KX3 D;  5B2J C;  4Z5T B;  2L5A A;  3X1V D;  4QLC A;  2CWE A;  3C1C A;  4QLC C;  4J8W D;  3C1C C;  1TZY A;  1JFI B;  5B1L A;  3VH6 W;  5BO0 B;  5B1L C;  2LY8 A;  5B24 A;  1AOI D;  1P3A C;  1M19 A;  1M19 C;  2RVQ C;  5AVC C;  2YFW A;  5AV6 C;  3O62 C;  3A6N B;  1P3F B;  3A6N C;  4HGA B;  4E44 A;  3KXB D;  5DNM B;  4ZUX B;  5JRG D;  3X1U A;  5FUG B;  3REJ D;  1P3L D;  1A7W A;  1ZLA A;  3WKJ D;  5GT0 D;  1ZLA C;  3MNN C;  3AZF C;  5CPK B;  4WU9 D;  1N1J B;  3NQJ B;  5GT3 A;  3NQU B;  3B6G D;  4ZBJ B;  4YM6 A;  5CPJ A;  3VH6 T;  4YS3 A;  4YM6 C;  5CPJ C;  4YS3 C;  4KGC B;  4EO5 B;  1P34 B;  3X1S D;  3REI D;  1ID3 B;  3UTB A;  2BYM B;  4J8U A;  5C3I C;  1U35 A;  5B33 D;  3AZI B;  3REH C;  2NQB A;  4H9S C;  2NQB C;  5AV9 A;  4KUD B;  1BFM A;  5CP6 B;  3AZN C;  5KDM A;  3UTA B;  4H9Q A;  3X1T A;  5AV5 A;  5BNV A;  5AV5 C;  3X1T C;  3B6F B;  3MGP B;  3C1B B;  4LD9 B;  3LZ1 A;  3LZ1 C;  5JA4 B;  1F1E A;  5BT1 C;  3W98 D;  1M1A D;  2JSS A;  5B1M A;  1P3O D;  2NZD C;  3AZE B;  3W99 C;  1HTA A;  4NE6 A;  3AZJ D;  3W97 A;  1P3F D;  3REL B;  3REL C;  1KX3 B;  5DNM D;  3LZ0 B;  3X1V B;  1H3O B;  3X1V C;  5B0Y D;  3AYW B;  4J8W C;  2HUE B;  1P3B B;  3LEL D;  2YFV B;  5GSU A;  1AOI C;  5GSU C;  1F66 D;  3WA9 B;  1P3M D;  3LJA D;  5CPK D;  4G92 C;  5BS7 C;  3KWQ B;  2F8N A;  3KXB C;  1KX5 A;  2ARO D;  1KX5 C;  5JRG A;  3UT9 B;  4KGC D;  5JRG C;  5E5A B;  4Z2M H;  4H9R B;  1HQ3 A;  1P3L B;  3REJ C;  1HQ3 C;  4WU8 A;  2HIO A;  1TAF B;  2HIO C;  3WKJ C;  3WAA B;  5GT0 C;  1P3K D;  4WU9 B;  4WU9 C;  3WTP B;  3VH5 W;  3AZL B;  3R45 A;  2CV5 A;  5B32 B;  1P3I A;  5B31 B;  3MGR D;  5AV8 A;  1P3I C;  3B6G C;  4R8P A;  1KX4 B;  5B2I B;  4DRB A;  3REI B;  3X1S A;  5BNX B;  3X1S C;  5CPI A;  2F8N K;  3MVD A;  4H9N A;  3AV2 B;  1M18 D;  3AZG D;  3B6F D;  4G91 C;  5B33 B;  3AFA D;  3C1B D;  4JJN B;  3KUY D;  1BH8 A;  5DNN B;  4J8V A;  5F99 B;  4WNN A;  4UUZ B;  2PYO A;  5B2J A;  3LZ0 D;  4Z5T A;  5B40 B;  1WWS A;  4Z5T C;  4X23 D;  2F8N H;  3TU4 D;  3W98 B;  1M1A B;  5AVB B;  3AYW D;  1P3O B;  1JFI A;  1P3O C;  5BO0 A;  1P3B D;  1P3A A;  4XUJ B;  3WA9 D;  5AVC A;  5AV6 A;  3O62 A;  3AZJ B;  4DRA A;  1P3G B;  3W96 B;  3A6N A;  1P3F A;  1P3F C;  3KWQ D;  4CSR A;  4HGA C;  1EQZ B;  4CAY