1HQ3C

Crystal structure of the histone-core-octamer in kcl/phosphate
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
95
structure length
95
Chain Sequence
YRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HISTONE H2A-IV
publication title Structure of the histone-core octamer in KCl/phosphate crystals at 2.15 A resolution.
pubmed doi rcsb
molecule tags Dna binding protein
total genus 32
structure length 95
sequence length 95
chains with identical sequence G
ec nomenclature
pdb deposition date 2000-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1hq3C00
3KUYB 3AZJA 4J8XC 1P3FB 3AV2D 3AZHD 3MGPC 2HIOB 5GXQC 4H9SA 5G49A 5AV8D 3AZMD 1P3OD 3X1SB 4ZUXD 5B1MB 2NQBD 1KX3B 5DNNC 5GSUA 5AVCC 3UTAA 3TU4B 2F8NK 3AYWB 3AZFC 4KUDD 1HQ3A 3AFAA 3WA9C 3WTPA 1ID3A 4YS3D 5B24A 4Z66D 5AVBC 3REIA 1H3OB 3WAAB 4XZQC 2AROD 1P3MB 1TZYC 3LZ1D 1P3BD 3MNNC 1P3LD 4Z2MG 4YM6B 1P3PD 2NZDD 4KGCA 4JJNC 2FJ7A 1P34B 4J8UB 5FUGB 5AV6A 1N1JA 5AV5B 5B2JA 5B0ZB 1P3AC 3A6NC 5B32C 3KUYA 3KWQB 4H9RB 3C1CB 1P3FA 1M19B 5F99A 4R8PC 4H9QB 4DRAA 4H9OA 5B0ZD 3KXBC 3W97C 4Z5TC 5JRGA 4UUZB 1KX4D 3B0DC 1P3KC 4HGAC 5B1MA 3W96D 4LD9A 1KX3A 5CPJD 1BH8A 3TU4A 3MGRA 3MGSD 3MGQC 3O62D 5GT3C 3UTBB 3B6GB 3X1VD 5B31B 3UT9A 3WKJA 1ZLAB 3WAAA 1H3OA 2F8NG 1F66B 3MVDB 4J8WB 5CPKB 3AZHC 1KU5A 4YM6A 3AZKB 3VH6W 4QLCD 2IO5B 3AZMC 3LELD 1P3OC 1M18D 4XUJD 4ZUXC 5FUGA 2NQBC 5AV5A 4WZSB 2CV5D 5B40C 3B6FA 4KUDC 3REHD 3W99D 4J8XB 1P3GB 5E5AD 3KWQA 2BYMB 3C1CA 3NQUB 3AV1A 1M19A 5B0YA 1Q9CA 3C1BC 3V9RA 4ZBJC 5B33D 5AV9B 4YS3C 1M1AA 3AZEA 5B1LD 1A7WA 2AROC 3AZJB 3LZ1C 3AZFB 5AY8B 4G92C 4KHAA 1P3LC 5G49B 3VH5A 4J8VC 1U35A 1P3PC 2NZDC 3B6GA 5B31A 3UTAB 1ZLAA 2PYOD 3AFAB 1F66A 3WTPB 3X1UC 3REKA 3AN2B 3RELA 5GSUD 5B24B 5CHLB 1HQ3D 3AZKA 3AFAD 3REIB 1KX4C 3REJA 1BH9B 4WU9C 1ID3D 2F8ND 1P3IC 3W96C 5CPJC 4NE3A 1F1EA 3B0BA 3MGSC 3O62C 3REID 4J8XA 3LZ0C 1P3GA 4KGCB 3W97B 5GXQA 5CP6C 1P3KB 2FJ7D 5DNNA 5AVCA 5AV6D 5AY8A 5F99B 3AZFA 1KX5D 5B2JD 4H9OB 1EQZB 3WA9A 4E44A 5JRGB 4QLCC 5DNMB 3KUYD 1M18C 4XUJC 4EO5B 1P3FD 4LD9B 5F99D 5AVBA 1BH8B 2CV5C 3AZGC 3W98C 3LJAB 4XZQA 2HIOD 3MGRB 1KX5B 1TZYA 3REHC 3W99C 4X23C 5E5AC 3X1SD 5B31G 5B1MD 3AN2A 4AWLB 3UT9B 1KX3D 3TU4D 5B33C 3AYWD 4JJNA 3WKJB 5BS7C 5B1LC 1BH9A 5BNXB 5B40B 3A6NA 1AOIC 3WKJD 5B32A 5C3IC 3WAAD 5BO0B 1P3MD 3W97A 3B0CT 3KXBA 3X1TC 4Z5TA 3B6FB 4YM6D 4H9SC 3AZNC 1P3KA 2PYOC 4G92B 4J8UD 1P34D 3AV1B 5KDMB 3MGQA 5AV5D 5B0YB 5GT3A 3V9RB 4J8VB 1M1AB 1EQZA 3AZEB 5DNMA 1ID3C 3KWQD 4WU8B 1M19D 3C1CD 2HUEB 5B2IB 1S32C 3LJAA 5GT0C 4KHAB 3AZED 3AZIC 1U35B 2YFVA 5BNVA 3AZHA 3AZMA 3AZLB 1P3OA 4WU9B 4ZUXA 1P3IB 3UTBD 5CPIB 3B6GD 2YFWB 5BNXA 3REKB 5B40A 3RELB 5B31D 5AV6C 3AV2C 1KX5C 3LZ0B 1ZLAD 5AV8C 5BO0A 3REJB 3KUYC 1F66D 4CSRA 3MVDD 3C1BA 2RVQD 4J8WD 1P3FC 5CP6B 5B32G 5CPKD 2HIOC 3KSYA 3AZKD 3LZ1A 3X1SC 3MGPB 5B1MC 5GXQB 1P3LA 5KDMA 4J8VA 1P3PA 3TU4C 3AYWC 4Z66C 4J8XD 1P3GD 2L5AA 5AVCB 5DNNB 3W98B 3AZGB 4WU8A 1P3BC 5B2IA 5AV9D 3WA9B 3X1UA 1P3MC 3AZJD 3AZFD 5AY8D 5AVBB 1KX4A 4XZQB 4NE5A 3AZLA 3VH5T 1TZYB 4WU9A 1P3IA 3W96A 5CPIA 2YFWA 5CPJA 1P34C 4J8UC 1AOIB 3MNNB 3MGSA 3O62A 3UTAD 5B0ZC 3LZ0A 4JJNB 1B67A 3X1TB 3WTPD 3R45B 3KWQC 3AN2D 3C1CC 1M19C 5CP6A 1P3AB 3A6NB 5B24D 4JJND 5B32B 2LY8A 2BYKA 4R8PB 3KXBB 3MGPA 3X1VC 4Z5TB 4QLCA 3B0DB 4XUJA 4HGAB 4KGCD 3UTBC 2CV5A 3AZGA 1S32B 3W97D 5GT0B 3W98A 3MGQB 5GT3B 4X23A 3VH6A 3W99A 1P3KD 1HTAA 3LELC 3MVDC 1BFMA 2RVQC 5B33A 4J8WC 3MGQD 5BS7A 2JSSA 5CPKC 4H9NA 4CAYA 1EQZD 5BT1D 5JRGD 2YFVB 5DNMD 2IO5C 3AZKC 3AV2B 4LD9D 5BNVB 3AZHB 1AOIA 3MNNA 5AV8B 3AZMB 1JFIA 3LJAD 1P3OB 3MGRD 4ZUXB 3X1TA 1P3GC 2NQBB 3R45A 5JA4A 2F8NH 3UT9D 3AZNA 4KUDB 1P3AA 2PYOA 5AV9C 1R4VA 1ULYA 4CSRB 4R8PA 3C1BB 4ZBJB 5B40D 3AZJC 4YS3B 4Z66B 5AY8C 2AROB 2F8NA 3LZ1B 1P3BB 3C1BD 3NQJA 1S32A 5GT0A 1P3LB 3AZIA 5GSUC 3UTAC 1P3PB 2NZDB 3B6FD 1WWSA 1HQ3C 3AFAC 3WTPC 3AV1D 3AN2C 5B0YD 4J8VD 1M1AD 5B24C 3VH5W 3X1UB 3REIC 4G91C 3AV2A 1KX5A 4WNNB 4WU8D 5B2ID 5AV8A 1KX4B 1TAFB 3X1UD 1U35D 4DRBA 3W96B 4KGCC 2NQBA 2FJ7C 5CPJB 2HIOA 4NE6A 3MGSB 4KUDA 3O62B 5B2JC 3AZLD 4WU9D 3X1SA 1P3ID 3X1VB 5CPID 1B6WA 3REKD 3RELD 4YS3A 3AYWA 4Z66A 5F99C 3LZ0D 1EQZC 5BT1C 2AROA 2BYKB 4M6BA 5JRGC 5DNMC 3REJD 1P3BA 4EO5C 4LD9C 5CP6D 4QLCB 1KX3C 2NZDA 3LJAC 3LELB 1M18B 4XUJB 3MGRC 1P3MA 4E45A 2CV5B 3MGPD 4H9PB 5GXQD 4AWLC 3UT9C 3REHB 4X23B 3W99B 3WKJC 5E5AB 4WV4B 1P34A 4J8UA 3WAAC 5DNND 5AVCD 3W98D 4WNNA 3AZGD 5B33B 5B0ZA 4H9NB 4CAYB 4X23D 3WA9D 5B1LB 1TAFA 4YM6C 4H9RA 4H9QA 5AVBD 5C3IB 5AV5C 4UUZA 1JFIB 4XZQD 3B6FC 1TZYD 3WTPE 3X1VA 5JA4B 3B0CW 1AOID 3AV1C 3MNND 3AZNB 5B0YC 1M1AC 2PYOB 3UTBA 3AZEC 1WWIA 3X1TD 5GSUB 4Z2MH 4WU8C 2HUEC 5B2IC 3AZND 1HQ3B 1P3AD 3A6ND 5B32D 3LELA 1M18A 1ID3B 3MVDA 2F8NB 1U35C 4J8WA 3B6GC 4R8PD 3NQJB 5CPKA 3KXBD 4H9PA 4Z5TD 5B31C 3AZIB 3REHA 4G91B 5E5AA 3AZLC 1ZLAC 2CWEA 5CPIC 1F66C 1S32D 3REKC 5GT0D 3RELC 3AZID 5GT3D 3VH6T 5B1LA 2FJ7B 2BYMA 3NQUA 3REJC 5AV6B 1N1JB 4NFTA 5B2JB 5AV9A
