4UUZA

Mcm2-histone complex
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
78
structure length
78
Chain Sequence
STELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Insight Into How the Human Helicase Subunit Mcm2 May Act as a Histone Chaperone Together with Asf1 at the Replication Fork.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Dna binding protein
molecule keywords HISTONE H3
total genus 24
structure length 78
sequence length 78
ec nomenclature
pdb deposition date 2014-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4uuzA00
5B2JD 3MGPD 1P3AC 3LJAA 5DNNB 5F99B 1KU5A 3B0CT 5B40A 3R45B 5BNXB 3AZFD 5B33D 5BNVA 3C1BB 5B32A 3MGQB 3LJAB 4J8VD 3AN2C 1P3GB 3REHD 1H3OA 1P3BD 5B2IC 4WU8D 1EQZC 5B1MB 4J8XA 1ID3C 3AZNA 1EQZB 1ZLAC 3W96B 1JFIB 2YFVA 5AV8B 3RELA 3W96C 5B2JC 1AOIA 3UTAB 1B6WA 4YM6D 3MNNB 1P3LB 5B33B 3AZHA 1M18D 2F8NA 5B24B 4XZQA 2FJ7A 5AV6D 5DNND 5AV9A 4R8PB 5KDMA 4WU9C 5JRGD 5AV5B 3WAAB 4QLCB 5B31B 3LELB 3AZKD 1P3PB 3AYWC 3AZID 2F8NG 4E44A 5B32C 1P3MC 3WAAA 2AROD 2HIOB 4H9OA 5AVBD 1TZYD 5GXQD 5GT0B 5AV5D 3LZ0B 1P3OD 4G91B 2BYKA 5JA4A 3REKD 3B0CW 5AV6C 4KGCA 1AOIB 3W97A 5AVCB 5CP6A 3MGRA 3A6NA 3X1UA 1F66D 3AN2D 4H9SC 3RELC 1P34C 3LZ0D 3LELD 3AZKB 5B32B 4J8UC 1ID3D 3AYWB 3AV1C 5GSUB 3REKB 3KUYD 3AZLA 5B1LC 1M19B 3B0DC 5DNMC 4H9RB 3MGSC 2HIOD 4UUZB 4JJNA 4WU9B 1P3KB 3VH5W 5B31G 4KGCC 5B2JB 3REIA 3UTBA 3B6FA 3C1CA 4YS3B 1S32A 4CAYA 1BH9A 5AY8B 3AV2C 5AV8D 3X1SC 3AZEA 3AZMB 4H9PB 4CAYB 1P3OC 4KUDC 4YS3A 5BS7C 5B1LA 1P3FD 3REHB 3MGRD 4E45A 4Z66A 5B1MD 5GT3C 2NQBC 4WU8B 1P3MB 1KX5C 5G49B 3NQJB 2YFVB 5AV8A 3C1BD 4XUJB 4XZQC 5B32G 5E5AD 1JFIA 3KXBA 3AZNB 1P3GA 4ZUXC 1EQZD 3R45A 5BNXA 5B0YA 3X1SA 5BNVB 1M18B 3AZGC 1P34D 3VH5T 5BT1C 5AV6A 5CPJA 1HQ3C 5E5AB 5B2IB 2BYMA 2FJ7D 4KGCB 3AZLD 3AZHD 5AY8D 2CV5D 1P3AD 2NZDD 3LZ0A 2CV5A 4J8WC 2PYOB 4H9QA 3AYWD 4KUDA 4J8XD 3X1TB 