B;  5DNM C;  5B0Y B;  3AZK D;  4H9O B;  4ZUX A;  4ZUX C;  3UT9 D;  3LEL B;  5E5A D;  1F66 B;  1P3M B;  3MNN A;  3LJA B;  3AZF A;  3WAA D;  3LJA C;  5CPK C;  5B24 B;  3WTP D;  3AZL D;  5B32 D;  2ARO B;  5B31 D;  1KX4 D;  4M6B A;  4ZBJ C;  5B2I D;  4XZQ D;  5B0Z D;  4KGC C;  4AWL B;  1P34 A;  4EO5 C;  3MGQ D;  1P34 C;  1ID3 A;  1ID3 C;  2BYM A;  3B0D B;  3AV2 D;  1P3K B;  3X1U B;  4NE5 A;  3REH A;  3AZI A;  3AZI C;  4H9S A;  4JJN D;  4H9P B;  5AY8 B;  3B0C W;  3MGR B;  5DNN D;  4KUD A;  4KUD C;  5F99 D;  3AZN A;  5CP6 A;  5CP6 C;  3UTA A;  5GT3 B;  3UTA C;  1M18 B;  3AZG B;  3MGP A;  3AFA B;  3C1B A;  3AZG C;  3MGP C;  3C1B C;  3AFA C;  3B6F C;  4LD9 A;  4LD9 C;  1S32 D;  3KUY B;  5JA4 A;  5B40 D;  4Z66 D;  3REK D;  3UTB B;  4J8U B;  1U35 B;  5AVB D;  2NZD A;  3AZE A;  1B67 A;  3AZE C;  1P3P B;  3W99 A;  5AV9 B;  4XUJ D;  4NE3 A;  1B6W A;  1P3G D;  3W96 D;  4J8X B;  3REL A;  5KDM B;  3V9R B;  1KX3 A;  1ULY A;  1EQZ D;  1KX3 C;  3X1V A;  3B0C T;  1H3O A;  3LZ0 C;  4X23 B;  3TU4 B;  4J8W A;  5B32 G;  3AYW C;  5B31 G;  2HUE C;  2YFV A;  1P3B C;  1AOI A;  3AV1 B;  3WA9 C;  3C1C D;  5B1M B;  1TZY D;  5BS7 A;  5B24 D;  3KXB A;  3KWQ C;  3AZK B;  3AN2 B;  3W97 B;  1BH9 B;  5E5A A;  3UT9 C;  3REJ A;  4H9R A;  5E5A C;  5GXQ B;  4WZS B;  1P3L A;  1P3L C;  3WKJ A;  5GT0 A;  3WAA C;  3X1U D;  4WU9 A;  3AZM B;  3WTP C;  3AZL A;  5G49 B;  3AZL C;  5AY8 D;  1ZLA D;  5B32 C;  2FJ7 B;  3B6G A;  5B31 C;  2BYK B;  4XZQ B;  1KX4 C;  5B0Z B;  5B2I C;  3MGQ B;  5GT3 D;  3REI A;  3MGQ C;  3REI C;  3AV2 A;  3VH5 A;  3AV2 C;  5B33 A;  5B33 C;  3MGS B;  4JJN C;  3UTB D;  4J8U D;  1U35 D;  5DNN C;  5F99 C;  4UUZ A;  3R45 B;  3AZH B;  2NQB D;  2CV5 B;  1P3P D;  5AV9 D;  4R8P B;  4J8X D; 
#chains in the Genus database with same CATH topology
 2DQN C;  1S32 B;  4Z66 B;  5B40 A;  3REK B;  3X1T D;  5B40 C;  2BG1 A;  3MVD B;  2IO5 B;  5CPI B;  3W98 A;  1M1A A;  3W98 C;  1P3O A;  5AVB C;  1M1A C;  4XUJ A;  1BH8 B;  3AV1 D;  4XUJ C;  5B1M D;  3AZJ A;  3W96 A;  3AZJ C;  1P3G C;  3W96 C;  2PYO B;  1EQZ A;  5DNM A;  1EQZ C;  4CAY A;  5B0Y A;  4H9O A;  3VH6 A;  5CHL B;  5B0Y C;  3AN2 D;  3W97 D;  4KHA B;  3LEL A;  3EG5 B;  5FUG A;  3LEL C;  5B2J B;  5GXQ D;  3H0M C;  1F66 A;  1F66 C;  4QLC B;  