chains in the Genus database with same CATH superfamily
3KUYB 3AZJA 4J8XC 1P3FB 2ZY3A 3AV2D 3H0LC 3MGPC 3AZHD 2HIOB 5GXQC 4H9SA 5G49A 5AV8D 3AZMD 1P3OD 3X1SB 4ZUXD 5B1MB 2NQBD 1KX3B 5DNNC 5GSUA 5AVCC 3UTAA 3TU4B 2F8NK 3AYWB 3AZFC 4KUDD 1HQ3A 3AFAA 3WA9C 3WTPA 1ID3A 4YS3D 5B24A 4Z66D 5AVBC 3REIA 1H3OB 3WAAB 4XZQC 2AROD 1P3MB 1TZYC 3LZ1D 1P3BD 3MNNC 1P3LD 4Z2MG 4YM6B 1P3PD 2NZDD 4KGCA 4JJNC 2FJ7A 2Y2LA 4J8UB 1P34B 5FUGB 5AV6A 1N1JA 5AV5B 5B2JA 5B0ZB 1P3AC 3A6NC 5B32C 3KUYA 3KWQB 4H9RB 3C1CB 1P3FA 1M19B 5F99A 4R8PC 4H9QB 4DRAA 4H9OA 5B0ZD 3KXBC 3W97C 4Z5TC 5JRGA 4UUZB 1KX4D 3B0DC 1P3KC 4HGAC 5B1MA 3W96D 4LD9A 1KX3A 5CPJD 1BH8A 3TU4A 3MGRA 3MGSD 3MGQC 3O62D 5GT3C 3UTBB 2Y2PA 3B6GB 1W2EA 3X1VD 5B31B 3UT9A 3WKJA 1ZLAB 3WAAA 1H3OA 2F8NG 1F66B 3MVDB 3AL0C 4J8WB 5CPKB 3AZHC 1KU5A 4YM6A 3AZKB 3VH6W 4QLCD 2IO5B 3AZMC 3LELD 1P3OC 1M18D 4XUJD 4ZUXC 5FUGA 2NQBC 5AV5A 4WZSB 2CV5D 5B40C 3B6FA 4KUDC 3REHD 3W99D 4J8XB 1P3GB 2Y2MA 5E5AD 3KWQA 2BYMB 2Y2QA 3NQUB 3C1CA 3AV1A 1M19A 2Y2JA 5B0YA 1Q9CA 3C1BC 3V9RA 4ZBJC 5B33D 5AV9B 4YS3C 1M1AA 3AZEA 5B1LD 1A7WA 2AROC 3AZJB 3LZ1C 3AZFB 5AY8B 4G92C 4KHAA 1P3LC 5G49B 3VH5A 4J8VC 1U35A 1P3PC 2NZDC 3B6GA 5B31A 3UTAB 1ZLAA 2PYOD 3AFAB 1F66A 3WTPB 3X1UC 3REKA 3AN2B 3RELA 5GSUD 3H0RC 5B24B 5CHLB 2DF4C 1HQ3D 3AZKA 3AFAD 3REIB 1KX4C 3REJA 1BH9B 4WU9C 1ID3D 2F8ND 1P3IC 2JE5A 3W96C 5CPJC 4NE3A 1F1EA 3B0BA 3MGSC 3O62C 3REID 4J8XA 3LZ0C 1P3GA 4KGCB 3W97B 5GXQA 5CP6C 1P3KB 2VQRA 2FJ7D 5DNNA 5AVCA 5AV6D 5AY8A 5F99B 3AZFA 1KX5D 5B2JD 4H9OB 1EQZB 3WA9A 4E44A 5JRGB 4QLCC 5DNMB 3KUYD 1M18C 4XUJC 4EO5B 1P3FD 4LD9B 5F99D 5AVBA 1BH8B 2CV5C 3AZGC 3W98C 3LJAB 4XZQA 2HIOD 3MGRB 1KX5B 2G5HC 1TZYA 3REHC 3W99C 4X23C 5E5AC 3X1SD 5B31G 2ZM5A 5B1MD 3AN2A 2F2AC 4AWLB 3UT9B 1KX3D 3TU4D 5B33C 3AYWD 4JJNA 3WKJB 5BS7C 5B1LC 1BH9A 5BNXB 5B40B 3A6NA 1AOIC 3WKJD 5B32A 5C3IC 3WAAD 3P5JB 5BO0B 1P3MD 3W97A 3B0CT 3KXBA 3X1TC 4Z5TA 3B6FB 2RIQA 4YM6D 4H9SC 3AZNC 1P3KA 2PYOC 4G92B 4J8UD 1P34D 3AV1B 3EPJA 5KDMB 3MGQA 5AV5D 5B0YB 5GT3A 3V9RB 4J8VB 1M1AB 1EQZA 3AZEB 5DNMA 1ID3C 3KWQD 4WU8B 1M19D 3C1CD 2HUEB 5B2IB 1S32C 3LJAA 5GT0C 4KHAB 3AZED 2Y2GA 3AZIC 1U35B 2YFVA 5BNVA 3AZHA 3AZMA 3AZLB 1P3OA 4WU9B 4ZUXA 1P3IB 3A1KA 3UTBD 5CPIB 3B6GD 2YFWB 5BNXA 3REKB 5B40A 3RELB 5B31D 2ZY5A 3A1IA 5AV6C 3AV2C 1KX5C 3LZ0B 1ZLAD 5AV8C 2Y2KA 5BO0A 3REJB 3KUYC 1F66D 4CSRA 3MVDD 3C1BA 2RVQD 4J8WD 1P3FC 5CP6B 5B32G 5CPKD 2HIOC 3KSYA 3AZKD 2UWXA 3LZ1A 3X1SC 3MGPB 5B1MC 5GXQB 1P3LA 5KDMA 4J8VA 1P3PA 3TU4C 3AYWC 4Z66C 4J8XD 1P3GD 2L5AA 5AVCB 5DNNB 3W98B 3AZGB 4WU8A 1P3BC 5B2IA 5AV9D 3WA9B 3X1UA 1P3MC 3AZJD 3AZFD 5AY8D 5AVBB 1KX4A 4XZQB 4NE5A 3AZLA 3VH5T 1TZYB 4WU9A 1P3IA 3W96A 5CPIA 2YFWA 5CPJA 1P34C 4J8UC 1AOIB 3MNNB 3MGSA 3O62A 3UTAD 5B0ZC 3LZ0A 4JJNB 1B67A 3X1TB 3WTPD 3R45B 3KWQC 3AN2D 3C1CC 1M19C 5CP6A 1P3AB 3A6NB 5B24D 2DQNC 5B32B 4JJND 2LY8A 2BYKA 3F6TA 4R8PB 3KXBB 3MGPA 3X1VC 1Z2CB 4Z5TB 4WJ3C 4QLCA 3B0DB 4XUJA 4HGAB 4KGCD 3UTBC 1T3UA 2CV5A 3AZGA 1S32B 3W97D 5GT0B 3W98A 2JCHA 3MGQB 5GT3B 4X23A 3VH6A 3EPLA 3W99A 1P3KD 1HTAA 2Y2OA 2J8PA 3LELC 2ZY2A 3MVDC 1BFMA 2RVQC 5B33A 4J8WC 3MGQD 5BS7A 2JSSA 5CPKC 4H9NA 4CAYA 1EQZD 5BT1D 2Y2HA 5JRGD 2YFVB 5DNMD 2IO5C 3AZKC 3AV2B 4LD9D 5BNVB 3AZHB 1AOIA 3MNNA 5AV8B 2XD5A 3AZMB 1JFIA 3LJAD 1P3OB 3MGRD 4ZUXB 3X1TA 1P3GC 2NQBB 3R45A 5JA4A 2F8NH 3UT9D 3AZNA 4KUDB 1P3AA 2PYOA 5AV9C 1R4VA 1ULYA 4CSRB 4R8PA 3C1BB 4ZBJB 5B40D 3AZJC 4YS3B 4Z66B 5AY8C 2AROB 2F8NA 3LZ1B 1P3BB 3C1BD 3NQJA 1S32A 3KFUG 5GT0A 1P3LB 3AZIA 3FDDA 5GSUC 3UTAC 1P3PB 2NZDB 3B6FD 1WWSA 1HQ3C 3AFAC 3WTPC 3H0MC 3AV1D 3AN2C 5B0YD 4J8VD 1M1AD 5B24C 3VH5W 3X1UB 3REIC 4G91C 3AV2A 1KX5A 2Y2NA 2XD1A 4WNNB 4WU8D 5B2ID 5AV8A 1KX4B 1TAFB 3X1UD 1U35D 4DRBA 3W96B 4KGCC 2NQBA 2FJ7C 5CPJB 2HIOA 4NE6A 3MGSB 4KUDA 3O62B 5B2JC 3AZLD 1PZRA 4WU9D 3X1SA 3EPHA 2W8SA 1P3ID 3X1VB 5CPID 1B6WA 3REKD 3RELD 4YS3A 