3C1CD 5F99C 1P3BA 5GT0A 1P3FB 5B0ZA 5B1LB 1M19C 3W98C 4H9PA 4KGCD 4LD9B 5CPIA 3W99B 5CHLB 4JJNC 4J8UB 4EO5C 1P3GD 3LJAD 4ZUXA 5DNMA 3KXBD 1P3IB 2NZDC 1P3BB 1P3IC 1M1AC 3B6FC 3NQUB 1ULYA 4J8XC 1ID3A 3AFAC 5BT1D 3LZ0C 3VH6T 4M6BA 3AN2A 1ZLAD 1HQ3A 4Z5TB 5AV9D 3KSYA 3X1UD 1U35B 1F66A 4JJNB 5B1LD 3C1CC 5B0ZC 4XUJC 5BS7A 4YS3D 1M18A 3AV2A 3AZED 1TZYB 5GXQB 4QLCC 5GT3A 4YM6A 3W99D 5CPJB 2NQBA 4J8WB 2PYOC 3RELD 3AZHC 5AVBA 3AZIB 3B6FD 4Z2MH 3WA9A 5B24C 5FUGA 3AZFC 1P3OB 5GT0D 5G49A 4WV4B 5JRGA 1HQ3B 1ID3B 1ZLAB 2BYKB 3MVDD 2HUEB 5B1MC 5GT3D 2F8NK 2NQBD 1WWSA 4Z66B 3AZEB 3UT9A 4ZUXB 3AZIC 1BH9B 1B67A 5GSUD 3MGSB 3MGQD 4J8VB 1TAFA 3KWQB 3UT9B 3TU4D 3REHC 3O62B 4NE6A 5B0ZB 5JRGB 3WA9D 5DNMD 5B40D 3AZFA 3RELB 3AZKC 4J8XB 2JSSA 4DRBA 1P34B 4UUZA 5AV6B 2RVQD 3W98A 1A7WA 5AY8C 3AZLB 5AVBB 5CPIC 4G91C 4Z66D 4LD9D 3WKJD 4KHAA 5B0ZD 3AV1D 3WA9B 1P3KD 3MGQA 1HQ3D 4YM6B 3V9RB 3REJA 1KX3C 3AYWA 3W99C 4NFTA 3W98B 3UT9D 4KHAB 3LZ1B 2NZDA 1F66C 3O62C 1F1EA 3KXBB 2AROB 4Z5TA 5CP6C 4R8PD 4XUJA 2AROC 5CP6B 4ZUXD 3MVDA 3AV1B 1P34A 3X1TC 3KWQD 4CSRA 4Z66C 4X23B 5CPID 3A6NC 3REHA 1BFMA 3WA9C 5AVCC 2HIOA 4H9OB 1P3MD 3MGSA 2F8NH 5E5AC 4KUDD 1Q9CA 4ZBJB 3W99A 1P3AA 3MGPA 5AY8A 5KDMB 4CSRB 4X23A 4NE3A 5F99D 3VH6W 3X1VA 5CPJD 3AZNC 3B6GC 1P3FA 4XZQB 3W97D 3UT9C 3W96A 3WTPD 2IO5B 2PYOD 3X1SD 2IO5C 5FUGB 4R8PC 1P3OA 5B2IA 1EQZA 3LZ1A 3KWQC 4WU8C 1M19A 3VH6A 4H9RA 1H3OB 3REJB 5E5AA 3WAAD 4J8WA 3MNNC 1P3LC 3AZEC 4ZBJC 3AZIA 3C1BA 3AFAD 3X1SB 3AV2B 3V9RA 1BH8A 3AZKA 3X1UB 1U35D 3UTAC 5AVCA 3MGRB 5AV9C 4WNNB 5C3IC 3WTPC 3AN2B 1P3GC 3VH5A 2CWEA 3KUYC 4NE5A 3AZFB 5CPKD 1M1AD 3NQUA 3MGQC 5JA4B 3NQJA 1P3IA 3MGPB 3AZND 3TU4C 5CPJC 1TZYC 5GXQC 3B6GA 1P3FC 5GSUC 5DNMB 3AZJC 4H9NB 1P3AB 4QLCA 4WU9D 4J8VA 3REKC 1KX5D 5CPKB 1KX4D 3B6GB 3W97C 5B0YD 1KX3B 3C1CB 4H9NA 5AV5A 3LZ1D 5B24A 4Z5TC 4YM6C 3MNNA 1P3LA 2CV5B 3AZGB 5B2JA 1AOIC 4WU9A 2CV5C 