1HQ3C

Crystal structure of the histone-core-octamer in kcl/phosphate
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
95
structure length
95
Chain Sequence
b'YRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HISTONE H2A-IV
publication title Structure of the histone-core octamer in KCl/phosphate crystals at 2.15 A resolution.
pubmed doi rcsb
molecule tags Dna binding protein
total genus 32
structure length 95
sequence length 95
chains with identical sequence G
ec nomenclature
pdb deposition date 2000-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1hq3C00
3X1SD 3X1UC 4WV4B 3AZEB 2FJ7B 4KGCA 3UTAA 4QLCD 1EQZC 3LELC 3W97A 5F99B 3WTPC 1P3LA 3VH5A 5CPKC 5GXQB 3B6GA 2BYMA 5BNXB 5B0ZA 3NQUB 2CWEA 5B1LA 3KSYA 5C3IC 3LJAB 1WWSA 5CP6C 5B0YA 3X1VC 2BYKA 5BO0A 4XUJA 2LY8A 5B1MC 3WTPE 1F1EA 4H9NA 5BNVB 1AOID 1ZLAA 3AFAA 4DRBA 3X1TC 4WNNA 3REJB 1KX4D 4CSRB 1P3KA 2JSSA 5GT3D 5B32B 5E5AB 5CPJD 3AV2D 3AZMA 4UUZB 2HIOB 1F66D 3C1BB 3WAAC 5JRGD 3KXBD 3AZLC 3AZKD 5B2ID 5B33B 3AZND 3R45B 5AV6A 4J8XB 3REIA 5G49B 3AN2C 2PYOC 3REKA 1P3AB 3LZ0B 3REHD 1TAFB 4JJNA 1BH9A 1U35B 1P3PA 3MVDC 3AZGD 4H9QA 1S32D 3X1SC 4WU9C 1P3BC 3AYWC 1B6WA 4QLCC 4J8VB 5AV9C 3AZJB 1P3MA 5DNMA 5GT0D 4ZUXD 4H9PB 1N1JB 3NQJB 5AVCA 5AVBB 4YM6C 5CPIB 3WA9D 3AZEA 2FJ7A 5F99A 3LZ1B 3WKJC 4G92C 3UTBB 1P3GD 1M19A 5B31G 1M18D 2AROC 5GXQA 4M6BA 5KDMB 5BNXA 4HGAB 3NQUA 1H3OB 1JFIB 1P3OD 3AZFD 3UT9D 3AZMD 3LJAA 3KUYD 3RELD 4KUDC 4YS3D 4ZBJC 3MNNB 3TU4B 5B2JB 3AV2C 5CPJC 5AY8D 5BNVA 4NFTA 3MGQB 4LD9B 5JRGC 3KXBC 5B2IC 3AZHC 1P3FB 3REJA 4CSRA 1EQZD 3LELD 5E5AA 3B6GB 4KGCC 2HIOA 3AV1A 3C1BA 3REHC 3UTAC 3VH6W 3W97C 3B0BA 1P3MD 1P3LC 5B33A 4H9OB 5CPKD 4X23B 3R45A 4J8XA 5AVCD 5G49A 1M1AB 5B0YB 3B6FA 1P3AA 3AZED 5GSUB 3LZ0A 1TAFA 1U35A 5GT0C 1P34B 5B0ZC 5DNNB 3AFAB 2IO5B 3W96B 1BFMA 5CP6D 3MGPB 4J8VA 3AZJA 5B1MD 3MGSB 3VH6T 1N1JA 3NQJA 4XUJC 2F8ND 3AZIB 3B0DC 4WU8B 3LZ1A 3UTBA 2CV5A 4J8WB 3WAAD 1P3KC 1P3OC 4Z5TD 3AZFC 3MGRB 3UT9C 3AZMC 3KWQB 5KDMA 3AN2D 4NE5A 4CAYB 2PYOD 1H3OA 1HQ3B 5AV6C 3REJD 1JFIA 2HUEB 5FUGB 5AV8D 2NZDB 5B32D 3C1CD 5BS7A 4Z66B 4G91B 3MNNA 4WU9D 1P3BD 1P3PC 3AYWD 3TU4A 5B2JA 5AV9D 1BH8B 5B40A 2NQBB 3MGQA 4LD9A 4R8PB 1P3MC 1KX3B 4YM6D 1U35D 1M19B 1P3FA 5AV5B 5AVCC 3W99B 4XZQA 3X1UB 3AZEC 2FJ7C 3WKJD 5F99C 2L5AA 4H9OA 4X23A 2AROD 1M1AA 1TZYB 5AVBD 4J8UA 5CPID 5GXQC 5GSUA 1P34A 1ID3B 1ULYA 5DNNA 3W96A 4KUDD 5C3IB 3MGPA 3LJAC 3X1VB 3MGSA 3AV1B 4Z5TC 4EO5C 3AZIA 1WWIA 3AZHD 1KX5B 2YFVB 3A6ND 3V9RB 4WU8A 3B6FB 3REJC 4KGCD 4J8WA 5AV8C 3UTAD 5B32C 3C1CC 3MGRA 3W97D 2HIOC 5B24B 3KWQA 1P3LD 5B31A 4CAYA 1HQ3A 4J8XC 3W98B 4H9SC 5FUGA 2NZDA 1P3AC 3B6GD 1P3IB 3LZ0C 5B0ZD 1U35C 4Z66A 5B1LD 1BH8A 2NQBA 4QLCB 5B0YD 3AZJC 4J8VC 4R8PA 4XUJD 2CV5B 1KX3A 5AV5A 3W99A 3X1UA 5AVBC 1ZLAD 5CPIC 3AFAD 3MGPD 1P3KD 3LZ1C 3MGSD 3UTBC 5JA4A 1TZYA 5AV6D 3VH6A 5B40B 3REID 1ID3A 4HGAC 2RVQC 3REKD 1AOIB 4JJND 3MGRD 3A6NC 1P3PD 4NE6A 3X1VA 4XZQB 1KX4B 3MNNC 1F66B 5GT3B 3TU4C 3AV2B 4AWLB 1HQ3D 5DNMD 1KX5A 5JRGB 2YFVA 2YFWA 3MGQC 3AZKB 5B2IB 4LD9C 3AZNB 3V9RA 4J8UB 1P3FC 2FJ7D 5F99D 3REHB 3B6GC 5B24A 5B1LC 3AZGB 1S32B 1M19D 2F8NK 3W98A 5AV5D 5GXQD 1M1AC 1Q9CA 5B0YC 1P3IA 5GSUC 5GT0B 2F8NG 4ZUXB 3MVDA 1P34C 1ZLAC 3WA9B 5DNNC 3AFAC 2IO5C 3W96C 4QLCA 3LJAD 1A7WA 3MGPC 3WAAA 3MGSC 4DRAA 1P3GB 3O62B 1M18B 5B31B 3AZIC 3REIC 5B32G 4WU8C 5E5AD 3REKC 1P3OB 2HIOD 3AV1D 3C1BD 4J8WC 3UT9B 4JJNC 3KUYB 3MGRC 3RELB 3KWQC 5B33D 4YS3B 4J8XD 3B6FD 1HQ3C 5AY8B 1P3AD 1R4VA 2HUEC 4WZSB 3LZ0D 5DNMC 1AOIA 2NZDC 1KX4A 4Z66C 4G91C 1EQZB 5GT3A 3LELB 3WTPB 3AV2A 1F66A 3AZJD 4J8VD 3W98D 2NQBC 5JRGA 3AZKA 5B2IA 5CPKB 5JA4B 3AZNA 1M19C 1KX3C 5AV5C 3REHA 3LZ1D 3UTBD 2CV5D 3AZGA 1S32A 5CP6B 1TZYC 5B1MB 5GT0A 4ZUXA 2RVQD 1KU5A 1ID3C 2F8NB 3WA9A 2YFWB 4Z2MH 3X1TB 3VH5W 3MNND 3TU4D 5B2JD 5E5AC 5B40D 1P3GA 3WAAB 4H9RB 3O62A 3AV1C 4Z5TB 4EO5B 3C1BC 3AZLB 1M18A 3MGQD 4LD9D 2F8NH 1KX5C 5B33C 3AN2B 1P3FD 2PYOB 4XZQD 5AV8B 3B6FC 1P3OA 3AZFA 3C1CB 3UT9A 3KUYA 3RELA 5B24C 3MVDB 3X1SB 4YS3A 4WU9B 1P3BB 3VH5T 4X23D 3AYWB 1M1AD 5AV9B 4J8UD 5AY8A 3W98C 5GSUD 4YM6B 1P34D 1P3IC 5DNND 3W96D 1EQZA 3LELA 3WTPA 3WKJB 4G92B 5CPKA 2CV5C 2AROB 3AZID 4WU8D 4E44A 4J8WD 4KHAB 5CP6A 5BS7C 3O62D 3KWQD 5B31D 4KUDB 4ZBJB 4NE3A 5B1MA 5CPJB 5B2JC 5B40C 2F8NA 2NZDD 5BT1D 3KXBB 3AZHB 3X1TA 1AOIC 3A6NB 4Z66D 4XZQC 1KX4C 4KGCB 2NQBD 3UTAB 4H9RA 1F66C 4Z2MG 4Z5TA 5GT3C 3W97B 4AWLC 3AZLA 1P3LB 4R8PD 4E45A 1KX3D 4X23C 3AZKC 3AN2A 2PYOA 3W99D 3X1UD 3AZNC 4J8UC 5AV8A 5B32A 3WTPD 3C1CA 4UUZA 2BYMB 5B0ZB 3X1SA 4WU9A 1P3BA 5B1LB 3AYWA 1TZYD 5AV9A 3AZGC 1S32C 4H9SA 3B0CW 2BYKB 5BO0B 4XUJB 4YM6A 1ID3D 4ZUXC 4H9NB 1ZLAB 3WA9C 3B0DB 1HTAA 3X1VD 4WNNB 3WKJA 1P3KB 3AZFB 4H9PA 2AROA 3AZMB 1P3GC 5AVBA 3O62C 1M18C 5CPIA 1KX5D 5B31C 3X1TD 3B0CT 5AV6B 3REIB 3REKB 5BT1C 4KHAA 5B24D 4JJNB 1BH9B 4KUDA 3AZLD 1P3PB 3KUYC 5CHLB 3RELC 4H9QB 4YS3C 5CPJA 3KXBA 1P3MB 5AY8C 5DNMB 3AZHA 1P3ID 4R8PC 3A6NA 1B67A 5AVCB 3MVDD 3W99C