1P3M A;  3C1C B;  3LJA A;  1P3M C;  5CPK A;  1TZY B;  5B1L B;  1TZY C;  1P3A B;  5B24 C;  3AZM D;  1M19 B;  1N1J A;  3NQJ A;  5GSU D;  5AVC B;  5AV6 B;  2ARO A;  3O62 B;  3NQU A;  2ARO C;  2YFW B;  2FJ7 D;  4KGC A;  4CSR B;  2F8N D;  4AWL C;  1KX5 D;  2RIQ A;  2Y2J A;  3B0D C;  1P3K A;  4Z2M G;  1P3K C;  3X1U C;  1HQ3 D;  3MGS D;  4H9P A;  5AY8 A;  4WU8 D;  2HIO D;  1ZLA B;  5AY8 C;  3MNN B;  3MGR A;  3AZF B;  3MGR C;  3AZH D;  1Q9C A;  2CV5 D;  5GT3 C;  1P3I D;  5AV8 D;  1M18 A;  4YM6 B;  4R8P D;  3AZG A;  4YS3 B;  3KSY A;  5CPJ B;  1M18 C;  3AFA A;  3B6F A;  3A1I A;  3KUY A;  5C3I B;  3KUY C;  5CPI D;  2ZY5 A;  3MVD D;  3UTB C;  4J8U C;  1U35 C;  2Y2L A;  3REH B;  2NQB B;  1P3P A;  1P3P C;  5AV9 C;  4J8V D;  3AZN B;  4J8X A;  3H0L C;  4J8X C;  2PYO D;  3V9R A;  4H9Q B;  3LZ0 A;  3X1T B;  5AV5 B;  4X23 A;  5BNV B;  4X23 C;  3TU4 A;  3TU4 C;  3AYW A;  1P3B A;  3LZ1 B;  5B2J D;  4Z5T D;  2F8N G;  3AV1 A;  3WA9 A;  4QLC D;  3AV1 C;  2NZD B;  5B1L D;  5B1M C;  1T3U A;  3KWQ A;  1P3A D;  2Y2P A;  1M19 D;  3W99 B;  2RVQ D;  5AVC D;  5AV6 D;  3O62 D;  3AZK A;  3FDD A;  3AN2 A;  3AZK C;  3AN2 C;  2F2A C;  2VQR A;  3A6N D;  4NFT A;  1BH9 A;  3UT9 A;  3W97 C;  5GXQ A;  5GXQ C;  2Y2N A;  1TAF A;  4J8W B;  3WAA A;  4ZUX D;  3WTP A;  1AOI B;  3AZM A;  5GSU B;  3AZM C;  5G49 A;  5B32 A;  3MNN D;  5B31 A;  3AZF D;  2FJ7 A;  4WJ3 C;  4G92 B;  2FJ7 C;  1KX4 A;  2BYK A;  2XD5 A;  4XZQ A;  5B2I A;  5B0Z A;  4XZQ C;  5B0Z C;  3KXB B;  2F8N B;  4WV4 B;  3F6T A;  3MGQ A;  5BNX A;  1KX5 B;  1Z2C B;  5JRG B;  5CPJ D;  4YM6 D;  1KU5 A;  4YS3 D;  3WTP E;  3REJ B;  1HQ3 B;  4JJN A;  1P34 D;  3MGS A;  3B0B A;  2Y2K A;  2HIO B;  4WU8 B;  3MGS C;  1ID3 D;  4WU8 C;  5GT0 B;  5DNN A;  3WKJ B;  5F99 A;  3REH D;  3AZI D;  3AZH A;  3AZH C;  1P3I B;  2CV5 C;  1WWI A;  5AV8 B;  3B6G B;  4KUD D;  5AV8 C;  3AZN D;  5CP6 D;  4R8P C;  2UWX A;  3UTA D;  1S32 A;  2XD1 A;  3X1S B;  4Z66 A;  1S32 C;  3REK A;  5AV5 D;  4Z66 C;  3REK C;  2W8S A;  4H9N B;  5CPI C;  3MVD C;  2IO5 C;  4G91 B;  5AVB A;  3MGP D;  3KFU G;  4LD9 D;  3LZ1 D;  1PZR A;  5BT1 D;  2ZY2 A;  4J8V B;  1R4V A;  2JE5 A;  4J8V C;  4WNN B;  1P3G A;  2NZD D;  3AZE D;  2PYO C;  3W99 D;  4DQY B;  3VH5 T;  4KHA A;  3REL D;  4E45 A;  1KX3 D;  