3KUYA 3X1TA 4H9QB 5BO0A 3MVDB 5B1MA 4X23C 5CPKC 5CP6D 1M1AA 5B40B 3X1VC 2F8ND 4J8VC 4HGAB 3REKA 3LELC 5B24D 5B0YB 1KX3D 3MGPC 5B31C 1P3PC 3TU4B 1TZYA 5GT3B 5AV5C 5GXQA 2NQBB 1S32D 1U35A 1F66B 3O62D 3AZJA 3REID 3B0BA 3UTBD 1KX5A 2HUEC 1KX4C 3AZGD 4QLCD 3AZMC 5B33C 5BO0B 5B32D 5AV8C 3AZJD 3KUYB 4JJND 5AVBC 3X1UC 3LJAC 4H9SA 1N1JA 4G92B 5CPKA 3WTPA 3C1BC 2YFWB 4LD9A 3REJC 1N1JB 5JRGC 1AOID 3LELA 3W98D 5DNNC 1S32B 3AZHB 3B0DB 3A6ND 1S32C 3WKJB 4J8WD 1HTAA 5B31D 3MNND 1P3LD 5B33A 1P3PD 1KX5B 4KUDB 4AWLB 3AZMD 3MGSD 1M19D 4WNNA 3REIC 3UTBC 1U35C 3TU4A 2FJ7C 2AROA 4G92C 1KX4A 5GSUA 2BYMB 2NZDB 3UTAD 1BH8B 4WZSB 1M1AB 3B6GD 5F99A 1P3BC 5GT0C 4XUJD 4YS3C 1KX4B 1P3ID 2RVQC 2HIOC 5DNNA 3A6NB 1P3KC 3REJD 4XZQD 3W97B 4LD9C 4HGAC 3WKJA 5B40C 4J8UD 5B0YC 3X1VB 1P3MA 3WAAC 3KXBC 3AZGA 5AVCD 3LZ1C 3KWQA 4WU8A 2LY8A 3O62A 4DRAA 3AFAA 1R4VA 4Z2MG 1TAFB 1KX3A 3WTPB 3MVDC 4J8UA 3AZMA 4R8PA 4Z5TD 2YFWA 5AV9B 3AFAB 5B31A 3MGRC 3AV2D 3AZLC 1P3PA 3B6FB 5B2ID 3WTPE 5CPIB 2FJ7B 5C3IB 1M18C 1ZLAA 3REIB 3UTBB 2PYOA 4AWLC 3W96D 4EO5B 1P3KA 3AV1A 2F8NB 3X1VD 2L5AA 3WKJC 1WWIA 3AZJB 3UTAA 3X1TD 4X23D
chains in the Genus database with same CATH superfamily
5B2JD 3MGPD 1P3AC 3A1IA 3LJAA 5DNNB 5F99B 1KU5A 3B0CT 5B40A 3R45B 5BNXB 3AZFD 5B33D 5BNVA 3C1BB 5B32A 3MGQB 3LJAB 4J8VD 3AN2C 1P3GB 3REHD 1H3OA 2G5HC 1P3BD 5B2IC 4WU8D 1EQZC 5B1MB 4J8XA 1ID3C 3AZNA 1EQZB 1ZLAC 3W96B 1JFIB 2YFVA 5AV8B 3RELA 3W96C 5B2JC 1AOIA 3UTAB 1B6WA 4YM6D 3MNNB 1P3LB 5B33B 3AZHA 1M18D 2F8NA 5B24B 4XZQA 2FJ7A 5AV6D 5DNND 2ZY2A 5AV9A 4R8PB 5KDMA 4WU9C 5JRGD 5AV5B 3WAAB 4QLCB 5B31B 3LELB 3AZKD 1P3PB 2XD1A 3AYWC 3AZID 2F8NG 4E44A 5B32C 1P3MC 3WAAA 2FFFB 2AROD 2HIOB 4H9OA 5AVBD 1TZYD 5GXQD 5GT0B 5AV5D 3LZ0B 1P3OD 4G91B 2BYKA 5JA4A 3REKD 2JE5A 3B0CW 5AV6C 4KGCA 1AOIB 3W97A 5AVCB 5CP6A 3MGRA 3A6NA 3X1UA 1F66D 3AN2D 4H9SC 3RELC 2Y2HA 1P34C 3LZ0D 3LELD 3AZKB 