chains in the Genus database with same CATH superfamily
3X1SD 3X1UC 4WV4B 3AZEB 2FJ7B 4KGCA 3UTAA 4QLCD 1EQZC 3LELC 3W97A 5F99B 2G5IC 3WTPC 1P3LA 3VH5A 5CPKC 5GXQB 2DQNC 4UPKA 3B6GA 2BYMA 5BNXB 5B0ZA 3NQUB 2CWEA 3P5JB 5B1LA 3KSYA 5C3IC 3LJAB 1WWSA 5CP6C 5B0YA 3X1VC 2BYKA 5BO0A 4XUJA 2LY8A 5B1MC 3WTPE 1F1EA 4H9NA 5BNVB 1AOID 1ZLAA 3AFAA 4DRBA 3X1TC 4WNNA 3REJB 1KX4D 4CSRB 1P3KA 2JSSA 5GT3D 5B32B 3A1KA 5E5AB 5CPJD 3AZMA 4UUZB 2HIOB 3AV2D 3C1BB 3WAAC 2Y2KA 5JRGD 3KXBD 3AZLC 3AZKD 5B2ID 5B33B 3AZND 3R45B 5AV6A 4J8XB 3REIA 1T3UA 5G49B 3AN2C 2PYOC 3REKA 1P3AB 3LZ0B 3REHD 1TAFB 4JJNA 1BH9A 1U35B 1P3PA 3MVDC 3AZGD 4H9QA 1S32D 3X1SC 4WU9C 1P3BC 3AYWC 1B6WA 4QLCC 4J8VB 5AV9C 3AZJB 1P3MA 5DNMA 5GT0D 4ZUXD 4H9PB 1N1JB 3NQJB 5AVCA 5AVBB 4YM6C 5CPIB 3EPHA 3WA9D 3AZEA 2FJ7A 5F99A 2Y2JA 2Y2GA 3LZ1B 3WKJC 4G92C 3UTBB 1P3GD 1M19A 5B31G 1M18D 2AROC 5GXQA 4M6BA 5KDMB 2F2AC 5BNXA 4HGAB 3NQUA 1H3OB 1JFIB 2ZY5A 1P3OD 3AZFD 3EG5B 3UT9D 3AZMD 3LJAA 3KUYD 3RELD 4KUDC 4YS3D 4ZBJC 3MNNB 3TU4B 5B2JB 3AV2C 5CPJC 5AY8D 5BNVA 4NFTA 3MGQB 4LD9B 5JRGC 3KXBC 5B2IC 3AZHC 1P3FB 3REJA 4CSRA 1EQZD 3LELD 5E5AA 3B6GB 4KGCC 2HIOA 3AV1A 3C1BA 3REHC 3UTAC 3VH6W 3W97C 3B0BA 1P3MD 1P3LC 5B33A 4H9OB 5CPKD 4X23B 3R45A 4J8XA 5AVCD 5G49A 1M1AB 5B0YB 3B6FA 1P3AA 3AZED 5GSUB 3LZ0A 1TAFA 1U35A 5GT0C 1P34B 3FDDA 5B0ZC 5DNNB 3AFAB 2IO5B 3W96B 1BFMA 5CP6D 1W2EA 3MGPB 4J8VA 3AZJA 5B1MD 3MGSB 3VH6T 1N1JA 3NQJA 4XUJC 2XD5A 2F8ND 3AZIB 3B0DC 4WU8B 3LZ1A 2UWXA 3UTBA 2CV5A 4J8WB 3WAAD 1P3KC 1P3OC 4Z5TD 3AZFC 3MGRB 3UT9C 3AZMC 3KWQB 2Y2OA 5KDMA 3AN2D 4NE5A 4CAYB 2PYOD 1H3OA 1HQ3B 5AV6C 3REJD 1JFIA 2HUEB 5FUGB 5AV8D 2NZDB 5B32D 3C1CD 2VQRA 5BS7A 2JE5A 4Z66B 4G91B 3MNNA 4WU9D 1P3BD 1P3PC 3AYWD 3TU4A 5B2JA 5AV9D 1BH8B 5B40A 2NQBB 2ZY3A 3MGQA 4LD9A 4R8PB 1P3MC 1KX3B 4YM6D 1U35D 1M19B 1P3FA 5AV5B 5AVCC 3W99B 4XZQA 3X1UB 3AZEC 2FJ7C 3WKJD 5F99C 2L5AA 3IP4C 4H9OA 4X23A 2AROD 1M1AA 1TZYB 5AVBD 4J8UA 5CPID 5GXQC 5GSUA 1P34A 1ID3B 1ULYA 5DNNA 3W96A 4KUDD 5C3IB 3MGPA 3LJAC 3X1VB 3MGSA 3AV1B 4Z5TC 4EO5C 3AZIA 1WWIA 3AZHD 1KX5B 2YFVB 3A6ND 2Y2HA 3V9RB 4WU8A 3B6FB 3REJC 4KGCD 4J8WA 5AV8C 3UTAD 5B32C 3C1CC 3MGRA 3W97D 2HIOC 5B24B 3KWQA 1P3LD 5B31A 4CAYA 1HQ3A 4J8XC 3W98B 4H9SC 5FUGA 2NZDA 2Y2NA 1P3AC 3B6GD 1P3IB 2FFFB 3LZ0C 5B0ZD 1U35C 4Z66A 5B1LD 1BH8A 2NQBA 4QLCB 2G5HC 5B0YD 3AZJC 4J8VC 4R8PA 4XUJD 2CV5B 3EPJA 1KX3A 2Y2IA 5AV5A 3W99A 3X1UA 5AVBC 1ZLAD 5CPIC 3AFAD 3MGPD 1P3KD 3LZ1C 3MGSD 3UTBC 5JA4A 1TZYA 2Y2MA 3KFUG 5AV6D 3VH6A 5B40B 3REID 1ID3A 4HGAC 2RVQC 3REKD 1AOIB 4JJND 3MGRD 3A6NC 1P3PD 4NE6A 3X1VA 4XZQB 1KX4B 3MNNC 1F66B 5GT3B 3TU4C 3AV2B 4AWLB 2Y2PA 1HQ3D 5DNMD 1KX5A 5JRGB 2YFVA 2YFWA 3MGQC 3AZKB 5B2IB 4LD9C 3AZNB 3H0MC 3V9RA 4J8UB 1P3FC 2FJ7D 3EPKA 5F99D 3REHB 3B6GC 5B24A 5B1LC 3AZGB 1S32B 1M19D 2F8NK 2RIQA 3W98A 2Y2LA 5GXQD 5AV5D 1M1AC 1Q9CA 5B0YC 1P3IA 5GSUC 5GT0B 2F8NG 4ZUXB 1Z2CB 3MVDA 1P34C 1ZLAC 3WA9B 5DNNC 2JCHA 2IO5C 3W96C 4QLCA 3AFAC 1A7WA 3LJAD 3MGPC 2ZY4A 3WAAA 3MGSC 4DRAA 1P3GB 3O62B 1M18B 5B31B 3AZIC 3REIC 5B32G 4WU8C 5E5AD 3REKC 1P3OB 2HIOD 3AV1D 3C1BD 4J8WC 3UT9B 4JJNC 2ZM5A 3KUYB 3MGRC 1PZRA 3RELB 3KWQC 5B33D 4YS3B 4J8XD 3B6FD 1HQ3C 5AY8B 1P3AD 1R4VA 2HUEC 4WZSB 3LZ0D 5DNMC 1AOIA 2NZDC 1KX4A 4Z66C 4G91C 1EQZB 5GT3A 3LELB 3WTPB 3AV2A 1F66A 3AZJD 4J8VD 3W98D 2NQBC 5JRGA 3AZKA 5B2IA 5CPKB 5JA4B 3AZNA 1M19C 1KX3C 3H0LC 5AV5C 3REHA 3LZ1D 3UTBD 2CV5D 3AZGA 1S32A 4DQYB 5CP6B 1TZYC 5B1MB 5GT0A 4ZUXA 2RVQD 1KU5A 1ID3C 2F8NB 3WA9A 2YFWB 4Z2MH 2ZY2A 3X1TB 3VH5W 3MNND 3TU4D 5B2JD 5E5AC 5B40D 1P3GA 3WAAB 4H9RB 3O62A 3AV1C 4Z5TB 4EO5B 3C1BC 3AZLB 1M18A 3MGQD 4LD9D 2Y2QA 2F8NH 1KX5C 5B33C 3H0RC 3AN2B 1P3FD 2PYOB 4XZQD 1F66D 5AV8B 3B6FC 1P3OA 3AZFA 3C1CB 3UT9A 3KUYA 2BG1A 3RELA 5B24C 3MVDB 3X1SB 4YS3A 4WU9B 1P3BB 3VH5T 4X23D 3AYWB 4WJ3C 1M1AD 5AV9B 4J8UD 5AY8A 3W98C 5GSUD 4YM6B 1P34D 1P3IC 5DNND 3W96D 1EQZA 