5B2J C;  4Z5T B;  2L5A A;  3X1V D;  4QLC A;  2CWE A;  3C1C A;  4QLC C;  4J8W D;  3C1C C;  1TZY A;  1JFI B;  5B1L A;  3VH6 W;  5BO0 B;  5B1L C;  2LY8 A;  5B24 A;  1AOI D;  1P3A C;  1M19 A;  3EPH A;  1M19 C;  2RVQ C;  5AVC C;  2YFW A;  5AV6 C;  3O62 C;  3A6N B;  1P3F B;  3A6N C;  4HGA B;  4E44 A;  3KXB D;  5DNM B;  4ZUX B;  5JRG D;  3X1U A;  5FUG B;  3REJ D;  1P3L D;  1A7W A;  1ZLA A;  3WKJ D;  5GT0 D;  1ZLA C;  3MNN C;  3AZF C;  5CPK B;  4WU9 D;  1N1J B;  3NQJ B;  2ZM5 A;  5GT3 A;  3NQU B;  3B6G D;  4ZBJ B;  4YM6 A;  5CPJ A;  3VH6 T;  2Y2Q A;  4YM6 C;  4YS3 A;  4YS3 C;  5CPJ C;  4KGC B;  4EO5 B;  1P34 B;  3X1S D;  3REI D;  1ID3 B;  3UTB A;  2BYM B;  4J8U A;  5C3I C;  1U35 A;  5B33 D;  3AZI B;  3REH C;  2NQB A;  4H9S C;  2NQB C;  5AV9 A;  4KUD B;  1BFM A;  5CP6 B;  3AZN C;  5KDM A;  3UTA B;  4H9Q A;  3X1T A;  5AV5 A;  5BNV A;  5AV5 C;  3X1T C;  3B6F B;  3MGP B;  3C1B B;  4LD9 B;  3LZ1 A;  2DF4 C;  3LZ1 C;  5JA4 B;  1F1E A;  5BT1 C;  3W98 D;  1M1A D;  2JSS A;  5B1M A;  1P3O D;  2NZD C;  3AZE B;  3W99 C;  1HTA A;  4NE6 A;  3AZJ D;  3W97 A;  1P3F D;  3REL B;  3REL C;  1KX3 B;  5DNM D;  3LZ0 B;  3X1V B;  1H3O B;  3X1V C;  5B0Y D;  3AYW B;  4J8W C;  2HUE B;  1P3B B;  3LEL D;  2YFV B;  5GSU A;  1AOI C;  5GSU C;  1F66 D;  3WA9 B;  1P3M D;  3LJA D;  5CPK D;  2Y2I A;  4G92 C;  5BS7 C;  3KWQ B;  4UPK A;  2F8N A;  2G5H C;  3KXB C;  1KX5 A;  2ARO D;  1KX5 C;  5JRG A;  3UT9 B;  4KGC D;  5JRG C;  5E5A B;  4Z2M H;  4H9R B;  1HQ3 A;  3A1K A;  1P3L B;  3REJ C;  1HQ3 C;  4WU8 A;  2HIO A;  1TAF B;  2HIO C;  3WKJ C;  3WAA B;  5GT0 C;  2J8P A;  1P3K D;  4WU9 B;  4WU9 C;  3WTP B;  3VH5 W;  3EPJ A;  3R45 A;  3AZL B;  2Y2G A;  2CV5 A;  5B32 B;  1P3I A;  5B31 B;  3MGR D;  5AV8 A;  1P3I C;  3B6G C;  4R8P A;  1KX4 B;  5B2I B;  2G5I C;  4DRB A;  3REI B;  3X1S A;  5BNX B;  3X1S C;  5CPI A;  2F8N K;  3MVD A;  3IP4 C;  4H9N A;  3AV2 B;  1M18 D;  3AZG D;  3B6F D;  2Y2O A;  4G91 C;  5B33 B;  3AFA D;  3C1B D;  4JJN B;  3KUY D;  1BH8 A;  5DNN B;  4J8V A;  5F99 B;  4WNN A;  4UUZ B;  2Y2M A;  2PYO A;  5B2J A;  3LZ0 D;  4Z5T A;  5B40 B;  1WWS A;  4Z5T C;  4X23 D;  2F8N H;  3TU4 D;  3W98 B;  1M1A B;  5AVB B;  3AYW D;  1P3O B;  1JFI A;  1P3O C;  5BO0 A;  1P3B D;  1P3A A;  4XUJ B;  3WA9 D;  5AVC