3AYWA 4Z66A 5F99C 3LZ0D 1EQZC 5BT1C 2AROA 2BYKB 4M6BA 5JRGC 3IP4C 5DNMC 3REJD 1P3BA 4EO5C 4LD9C 5CP6D 4QLCB 2FFFB 1KX3C 2NZDA 3LJAC 3LELB 1M18B 4XUJB 3MGRC 1P3MA 4E45A 3EG5B 2CV5B 3MGPD 4H9PB 5GXQD 4AWLC 3UT9C 3REHB 4X23B 3W99B 3WKJC 5E5AB 4WV4B 1P34A 4J8UA 3WAAC 5DNND 5AVCD 3W98D 4WNNA 3AZGD 5B33B 5B0ZA 4H9NB 4CAYB 4X23D 3WA9D 5B1LB 1TAFA 4YM6C 4H9RA 4H9QA 5AVBD 5C3IB 5AV5C 4UUZA 1JFIB 4XZQD 3B6FC 1TZYD 3WTPE 3X1VA 5JA4B 2G5IC 3B0CW 1AOID 3AV1C 3MNND 3AZNB 5B0YC 1M1AC 2PYOB 3UTBA 3AZEC 1WWIA 3X1TD 5GSUB 4Z2MH 4WU8C 2HUEC 5B2IC 3AZND 1HQ3B 1P3AD 3A6ND 5B32D 3LELA 1M18A 1ID3B 3MVDA 2F8NB 1U35C 4J8WA 3B6GC 2Y2IA 4R8PD 3NQJB 5CPKA 3KXBD 2BG1A 4H9PA 4Z5TD 4UPKA 5B31C 3AZIB 4DQYB 3REHA 4G91B 2ZY4A 5E5AA 3AZLC 1ZLAC 2CWEA 5CPIC 1F66C 1S32D 3REKC 5GT0D 3RELC 3AZID 5GT3D 3VH6T 5B1LA 2FJ7B 3EPKA 2BYMA 3NQUA 3REJC 5AV6B 1N1JB 4NFTA 5B2JB 5AV9A
chains in the Genus database with same CATH topology
3KUYB 3AZJA 4J8XC 1P3FB 2ZY3A 3AV2D 3H0LC 3MGPC 3AZHD 2HIOB 5GXQC 4H9SA 5G49A 5AV8D 3AZMD 1P3OD 3X1SB 4ZUXD 5B1MB 2NQBD 1KX3B 5DNNC 5GSUA 5AVCC 3UTAA 3TU4B 2F8NK 3AYWB 3AZFC 4KUDD 1HQ3A 3AFAA 3WA9C 3WTPA 1ID3A 4YS3D 5B24A 4Z66D 5AVBC 3REIA 1H3OB 3WAAB 4XZQC 2AROD 1P3MB 1TZYC 3LZ1D 1P3BD 3MNNC 1P3LD 4Z2MG 4YM6B 1P3PD 2NZDD 4KGCA 4JJNC 2FJ7A 2Y2LA 4J8UB 1P34B 5FUGB 5AV6A 1N1JA 5AV5B 5B2JA 5B0ZB 1P3AC 3A6NC 5B32C 3KUYA 3KWQB 4H9RB 3C1CB 1P3FA 1M19B 5F99A 4R8PC 4H9QB 4DRAA 4H9OA 5B0ZD 3KXBC 3W97C 4Z5TC 5JRGA 4UUZB 1KX4D 3B0DC 1P3KC 4HGAC 5B1MA 3W96D 4LD9A 1KX3A 5CPJD 1BH8A 3TU4A 3MGRA 3MGSD 3MGQC 3O62D 5GT3C 3UTBB 2Y2PA 3B6GB 1W2EA 3X1VD 5B31B 3UT9A 3WKJA 1ZLAB 3WAAA 1H3OA 2F8NG 1F66B 3MVDB 3AL0C 4J8WB 5CPKB 3AZHC 1KU5A 4YM6A 3AZKB 3VH6W 4QLCD 2IO5B 3AZMC 3LELD 1P3OC 1M18D 4XUJD 4ZUXC 5FUGA 2NQBC 5AV5A 4WZSB 2CV5D 5B40C 3B6FA 4KUDC 3REHD 3W99D 4J8XB 1P3GB 2Y2MA 5E5AD 3KWQA 2BYMB 2Y2QA 3NQUB 3C1CA 3AV1A 1M19A 2Y2JA 5B0YA 1Q9CA 3C1BC 3V9RA 4ZBJC 5B33D 5AV9B 4YS3C 1M1AA 3AZEA 5B1LD 1A7WA 2AROC 3AZJB 3LZ1C 3AZFB 5AY8B 4G92C 4KHAA 1P3LC 5G49B 3VH5A 4J8VC 1U35A 1P3PC 2NZDC 3B6GA 5B31A 3UTAB 1ZLAA 2PYOD 3AFAB 1F66A 3WTPB 3X1UC 3REKA 3AN2B 3RELA 5GSUD 3H0RC 5B24B 5CHLB 2DF4C 1HQ3D 3AZKA 3AFAD 3REIB 1KX4C 3REJA 1BH9B 4WU9C 1ID3D 2F8ND 1P3IC 2JE5A 3W96C 5CPJC 4NE3A 1F1EA 3B0BA 3MGSC 3O62C 3REID 4J8XA 3LZ0C 1P3GA 4KGCB 3W97B 5GXQA 5CP6C 1P3KB 2VQRA 2FJ7D 5DNNA 5AVCA 5AV6D 5AY8A 5F99B 3AZFA 1KX5D 5B2JD 4H9OB 1EQZB 3WA9A 4E44A 5JRGB 4QLCC 5DNMB 3KUYD 1M18C 4XUJC 4EO5B 1P3FD 4LD9B 5F99D 5AVBA 1BH8B 2CV5C 3AZGC 3W98C 3LJAB 4XZQA 2HIOD 3MGRB 1KX5B 2G5HC 1TZYA 3REHC 3W99C 4X23C 5E5AC 3X1SD 5B31G 2ZM5A 5B1MD 3AN2A 2F2AC 4AWLB 3UT9B 1KX3D 3TU4D 5B33C 3AYWD 4JJNA 3WKJB 5BS7C 5B1LC 1BH9A 5BNXB 5B40B 3A6NA 1AOIC 3WKJD 5B32A 5C3IC 3WAAD 3P5JB 5BO0B 1P3MD 3W97A 3B0CT 3KXBA 3X1TC 4Z5TA 3B6FB 2RIQA 4YM6D 4H9SC 3AZNC 1P3KA 2PYOC 4G92B 4J8UD 1P34D 3AV1B 3EPJA 5KDMB 3MGQA 5AV5D 5B0YB 5GT3A 3V9RB 4J8VB 1M1AB 1EQZA 3AZEB 5DNMA 1ID3C 3KWQD 4WU8B 1M19D 3C1CD 2HUEB 5B2IB 1S32C 3LJAA 5GT0C 4KHAB 3AZED 2Y2GA 3AZIC 1U35B 2YFVA 5BNVA 3AZHA 3AZMA 3AZLB 1P3OA 4WU9B 4ZUXA 1P3IB 3A1KA 3UTBD 5CPIB 3B6GD 2YFWB 5BNXA 3REKB 5B40A 3RELB 5B31D 2ZY5A 3A1IA 5AV6C 3AV2C 1KX5C 3LZ0B 1ZLAD 5AV8C 2Y2KA 5BO0A 3REJB 3KUYC 1F66D 4CSRA 3MVDD 3C1BA 2RVQD 4J8WD 1P3FC 5CP6B 5B32G 5CPKD 2HIOC 3KSYA 3AZKD 2UWXA 3LZ1A 3X1SC 3MGPB 5B1MC 5GXQB 1P3LA 5KDMA 4J8VA 1P3PA 3TU4C 3AYWC 4Z66C 4J8XD 1P3GD 2L5AA 5AVCB 5DNNB 3W98B 3AZGB 4WU8A 1P3BC 5B2IA 5AV9D 3WA9B 3X1UA 1P3MC 3AZJD 3AZFD 5AY8D 5AVBB 1KX4A 4XZQB 4NE5A 3AZLA 3VH5T 1TZYB 4WU9A 1P3IA 3W96A 5CPIA 2YFWA 5CPJA 1P34C 4J8UC 1AOIB 3MNNB 3MGSA 3O62A 3UTAD 5B0ZC 3LZ0A 4JJNB 1B67A 3X1TB 3WTPD 3R45B 3KWQC 3AN2D 3C1CC 1M19C 5CP6A 1P3AB 3A6NB 5B24D 2DQNC 5B32B 4JJND 2LY8A 2BYKA 3F6TA 4R8PB 3KXBB 3MGPA 3X1VC 1Z2CB 4Z5TB 4WJ3C 4QLCA 3B0DB 4XUJA 4HGAB 4KGCD 3UTBC 1T3UA 2CV5A 3AZGA 1S32B 3W97D 5GT0B 3W98A 2JCHA 3MGQB 5GT3B 4X23A 3VH6A 3EPLA 3W99A 1P3KD 1HTAA 2Y2OA 2J8PA 3LELC 2ZY2A 3MVDC 1BFMA 2RVQC 5B33A 4J8WC 3MGQD 5BS7A 2JSSA 5CPKC 4H9NA 4CAYA 1EQZD 5BT1D 2Y2HA 5JRGD 2YFVB 5DNMD 2IO5C 3AZKC 3AV2B 4LD9D 5BNVB 3AZHB 1AOIA 3MNNA 5AV8B 2XD5A 3AZMB 1JFIA 3LJAD 1P3OB 3MGRD 4ZUXB 3X1TA 1P3GC 2NQBB 3R45A 5JA4A 2F8NH 3UT9D 3AZNA 4KUDB 1P3AA 2PYOA 5AV9C 1R4VA 1ULYA 4CSRB 4R8PA 3C1BB 4ZBJB 5B40D 3AZJC 4YS3B 4Z66B 5AY8C 2AROB 2F8NA 3LZ1B 1P3BB 3C1BD 3NQJA 1S32A 3KFUG 5GT0A 1P3LB 3AZIA 3FDDA 5GSUC 3UTAC 1P3PB 