5B32B 4J8UC 1ID3D 3AYWB 3AV1C 5GSUB 3REKB 3KUYD 3AZLA 5B1LC 1M19B 3B0DC 5DNMC 4H9RB 3MGSC 2HIOD 4UUZB 3EPLA 4JJNA 4WU9B 1P3KB 3VH5W 5B31G 4KGCC 5B2JB 3REIA 3UTBA 3B6FA 3C1CA 4YS3B 1S32A 4CAYA 1BH9A 5AY8B 3AV2C 5AV8D 3X1SC 3AZEA 2Y2IA 3AZMB 4H9PB 4CAYB 1P3OC 4KUDC 4YS3A 5BS7C 2ZM5A 5B1LA 1P3FD 3REHB 3MGRD 4E45A 4Z66A 5B1MD 5GT3C 2NQBC 4WU8B 1P3MB 1KX5C 3H0LC 2Y2PA 5G49B 3NQJB 2YFVB 5AV8A 3C1BD 4XUJB 4XZQC 3P5JB 5B32G 5E5AD 1JFIA 3KXBA 3AZNB 1P3GA 4ZUXC 1EQZD 3R45A 5BNXA 5B0YA 3FDDA 3X1SA 5BNVB 1M18B 3AZGC 1P34D 3VH5T 5BT1C 5AV6A 5CPJA 1HQ3C 3H0MC 5E5AB 5B2IB 2BYMA 2FJ7D 4KGCB 3AZLD 3AZHD 5AY8D 2CV5D 1P3AD 2NZDD 3LZ0A 2CV5A 4J8WC 2PYOB 2W8SA 4H9QA 3AYWD 4KUDA 4J8XD 2J8PA 3X1TB 3C1CD 5F99C 1P3BA 5GT0A 1P3FB 5B0ZA 5B1LB 1M19C 3W98C 4H9PA 4KGCD 4LD9B 5CPIA 3W99B 5CHLB 4JJNC 4J8UB 4EO5C 1P3GD 3LJAD 4ZUXA 5DNMA 3KXBD 1P3IB 2NZDC 1P3BB 1P3IC 2F2AC 1M1AC 3B6FC 3NQUB 1ULYA 4J8XC 1ID3A 3AFAC 5BT1D 3LZ0C 3VH6T 4M6BA 3AN2A 1ZLAD 1HQ3A 4Z5TB 5AV9D 3KSYA 3X1UD 1U35B 1F66A 4JJNB 5B1LD 3C1CC 5B0ZC 4XUJC 5BS7A 4YS3D 3A1KA 1M18A 4UPKA 3AV2A 3AZED 1TZYB 5GXQB 4QLCC 5GT3A 4YM6A 3W99D 5CPJB 2NQBA 4J8WB 2PYOC 3RELD 3AZHC 5AVBA 3AZIB 3B6FD 4Z2MH 3WA9A 5B24C 5FUGA 3AZFC 1P3OB 5GT0D 5G49A 4WV4B 5JRGA 1HQ3B 1ID3B 1ZLAB 2BYKB 3EPKA 3MVDD 2HUEB 5B1MC 5GT3D 2F8NK 2NQBD 2DF4C 1WWSA 4Z66B 3AZEB 3UT9A 4ZUXB 3AZIC 1BH9B 1B67A 5GSUD 3MGSB 3MGQD 4J8VB 1TAFA 2UWXA 3KWQB 3UT9B 3TU4D 3REHC 3O62B 4NE6A 5B0ZB 5JRGB 3WA9D 5DNMD 5B40D 3AZFA 3RELB 3AZKC 2Y2OA 4J8XB 2JSSA 4DRBA 1P34B 2ZY4A 4UUZA 5AV6B 2RVQD 3W98A 1A7WA 5AY8C 3AZLB 5AVBB 5CPIC 4G91C 4Z66D 4LD9D 3WKJD 4KHAA 5B0ZD 3AV1D 3WA9B 1P3KD 3MGQA 1HQ3D 4YM6B 3V9RB 3REJA 1KX3C 3AYWA 3W99C 4NFTA 3W98B 3UT9D 4KHAB 3LZ1B 2NZDA 1F66C 3O62C 1F1EA 3KXBB 3EPHA 2AROB 4Z5TA 5CP6C 4R8PD 4XUJA 2AROC 5CP6B 4ZUXD 3MVDA 3AV1B 3EPJA 1P34A 3X1TC 2Y2KA 3KWQD 4CSRA 4Z66C 4X23B 1W2EA 3A6NC 3REHA 