A;  5AV6 A;  3O62 A;  2FFF B;  3AZJ B;  4DRA A;  1P3G B;  2Y2H A;  3A6N A;  3W96 B;  1P3F A;  1P3F C;  3KWQ D;  4CSR A;  4HGA C;  1EQZ B;  4CAY B;  5DNM C;  5B0Y B;  3AZK D;  4H9O B;  4ZUX A;  4ZUX C;  3UT9 D;  3LEL B;  5E5A D;  1F66 B;  1P3M B;  3MNN A;  3LJA B;  3AZF A;  3WAA D;  3LJA C;  5CPK C;  5B24 B;  3WTP D;  3EPL A;  3AZL D;  5B32 D;  2ARO B;  5B31 D;  1KX4 D;  4M6B A;  3H0R C;  4ZBJ C;  5B2I D;  5B0Z D;  4XZQ D;  4KGC C;  4AWL B;  1P34 A;  3EPK A;  4EO5 C;  3MGQ D;  1P34 C;  1ID3 A;  1ID3 C;  2BYM A;  3B0D B;  3AV2 D;  1P3K B;  3X1U B;  4NE5 A;  3REH A;  3AZI A;  3AZI C;  4H9S A;  4JJN D;  4H9P B;  5AY8 B;  3B0C W;  3MGR B;  5DNN D;  4KUD A;  4KUD C;  5F99 D;  3AZN A;  5CP6 A;  5CP6 C;  3UTA A;  5GT3 B;  3UTA C;  1M18 B;  3AZG B;  3MGP A;  3AFA B;  3C1B A;  3AZG C;  3MGP C;  3C1B C;  3AFA C;  3B6F C;  4LD9 A;  4LD9 C;  1S32 D;  3KUY B;  5JA4 A;  5B40 D;  4Z66 D;  3REK D;  3UTB B;  4J8U B;  1U35 B;  5AVB D;  2NZD A;  3AZE A;  2ZY3 A;  1B67 A;  3AZE C;  1P3P B;  3W99 A;  5AV9 B;  4XUJ D;  4NE3 A;  1B6W A;  1P3G D;  3W96 D;  4J8X B;  3REL A;  5KDM B;  3V9R B;  1KX3 A;  1ULY A;  1EQZ D;  1KX3 C;  3X1V A;  3B0C T;  1H3O A;  3LZ0 C;  4X23 B;  3TU4 B;  4J8W A;  5B32 G;  3AYW C;  5B31 G;  2HUE C;  2YFV A;  1P3B C;  1AOI A;  3AV1 B;  3WA9 C;  3C1C D;  5B1M B;  1TZY D;  5BS7 A;  5B24 D;  3KXB A;  3KWQ C;  3AZK B;  3AN2 B;  3P5J B;  3W97 B;  1BH9 B;  5E5A A;  3UT9 C;  3REJ A;  4H9R A;  5E5A C;  5GXQ B;  4WZS B;  1P3L A;  1P3L C;  3WKJ A;  5GT0 A;  3WAA C;  3X1U D;  4WU9 A;  3AZM B;  3WTP C;  3AZL A;  5G49 B;  3AZL C;  5AY8 D;  1ZLA D;  5B32 C;  2FJ7 B;  3B6G A;  5B31 C;  2BYK B;  4XZQ B;  1KX4 C;  5B0Z B;  5B2I C;  3MGQ B;  5GT3 D;  3REI A;  3MGQ C;  3REI C;  3AV2 A;  3VH5 A;  3AV2 C;  5B33 A;  5B33 C;  3MGS B;  2ZY4 A;  4JJN C;  2JCH A;  1W2E A;  3UTB D;  4J8U D;  1U35 D;  5DNN C;  5F99 C;  4UUZ A;  3R45 B;  3AZH B;  2NQB D;  2CV5 B;  1P3P D;  3AL0 C;  5AV9 D;  4R8P B;  4J8X D; 
#chains in the Genus database with same CATH homology