2NZDB 3B6FD 1WWSA 1HQ3C 3AFAC 3WTPC 3H0MC 3AV1D 3AN2C 5B0YD 4J8VD 1M1AD 5B24C 3VH5W 3X1UB 3REIC 4G91C 3AV2A 1KX5A 2Y2NA 2XD1A 4WNNB 4WU8D 5B2ID 5AV8A 1KX4B 1TAFB 3X1UD 1U35D 4DRBA 3W96B 4KGCC 2NQBA 2FJ7C 5CPJB 2HIOA 4NE6A 3MGSB 4KUDA 3O62B 5B2JC 3AZLD 1PZRA 4WU9D 3X1SA 3EPHA 2W8SA 1P3ID 3X1VB 5CPID 1B6WA 3REKD 3RELD 4YS3A 3AYWA 4Z66A 5F99C 3LZ0D 1EQZC 5BT1C 2AROA 2BYKB 4M6BA 5JRGC 3IP4C 5DNMC 3REJD 1P3BA 4EO5C 4LD9C 5CP6D 4QLCB 2FFFB 1KX3C 2NZDA 3LJAC 3LELB 1M18B 4XUJB 3MGRC 1P3MA 4E45A 3EG5B 2CV5B 3MGPD 4H9PB 5GXQD 4AWLC 3UT9C 3REHB 4X23B 3W99B 3WKJC 5E5AB 4WV4B 1P34A 4J8UA 3WAAC 5DNND 5AVCD 3W98D 4WNNA 3AZGD 5B33B 5B0ZA 4H9NB 4CAYB 4X23D 3WA9D 5B1LB 1TAFA 4YM6C 4H9RA 4H9QA 5AVBD 5C3IB 5AV5C 4UUZA 1JFIB 4XZQD 3B6FC 1TZYD 3WTPE 3X1VA 5JA4B 2G5IC 3B0CW 1AOID 3AV1C 3MNND 3AZNB 5B0YC 1M1AC 2PYOB 3UTBA 3AZEC 1WWIA 3X1TD 5GSUB 4Z2MH 4WU8C 2HUEC 5B2IC 3AZND 1HQ3B 1P3AD 3A6ND 5B32D 3LELA 1M18A 1ID3B 3MVDA 2F8NB 1U35C 4J8WA 3B6GC 2Y2IA 4R8PD 3NQJB 5CPKA 3KXBD 2BG1A 4H9PA 4Z5TD 4UPKA 5B31C 3AZIB 4DQYB 3REHA 4G91B 2ZY4A 5E5AA 3AZLC 1ZLAC 2CWEA 5CPIC 1F66C 1S32D 3REKC 5GT0D 3RELC 3AZID 5GT3D 3VH6T 5B1LA 2FJ7B 3EPKA 2BYMA 3NQUA 3REJC 5AV6B 1N1JB 4NFTA 5B2JB 5AV9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KUY B;  3AZJ A;  4J8X C;  1P3F B;  3AV2 D;  3AZH D;  3MGP C;  2HIO B;  5GXQ C;  4H9S A;  5G49 A;  5AV8 D;  3AZM D;  1P3O D;  3X1S B;  4ZUX D;  5B1M B;  2NQB D;  1KX3 B;  5DNN C;  5GSU A;  5AVC C;  3UTA A;  3TU4 B;  2F8N K;  3AYW B;  3AZF C;  4KUD D;  1HQ3 A;  3AFA A;  3WA9 C;  3WTP A;  1ID3 A;  4YS3 D;  5B24 A;  4Z66 D;  5AVB C;  3REI A;  1H3O B;  3WAA B;  4XZQ C;  2ARO D;  1P3M B;  1TZY C;  3LZ1 D;  1P3B D;  3MNN C;  1P3L D;  4Z2M G;  4YM6 B;  1P3P D;  2NZD D;  4KGC A;  4JJN C;  2FJ7 A;  1P34 B;  4J8U B;  5FUG B;  5AV6 A;  1N1J A;  5AV5 B;  5B2J A;  5B0Z B;  1P3A C;  3A6N C;  5B32 C;  3KUY A;  3KWQ B;  4H9R B;  3C1C B;  1P3F A;  1M19 B;  5F99 A;  4R8P C;  4H9Q B;  4DRA A;  4H9O A;  5B0Z D;  3KXB C;  3W97 C;  4Z5T C;  5JRG A;  4UUZ B;  1KX4 D;  3B0D C;  1P3K C;  4HGA C;  5B1M A;  3W96 D;  4LD9 A;  1KX3 A;  5CPJ D;  1BH8 A;  3TU4 A;  3MGR A;  3MGS D;  3MGQ C;  3O62 D;  5GT3 C;  3UTB B;  3B6G B;  3X1V D;  5B31 B;  3UT9 A;  3WKJ A;  1ZLA B;  3WAA A;  1H3O A;  2F8N G;  1F66 B;  3MVD B;  4J8W B;  5CPK B;  3AZH C;  1KU5 A;  4YM6 A;  3AZK B;  3VH6 W;  4QLC D;  2IO5 B;  3AZM C;  3LEL D;  1P3O C;  1M18 D;  4XUJ D;  4ZUX C;  5FUG A;  2NQB C;  5AV5 A;  4WZS B;  2CV5 D;  5B40 C;  3B6F A;  4KUD C;  3REH D;  3W99 D;  4J8X B;  1P3G B;  5E5A D;  3KWQ A;  2BYM B;  3C1C A;  3NQU B;  3AV1 A;  1M19 A;  5B0Y A;  1Q9C A;  3C1B C;  3V9R A;  4ZBJ C;  5B33 D;  5AV9 B;  4YS3 C;  1M1A A;  3AZE A;  5B1L D;  1A7W A;  2ARO C;  3AZJ B;  3LZ1 C;  3AZF B;  5AY8 B;  4G92 C;  4KHA A;  1P3L C;  5G49 B;  3VH5 A;  4J8V C;  1U35 A;  1P3P C;  2NZD C;  3B6G A;  5B31 A;  3UTA B;  1ZLA A;  2PYO D;  3AFA B;  1F66 A;  3WTP B;  3X1U C;  3REK A;  3AN2 B;  3REL A;  5GSU D;  5B24 B;  5CHL B;  1HQ3 D;  3AZK A;  3AFA D;  3REI B;  1KX4 C;  3REJ A;  1BH9 B;  4WU9 C;  1ID3 D;  2F8N D;  1P3I C;  3W96 C;  5CPJ C;  4NE3 A;  1F1E A;  3B0B A;  3MGS C;  3O62 C;  3REI D;  4J8X A;  3LZ0 C;  1P3G A;  4KGC B;  3W97 B;  5GXQ A;  5CP6 C;  1P3K B;  2FJ7 D;  5DNN A;  5AVC A;  5AV6 D;  5AY8 A;  5F99 B;  3AZF A;  1KX5 D;  5B2J D;  4H9O B;  1EQZ B;  3WA9 A;  4E44 A;  5JRG B;  4QLC C;  5DNM B;  3KUY D;  1M18 C;  4XUJ C;  4EO5 B;  1P3F D;  4LD9 B;  5F99 D;  5AVB A;  1BH8 B;  2CV5 C;  3AZG C;  3W98 C;  3LJA B;  4XZQ A;  2HIO D;  3MGR B;  1KX5 B;  1TZY A;  3REH C;  3W99 C;  4X23 C;  5E5A C;  3X1S D;  5B31 G;  5B1M D;  3AN2 A;  4AWL B;  3UT9 B;  1KX3 D;  3TU4 D;  5B33 C;  3AYW D;  4JJN A;  3WKJ B;  5BS7 C;  5B1L C;  1BH9 A;  5BNX B;  5B40 B;  3A6N A;  1AOI C;  3WKJ D;  5B32 A;  5C3I C;  3WAA D;  5BO0 B;  1P3M D;  3W97 A;  3B0C T;  3KXB A;  3X1T C;  4Z5T A;  3B6F B;  4YM6 D;  4H9S C;  3AZN C;  1P3K A;  2PYO C;  4G92 B;  4J8U D;  1P34 D;  3AV1 B;  5KDM B;  3MGQ A;  5AV5 D;  5B0Y B;  5GT3 A;  3V9R B;  4J8V B;  1M1A B;  1EQZ A;  3AZE B;  5DNM A;  1ID3 C;  3KWQ D;  4WU8 B;  1M19 D;  3C1C D;  2HUE B;  5B2I B;  1S32 C;  3LJA A;  5GT0 C;  4KHA B;  3AZE D;  3AZI C;  1U35 B;  2YFV A;  5BNV A;  3AZH A;  3AZM A;  3AZL B;  1P3O A;  4WU9 B;  4ZUX A;  1P3I B;  3UTB D;  5CPI B;  3B6G D;  2YFW B;  5BNX A;  3REK B;  5B40 A;  3REL B;  5B31 D;  