3LELA 3WTPA 3WKJB 4G92B 5CPKA 2CV5C 2AROB 3AZID 3A1IA 4WU8D 4E44A 3AL0C 4J8WD 2DF4C 4KHAB 5CP6A 5BS7C 3O62D 3KWQD 5B31D 4KUDB 4ZBJB 4NE3A 5B1MA 5CPJB 5B2JC 2J8PA 5B40C 2F8NA 2NZDD 5BT1D 3KXBB 3AZHB 3X1TA 1AOIC 3A6NB 4Z66D 4XZQC 1KX4C 4KGCB 2NQBD 3UTAB 4H9RA 1F66C 4Z2MG 4Z5TA 5GT3C 3W97B 4AWLC 3AZLA 1P3LB 4R8PD 4E45A 1KX3D 4X23C 3AZKC 3AN2A 2PYOA 3W99D 3X1UD 3AZNC 4J8UC 5AV8A 5B32A 3WTPD 3C1CA 4UUZA 2BYMB 5B0ZB 3X1SA 4WU9A 1P3BA 5B1LB 3AYWA 1TZYD 5AV9A 3AZGC 1S32C 4H9SA 3B0CW 2BYKB 5BO0B 4XUJB 4YM6A 1ID3D 4ZUXC 2XD1A 4H9NB 1ZLAB 3WA9C 3B0DB 1HTAA 3X1VD 4WNNB 3WKJA 1P3KB 3AZFB 4H9PA 2AROA 3AZMB 1P3GC 5AVBA 3O62C 1M18C 5CPIA 1KX5D 5B31C 3X1TD 3B0CT 5AV6B 3REIB 3F6TA 3REKB 5BT1C 4KHAA 5B24D 4JJNB 1BH9B 4KUDA 3AZLD 1P3PB 3KUYC 5CHLB 3EPLA 3RELC 4H9QB 2W8SA 4YS3C 5CPJA 3KXBA 1P3MB 5AY8C 5DNMB 3AZHA 1P3ID 4R8PC 3A6NA 1B67A 5AVCB 3MVDD 3W99C
chains in the Genus database with same CATH topology
3X1SD 3X1UC 4WV4B 3AZEB 2FJ7B 4KGCA 3UTAA 4QLCD 1EQZC 3LELC 3W97A 5F99B 2G5IC 3WTPC 1P3LA 3VH5A 5CPKC 5GXQB 2DQNC 4UPKA 3B6GA 2BYMA 5BNXB 5B0ZA 3NQUB 2CWEA 3P5JB 5B1LA 3KSYA 5C3IC 3LJAB 1WWSA 5CP6C 5B0YA 3X1VC 2BYKA 5BO0A 4XUJA 2LY8A 5B1MC 3WTPE 1F1EA 4H9NA 5BNVB 1AOID 1ZLAA 3AFAA 4DRBA 3X1TC 4WNNA 3REJB 1KX4D 4CSRB 1P3KA 2JSSA 5GT3D 5B32B 3A1KA 5E5AB 5CPJD 3AZMA 4UUZB 2HIOB 3AV2D 3C1BB 3WAAC 2Y2KA 5JRGD 3KXBD 3AZLC 3AZKD 5B2ID 5B33B 3AZND 3R45B 5AV6A 4J8XB 3REIA 1T3UA 5G49B 3AN2C 2PYOC 3REKA 1P3AB 3LZ0B 3REHD 1TAFB 4JJNA 1BH9A 1U35B 1P3PA 3MVDC 3AZGD 4H9QA 1S32D 3X1SC 4WU9C 1P3BC 3AYWC 1B6WA 4QLCC 4J8VB 5AV9C 3AZJB 1P3MA 5DNMA 5GT0D 4ZUXD 4H9PB 1N1JB 3NQJB 5AVCA 5AVBB 4YM6C 5CPIB 3EPHA 3WA9D 3AZEA 2FJ7A 5F99A 2Y2JA 2Y2GA 3LZ1B 3WKJC 4G92C 3UTBB 1P3GD 1M19A 5B31G 1M18D 2AROC 5GXQA 4M6BA 5KDMB 2F2AC 5BNXA 4HGAB 3NQUA 1H3OB 1JFIB 2ZY5A 1P3OD 3AZFD 3EG5B 3UT9D 3AZMD 3LJAA 3KUYD 3RELD 4KUDC 4YS3D 4ZBJC 3MNNB 3TU4B 5B2JB 3AV2C 5CPJC 5AY8D 5BNVA 4NFTA 3MGQB 4LD9B 5JRGC 3KXBC 5B2IC 3AZHC 1P3FB 3REJA 4CSRA 1EQZD 3LELD 5E5AA 3B6GB 4KGCC 2HIOA 3AV1A 3C1BA 3REHC 3UTAC 3VH6W 3W97C 3B0BA 1P3MD 1P3LC 5B33A 4H9OB 5CPKD 4X23B 3R45A 4J8XA 5AVCD 5G49A 1M1AB 5B0YB 3B6FA 1P3AA 3AZED 5GSUB 3LZ0A 1TAFA 1U35A 5GT0C 1P34B 3FDDA 5B0ZC 5DNNB 3AFAB 2IO5B 3W96B 1BFMA 5CP6D 1W2EA 3MGPB 4J8VA 3AZJA 5B1MD 3MGSB 3VH6T 1N1JA 3NQJA 4XUJC 2XD5A 2F8ND 3AZIB 3B0DC 4WU8B 3LZ1A 2UWXA 3UTBA 2CV5A 4J8WB 3WAAD 1P3KC 1P3OC 4Z5TD 3AZFC 3MGRB 3UT9C 3AZMC 3KWQB 2Y2OA 5KDMA 3AN2D 4NE5A 4CAYB 2PYOD 1H3OA 1HQ3B 5AV6C 3REJD 1JFIA 2HUEB 5FUGB 5AV8D 2NZDB 5B32D 3C1CD 2VQRA 5BS7A 2JE5A 4Z66B 4G91B 3MNNA 4WU9D 1P3BD 1P3PC 3AYWD 3TU4A 5B2JA 5AV9D 1BH8B 5B40A 2NQBB 2ZY3A 3MGQA 4LD9A 4R8PB 1P3MC 1KX3B 4YM6D 1U35D 1M19B 1P3FA 5AV5B 5AVCC 3W99B 4XZQA 3X1UB 3AZEC 2FJ7C 3WKJD 5F99C 2L5AA 3IP4C 4H9OA 4X23A 2AROD 1M1AA 1TZYB 5AVBD 4J8UA 5CPID 5GXQC 5GSUA 1P34A 1ID3B 1ULYA 5DNNA 3W96A 4KUDD 5C3IB 3MGPA 3LJAC 3X1VB 3MGSA 3AV1B 4Z5TC 4EO5C 3AZIA 1WWIA 3AZHD 1KX5B 2YFVB 3A6ND 2Y2HA 3V9RB 4WU8A 3B6FB 3REJC 4KGCD 4J8WA 5AV8C 3UTAD 5B32C 3C1CC 3MGRA 3W97D 2HIOC 5B24B 3KWQA 1P3LD 5B31A 4CAYA 1HQ3A 4J8XC 3W98B 4H9SC 5FUGA 2NZDA 2Y2NA 1P3AC 3B6GD 1P3IB 2FFFB 3LZ0C 5B0ZD 1U35C 4Z66A 5B1LD 1BH8A 2NQBA 4QLCB 2G5HC 5B0YD 3AZJC 4J8VC 4R8PA 4XUJD 2CV5B 3EPJA 1KX3A 2Y2IA 5AV5A 3W99A 3X1UA 5AVBC 1ZLAD 5CPIC 3AFAD 3MGPD 1P3KD 3LZ1C 3MGSD 3UTBC 5JA4A 1TZYA 2Y2MA 3KFUG 5AV6D 3VH6A 5B40B 3REID 1ID3A 4HGAC 2RVQC 3REKD 1AOIB 4JJND 3MGRD 3A6NC 1P3PD 4NE6A 3X1VA 4XZQB 1KX4B 3MNNC 1F66B 5GT3B 3TU4C 3AV2B 4AWLB 2Y2PA 1HQ3D 5DNMD 1KX5A 5JRGB 2YFVA 2YFWA 3MGQC 3AZKB 5B2IB 4LD9C 3AZNB 3H0MC 3V9RA 4J8UB 1P3FC 2FJ7D 3EPKA 5F99D 3REHB 3B6GC 5B24A 5B1LC 3AZGB 1S32B 1M19D 2F8NK 2RIQA 3W98A 2Y2LA 5GXQD 5AV5D 1M1AC 1Q9CA 5B0YC 1P3IA 5GSUC 5GT0B 2F8NG 4ZUXB 1Z2CB 3MVDA 1P34C 1ZLAC 3WA9B 5DNNC 2JCHA 2IO5C 3W96C 4QLCA 3AFAC 1A7WA 3LJAD 3MGPC 2ZY4A 3WAAA 3MGSC 4DRAA 1P3GB 3O62B 1M18B 5B31B 3AZIC 3REIC 5B32G 4WU8C 5E5AD 3REKC 1P3OB 2HIOD 3AV1D 3C1BD 4J8WC 3UT9B 4JJNC 2ZM5A 3KUYB 3MGRC 1PZRA 3RELB 3KWQC 5B33D 4YS3B 4J8XD 3B6FD 1HQ3C 5AY8B 1P3AD 1R4VA 2HUEC 4WZSB 3LZ0D 5DNMC 1AOIA 2NZDC 1KX4A 4Z66C 4G91C 1EQZB 5GT3A 3LELB 3WTPB 3AV2A 1F66A 3AZJD 4J8VD 3W98D 2NQBC 5JRGA 3AZKA 5B2IA 5CPKB 5JA4B 3AZNA 1M19C 1KX3C 3H0LC 5AV5C 3REHA 3LZ1D 3UTBD 2CV5D 3AZGA 1S32A 4DQYB 5CP6B 1TZYC 5B1MB 5GT0A 4ZUXA 2RVQD 1KU5A 1ID3C 2F8NB 3WA9A 2YFWB 4Z2MH 2ZY2A 3X1TB 3VH5W 3MNND 3TU4D 5B2JD 5E5AC 