 2DQN C;  1S32 B;  4Z66 B;  5B40 A;  3REK B;  3X1T D;  5B40 C;  2BG1 A;  3MVD B;  2IO5 B;  5CPI B;  3W98 A;  1M1A A;  3W98 C;  1P3O A;  5AVB C;  1M1A C;  4XUJ A;  1BH8 B;  3AV1 D;  4XUJ C;  5B1M D;  3AZJ A;  3W96 A;  3AZJ C;  1P3G C;  3W96 C;  2PYO B;  1EQZ A;  5DNM A;  1EQZ C;  4CAY A;  5B0Y A;  4H9O A;  3VH6 A;  5CHL B;  5B0Y C;  3AN2 D;  3W97 D;  4KHA B;  3LEL A;  3EG5 B;  5FUG A;  3LEL C;  5B2J B;  5GXQ D;  3H0M C;  1F66 A;  1F66 C;  4QLC B;  1P3M A;  3C1C B;  3LJA A;  1P3M C;  5CPK A;  1TZY B;  5B1L B;  1TZY C;  1P3A B;  5B24 C;  3AZM D;  1M19 B;  1N1J A;  3NQJ A;  5GSU D;  5AVC B;  5AV6 B;  2ARO A;  3O62 B;  3NQU A;  2ARO C;  2YFW B;  2FJ7 D;  4KGC A;  4CSR B;  2F8N D;  4AWL C;  1KX5 D;  2RIQ A;  2Y2J A;  3B0D C;  1P3K A;  4Z2M G;  1P3K C;  3X1U C;  1HQ3 D;  3MGS D;  4H9P A;  5AY8 A;  4WU8 D;  2HIO D;  1ZLA B;  5AY8 C;  3MNN B;  3MGR A;  3AZF B;  3MGR C;  3AZH D;  1Q9C A;  2CV5 D;  5GT3 C;  1P3I D;  5AV8 D;  1M18 A;  4YM6 B;  4R8P D;  3AZG A;  4YS3 B;  3KSY A;  5CPJ B;  1M18 C;  3AFA A;  3B6F A;  3A1I A;  3KUY A;  5C3I B;  3KUY C;  5CPI D;  2ZY5 A;  3MVD D;  3UTB C;  4J8U C;  1U35 C;  2Y2L A;  3REH B;  2NQB B;  1P3P A;  1P3P C;  5AV9 C;  4J8V D;  3AZN B;  4J8X A;  3H0L C;  4J8X C;  2PYO D;  3V9R A;  4H9Q B;  3LZ0 A;  3X1T B;  5AV5 B;  4X23 A;  5BNV B;  4X23 C;  3TU4 A;  3TU4 C;  3AYW A;  1P3B A;  3LZ1 B;  5B2J D;  4Z5T D;  2F8N G;  3AV1 A;  3WA9 A;  4QLC D;  3AV1 C;  2NZD B;  5B1L D;  5B1M C;  1T3U A;  3KWQ A;  1P3A D;  2Y2P A;  1M19 D;  3W99 B;  2RVQ D;  5AVC D;  5AV6 D;  3O62 D;  3AZK A;  3FDD A;  3AN2 A;  3AZK C;  3AN2 C;  2F2A C;  2VQR A;  3A6N D;  4NFT A;  1BH9 A;  3UT9 A;  3W97 C;  5GXQ A;  5GXQ C;  2Y2N A;  1TAF A;  4J8W B;  3WAA A;  4ZUX D;  3WTP A;  1AOI B;  3AZM A;  5GSU B;  3AZM C;  5G49 A;  5B32 A;  3MNN D;  5B31 A;  3AZF D;  2FJ7 A;  4WJ3 C;  4G92 B;  2FJ7 C;  1KX4 A;  2BYK A;  2XD5 A;  4XZQ A;  5B2I A;  5B0Z A;  4XZQ C;  5B0Z C;  3KXB B;  2F8N B;  4WV4 B;  3F6T A;  3MGQ A;  5BNX A;  1KX5 B;  1Z2C B;  5JRG B;  5CPJ D;  4YM6 D;  1KU5 A;  4YS3 D;  3WTP E;  3REJ B;  1HQ3 B;  4JJN A;  1P34 D;  3MGS A;  3B0B A;  2Y2K A;  2HIO B;  4WU8 B;  3MGS C;  1ID3 D;  4WU8 C;  5GT0 B;  5DNN A;  3WKJ B;  5F99 A;  3REH D;  3AZI D;  3AZH A;  3AZH C;  1P3I B;  2CV5 C;  1WWI A;  5AV8 B;  3B6G B;  4KUD D;  5AV8 C;  3AZN D;  5CP6 D;  4R8P C;  2UWX A;  3UTA D;  1S32 A;  2XD1 A;  3X1S B;  4Z66 A;  1S32 C;  3REK A;  5AV5 D;  4Z66 C;  3REK C;  2W8S A;  4H9N B;  5CPI C;  3MVD C;  2IO5 