5AV6 C;  3AV2 C;  1KX5 C;  3LZ0 B;  1ZLA D;  5AV8 C;  5BO0 A;  3REJ B;  3KUY C;  1F66 D;  4CSR A;  3MVD D;  3C1B A;  2RVQ D;  4J8W D;  1P3F C;  5CP6 B;  5B32 G;  5CPK D;  2HIO C;  3KSY A;  3AZK D;  3LZ1 A;  3X1S C;  3MGP B;  5B1M C;  5GXQ B;  1P3L A;  5KDM A;  4J8V A;  1P3P A;  3TU4 C;  3AYW C;  4Z66 C;  4J8X D;  1P3G D;  2L5A A;  5AVC B;  5DNN B;  3W98 B;  3AZG B;  4WU8 A;  1P3B C;  5B2I A;  5AV9 D;  3WA9 B;  3X1U A;  1P3M C;  3AZJ D;  3AZF D;  5AY8 D;  5AVB B;  1KX4 A;  4XZQ B;  4NE5 A;  3AZL A;  3VH5 T;  1TZY B;  4WU9 A;  1P3I A;  3W96 A;  5CPI A;  2YFW A;  5CPJ A;  1P34 C;  4J8U C;  1AOI B;  3MNN B;  3MGS A;  3O62 A;  3UTA D;  5B0Z C;  3LZ0 A;  4JJN B;  1B67 A;  3X1T B;  3WTP D;  3R45 B;  3KWQ C;  3AN2 D;  3C1C C;  1M19 C;  5CP6 A;  1P3A B;  3A6N B;  5B24 D;  4JJN D;  5B32 B;  2LY8 A;  2BYK A;  4R8P B;  3KXB B;  3MGP A;  3X1V C;  4Z5T B;  4QLC A;  3B0D B;  4XUJ A;  4HGA B;  4KGC D;  3UTB C;  2CV5 A;  3AZG A;  1S32 B;  3W97 D;  5GT0 B;  3W98 A;  3MGQ B;  5GT3 B;  4X23 A;  3VH6 A;  3W99 A;  1P3K D;  1HTA A;  3LEL C;  3MVD C;  1BFM A;  2RVQ C;  5B33 A;  4J8W C;  3MGQ D;  5BS7 A;  2JSS A;  5CPK C;  4H9N A;  4CAY A;  1EQZ D;  5BT1 D;  5JRG D;  2YFV B;  5DNM D;  2IO5 C;  3AZK C;  3AV2 B;  4LD9 D;  5BNV B;  3AZH B;  1AOI A;  3MNN A;  5AV8 B;  3AZM B;  1JFI A;  3LJA D;  1P3O B;  3MGR D;  4ZUX B;  3X1T A;  1P3G C;  2NQB B;  3R45 A;  5JA4 A;  2F8N H;  3UT9 D;  3AZN A;  4KUD B;  1P3A A;  2PYO A;  5AV9 C;  1R4V A;  1ULY A;  4CSR B;  4R8P A;  3C1B B;  4ZBJ B;  5B40 D;  3AZJ C;  4YS3 B;  4Z66 B;  5AY8 C;  2ARO B;  2F8N A;  3LZ1 B;  1P3B B;  3C1B D;  3NQJ A;  1S32 A;  5GT0 A;  1P3L B;  3AZI A;  5GSU C;  3UTA C;  1P3P B;  2NZD B;  3B6F D;  1WWS A;  1HQ3 C;  3AFA C;  3WTP C;  3AV1 D;  3AN2 C;  5B0Y D;  4J8V D;  1M1A D;  5B24 C;  3VH5 W;  3X1U B;  3REI C;  4G91 C;  3AV2 A;  1KX5 A;  4WNN B;  4WU8 D;  5B2I D;  5AV8 A;  1KX4 B;  1TAF B;  3X1U D;  1U35 D;  4DRB A;  3W96 B;  4KGC C;  2NQB A;  2FJ7 C;  5CPJ B;  2HIO A;  4NE6 A;  3MGS B;  4KUD A;  3O62 B;  5B2J C;  3AZL D;  4WU9 D;  3X1S A;  1P3I D;  3X1V B;  5CPI D;  1B6W A;  3REK D;  3REL D;  4YS3 A;  3AYW A;  4Z66 A;  5F99 C;  3LZ0 D;  1EQZ C;  5BT1 C;  2ARO A;  2BYK B;  4M6B A;  5JRG C;  5DNM C;  3REJ D;  1P3B A;  4EO5 C;  4LD9 C;  5CP6 D;  4QLC B;  1KX3 C;  2NZD A;  3LJA C;  3LEL B;  1M18 B;  4XUJ B;  3MGR C;  1P3M A;  4E45 A;  2CV5 B;  3MGP D;  4H9P B;  5GXQ D;  4AWL C;  3UT9 C;  3REH B;  4X23 B;  3W99 B;  3WKJ C;  5E5A B;  4WV4 B;  1P34 A;  4J8U A;  3WAA C;  5DNN D;  5AVC D;  3W98 D;  4WNN A;  3AZG D;  5B33 B;  5B0Z A;  4H9N B;  4CAY B;  4X23 D;  3WA9 D;  5B1L B;  1TAF A;  4YM6 C;  4H9R A;  4H9Q A;  5AVB D;  5C3I B;  5AV5 C;  4UUZ A;  1JFI B;  4XZQ D;  3B6F C;  1TZY D;  3WTP E;  3X1V A;  5JA4 B;  3B0C W;  1AOI D;  3AV1 C;  3MNN D;  3AZN B;  5B0Y C;  1M1A C;  2PYO B;  3UTB A;  3AZE C;  1WWI A;  3X1T D;  5GSU B;  4Z2M H;  4WU8 C;  2HUE C;  5B2I C;  3AZN D;  1HQ3 B;  1P3A D;  3A6N D;  5B32 D;  3LEL A;  1M18 A;  1ID3 B;  3MVD A;  2F8N B;  1U35 C;  4J8W A;  3B6G C;  4R8P D;  3NQJ B;  5CPK A;  3KXB D;  4H9P A;  4Z5T D;  5B31 C;  3AZI B;  3REH A;  4G91 B;  5E5A A;  3AZL C;  1ZLA C;  2CWE A;  5CPI C;  1F66 C;  1S32 D;  3REK C;  5GT0 D;  3REL C;  3AZI D;  5GT3 D;  3VH6 T;  5B1L A;  2FJ7 B;  2BYM A;  3NQU A;  3REJ C;  5AV6 B;  1N1J B;  4NFT A;  5B2J B;  5AV9 A; 
#chains in the Genus database with same CATH topology
 3KUY B;  3AZJ A;  4J8X C;  1P3F B;  2ZY3 A;  3AV2 D;  3H0L C;  3MGP C;  3AZH D;  2HIO B;  5GXQ C;  4H9S A;  5G49 A;  5AV8 D;  3AZM D;  1P3O D;  3X1S B;  4ZUX D;  5B1M B;  2NQB D;  1KX3 B;  5DNN C;  5GSU A;  5AVC C;  3UTA A;  3TU4 B;  2F8N K;  3AYW B;  3AZF C;  4KUD D;  1HQ3 A;  3AFA A;  3WA9 C;  3WTP A;  1ID3 A;  4YS3 D;  5B24 A;  4Z66 D;  5AVB C;  3REI A;  1H3O B;  3WAA B;  4XZQ C;  2ARO D;  1P3M B;  1TZY C;  3LZ1 D;  1P3B D;  3MNN C;  1P3L D;  4Z2M G;  4YM6 B;  1P3P D;  2NZD D;  4KGC A;  4JJN C;  2FJ7 A;  2Y2L A;  4J8U B;  1P34 B;  5FUG B;  5AV6 A;  1N1J A;  5AV5 B;  5B2J A;  5B0Z B;  1P3A C;  3A6N C;  5B32 C;  3KUY A;  3KWQ B;  4H9R B;  3C1C B;  1P3F A;  1M19 B;  5F99 A;  4R8P C;  4H9Q B;  4DRA A;  4H9O A;  5B0Z D;  3KXB C;  3W97 C;  4Z5T C;  5JRG A;  4UUZ B;  1KX4 D;  3B0D C;  1P3K C;  4HGA C;  5B1M A;  3W96 D;  4LD9 A;  1KX3 A;  5CPJ D;  1BH8 A;  3TU4 A;  3MGR A;  3MGS D;  3MGQ C;  3O62 D;  5GT3 C;  3UTB