5B40D 1P3GA 3WAAB 4H9RB 3O62A 3AV1C 4Z5TB 4EO5B 3C1BC 3AZLB 1M18A 3MGQD 4LD9D 2Y2QA 2F8NH 1KX5C 5B33C 3H0RC 3AN2B 1P3FD 2PYOB 4XZQD 1F66D 5AV8B 3B6FC 1P3OA 3AZFA 3C1CB 3UT9A 3KUYA 2BG1A 3RELA 5B24C 3MVDB 3X1SB 4YS3A 4WU9B 1P3BB 3VH5T 4X23D 3AYWB 4WJ3C 1M1AD 5AV9B 4J8UD 5AY8A 3W98C 5GSUD 4YM6B 1P34D 1P3IC 5DNND 3W96D 1EQZA 3LELA 3WTPA 3WKJB 4G92B 5CPKA 2CV5C 2AROB 3AZID 3A1IA 4WU8D 4E44A 3AL0C 4J8WD 2DF4C 4KHAB 5CP6A 5BS7C 3O62D 3KWQD 5B31D 4KUDB 4ZBJB 4NE3A 5B1MA 5CPJB 5B2JC 2J8PA 5B40C 2F8NA 2NZDD 5BT1D 3KXBB 3AZHB 3X1TA 1AOIC 3A6NB 4Z66D 4XZQC 1KX4C 4KGCB 2NQBD 3UTAB 4H9RA 1F66C 4Z2MG 4Z5TA 5GT3C 3W97B 4AWLC 3AZLA 1P3LB 4R8PD 4E45A 1KX3D 4X23C 3AZKC 3AN2A 2PYOA 3W99D 3X1UD 3AZNC 4J8UC 5AV8A 5B32A 3WTPD 3C1CA 4UUZA 2BYMB 5B0ZB 3X1SA 4WU9A 1P3BA 5B1LB 3AYWA 1TZYD 5AV9A 3AZGC 1S32C 4H9SA 3B0CW 2BYKB 5BO0B 4XUJB 4YM6A 1ID3D 4ZUXC 2XD1A 4H9NB 1ZLAB 3WA9C 3B0DB 1HTAA 3X1VD 4WNNB 3WKJA 1P3KB 3AZFB 4H9PA 2AROA 3AZMB 1P3GC 5AVBA 3O62C 1M18C 5CPIA 1KX5D 5B31C 3X1TD 3B0CT 5AV6B 3REIB 3F6TA 3REKB 5BT1C 4KHAA 5B24D 4JJNB 1BH9B 4KUDA 3AZLD 1P3PB 3KUYC 5CHLB 3EPLA 3RELC 4H9QB 2W8SA 4YS3C 5CPJA 3KXBA 1P3MB 5AY8C 5DNMB 3AZHA 1P3ID 4R8PC 3A6NA 1B67A 5AVCB 3MVDD 3W99C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3X1S D;  3X1U C;  4WV4 B;  3AZE B;  2FJ7 B;  4KGC A;  3UTA A;  4QLC D;  1EQZ C;  3LEL C;  3W97 A;  5F99 B;  3WTP C;  1P3L A;  3VH5 A;  5CPK C;  5GXQ B;  3B6G A;  2BYM A;  5BNX B;  5B0Z A;  3NQU B;  2CWE A;  5B1L A;  3KSY A;  5C3I C;  3LJA B;  1WWS A;  5CP6 C;  5B0Y A;  3X1V C;  2BYK A;  5BO0 A;  4XUJ A;  2LY8 A;  5B1M C;  3WTP E;  1F1E A;  4H9N A;  5BNV B;  1AOI D;  1ZLA A;  3AFA A;  4DRB A;  3X1T C;  4WNN A;  3REJ B;  1KX4 D;  4CSR B;  1P3K A;  2JSS A;  5GT3 D;  5B32 B;  5E5A B;  5CPJ D;  3AV2 D;  3AZM A;  4UUZ B;  2HIO B;  1F66 D;  3C1B B;  3WAA C;  5JRG D;  3KXB D;  3AZL C;  3AZK D;  5B2I D;  5B33 B;  3AZN D;  3R45 B;  5AV6 A;  4J8X B;  3REI A;  5G49 B;  3AN2 C;  2PYO C;  3REK A;  1P3A B;  3LZ0 B;  3REH D;  1TAF B;  4JJN A;  1BH9 A;  1U35 B;  1P3P A;  3MVD C;  3AZG D;  4H9Q A;  1S32 D;  3X1S C;  4WU9 C;  1P3B C;  3AYW C;  1B6W A;  4QLC C;  4J8V B;  5AV9 C;  3AZJ B;  1P3M A;  5DNM A;  5GT0 D;  4ZUX D;  4H9P B;  1N1J B;  3NQJ B;  5AVC A;  5AVB B;  4YM6 C;  5CPI B;  3WA9 D;  3AZE A;  2FJ7 A;  5F99 A;  3LZ1 B;  3WKJ C;  4G92 C;  3UTB B;  1P3G D;  1M19 A;  5B31 G;  1M18 D;  2ARO C;  5GXQ A;  4M6B A;  5KDM B;  5BNX A;  4HGA B;  3NQU A;  1H3O B;  1JFI B;  1P3O D;  3AZF D;  3UT9 D;  3AZM D;  3LJA A;  3KUY D;  3REL D;  4KUD C;  4YS3 D;  4ZBJ C;  3MNN B;  3TU4 B;  5B2J B;  3AV2 C;  5CPJ C;  5AY8 D;  5BNV A;  4NFT A;  3MGQ B;  4LD9 B;  5JRG C;  3KXB C;  5B2I C;  3AZH C;  1P3F B;  3REJ A;  4CSR A;  1EQZ D;  3LEL D;  5E5A A;  3B6G B;  4KGC C;  2HIO A;  3AV1 A;  3C1B A;  3REH C;  3UTA C;  3VH6 W;  3W97 C;  3B0B A;  1P3M D;  1P3L C;  5B33 A;  4H9O B;  5CPK D;  4X23 B;  3R45 A;  4J8X A;  5AVC D;  5G49 A;  1M1A B;  5B0Y B;  3B6F A;  1P3A A;  3AZE D;  5GSU B;  3LZ0 A;  1TAF A;  1U35 A;  5GT0 C;  1P34 B;  5B0Z C;  5DNN B;  3AFA B;  2IO5 B;  3W96 B;  1BFM A;  5CP6 D;  3MGP B;  4J8V A;  3AZJ A;  5B1M D;  3MGS B;  3VH6 T;  1N1J A;  3NQJ A;  4XUJ C;  2F8N D;  3AZI B;  3B0D C;  4WU8 B;  3LZ1 A;  3UTB A;  2CV5 A;  4J8W B;  3WAA D;  1P3K C;  1P3O C;  4Z5T D;  3AZF C;  3MGR B;  3UT9 C;  3AZM C;  3KWQ B;  5KDM A;  3AN2 D;  4NE5 A;  4CAY B;  2PYO D;  1H3O A;  1HQ3 B;  5AV6 C;  3REJ D;  1JFI A;  2HUE B;  5FUG B;  5AV8 D;  2NZD B;  5B32 D;  3C1C D;  5BS7 A;  4Z66 B;  4G91 B;  3MNN A;  4WU9 D;  1P3B D;  1P3P C;  3AYW D;  3TU4 A;  5B2J A;  5AV9 D;  1BH8 B;  5B40 A;  2NQB B;  3MGQ A;  4LD9 A;  4R8P B;  1P3M C;  1KX3 B;  4YM6 D;  1U35 D;  1M19 B;  1P3F A;  5AV5 B;  5AVC C;  3W99 B;  4XZQ A;  3X1U B;  3AZE C;  2FJ7 C;  3WKJ D;  5F99 C;  2L5A A;  4H9O A;  4X23 A;  2ARO D;  1M1A A;  1TZY B;  5AVB D;  4J8U A;  5CPI D;  5GXQ C;  5GSU A;  1P34 A;  1ID3 B;  1ULY A;  5DNN A;  3W96 A;  4KUD D;  5C3I B;  3MGP A;  3LJA C;  3X1V B;  3MGS A;  3AV1 B;  4Z5T C;  4EO5 C;  3AZI A;  1WWI A;  3AZH D;  1KX5 B;  2YFV B;  3A6N D;  3V9R B;  4WU8 A;  3B6F B;  3REJ C;  4KGC D;  4J8W A;  5AV8 C;  3UTA D;  5B32 C;  3C1C C;  3MGR A;  3W97 D;  2HIO C;  5B24 B;  3KWQ A;  1P3L D;  5B31 A;  4CAY A;  1HQ3 A;  4J8X C;  3W98 B;  4H9S C;  5FUG A;  2NZD A;  1P3A C;  3B6G D;  1P3I B;  3LZ0 C;  5B0Z D;  1U35 C;  4Z66 A;  