C;  4G91 B;  5AVB A;  3MGP D;  3KFU G;  4LD9 D;  3LZ1 D;  1PZR A;  5BT1 D;  2ZY2 A;  4J8V B;  1R4V A;  2JE5 A;  4J8V C;  4WNN B;  1P3G A;  2NZD D;  3AZE D;  2PYO C;  3W99 D;  4DQY B;  3VH5 T;  4KHA A;  3REL D;  4E45 A;  1KX3 D;  5B2J C;  4Z5T B;  2L5A A;  3X1V D;  4QLC A;  2CWE A;  3C1C A;  4QLC C;  4J8W D;  3C1C C;  1TZY A;  1JFI B;  5B1L A;  3VH6 W;  5BO0 B;  5B1L C;  2LY8 A;  5B24 A;  1AOI D;  1P3A C;  1M19 A;  3EPH A;  1M19 C;  2RVQ C;  5AVC C;  2YFW A;  5AV6 C;  3O62 C;  3A6N B;  1P3F B;  3A6N C;  4HGA B;  4E44 A;  3KXB D;  5DNM B;  4ZUX B;  5JRG D;  3X1U A;  5FUG B;  3REJ D;  1P3L D;  1A7W A;  1ZLA A;  3WKJ D;  5GT0 D;  1ZLA C;  3MNN C;  3AZF C;  5CPK B;  4WU9 D;  1N1J B;  3NQJ B;  2ZM5 A;  5GT3 A;  3NQU B;  3B6G D;  4ZBJ B;  4YM6 A;  5CPJ A;  3VH6 T;  2Y2Q A;  4YM6 C;  4YS3 A;  4YS3 C;  5CPJ C;  4KGC B;  4EO5 B;  1P34 B;  3X1S D;  3REI D;  1ID3 B;  3UTB A;  2BYM B;  4J8U A;  5C3I C;  1U35 A;  5B33 D;  3AZI B;  3REH C;  2NQB A;  4H9S C;  2NQB C;  5AV9 A;  4KUD B;  1BFM A;  5CP6 B;  3AZN C;  5KDM A;  3UTA B;  4H9Q A;  3X1T A;  5AV5 A;  5BNV A;  5AV5 C;  3X1T C;  3B6F B;  3MGP B;  3C1B B;  4LD9 B;  3LZ1 A;  2DF4 C;  3LZ1 C;  5JA4 B;  1F1E A;  5BT1 C;  3W98 D;  1M1A D;  2JSS A;  5B1M A;  1P3O D;  2NZD C;  3AZE B;  3W99 C;  1HTA A;  4NE6 A;  3AZJ D;  3W97 A;  1P3F D;  3REL B;  3REL C;  1KX3 B;  5DNM D;  3LZ0 B;  3X1V B;  1H3O B;  3X1V C;  5B0Y D;  3AYW B;  4J8W C;  2HUE B;  1P3B B;  3LEL D;  2YFV B;  5GSU A;  1AOI C;  5GSU C;  1F66 D;  3WA9 B;  1P3M D;  3LJA D;  5CPK D;  2Y2I A;  4G92 C;  5BS7 C;  3KWQ B;  4UPK A;  2F8N A;  2G5H C;  3KXB C;  1KX5 A;  2ARO D;  1KX5 C;  5JRG A;  3UT9 B;  4KGC D;  5JRG C;  5E5A B;  4Z2M H;  4H9R B;  1HQ3 A;  3A1K A;  1P3L B;  3REJ C;  1HQ3 C;  4WU8 A;  2HIO A;  1TAF B;  2HIO C;  3WKJ C;  3WAA B;  5GT0 C;  2J8P A;  1P3K D;  4WU9 B;  4WU9 C;  3WTP B;  3VH5 W;  3EPJ A;  3R45 A;  3AZL B;  2Y2G A;  2CV5 A;  5B32 B;  1P3I A;  5B31 B;  3MGR D;  5AV8 A;  1P3I C;  3B6G C;  4R8P A;  1KX4 B;  5B2I B;  2G5I C;  4DRB A;  3REI B;  3X1S A;  5BNX B;  3X1S C;  5CPI A;  2F8N K;  3MVD A;  3IP4 C;  4H9N A;  3AV2 B;  1M18 D;  3AZG D;  3B6F D;  2Y2O A;  4G91 C;  5B33 B;  3AFA D;  3C1B D;  4JJN B;  3KUY D;  1BH8 A;  5DNN B;  4J8V A;  5F99 B;  