5CPID 1BFMA 3WA9C 5AVCC 2HIOA 4H9OB 3AZJB 1P3MD 3MGSA 2F8NH 5E5AC 3EG5B 4KUDD 1Q9CA 4WJ3C 4ZBJB 3W99A 1P3AA 3MGPA 5AY8A 5KDMB 4CSRB 4X23A 3KFUG 4NE3A 5F99D 3VH6W 3X1VA 5CPJD 3AZNC 3B6GC 1P3FA 4XZQB 3W97D 3UT9C 3W96A 3WTPD 2IO5B 2PYOD 3X1SD 2IO5C 5FUGB 4R8PC 1P3OA 5B2IA 2G5IC 3LZ1A 3KWQC 4WU8C 1EQZA 1M19A 3VH6A 4H9RA 1H3OB 3REJB 5E5AA 3WAAD 4J8WA 3MNNC 1P3LC 3AZEC 4ZBJC 3AZIA 3AL0C 3C1BA 3AFAD 3X1SB 3AV2B 3V9RA 1BH8A 3AZKA 3X1UB 1U35D 3UTAC 5AVCA 3MGRB 5AV9C 4WNNB 2Y2GA 5C3IC 3WTPC 3AN2B 1P3GC 3VH5A 2CWEA 2ZY5A 3KUYC 4NE5A 3AZFB 5CPKD 1M1AD 2XD5A 3NQUA 3MGQC 5JA4B 3NQJA 1P3IA 3MGPB 3AZND 3TU4C 5CPJC 1TZYC 5GXQC 3B6GA 1P3FC 2JCHA 5GSUC 5DNMB 3AZJC 4H9NB 1P3AB 4QLCA 4WU9D 4J8VA 3REKC 1KX5D 5CPKB 1KX4D 2ZY3A 3B6GB 3W97C 2Y2LA 5B0YD 1KX3B 3C1CB 4H9NA 5AV5A 3LZ1D 5B24A 4Z5TC 4YM6C 3MNNA 1P3LA 3IP4C 2CV5B 3AZGB 5B2JA 1AOIC 4WU9A 2CV5C 3KUYA 3X1TA 4H9QB 5BO0A 3MVDB 5B1MA 4X23C 5CPKC 5CP6D 1M1AA 5B40B 3X1VC 2F8ND 4J8VC 4HGAB 3REKA 3LELC 5B24D 5B0YB 1KX3D 3MGPC 5B31C 1P3PC 3TU4B 1TZYA 5GT3B 5AV5C 5GXQA 2NQBB 1S32D 1U35A 1F66B 1T3UA 3O62D 3AZJA 3REID 3B0BA 3UTBD 1KX5A 2HUEC 1KX4C 2VQRA 4QLCD 3AZGD 3AZMC 5B33C 5BO0B 5B32D 5AV8C 3AZJD 3KUYB 4JJND 3F6TA 5AVBC 3X1UC 3LJAC 4H9SA 1N1JA 4G92B 5CPKA 4DQYB 2Y2JA 3WTPA 2Y2QA 3C1BC 2YFWB 4LD9A 3REJC 1N1JB 5JRGC 1AOID 3LELA 3W98D 3H0RC 5DNNC 1S32B 3AZHB 3B0DB 3A6ND 1S32C 3WKJB 4J8WD 1HTAA 5B31D 3MNND 1P3LD 5B33A 1P3PD 1KX5B 4KUDB 4AWLB 3AZMD 3MGSD 1M19D 4WNNA 3REIC 3UTBC 1U35C 3TU4A 2BG1A 2FJ7C 2AROA 2DQNC 4G92C 1KX4A 2Y2NA 5GSUA 2BYMB 2NZDB 3UTAD 1BH8B 4WZSB 1M1AB 3B6GD 5F99A 1P3BC 5GT0C 4XUJD 4YS3C 1KX4B 1P3ID 2RVQC 2HIOC 5DNNA 1PZRA 3A6NB 1P3KC 3REJD 4XZQD 3W97B 4LD9C 4HGAC 3WKJA 5B40C 4J8UD 5B0YC 3X1VB 1P3MA 2RIQA 3WAAC 3KXBC 3AZGA 5AVCD 3LZ1C 3KWQA 4WU8A 2LY8A 3O62A 4DRAA 3AFAA 1R4VA 4Z2MG 1TAFB 1KX3A 3WTPB 3MVDC 4J8UA 3AZMA 5AV9B 4Z5TD 2YFWA 4R8PA 3AFAB 5B31A 3MGRC 3AV2D 3AZLC 1P3PA 3B6FB 5B2ID 3WTPE 5CPIB 2Y2MA 5C3IB 2FJ7B 1M18C 1ZLAA 3REIB 3UTBB 2PYOA 4AWLC 3W96D 4EO5B 1P3KA 3AV1A 2F8NB 3X1VD 2L5AA 3WKJC 1WWIA 1Z2CB 3UTAA 3X1TD 4X23D