5B1L D;  1BH8 A;  2NQB A;  4QLC B;  5B0Y D;  3AZJ C;  4J8V C;  4R8P A;  4XUJ D;  2CV5 B;  1KX3 A;  5AV5 A;  3W99 A;  3X1U A;  5AVB C;  1ZLA D;  5CPI C;  3AFA D;  3MGP D;  1P3K D;  3LZ1 C;  3MGS D;  3UTB C;  5JA4 A;  1TZY A;  5AV6 D;  3VH6 A;  5B40 B;  3REI D;  1ID3 A;  4HGA C;  2RVQ C;  3REK D;  1AOI B;  4JJN D;  3MGR D;  3A6N C;  1P3P D;  4NE6 A;  3X1V A;  4XZQ B;  1KX4 B;  3MNN C;  1F66 B;  5GT3 B;  3TU4 C;  3AV2 B;  4AWL B;  1HQ3 D;  5DNM D;  1KX5 A;  5JRG B;  2YFV A;  2YFW A;  3MGQ C;  3AZK B;  5B2I B;  4LD9 C;  3AZN B;  3V9R A;  4J8U B;  1P3F C;  2FJ7 D;  5F99 D;  3REH B;  3B6G C;  5B24 A;  5B1L C;  3AZG B;  1S32 B;  1M19 D;  2F8N K;  3W98 A;  5AV5 D;  5GXQ D;  1M1A C;  1Q9C A;  5B0Y C;  1P3I A;  5GSU C;  5GT0 B;  2F8N G;  4ZUX B;  3MVD A;  1P34 C;  1ZLA C;  3WA9 B;  5DNN C;  3AFA C;  2IO5 C;  3W96 C;  4QLC A;  3LJA D;  1A7W A;  3MGP C;  3WAA A;  3MGS C;  4DRA A;  1P3G B;  3O62 B;  1M18 B;  5B31 B;  3AZI C;  3REI C;  5B32 G;  4WU8 C;  5E5A D;  3REK C;  1P3O B;  2HIO D;  3AV1 D;  3C1B D;  4J8W C;  3UT9 B;  4JJN C;  3KUY B;  3MGR C;  3REL B;  3KWQ C;  5B33 D;  4YS3 B;  4J8X D;  3B6F D;  1HQ3 C;  5AY8 B;  1P3A D;  1R4V A;  2HUE C;  4WZS B;  3LZ0 D;  5DNM C;  1AOI A;  2NZD C;  1KX4 A;  4Z66 C;  4G91 C;  1EQZ B;  5GT3 A;  3LEL B;  3WTP B;  3AV2 A;  1F66 A;  3AZJ D;  4J8V D;  3W98 D;  2NQB C;  5JRG A;  3AZK A;  5B2I A;  5CPK B;  5JA4 B;  3AZN A;  1M19 C;  1KX3 C;  5AV5 C;  3REH A;  3LZ1 D;  3UTB D;  2CV5 D;  3AZG A;  1S32 A;  5CP6 B;  1TZY C;  5B1M B;  5GT0 A;  4ZUX A;  2RVQ D;  1KU5 A;  1ID3 C;  2F8N B;  3WA9 A;  2YFW B;  4Z2M H;  3X1T B;  3VH5 W;  3MNN D;  3TU4 D;  5B2J D;  5E5A C;  5B40 D;  1P3G A;  3WAA B;  4H9R B;  3O62 A;  3AV1 C;  4Z5T B;  4EO5 B;  3C1B C;  3AZL B;  1M18 A;  3MGQ D;  4LD9 D;  2F8N H;  1KX5 C;  5B33 C;  3AN2 B;  1P3F D;  2PYO B;  4XZQ D;  5AV8 B;  3B6F C;  1P3O A;  3AZF A;  3C1C B;  3UT9 A;  3KUY A;  3REL A;  5B24 C;  3MVD B;  3X1S B;  4YS3 A;  4WU9 B;  1P3B B;  3VH5 T;  4X23 D;  3AYW B;  1M1A D;  5AV9 B;  4J8U D;  5AY8 A;  3W98 C;  5GSU D;  4YM6 B;  1P34 D;  1P3I C;  5DNN D;  3W96 D;  1EQZ A;  3LEL A;  3WTP A;  3WKJ B;  4G92 B;  5CPK A;  2CV5 C;  2ARO B;  3AZI D;  4WU8 D;  4E44 A;  4J8W D;  4KHA B;  5CP6 A;  5BS7 C;  3O62 D;  3KWQ D;  5B31 D;  4KUD B;  4ZBJ B;  4NE3 A;  5B1M A;  5CPJ B;  5B2J C;  5B40 C;  2F8N A;  2NZD D;  5BT1 D;  3KXB B;  3AZH B;  3X1T A;  1AOI C;  3A6N B;  4Z66 D;  4XZQ C;  1KX4 C;  4KGC B;  2NQB D;  3UTA B;  4H9R A;  1F66 C;  4Z2M G;  4Z5T A;  5GT3 C;  3W97 B;  4AWL C;  3AZL A;  1P3L B;  4R8P D;  4E45 A;  1KX3 D;  4X23 C;  3AZK C;  3AN2 A;  2PYO A;  3W99 D;  3X1U D;  3AZN C;  4J8U C;  5AV8 A;  5B32 A;  3WTP D;  3C1C A;  4UUZ A;  2BYM B;  5B0Z B;  3X1S A;  4WU9 A;  1P3B A;  5B1L B;  3AYW A;  1TZY D;  5AV9 A;  3AZG C;  1S32 C;  4H9S A;  3B0C W;  2BYK B;  5BO0 B;  4XUJ B;  4YM6 A;  1ID3 D;  4ZUX C;  4H9N B;  1ZLA B;  3WA9 C;  3B0D B;  1HTA A;  3X1V D;  4WNN B;  3WKJ A;  1P3K B;  3AZF B;  4H9P A;  2ARO A;  3AZM B;  1P3G C;  5AVB A;  3O62 C;  1M18 C;  5CPI A;  1KX5 D;  5B31 C;  3X1T D;  3B0C T;  5AV6 B;  3REI B;  3REK B;  5BT1 C;  4KHA A;  5B24 D;  4JJN B;  1BH9 B;  4KUD A;  3AZL D;  1P3P B;  3KUY C;  5CHL B;  3REL C;  4H9Q B;  4YS3 C;  5CPJ A;  3KXB A;  1P3M B;  5AY8 C;  5DNM B;  3AZH A;  1P3I D;  4R8P C;  3A6N A;  1B67 A;  5AVC B;  3MVD D;  3W99 C; 
#chains in the Genus database with same CATH topology
 3X1S D;  3X1U C;  4WV4 B;  3AZE B;  2FJ7 B;  4KGC A;  3UTA A;  4QLC D;  1EQZ C;  3LEL C;  3W97 A;  5F99 B;  2G5I C;  3WTP C;  1P3L A;  3VH5 A;  5CPK C;  5GXQ B;  2DQN C;  4UPK A;  3B6G A;  2BYM A;  5BNX B;  5B0Z A;  3NQU B;  2CWE A;  3P5J B;  5B1L A;  3KSY A;  5C3I C;  3LJA B;  1WWS A;  5CP6 C;  5B0Y A;  3X1V C;  2BYK A;  5BO0 A;  4XUJ A;  2LY8 A;  5B1M C;  3WTP E;  1F1E A;  4H9N A;  5BNV B;  1AOI D;  1ZLA A;  3AFA A;  4DRB A;  3X1T C;  4WNN A;  3REJ B;  1KX4 D;  4CSR B;  1P3K A;  2JSS A;  5GT3 D;  5B32 B;  3A1K A;  5E5A B;  5CPJ D;  3AZM A;  4UUZ B;  2HIO B;  3AV2 D;  3C1B B;  3WAA C;  2Y2K A;  5JRG D;  3KXB D;  3AZL C;  3AZK D;  5B2I D;  5B33 B;  3AZN D;  3R45 B;  5AV6 A;  4J8X B;  3REI A;  1T3U A;  5G49 B;  3AN2 C;  2PYO C;  3REK A;  1P3A B;  3LZ0 B;  3REH D;  1TAF B;  4JJN A;  1BH9 A;  1U35 B;  1P3P A;  3MVD C;  3AZG D;  4H9Q A;  1S32 D;  3X1S C;  4WU9 C;  1P3B C;  3AYW C;  1B6W A;  4QLC C;  4J8V B;  5AV9 