4WNN A;  4UUZ B;  2Y2M A;  2PYO A;  5B2J A;  3LZ0 D;  4Z5T A;  5B40 B;  1WWS A;  4Z5T C;  4X23 D;  2F8N H;  3TU4 D;  3W98 B;  1M1A B;  5AVB B;  3AYW D;  1P3O B;  1JFI A;  1P3O C;  5BO0 A;  1P3B D;  1P3A A;  4XUJ B;  3WA9 D;  5AVC A;  5AV6 A;  3O62 A;  2FFF B;  3AZJ B;  4DRA A;  1P3G B;  2Y2H A;  3A6N A;  3W96 B;  1P3F A;  1P3F C;  3KWQ D;  4CSR A;  4HGA C;  1EQZ B;  4CAY B;  5DNM C;  5B0Y B;  3AZK D;  4H9O B;  4ZUX A;  4ZUX C;  3UT9 D;  3LEL B;  5E5A D;  1F66 B;  1P3M B;  3MNN A;  3LJA B;  3AZF A;  3WAA D;  3LJA C;  5CPK C;  5B24 B;  3WTP D;  3EPL A;  3AZL D;  5B32 D;  2ARO B;  5B31 D;  1KX4 D;  4M6B A;  3H0R C;  4ZBJ C;  5B2I D;  5B0Z D;  4XZQ D;  4KGC C;  4AWL B;  1P34 A;  3EPK A;  4EO5 C;  3MGQ D;  1P34 C;  1ID3 A;  1ID3 C;  2BYM A;  3B0D B;  3AV2 D;  1P3K B;  3X1U B;  4NE5 A;  3REH A;  3AZI A;  3AZI C;  4H9S A;  4JJN D;  4H9P B;  5AY8 B;  3B0C W;  3MGR B;  5DNN D;  4KUD A;  4KUD C;  5F99 D;  3AZN A;  5CP6 A;  5CP6 C;  3UTA A;  5GT3 B;  3UTA C;  1M18 B;  3AZG B;  3MGP A;  3AFA B;  3C1B A;  3AZG C;  3MGP C;  3C1B C;  3AFA C;  3B6F C;  4LD9 A;  4LD9 C;  1S32 D;  3KUY B;  5JA4 A;  5B40 D;  4Z66 D;  3REK D;  3UTB B;  4J8U B;  1U35 B;  5AVB D;  2NZD A;  3AZE A;  2ZY3 A;  1B67 A;  3AZE C;  1P3P B;  3W99 A;  5AV9 B;  4XUJ D;  4NE3 A;  1B6W A;  1P3G D;  3W96 D;  4J8X B;  3REL A;  5KDM B;  3V9R B;  1KX3 A;  1ULY A;  1EQZ D;  1KX3 C;  3X1V A;  3B0C T;  1H3O A;  3LZ0 C;  4X23 B;  3TU4 B;  4J8W A;  5B32 G;  3AYW C;  5B31 G;  2HUE C;  2YFV A;  1P3B C;  1AOI A;  3AV1 B;  3WA9 C;  3C1C D;  5B1M B;  1TZY D;  5BS7 A;  5B24 D;  3KXB A;  3KWQ C;  3AZK B;  3AN2 B;  3P5J B;  3W97 B;  1BH9 B;  5E5A A;  3UT9 C;  3REJ A;  4H9R A;  5E5A C;  5GXQ B;  4WZS B;  1P3L A;  1P3L C;  3WKJ A;  5GT0 A;  3WAA C;  3X1U D;  4WU9 A;  3AZM B;  3WTP C;  3AZL A;  5G49 B;  3AZL C;  5AY8 D;  1ZLA D;  5B32 C;  2FJ7 B;  3B6G A;  5B31 C;  2BYK B;  4XZQ B;  1KX4 C;  5B0Z B;  5B2I C;  3MGQ B;  5GT3 D;  3REI A;  3MGQ C;  3REI C;  3AV2 A;  3VH5 A;  3AV2 C;  5B33 A;  5B33 C;  3MGS B;  2ZY4 A;  4JJN C;  2JCH A;  1W2E A;  3UTB D;  4J8U D;  1U35 D;  5DNN C;  5F99 C;  4UUZ A;  3R45 B;  3AZH B;  2NQB D;  2CV5 B;  1P3P D;  3AL0 C;  5AV9 D;  4R8P B;  4J8X D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...