B;  2Y2P A;  3B6G B;  1W2E A;  3X1V D;  5B31 B;  3UT9 A;  3WKJ A;  1ZLA B;  3WAA A;  1H3O A;  2F8N G;  1F66 B;  3MVD B;  3AL0 C;  4J8W B;  5CPK B;  3AZH C;  1KU5 A;  4YM6 A;  3AZK B;  3VH6 W;  4QLC D;  2IO5 B;  3AZM C;  3LEL D;  1P3O C;  1M18 D;  4XUJ D;  4ZUX C;  5FUG A;  2NQB C;  5AV5 A;  4WZS B;  2CV5 D;  5B40 C;  3B6F A;  4KUD C;  3REH D;  3W99 D;  4J8X B;  1P3G B;  2Y2M A;  5E5A D;  3KWQ A;  2BYM B;  2Y2Q A;  3NQU B;  3C1C A;  3AV1 A;  1M19 A;  2Y2J A;  5B0Y A;  1Q9C A;  3C1B C;  3V9R A;  4ZBJ C;  5B33 D;  5AV9 B;  4YS3 C;  1M1A A;  3AZE A;  5B1L D;  1A7W A;  2ARO C;  3AZJ B;  3LZ1 C;  3AZF B;  5AY8 B;  4G92 C;  4KHA A;  1P3L C;  5G49 B;  3VH5 A;  4J8V C;  1U35 A;  1P3P C;  2NZD C;  3B6G A;  5B31 A;  3UTA B;  1ZLA A;  2PYO D;  3AFA B;  1F66 A;  3WTP B;  3X1U C;  3REK A;  3AN2 B;  3REL A;  5GSU D;  3H0R C;  5B24 B;  5CHL B;  2DF4 C;  1HQ3 D;  3AZK A;  3AFA D;  3REI B;  1KX4 C;  3REJ A;  1BH9 B;  4WU9 C;  1ID3 D;  2F8N D;  1P3I C;  2JE5 A;  3W96 C;  5CPJ C;  4NE3 A;  1F1E A;  3B0B A;  3MGS C;  3O62 C;  3REI D;  4J8X A;  3LZ0 C;  1P3G A;  4KGC B;  3W97 B;  5GXQ A;  5CP6 C;  1P3K B;  2VQR A;  2FJ7 D;  5DNN A;  5AVC A;  5AV6 D;  5AY8 A;  5F99 B;  3AZF A;  1KX5 D;  5B2J D;  4H9O B;  1EQZ B;  3WA9 A;  4E44 A;  5JRG B;  4QLC C;  5DNM B;  3KUY D;  1M18 C;  4XUJ C;  4EO5 B;  1P3F D;  4LD9 B;  5F99 D;  5AVB A;  1BH8 B;  2CV5 C;  3AZG C;  3W98 C;  3LJA B;  4XZQ A;  2HIO D;  3MGR B;  1KX5 B;  2G5H C;  1TZY A;  3REH C;  3W99 C;  4X23 C;  5E5A C;  3X1S D;  5B31 G;  2ZM5 A;  5B1M D;  3AN2 A;  2F2A C;  4AWL B;  3UT9 B;  1KX3 D;  3TU4 D;  5B33 C;  3AYW D;  4JJN A;  3WKJ B;  5BS7 C;  5B1L C;  1BH9 A;  5BNX B;  5B40 B;  3A6N A;  1AOI C;  3WKJ D;  5B32 A;  5C3I C;  3WAA D;  3P5J B;  5BO0 B;  1P3M D;  3W97 A;  3B0C T;  3KXB A;  3X1T C;  4Z5T A;  3B6F B;  2RIQ A;  4YM6 D;  4H9S C;  3AZN C;  1P3K A;  2PYO C;  4G92 B;  4J8U D;  1P34 D;  3AV1 B;  3EPJ A;  5KDM B;  3MGQ A;  5AV5 D;  5B0Y B;  5GT3 A;  3V9R B;  4J8V B;  1M1A B;  1EQZ A;  3AZE B;  5DNM A;  1ID3 C;  3KWQ D;  4WU8 B;  1M19 D;  3C1C D;  2HUE B;  5B2I B;  1S32 C;  3LJA A;  5GT0 C;  4KHA B;  3AZE D;  2Y2G A;  3AZI C;  1U35 B;  2YFV A;  5BNV A;  3AZH A;  3AZM A;  3AZL B;  1P3O A;  4WU9 B;  4ZUX A;  1P3I B;  3A1K A;  3UTB D;  5CPI B;  3B6G D;  2YFW B;  5BNX A;  3REK B;  5B40 A;  3REL B;  5B31 D;  2ZY5 A;  3A1I A;  5AV6 C;  3AV2 C;  1KX5 C;  3LZ0 B;  1ZLA D;  5AV8 C;  2Y2K A;  5BO0 A;  3REJ B;  3KUY C;  1F66 D;  4CSR A;  3MVD D;  3C1B A;  2RVQ D;  4J8W D;  1P3F C;  5CP6 B;  5B32 G;  5CPK D;  2HIO C;  3KSY A;  3AZK D;  2UWX A;  3LZ1 A;  3X1S C;  3MGP B;  5B1M C;  5GXQ B;  1P3L A;  5KDM A;  4J8V A;  1P3P A;  3TU4 C;  3AYW C;  4Z66 C;  4J8X D;  1P3G D;  2L5A A;  5AVC B;  5DNN B;  3W98 B;  3AZG B;  4WU8 A;  1P3B C;  5B2I A;  5AV9 D;  3WA9 B;  3X1U A;  1P3M C;  3AZJ D;  3AZF D;  5AY8 D;  5AVB B;  1KX4 A;  4XZQ B;  4NE5 A;  3AZL A;  3VH5 T;  1TZY B;  4WU9 A;  1P3I A;  3W96 A;  5CPI A;  2YFW A;  5CPJ A;  1P34 C;  4J8U C;  1AOI B;  3MNN B;  3MGS A;  3O62 A;  3UTA D;  5B0Z C;  3LZ0 A;  4JJN B;  1B67 A;  3X1T B;  3WTP D;  3R45 B;  3KWQ C;  3AN2 D;  3C1C C;  1M19 C;  5CP6 A;  1P3A B;  3A6N B;  5B24 D;  2DQN C;  5B32 B;  4JJN D;  2LY8 A;  2BYK A;  3F6T A;  4R8P B;  3KXB B;  3MGP A;  3X1V C;  1Z2C B;  4Z5T B;  4WJ3 C;  4QLC A;  3B0D B;  4XUJ A;  4HGA B;  4KGC D;  3UTB C;  1T3U A;  2CV5 A;  3AZG A;  1S32 B;  3W97 D;  5GT0 B;  3W98 A;  2JCH A;  3MGQ B;  5GT3 B;  4X23 A;  3VH6 A;  3EPL A;  3W99 A;  1P3K D;  1HTA A;  2Y2O A;  2J8P A;  3LEL C;  2ZY2 A;  3MVD C;  1BFM A;  2RVQ C;  5B33 A;  4J8W C;  3MGQ D;  5BS7 A;  2JSS A;  5CPK C;  4H9N A;  4CAY A;  1EQZ D;  5BT1 D;  2Y2H A;  5JRG D;  2YFV B;  5DNM D;  2IO5 C;  3AZK C;  3AV2 B;  4LD9 D;  5BNV B;  3AZH B;  1AOI A;  3MNN A;  5AV8 B;  2XD5 A;  3AZM B;  1JFI A;  3LJA D;  1P3O B;  3MGR D;  4ZUX B;  3X1T A;  1P3G C;  2NQB B;  3R45 A;  5JA4 A;  2F8N H;  3UT9 D;  3AZN A;  4KUD B;  1P3A A;  2PYO A;  5AV9 C;  1R4V A;  1ULY A;  4CSR B;  4R8P A;  3C1B B;  4ZBJ B;  5B40 D;  3AZJ C;  4YS3 B;  4Z66 B;  5AY8 C;  2ARO B;  2F8N A;  3LZ1 B;  1P3B B;  3C1B D;  3NQJ A;  1S32 A;  3KFU G;  5GT0 A;  1P3L B;  3AZI A;  3FDD A;  5GSU C;  3UTA C;  1P3P B;  2NZD B;  3B6F D;  1WWS A;  1HQ3 C;  3AFA C;  3WTP C;  3H0M C;  3AV1 D;  3AN2 C;  5B0Y D;  4J8V D;  1M1A D;  5B24 C;  3VH5 W;  3X1U B;  3REI C;  4G91 C;  3AV2 