C;  3AZJ B;  1P3M A;  5DNM A;  5GT0 D;  4ZUX D;  4H9P B;  1N1J B;  3NQJ B;  5AVC A;  5AVB B;  4YM6 C;  5CPI B;  3EPH A;  3WA9 D;  3AZE A;  2FJ7 A;  5F99 A;  2Y2J A;  2Y2G A;  3LZ1 B;  3WKJ C;  4G92 C;  3UTB B;  1P3G D;  1M19 A;  5B31 G;  1M18 D;  2ARO C;  5GXQ A;  4M6B A;  5KDM B;  2F2A C;  5BNX A;  4HGA B;  3NQU A;  1H3O B;  1JFI B;  2ZY5 A;  1P3O D;  3AZF D;  3EG5 B;  3UT9 D;  3AZM D;  3LJA A;  3KUY D;  3REL D;  4KUD C;  4YS3 D;  4ZBJ C;  3MNN B;  3TU4 B;  5B2J B;  3AV2 C;  5CPJ C;  5AY8 D;  5BNV A;  4NFT A;  3MGQ B;  4LD9 B;  5JRG C;  3KXB C;  5B2I C;  3AZH C;  1P3F B;  3REJ A;  4CSR A;  1EQZ D;  3LEL D;  5E5A A;  3B6G B;  4KGC C;  2HIO A;  3AV1 A;  3C1B A;  3REH C;  3UTA C;  3VH6 W;  3W97 C;  3B0B A;  1P3M D;  1P3L C;  5B33 A;  4H9O B;  5CPK D;  4X23 B;  3R45 A;  4J8X A;  5AVC D;  5G49 A;  1M1A B;  5B0Y B;  3B6F A;  1P3A A;  3AZE D;  5GSU B;  3LZ0 A;  1TAF A;  1U35 A;  5GT0 C;  1P34 B;  3FDD A;  5B0Z C;  5DNN B;  3AFA B;  2IO5 B;  3W96 B;  1BFM A;  5CP6 D;  1W2E A;  3MGP B;  4J8V A;  3AZJ A;  5B1M D;  3MGS B;  3VH6 T;  1N1J A;  3NQJ A;  4XUJ C;  2XD5 A;  2F8N D;  3AZI B;  3B0D C;  4WU8 B;  3LZ1 A;  2UWX A;  3UTB A;  2CV5 A;  4J8W B;  3WAA D;  1P3K C;  1P3O C;  4Z5T D;  3AZF C;  3MGR B;  3UT9 C;  3AZM C;  3KWQ B;  2Y2O A;  5KDM A;  3AN2 D;  4NE5 A;  4CAY B;  2PYO D;  1H3O A;  1HQ3 B;  5AV6 C;  3REJ D;  1JFI A;  2HUE B;  5FUG B;  5AV8 D;  2NZD B;  5B32 D;  3C1C D;  2VQR A;  5BS7 A;  2JE5 A;  4Z66 B;  4G91 B;  3MNN A;  4WU9 D;  1P3B D;  1P3P C;  3AYW D;  3TU4 A;  5B2J A;  5AV9 D;  1BH8 B;  5B40 A;  2NQB B;  2ZY3 A;  3MGQ A;  4LD9 A;  4R8P B;  1P3M C;  1KX3 B;  4YM6 D;  1U35 D;  1M19 B;  1P3F A;  5AV5 B;  5AVC C;  3W99 B;  4XZQ A;  3X1U B;  3AZE C;  2FJ7 C;  3WKJ D;  5F99 C;  2L5A A;  3IP4 C;  4H9O A;  4X23 A;  2ARO D;  1M1A A;  1TZY B;  5AVB D;  4J8U A;  5CPI D;  5GXQ C;  5GSU A;  1P34 A;  1ID3 B;  1ULY A;  5DNN A;  3W96 A;  4KUD D;  5C3I B;  3MGP A;  3LJA C;  3X1V B;  3MGS A;  3AV1 B;  4Z5T C;  4EO5 C;  3AZI A;  1WWI A;  3AZH D;  1KX5 B;  2YFV B;  3A6N D;  2Y2H A;  3V9R B;  4WU8 A;  3B6F B;  3REJ C;  4KGC D;  4J8W A;  5AV8 C;  3UTA D;  5B32 C;  3C1C C;  3MGR A;  3W97 D;  2HIO C;  5B24 B;  3KWQ A;  1P3L D;  5B31 A;  4CAY A;  1HQ3 A;  4J8X C;  3W98 B;  4H9S C;  5FUG A;  2NZD A;  2Y2N A;  1P3A C;  3B6G D;  1P3I B;  2FFF B;  3LZ0 C;  5B0Z D;  1U35 C;  4Z66 A;  5B1L D;  1BH8 A;  2NQB A;  4QLC B;  2G5H C;  5B0Y D;  3AZJ C;  4J8V C;  4R8P A;  4XUJ D;  2CV5 B;  3EPJ A;  1KX3 A;  2Y2I A;  5AV5 A;  3W99 A;  3X1U A;  5AVB C;  1ZLA D;  5CPI C;  3AFA D;  3MGP D;  1P3K D;  3LZ1 C;  3MGS D;  3UTB C;  5JA4 A;  1TZY A;  2Y2M A;  3KFU G;  5AV6 D;  3VH6 A;  5B40 B;  3REI D;  1ID3 A;  4HGA C;  2RVQ C;  3REK D;  1AOI B;  4JJN D;  3MGR D;  3A6N C;  1P3P D;  4NE6 A;  3X1V A;  4XZQ B;  1KX4 B;  3MNN C;  1F66 B;  5GT3 B;  3TU4 C;  3AV2 B;  4AWL B;  2Y2P A;  1HQ3 D;  5DNM D;  1KX5 A;  5JRG B;  2YFV A;  2YFW A;  3MGQ C;  3AZK B;  5B2I B;  4LD9 C;  3AZN B;  3H0M C;  3V9R A;  4J8U B;  1P3F C;  2FJ7 D;  3EPK A;  5F99 D;  3REH B;  3B6G C;  5B24 A;  5B1L C;  3AZG B;  1S32 B;  1M19 D;  2F8N K;  2RIQ A;  3W98 A;  2Y2L A;  5GXQ D;  5AV5 D;  1M1A C;  1Q9C A;  5B0Y C;  1P3I A;  5GSU C;  5GT0 B;  2F8N G;  4ZUX B;  1Z2C B;  3MVD A;  1P34 C;  1ZLA C;  3WA9 B;  5DNN C;  2JCH A;  2IO5 C;  3W96 C;  4QLC A;  3AFA C;  1A7W A;  3LJA D;  3MGP C;  2ZY4 A;  3WAA A;  3MGS C;  4DRA A;  1P3G B;  3O62 B;  1M18 B;  5B31 B;  3AZI C;  3REI C;  5B32 G;  4WU8 C;  5E5A D;  3REK C;  1P3O B;  2HIO D;  3AV1 D;  3C1B D;  4J8W C;  3UT9 B;  4JJN C;  2ZM5 A;  3KUY B;  3MGR C;  1PZR A;  3REL B;  3KWQ C;  5B33 D;  4YS3 B;  4J8X D;  3B6F D;  1HQ3 C;  5AY8 B;  1P3A D;  1R4V A;  2HUE C;  4WZS B;  3LZ0 D;  5DNM C;  1AOI A;  2NZD C;  1KX4 A;  4Z66 C;  4G91 C;  1EQZ B;  5GT3 A;  3LEL B;  3WTP B;  3AV2 A;  1F66 A;  3AZJ D;  4J8V D;  3W98 D;  2NQB C;  5JRG A;  3AZK A;  5B2I A;  5CPK B;  5JA4 B;  3AZN A;  1M19 C;  1KX3 C;  3H0L C;  5AV5 C;  3REH A;  3LZ1 D;  3UTB D;  2CV5 D;  3AZG A;  1S32 A;  4DQY B;  5CP6 B;  1TZY C;  5B1M B;  5GT0 A;  4ZUX A;  2RVQ D;  1KU5 A;  1ID3 C;  2F8N B;  3WA9 A;  2YFW B;  4Z2M H;  2ZY2 A;  3X1T B;  3VH5 W;  3MNN D;  3TU4 D;  5B2J D;  5E5A C;  5B40 D;  1P3G A;  3WAA B;  4H9R B;  3O62 A;  3AV1 C;  4Z5T B;  4EO5 B;  3C1B C;  3AZL B;  1M18 A;  3MGQ D;  4LD9 D;  2Y2Q A;  2F8N H;  1KX5 C;  5B33 C;  3H0R