chains in the Genus database with same CATH topology
5B2JD 3MGPD 1P3AC 3A1IA 3LJAA 5DNNB 5F99B 1KU5A 3B0CT 5B40A 3R45B 5BNXB 3AZFD 5B33D 5BNVA 3C1BB 5B32A 3MGQB 3LJAB 4J8VD 3AN2C 1P3GB 3REHD 1H3OA 2G5HC 1P3BD 5B2IC 4WU8D 1EQZC 5B1MB 4J8XA 1ID3C 3AZNA 1EQZB 1ZLAC 3W96B 1JFIB 2YFVA 5AV8B 3RELA 3W96C 5B2JC 1AOIA 3UTAB 1B6WA 4YM6D 3MNNB 1P3LB 5B33B 3AZHA 1M18D 2F8NA 5B24B 4XZQA 2FJ7A 5AV6D 5DNND 2ZY2A 5AV9A 4R8PB 5KDMA 4WU9C 5JRGD 5AV5B 3WAAB 4QLCB 5B31B 3LELB 3AZKD 1P3PB 2XD1A 3AYWC 3AZID 2F8NG 4E44A 5B32C 1P3MC 3WAAA 2FFFB 2AROD 2HIOB 4H9OA 5AVBD 1TZYD 5GXQD 5GT0B 5AV5D 3LZ0B 1P3OD 4G91B 2BYKA 5JA4A 3REKD 2JE5A 3B0CW 5AV6C 4KGCA 1AOIB 3W97A 5AVCB 5CP6A 3MGRA 3A6NA 3X1UA 1F66D 3AN2D 4H9SC 3RELC 2Y2HA 1P34C 3LZ0D 3LELD 3AZKB 5B32B 4J8UC 1ID3D 3AYWB 3AV1C 5GSUB 3REKB 3KUYD 3AZLA 5B1LC 1M19B 3B0DC 5DNMC 4H9RB 3MGSC 2HIOD 4UUZB 3EPLA 4JJNA 4WU9B 1P3KB 3VH5W 5B31G 4KGCC 5B2JB 3REIA 3UTBA 3B6FA 3C1CA 4YS3B 1S32A 4CAYA 1BH9A 5AY8B 3AV2C 5AV8D 3X1SC 3AZEA 2Y2IA 3AZMB 4H9PB 4CAYB 1P3OC 4KUDC 4YS3A 5BS7C 2ZM5A 5B1LA 1P3FD 3REHB 3MGRD 4E45A 4Z66A 5B1MD 5GT3C 2NQBC 4WU8B 1P3MB 1KX5C 3H0LC 2Y2PA 5G49B 3NQJB 2YFVB 5AV8A 3C1BD 4XUJB 4XZQC 3P5JB 5B32G 5E5AD 1JFIA 3KXBA 3AZNB 1P3GA 4ZUXC 1EQZD 3R45A 5BNXA 5B0YA 3FDDA 3X1SA 5BNVB 1M18B 3AZGC 1P34D 3VH5T 5BT1C 5AV6A 5CPJA 1HQ3C 3H0MC 5E5AB 5B2IB 2BYMA 2FJ7D 4KGCB 3AZLD 3AZHD 5AY8D 2CV5D 1P3AD 2NZDD 3LZ0A 2CV5A 4J8WC 2PYOB 2W8SA 4H9QA 3AYWD 4KUDA 4J8XD 2J8PA 3X1TB 3C1CD 5F99C 1P3BA 5GT0A 1P3FB 5B0ZA 5B1LB 1M19C 3W98C 4H9PA 4KGCD 4LD9B 5CPIA 3W99B 5CHLB 4JJNC 4J8UB 4EO5C 1P3GD 3LJAD 4ZUXA 5DNMA 3KXBD 1P3IB 2NZDC 1P3BB 1P3IC 2F2AC 1M1AC 3B6FC 3NQUB 1ULYA 4J8XC 1ID3A 3AFAC 5BT1D 3LZ0C 