A;  1KX5 A;  2Y2N A;  2XD1 A;  4WNN B;  4WU8 D;  5B2I D;  5AV8 A;  1KX4 B;  1TAF B;  3X1U D;  1U35 D;  4DRB A;  3W96 B;  4KGC C;  2NQB A;  2FJ7 C;  5CPJ B;  2HIO A;  4NE6 A;  3MGS B;  4KUD A;  3O62 B;  5B2J C;  3AZL D;  1PZR A;  4WU9 D;  3X1S A;  3EPH A;  2W8S A;  1P3I D;  3X1V B;  5CPI D;  1B6W A;  3REK D;  3REL D;  4YS3 A;  3AYW A;  4Z66 A;  5F99 C;  3LZ0 D;  1EQZ C;  5BT1 C;  2ARO A;  2BYK B;  4M6B A;  5JRG C;  3IP4 C;  5DNM C;  3REJ D;  1P3B A;  4EO5 C;  4LD9 C;  5CP6 D;  4QLC B;  2FFF B;  1KX3 C;  2NZD A;  3LJA C;  3LEL B;  1M18 B;  4XUJ B;  3MGR C;  1P3M A;  4E45 A;  3EG5 B;  2CV5 B;  3MGP D;  4H9P B;  5GXQ D;  4AWL C;  3UT9 C;  3REH B;  4X23 B;  3W99 B;  3WKJ C;  5E5A B;  4WV4 B;  1P34 A;  4J8U A;  3WAA C;  5DNN D;  5AVC D;  3W98 D;  4WNN A;  3AZG D;  5B33 B;  5B0Z A;  4H9N B;  4CAY B;  4X23 D;  3WA9 D;  5B1L B;  1TAF A;  4YM6 C;  4H9R A;  4H9Q A;  5AVB D;  5C3I B;  5AV5 C;  4UUZ A;  1JFI B;  4XZQ D;  3B6F C;  1TZY D;  3WTP E;  3X1V A;  5JA4 B;  2G5I C;  3B0C W;  1AOI D;  3AV1 C;  3MNN D;  3AZN B;  5B0Y C;  1M1A C;  2PYO B;  3UTB A;  3AZE C;  1WWI A;  3X1T D;  5GSU B;  4Z2M H;  4WU8 C;  2HUE C;  5B2I C;  3AZN D;  1HQ3 B;  1P3A D;  3A6N D;  5B32 D;  3LEL A;  1M18 A;  1ID3 B;  3MVD A;  2F8N B;  1U35 C;  4J8W A;  3B6G C;  2Y2I A;  4R8P D;  3NQJ B;  5CPK A;  3KXB D;  2BG1 A;  4H9P A;  4Z5T D;  4UPK A;  5B31 C;  3AZI B;  4DQY B;  3REH A;  4G91 B;  2ZY4 A;  5E5A A;  3AZL C;  1ZLA C;  2CWE A;  5CPI C;  1F66 C;  1S32 D;  3REK C;  5GT0 D;  3REL C;  3AZI D;  5GT3 D;  3VH6 T;  5B1L A;  2FJ7 B;  3EPK A;  2BYM A;  3NQU A;  3REJ C;  5AV6 B;  1N1J B;  4NFT A;  5B2J B;  5AV9 A; 
#chains in the Genus database with same CATH homology
 3KUY B;  3AZJ A;  4J8X C;  1P3F B;  2ZY3 A;  3AV2 D;  3H0L C;  3MGP C;  3AZH D;  2HIO B;  5GXQ C;  4H9S A;  5G49 A;  5AV8 D;  3AZM D;  1P3O D;  3X1S B;  4ZUX D;  5B1M B;  2NQB D;  1KX3 B;  5DNN C;  5GSU A;  5AVC C;  3UTA A;  3TU4 B;  2F8N K;  3AYW B;  3AZF C;  4KUD D;  1HQ3 A;  3AFA A;  3WA9 C;  3WTP A;  1ID3 A;  4YS3 D;  5B24 A;  4Z66 D;  5AVB C;  3REI A;  1H3O B;  3WAA B;  4XZQ C;  2ARO D;  1P3M B;  1TZY C;  3LZ1 D;  1P3B D;  3MNN C;  1P3L D;  4Z2M G;  4YM6 B;  1P3P D;  2NZD D;  4KGC A;  4JJN C;  2FJ7 A;  2Y2L A;  4J8U B;  1P34 B;  5FUG B;  5AV6 A;  1N1J A;  5AV5 B;  5B2J A;  5B0Z B;  1P3A C;  3A6N C;  5B32 C;  3KUY A;  3KWQ B;  4H9R B;  3C1C B;  1P3F A;  1M19 B;  5F99 A;  4R8P C;  4H9Q B;  4DRA A;  4H9O A;  5B0Z D;  3KXB C;  3W97 C;  4Z5T C;  5JRG A;  4UUZ B;  1KX4 D;  3B0D C;  1P3K C;  4HGA C;  5B1M A;  3W96 D;  4LD9 A;  1KX3 A;  5CPJ D;  1BH8 A;  3TU4 A;  3MGR A;  3MGS D;  3MGQ C;  3O62 D;  5GT3 C;  3UTB B;  2Y2P A;  3B6G B;  1W2E A;  3X1V D;  5B31 B;  3UT9 A;  3WKJ A;  1ZLA B;  3WAA A;  1H3O A;  2F8N G;  1F66 B;  3MVD B;  3AL0 C;  4J8W B;  5CPK B;  3AZH C;  1KU5 A;  4YM6 A;  3AZK B;  3VH6 W;  4QLC D;  2IO5 B;  3AZM C;  3LEL D;  1P3O C;  1M18 D;  4XUJ D;  4ZUX C;  5FUG A;  2NQB C;  5AV5 A;  4WZS B;  2CV5 D;  5B40 C;  3B6F A;  4KUD C;  3REH D;  3W99 D;  4J8X B;  1P3G B;  2Y2M A;  5E5A D;  3KWQ A;  2BYM B;  2Y2Q A;  3NQU B;  3C1C A;  3AV1 A;  1M19 A;  2Y2J A;  5B0Y A;  1Q9C A;  3C1B C;  3V9R A;  4ZBJ C;  5B33 D;  5AV9 B;  4YS3 C;  1M1A A;  3AZE A;  5B1L D;  1A7W A;  2ARO C;  3AZJ B;  3LZ1 C;  3AZF B;  5AY8 B;  4G92 C;  4KHA A;  1P3L C;  5G49 B;  3VH5 A;  4J8V C;  1U35 A;  1P3P C;  2NZD C;  3B6G A;  5B31 A;  3UTA B;  1ZLA A;  2PYO D;  3AFA B;  1F66 A;  3WTP B;  3X1U C;  3REK A;  3AN2 B;  3REL A;  5GSU D;  3H0R C;  5B24 B;  5CHL B;  2DF4 C;  1HQ3 D;  3AZK A;  3AFA D;  3REI B;  1KX4 C;  3REJ A;  1BH9 B;  4WU9 C;  1ID3 D;  2F8N D;  1P3I C;  2JE5 A;  3W96 C;  5CPJ C;  4NE3 A;  1F1E A;  3B0B A;  3MGS C;  3O62 C;  3REI D;  4J8X A;  3LZ0 C;  1P3G A;  4KGC B;  3W97 B;  5GXQ A;  5CP6 C;  1P3K B;  2VQR A;  2FJ7 D;  5DNN A;  5AVC A;  5AV6 D;  5AY8 A;  5F99 B;  3AZF A;  1KX5 D;  5B2J D;  4H9O B;  1EQZ B;  3WA9 A;  4E44 A;  5JRG B;  4QLC C;  5DNM B;  3KUY D;  1M18 C;  4XUJ C;  4EO5 B;  1P3F D;  4LD9 B;  5F99 D;  5AVB A;  1BH8 B;  2CV5 C;  3AZG C;  3W98 C;  3LJA B;  4XZQ A;  2HIO D;  3MGR B;  1KX5 B;  2G5H C;  1TZY A;  3REH C;  3W99 C;  4X23 C;  5E5A C;  3X1S D;  5B31 G;  2ZM5 A;  5B1M D;  3AN2 A;  2F2A C;  4AWL B;  3UT9 B;  1KX3 D;  3TU4 D;  5B33 C;  3AYW D;  4JJN A;  3WKJ B;  5BS7 C;  5B1L C;  1BH9 A;  5BNX B;  5B40 B;  3A6N A;  1AOI C;  