C;  3AN2 B;  1P3F D;  2PYO B;  4XZQ D;  1F66 D;  5AV8 B;  3B6F C;  1P3O A;  3AZF A;  3C1C B;  3UT9 A;  3KUY A;  2BG1 A;  3REL A;  5B24 C;  3MVD B;  3X1S B;  4YS3 A;  4WU9 B;  1P3B B;  3VH5 T;  4X23 D;  3AYW B;  4WJ3 C;  1M1A D;  5AV9 B;  4J8U D;  5AY8 A;  3W98 C;  5GSU D;  4YM6 B;  1P34 D;  1P3I C;  5DNN D;  3W96 D;  1EQZ A;  3LEL A;  3WTP A;  3WKJ B;  4G92 B;  5CPK A;  2CV5 C;  2ARO B;  3AZI D;  3A1I A;  4WU8 D;  4E44 A;  3AL0 C;  4J8W D;  2DF4 C;  4KHA B;  5CP6 A;  5BS7 C;  3O62 D;  3KWQ D;  5B31 D;  4KUD B;  4ZBJ B;  4NE3 A;  5B1M A;  5CPJ B;  5B2J C;  2J8P A;  5B40 C;  2F8N A;  2NZD D;  5BT1 D;  3KXB B;  3AZH B;  3X1T A;  1AOI C;  3A6N B;  4Z66 D;  4XZQ C;  1KX4 C;  4KGC B;  2NQB D;  3UTA B;  4H9R A;  1F66 C;  4Z2M G;  4Z5T A;  5GT3 C;  3W97 B;  4AWL C;  3AZL A;  1P3L B;  4R8P D;  4E45 A;  1KX3 D;  4X23 C;  3AZK C;  3AN2 A;  2PYO A;  3W99 D;  3X1U D;  3AZN C;  4J8U C;  5AV8 A;  5B32 A;  3WTP D;  3C1C A;  4UUZ A;  2BYM B;  5B0Z B;  3X1S A;  4WU9 A;  1P3B A;  5B1L B;  3AYW A;  1TZY D;  5AV9 A;  3AZG C;  1S32 C;  4H9S A;  3B0C W;  2BYK B;  5BO0 B;  4XUJ B;  4YM6 A;  1ID3 D;  4ZUX C;  2XD1 A;  4H9N B;  1ZLA B;  3WA9 C;  3B0D B;  1HTA A;  3X1V D;  4WNN B;  3WKJ A;  1P3K B;  3AZF B;  4H9P A;  2ARO A;  3AZM B;  1P3G C;  5AVB A;  3O62 C;  1M18 C;  5CPI A;  1KX5 D;  5B31 C;  3X1T D;  3B0C T;  5AV6 B;  3REI B;  3F6T A;  3REK B;  5BT1 C;  4KHA A;  5B24 D;  4JJN B;  1BH9 B;  4KUD A;  3AZL D;  1P3P B;  3KUY C;  5CHL B;  3EPL A;  3REL C;  4H9Q B;  2W8S A;  4YS3 C;  5CPJ A;  3KXB A;  1P3M B;  5AY8 C;  5DNM B;  3AZH A;  1P3I D;  4R8P C;  3A6N A;  1B67 A;  5AVC B;  3MVD D;  3W99 C; 
#chains in the Genus database with same CATH homology
 3X1S D;  3X1U C;  4WV4 B;  3AZE B;  2FJ7 B;  4KGC A;  3UTA A;  4QLC D;  1EQZ C;  3LEL C;  3W97 A;  5F99 B;  2G5I C;  3WTP C;  1P3L A;  3VH5 A;  5CPK C;  5GXQ B;  2DQN C;  4UPK A;  3B6G A;  2BYM A;  5BNX B;  5B0Z A;  3NQU B;  2CWE A;  3P5J B;  5B1L A;  3KSY A;  5C3I C;  3LJA B;  1WWS A;  5CP6 C;  5B0Y A;  3X1V C;  2BYK A;  5BO0 A;  4XUJ A;  2LY8 A;  5B1M C;  3WTP E;  1F1E A;  4H9N A;  5BNV B;  1AOI D;  1ZLA A;  3AFA A;  4DRB A;  3X1T C;  4WNN A;  3REJ B;  1KX4 D;  4CSR B;  1P3K A;  2JSS A;  5GT3 D;  5B32 B;  3A1K A;  5E5A B;  5CPJ D;  3AZM A;  4UUZ B;  2HIO B;  3AV2 D;  3C1B B;  3WAA C;  2Y2K A;  5JRG D;  3KXB D;  3AZL C;  3AZK D;  5B2I D;  5B33 B;  3AZN D;  3R45 B;  5AV6 A;  4J8X B;  3REI A;  1T3U A;  5G49 B;  3AN2 C;  2PYO C;  3REK A;  1P3A B;  3LZ0 B;  3REH D;  1TAF B;  4JJN A;  1BH9 A;  1U35 B;  1P3P A;  3MVD C;  3AZG D;  4H9Q A;  1S32 D;  3X1S C;  4WU9 C;  1P3B C;  3AYW C;  1B6W A;  4QLC C;  4J8V B;  5AV9 C;  3AZJ B;  1P3M A;  5DNM A;  5GT0 D;  4ZUX D;  4H9P B;  1N1J B;  3NQJ B;  5AVC A;  5AVB B;  4YM6 C;  5CPI B;  3EPH A;  3WA9 D;  3AZE A;  2FJ7 A;  5F99 A;  2Y2J A;  2Y2G A;  3LZ1 B;  3WKJ C;  4G92 C;  3UTB B;  1P3G D;  1M19 A;  5B31 G;  1M18 D;  2ARO C;  5GXQ A;  4M6B A;  5KDM B;  2F2A C;  5BNX A;  4HGA B;  3NQU A;  1H3O B;  1JFI B;  2ZY5 A;  1P3O D;  3AZF D;  3EG5 B;  3UT9 D;  3AZM D;  3LJA A;  3KUY D;  3REL D;  4KUD C;  4YS3 D;  4ZBJ C;  3MNN B;  3TU4 B;  5B2J B;  3AV2 C;  5CPJ C;  5AY8 D;  5BNV A;  4NFT A;  3MGQ B;  4LD9 B;  5JRG C;  3KXB C;  5B2I C;  3AZH C;  1P3F B;  3REJ A;  4CSR A;  1EQZ D;  3LEL D;  5E5A A;  3B6G B;  4KGC C;  2HIO A;  3AV1 A;  3C1B A;  3REH C;  3UTA C;  3VH6 W;  3W97 C;  3B0B A;  1P3M D;  1P3L C;  5B33 A;  4H9O B;  5CPK D;  4X23 B;  3R45 A;  4J8X A;  5AVC D;  5G49 A;  1M1A B;  5B0Y B;  3B6F A;  1P3A A;  3AZE D;  5GSU B;  3LZ0 A;  1TAF A;  1U35 A;  5GT0 C;  1P34 B;  3FDD A;  5B0Z C;  5DNN B;  3AFA B;  2IO5 B;  3W96 B;  1BFM A;  5CP6 D;  1W2E A;  3MGP B;  4J8V A;  3AZJ A;  5B1M D;  3MGS B;  3VH6 T;  1N1J A;  3NQJ A;  4XUJ C;  2XD5 A;  2F8N D;  3AZI B;  3B0D C;  4WU8 B;  3LZ1 A;  2UWX A;  3UTB A;  2CV5 A;  4J8W B;  3WAA D;  1P3K C;  1P3O C;  4Z5T D;  3AZF C;  3MGR B;  3UT9 C;  3AZM C;  3KWQ B;  2Y2O A;  5KDM A;  3AN2 D;  4NE5 A;  4CAY B;  2PYO D;  1H3O A;  1HQ3 B;  5AV6 C;  3REJ D;  1JFI A;  2HUE B;  5FUG B;  5AV8 D;  2NZD B;  5B32 D;  3C1C D;  2VQR A;  5BS7 A;  2JE5 A;  4Z66 B;  4G91 B;  3MNN A;  4WU9 D;  1P3B D;  1P3P C;  3AYW D;  3TU4 A;  5B2J A;  5AV9 D;  1BH8 B;  5B40 A;  2NQB B;  2ZY3 A;  3MGQ A;  4LD9 A;  4R8P B;  1P3M C;  1KX3 B;  4YM6 D;  1U35 D;  1M19 B;  1P3F A;  5AV5 B;  5AVC C;  3W99 B;  