3VH6T 4M6BA 3AN2A 1ZLAD 1HQ3A 4Z5TB 5AV9D 3KSYA 3X1UD 1U35B 1F66A 4JJNB 5B1LD 3C1CC 5B0ZC 4XUJC 5BS7A 4YS3D 3A1KA 1M18A 4UPKA 3AV2A 3AZED 1TZYB 5GXQB 4QLCC 5GT3A 4YM6A 3W99D 5CPJB 2NQBA 4J8WB 2PYOC 3RELD 3AZHC 5AVBA 3AZIB 3B6FD 4Z2MH 3WA9A 5B24C 5FUGA 3AZFC 1P3OB 5GT0D 5G49A 4WV4B 5JRGA 1HQ3B 1ID3B 1ZLAB 2BYKB 3EPKA 3MVDD 2HUEB 5B1MC 5GT3D 2F8NK 2NQBD 2DF4C 1WWSA 4Z66B 3AZEB 3UT9A 4ZUXB 3AZIC 1BH9B 1B67A 5GSUD 3MGSB 3MGQD 4J8VB 1TAFA 2UWXA 3KWQB 3UT9B 3TU4D 3REHC 3O62B 4NE6A 5B0ZB 5JRGB 3WA9D 5DNMD 5B40D 3AZFA 3RELB 3AZKC 2Y2OA 4J8XB 2JSSA 4DRBA 1P34B 2ZY4A 4UUZA 5AV6B 2RVQD 3W98A 1A7WA 5AY8C 3AZLB 5AVBB 5CPIC 4G91C 4Z66D 4LD9D 3WKJD 4KHAA 5B0ZD 3AV1D 3WA9B 1P3KD 3MGQA 1HQ3D 4YM6B 3V9RB 3REJA 1KX3C 3AYWA 3W99C 4NFTA 3W98B 3UT9D 4KHAB 3LZ1B 2NZDA 1F66C 3O62C 1F1EA 3KXBB 3EPHA 2AROB 4Z5TA 5CP6C 4R8PD 4XUJA 2AROC 5CP6B 4ZUXD 3MVDA 3AV1B 3EPJA 1P34A 3X1TC 2Y2KA 3KWQD 4CSRA 4Z66C 4X23B 1W2EA 3A6NC 3REHA 5CPID 1BFMA 3WA9C 5AVCC 2HIOA 4H9OB 3AZJB 1P3MD 3MGSA 2F8NH 5E5AC 3EG5B 4KUDD 1Q9CA 4WJ3C 4ZBJB 3W99A 1P3AA 3MGPA 5AY8A 5KDMB 4CSRB 4X23A 3KFUG 4NE3A 5F99D 3VH6W 3X1VA 5CPJD 3AZNC 3B6GC 1P3FA 4XZQB 3W97D 3UT9C 3W96A 3WTPD 2IO5B 2PYOD 3X1SD 2IO5C 5FUGB 4R8PC 1P3OA 5B2IA 2G5IC 3LZ1A 3KWQC 4WU8C 1EQZA 1M19A 3VH6A 4H9RA 1H3OB 3REJB 5E5AA 3WAAD 4J8WA 3MNNC 1P3LC 3AZEC 4ZBJC 3AZIA 3AL0C 3C1BA 3AFAD 3X1SB 3AV2B 3V9RA 1BH8A 3AZKA 3X1UB 1U35D 3UTAC 5AVCA 3MGRB 5AV9C 4WNNB 2Y2GA 5C3IC 3WTPC 3AN2B 1P3GC 3VH5A 2CWEA 2ZY5A 3KUYC 4NE5A 3AZFB 5CPKD 1M1AD 2XD5A 3NQUA 3MGQC 5JA4B 3NQJA 1P3IA 3MGPB 3AZND 3TU4C 5CPJC 1TZYC 5GXQC 3B6GA 1P3FC 2JCHA 5GSUC 5DNMB 3AZJC 4H9NB 1P3AB 4QLCA 4WU9D 4J8VA 3REKC 1KX5D 5CPKB 1KX4D 2ZY3A 3B6GB 3W97C 2Y2LA 5B0YD 1KX3B 3C1CB 4H9NA 5AV5A 3LZ1D 5B24A 4Z5TC 4YM6C 3MNNA 1P3LA 3IP4C 2CV5B 3AZGB 5B2JA 1AOIC 4WU9A 2CV5C 3KUYA 3X1TA 4H9QB 5BO0A 3MVDB 5B1MA 4X23C 5CPKC 5CP6D 1M1AA 5B40B 3X1VC 