3WKJ D;  5B32 A;  5C3I C;  3WAA D;  3P5J B;  5BO0 B;  1P3M D;  3W97 A;  3B0C T;  3KXB A;  3X1T C;  4Z5T A;  3B6F B;  2RIQ A;  4YM6 D;  4H9S C;  3AZN C;  1P3K A;  2PYO C;  4G92 B;  4J8U D;  1P34 D;  3AV1 B;  3EPJ A;  5KDM B;  3MGQ A;  5AV5 D;  5B0Y B;  5GT3 A;  3V9R B;  4J8V B;  1M1A B;  1EQZ A;  3AZE B;  5DNM A;  1ID3 C;  3KWQ D;  4WU8 B;  1M19 D;  3C1C D;  2HUE B;  5B2I B;  1S32 C;  3LJA A;  5GT0 C;  4KHA B;  3AZE D;  2Y2G A;  3AZI C;  1U35 B;  2YFV A;  5BNV A;  3AZH A;  3AZM A;  3AZL B;  1P3O A;  4WU9 B;  4ZUX A;  1P3I B;  3A1K A;  3UTB D;  5CPI B;  3B6G D;  2YFW B;  5BNX A;  3REK B;  5B40 A;  3REL B;  5B31 D;  2ZY5 A;  3A1I A;  5AV6 C;  3AV2 C;  1KX5 C;  3LZ0 B;  1ZLA D;  5AV8 C;  2Y2K A;  5BO0 A;  3REJ B;  3KUY C;  1F66 D;  4CSR A;  3MVD D;  3C1B A;  2RVQ D;  4J8W D;  1P3F C;  5CP6 B;  5B32 G;  5CPK D;  2HIO C;  3KSY A;  3AZK D;  2UWX A;  3LZ1 A;  3X1S C;  3MGP B;  5B1M C;  5GXQ B;  1P3L A;  5KDM A;  4J8V A;  1P3P A;  3TU4 C;  3AYW C;  4Z66 C;  4J8X D;  1P3G D;  2L5A A;  5AVC B;  5DNN B;  3W98 B;  3AZG B;  4WU8 A;  1P3B C;  5B2I A;  5AV9 D;  3WA9 B;  3X1U A;  1P3M C;  3AZJ D;  3AZF D;  5AY8 D;  5AVB B;  1KX4 A;  4XZQ B;  4NE5 A;  3AZL A;  3VH5 T;  1TZY B;  4WU9 A;  1P3I A;  3W96 A;  5CPI A;  2YFW A;  5CPJ A;  1P34 C;  4J8U C;  1AOI B;  3MNN B;  3MGS A;  3O62 A;  3UTA D;  5B0Z C;  3LZ0 A;  4JJN B;  1B67 A;  3X1T B;  3WTP D;  3R45 B;  3KWQ C;  3AN2 D;  3C1C C;  1M19 C;  5CP6 A;  1P3A B;  3A6N B;  5B24 D;  2DQN C;  5B32 B;  4JJN D;  2LY8 A;  2BYK A;  3F6T A;  4R8P B;  3KXB B;  3MGP A;  3X1V C;  1Z2C B;  4Z5T B;  4WJ3 C;  4QLC A;  3B0D B;  4XUJ A;  4HGA B;  4KGC D;  3UTB C;  1T3U A;  2CV5 A;  3AZG A;  1S32 B;  3W97 D;  5GT0 B;  3W98 A;  2JCH A;  3MGQ B;  5GT3 B;  4X23 A;  3VH6 A;  3EPL A;  3W99 A;  1P3K D;  1HTA A;  2Y2O A;  2J8P A;  3LEL C;  2ZY2 A;  3MVD C;  1BFM A;  2RVQ C;  5B33 A;  4J8W C;  3MGQ D;  5BS7 A;  2JSS A;  5CPK C;  4H9N A;  4CAY A;  1EQZ D;  5BT1 D;  2Y2H A;  5JRG D;  2YFV B;  5DNM D;  2IO5 C;  3AZK C;  3AV2 B;  4LD9 D;  5BNV B;  3AZH B;  1AOI A;  3MNN A;  5AV8 B;  2XD5 A;  3AZM B;  1JFI A;  3LJA D;  1P3O B;  3MGR D;  4ZUX B;  3X1T A;  1P3G C;  2NQB B;  3R45 A;  5JA4 A;  2F8N H;  3UT9 D;  3AZN A;  4KUD B;  1P3A A;  2PYO A;  5AV9 C;  1R4V A;  1ULY A;  4CSR B;  4R8P A;  3C1B B;  4ZBJ B;  5B40 D;  3AZJ C;  4YS3 B;  4Z66 B;  5AY8 C;  2ARO B;  2F8N A;  3LZ1 B;  1P3B B;  3C1B D;  3NQJ A;  1S32 A;  3KFU G;  5GT0 A;  1P3L B;  3AZI A;  3FDD A;  5GSU C;  3UTA C;  1P3P B;  2NZD B;  3B6F D;  1WWS A;  1HQ3 C;  3AFA C;  3WTP C;  3H0M C;  3AV1 D;  3AN2 C;  5B0Y D;  4J8V D;  1M1A D;  5B24 C;  3VH5 W;  3X1U B;  3REI C;  4G91 C;  3AV2 A;  1KX5 A;  2Y2N A;  2XD1 A;  4WNN B;  4WU8 D;  5B2I D;  5AV8 A;  1KX4 B;  1TAF B;  3X1U D;  1U35 D;  4DRB A;  3W96 B;  4KGC C;  2NQB A;  2FJ7 C;  5CPJ B;  2HIO A;  4NE6 A;  3MGS B;  4KUD A;  3O62 B;  5B2J C;  3AZL D;  1PZR A;  4WU9 D;  3X1S A;  3EPH A;  2W8S A;  1P3I D;  3X1V B;  5CPI D;  1B6W A;  3REK D;  3REL D;  4YS3 A;  3AYW A;  4Z66 A;  5F99 C;  3LZ0 D;  1EQZ C;  5BT1 C;  2ARO A;  2BYK B;  4M6B A;  5JRG C;  3IP4 C;  5DNM C;  3REJ D;  1P3B A;  4EO5 C;  4LD9 C;  5CP6 D;  4QLC B;  2FFF B;  1KX3 C;  2NZD A;  3LJA C;  3LEL B;  1M18 B;  4XUJ B;  3MGR C;  1P3M A;  4E45 A;  3EG5 B;  2CV5 B;  3MGP D;  4H9P B;  5GXQ D;  4AWL C;  3UT9 C;  3REH B;  4X23 B;  3W99 B;  3WKJ C;  5E5A B;  4WV4 B;  1P34 A;  4J8U A;  3WAA C;  5DNN D;  5AVC D;  3W98 D;  4WNN A;  3AZG D;  5B33 B;  5B0Z A;  4H9N B;  4CAY B;  4X23 D;  3WA9 D;  5B1L B;  1TAF A;  4YM6 C;  4H9R A;  4H9Q A;  5AVB D;  5C3I B;  5AV5 C;  4UUZ A;  1JFI B;  4XZQ D;  3B6F C;  1TZY D;  3WTP E;  3X1V A;  5JA4 B;  2G5I C;  3B0C W;  1AOI D;  3AV1 C;  3MNN D;  3AZN B;  5B0Y C;  1M1A C;  2PYO B;  3UTB A;  3AZE C;  1WWI A;  3X1T D;  5GSU B;  4Z2M H;  4WU8 C;  2HUE C;  5B2I C;  3AZN D;  1HQ3 B;  1P3A D;  3A6N D;  5B32 D;  3LEL A;  1M18 A;  1ID3 B;  3MVD A;  2F8N B;  1U35 C;  4J8W A;  3B6G C;  2Y2I A;  4R8P D;  3NQJ B;  5CPK A;  3KXB D;  2BG1 A;  4H9P A;  4Z5T D;  4UPK A;  5B31 C;  3AZI B;  4DQY B;  3REH A;  4G91 B;  2ZY4 A;  5E5A A;  3AZL C;  1ZLA C;  2CWE A;  5CPI C;  1F66 C;  1S32 D;  3REK C;  5GT0 D;  3REL C;  3AZI D;  5GT3 D;  3VH6 T;  5B1L A;  2FJ7 B;  3EPK A;  2BYM A;  3NQU A;  3REJ C;  5AV6 B;  1N1J B;  4NFT A;  5B2J B;  5AV9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...