4XZQ A;  3X1U B;  3AZE C;  2FJ7 C;  3WKJ D;  5F99 C;  2L5A A;  3IP4 C;  4H9O A;  4X23 A;  2ARO D;  1M1A A;  1TZY B;  5AVB D;  4J8U A;  5CPI D;  5GXQ C;  5GSU A;  1P34 A;  1ID3 B;  1ULY A;  5DNN A;  3W96 A;  4KUD D;  5C3I B;  3MGP A;  3LJA C;  3X1V B;  3MGS A;  3AV1 B;  4Z5T C;  4EO5 C;  3AZI A;  1WWI A;  3AZH D;  1KX5 B;  2YFV B;  3A6N D;  2Y2H A;  3V9R B;  4WU8 A;  3B6F B;  3REJ C;  4KGC D;  4J8W A;  5AV8 C;  3UTA D;  5B32 C;  3C1C C;  3MGR A;  3W97 D;  2HIO C;  5B24 B;  3KWQ A;  1P3L D;  5B31 A;  4CAY A;  1HQ3 A;  4J8X C;  3W98 B;  4H9S C;  5FUG A;  2NZD A;  2Y2N A;  1P3A C;  3B6G D;  1P3I B;  2FFF B;  3LZ0 C;  5B0Z D;  1U35 C;  4Z66 A;  5B1L D;  1BH8 A;  2NQB A;  4QLC B;  2G5H C;  5B0Y D;  3AZJ C;  4J8V C;  4R8P A;  4XUJ D;  2CV5 B;  3EPJ A;  1KX3 A;  2Y2I A;  5AV5 A;  3W99 A;  3X1U A;  5AVB C;  1ZLA D;  5CPI C;  3AFA D;  3MGP D;  1P3K D;  3LZ1 C;  3MGS D;  3UTB C;  5JA4 A;  1TZY A;  2Y2M A;  3KFU G;  5AV6 D;  3VH6 A;  5B40 B;  3REI D;  1ID3 A;  4HGA C;  2RVQ C;  3REK D;  1AOI B;  4JJN D;  3MGR D;  3A6N C;  1P3P D;  4NE6 A;  3X1V A;  4XZQ B;  1KX4 B;  3MNN C;  1F66 B;  5GT3 B;  3TU4 C;  3AV2 B;  4AWL B;  2Y2P A;  1HQ3 D;  5DNM D;  1KX5 A;  5JRG B;  2YFV A;  2YFW A;  3MGQ C;  3AZK B;  5B2I B;  4LD9 C;  3AZN B;  3H0M C;  3V9R A;  4J8U B;  1P3F C;  2FJ7 D;  3EPK A;  5F99 D;  3REH B;  3B6G C;  5B24 A;  5B1L C;  3AZG B;  1S32 B;  1M19 D;  2F8N K;  2RIQ A;  3W98 A;  2Y2L A;  5GXQ D;  5AV5 D;  1M1A C;  1Q9C A;  5B0Y C;  1P3I A;  5GSU C;  5GT0 B;  2F8N G;  4ZUX B;  1Z2C B;  3MVD A;  1P34 C;  1ZLA C;  3WA9 B;  5DNN C;  2JCH A;  2IO5 C;  3W96 C;  4QLC A;  3AFA C;  1A7W A;  3LJA D;  3MGP C;  2ZY4 A;  3WAA A;  3MGS C;  4DRA A;  1P3G B;  3O62 B;  1M18 B;  5B31 B;  3AZI C;  3REI C;  5B32 G;  4WU8 C;  5E5A D;  3REK C;  1P3O B;  2HIO D;  3AV1 D;  3C1B D;  4J8W C;  3UT9 B;  4JJN C;  2ZM5 A;  3KUY B;  3MGR C;  1PZR A;  3REL B;  3KWQ C;  5B33 D;  4YS3 B;  4J8X D;  3B6F D;  1HQ3 C;  5AY8 B;  1P3A D;  1R4V A;  2HUE C;  4WZS B;  3LZ0 D;  5DNM C;  1AOI A;  2NZD C;  1KX4 A;  4Z66 C;  4G91 C;  1EQZ B;  5GT3 A;  3LEL B;  3WTP B;  3AV2 A;  1F66 A;  3AZJ D;  4J8V D;  3W98 D;  2NQB C;  5JRG A;  3AZK A;  5B2I A;  5CPK B;  5JA4 B;  3AZN A;  1M19 C;  1KX3 C;  3H0L C;  5AV5 C;  3REH A;  3LZ1 D;  3UTB D;  2CV5 D;  3AZG A;  1S32 A;  4DQY B;  5CP6 B;  1TZY C;  5B1M B;  5GT0 A;  4ZUX A;  2RVQ D;  1KU5 A;  1ID3 C;  2F8N B;  3WA9 A;  2YFW B;  4Z2M H;  2ZY2 A;  3X1T B;  3VH5 W;  3MNN D;  3TU4 D;  5B2J D;  5E5A C;  5B40 D;  1P3G A;  3WAA B;  4H9R B;  3O62 A;  3AV1 C;  4Z5T B;  4EO5 B;  3C1B C;  3AZL B;  1M18 A;  3MGQ D;  4LD9 D;  2Y2Q A;  2F8N H;  1KX5 C;  5B33 C;  3H0R C;  3AN2 B;  1P3F D;  2PYO B;  4XZQ D;  1F66 D;  5AV8 B;  3B6F C;  1P3O A;  3AZF A;  3C1C B;  3UT9 A;  3KUY A;  2BG1 A;  3REL A;  5B24 C;  3MVD B;  3X1S B;  4YS3 A;  4WU9 B;  1P3B B;  3VH5 T;  4X23 D;  3AYW B;  4WJ3 C;  1M1A D;  5AV9 B;  4J8U D;  5AY8 A;  3W98 C;  5GSU D;  4YM6 B;  1P34 D;  1P3I C;  5DNN D;  3W96 D;  1EQZ A;  3LEL A;  3WTP A;  3WKJ B;  4G92 B;  5CPK A;  2CV5 C;  2ARO B;  3AZI D;  3A1I A;  4WU8 D;  4E44 A;  3AL0 C;  4J8W D;  2DF4 C;  4KHA B;  5CP6 A;  5BS7 C;  3O62 D;  3KWQ D;  5B31 D;  4KUD B;  4ZBJ B;  4NE3 A;  5B1M A;  5CPJ B;  5B2J C;  2J8P A;  5B40 C;  2F8N A;  2NZD D;  5BT1 D;  3KXB B;  3AZH B;  3X1T A;  1AOI C;  3A6N B;  4Z66 D;  4XZQ C;  1KX4 C;  4KGC B;  2NQB D;  3UTA B;  4H9R A;  1F66 C;  4Z2M G;  4Z5T A;  5GT3 C;  3W97 B;  4AWL C;  3AZL A;  1P3L B;  4R8P D;  4E45 A;  1KX3 D;  4X23 C;  3AZK C;  3AN2 A;  2PYO A;  3W99 D;  3X1U D;  3AZN C;  4J8U C;  5AV8 A;  5B32 A;  3WTP D;  3C1C A;  4UUZ A;  2BYM B;  5B0Z B;  3X1S A;  4WU9 A;  1P3B A;  5B1L B;  3AYW A;  1TZY D;  5AV9 A;  3AZG C;  1S32 C;  4H9S A;  3B0C W;  2BYK B;  5BO0 B;  4XUJ B;  4YM6 A;  1ID3 D;  4ZUX C;  2XD1 A;  4H9N B;  1ZLA B;  3WA9 C;  3B0D B;  1HTA A;  3X1V D;  4WNN B;  3WKJ A;  1P3K B;  3AZF B;  4H9P A;  2ARO A;  3AZM B;  1P3G C;  5AVB A;  3O62 C;  1M18 C;  5CPI A;  1KX5 D;  5B31 C;  3X1T D;  3B0C T;  5AV6 B;  3REI B;  3F6T A;  3REK B;  5BT1 C;  4KHA A;  5B24 D;  4JJN B;  1BH9 B;  4KUD A;  3AZL D;  1P3P B;  3KUY C;  5CHL B;  3EPL A;  3REL C;  4H9Q B;  2W8S A;  4YS3 C;  5CPJ A;  3KXB A;  1P3M B;  5AY8 C;  5DNM B;  3AZH A;  1P3I D;  4R8P C;  3A6N A;  1B67 A;  5AVC B;  3MVD D;  3W99 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...