2F8ND 4J8VC 4HGAB 3REKA 3LELC 5B24D 5B0YB 1KX3D 3MGPC 5B31C 1P3PC 3TU4B 1TZYA 5GT3B 5AV5C 5GXQA 2NQBB 1S32D 1U35A 1F66B 1T3UA 3O62D 3AZJA 3REID 3B0BA 3UTBD 1KX5A 2HUEC 1KX4C 2VQRA 4QLCD 3AZGD 3AZMC 5B33C 5BO0B 5B32D 5AV8C 3AZJD 3KUYB 4JJND 3F6TA 5AVBC 3X1UC 3LJAC 4H9SA 1N1JA 4G92B 5CPKA 4DQYB 2Y2JA 3WTPA 2Y2QA 3C1BC 2YFWB 4LD9A 3REJC 1N1JB 5JRGC 1AOID 3LELA 3W98D 3H0RC 5DNNC 1S32B 3AZHB 3B0DB 3A6ND 1S32C 3WKJB 4J8WD 1HTAA 5B31D 3MNND 1P3LD 5B33A 1P3PD 1KX5B 4KUDB 4AWLB 3AZMD 3MGSD 1M19D 4WNNA 3REIC 3UTBC 1U35C 3TU4A 2BG1A 2FJ7C 2AROA 2DQNC 4G92C 1KX4A 2Y2NA 5GSUA 2BYMB 2NZDB 3UTAD 1BH8B 4WZSB 1M1AB 3B6GD 5F99A 1P3BC 5GT0C 4XUJD 4YS3C 1KX4B 1P3ID 2RVQC 2HIOC 5DNNA 1PZRA 3A6NB 1P3KC 3REJD 4XZQD 3W97B 4LD9C 4HGAC 3WKJA 5B40C 4J8UD 5B0YC 3X1VB 1P3MA 2RIQA 3WAAC 3KXBC 3AZGA 5AVCD 3LZ1C 3KWQA 4WU8A 2LY8A 3O62A 4DRAA 3AFAA 1R4VA 4Z2MG 1TAFB 1KX3A 3WTPB 3MVDC 4J8UA 3AZMA 5AV9B 4Z5TD 2YFWA 4R8PA 3AFAB 5B31A 3MGRC 3AV2D 3AZLC 1P3PA 3B6FB 5B2ID 3WTPE 5CPIB 2Y2MA 5C3IB 2FJ7B 1M18C 1ZLAA 3REIB 3UTBB 2PYOA 4AWLC 3W96D 4EO5B 1P3KA 3AV1A 2F8NB 3X1VD 2L5AA 3WKJC 1WWIA 1Z2CB 3UTAA 3X1TD 4X23D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5B2J D;  3MGP D;  1P3A C;  3LJA A;  5DNN B;  5F99 B;  1KU5 A;  3B0C T;  5B40 A;  3R45 B;  5BNX B;  3AZF D;  5B33 D;  5BNV A;  3C1B B;  5B32 A;  3MGQ B;  3LJA B;  4J8V D;  3AN2 C;  1P3G B;  3REH D;  1H3O A;  1P3B D;  5B2I C;  4WU8 D;  1EQZ C;  5B1M B;  4J8X A;  1ID3 C;  3AZN A;  1EQZ B;  1ZLA C;  3W96 B;  1JFI B;  2YFV A;  5AV8 B;  3REL A;  3W96 C;  5B2J C;  1AOI A;  3UTA B;  1B6W A;  4YM6 D;  3MNN B;  1P3L B;  5B33 B;  3AZH A;  1M18 D;  2F8N A;  5B24 B;  4XZQ A;  2FJ7 A;  5AV6 D;  5DNN D;  5AV9 A;  4R8P B;  5KDM A;  4WU9 C;  5JRG D;  5AV5 B;  3WAA B;  4QLC B;  5B31 B;  3LEL B;  3AZK D;  1P3P B;  3AYW C;  3AZI D;  2F8N G;  4E44 A;  5B32 C;  1P3M C;  3WAA A;  2ARO D;  2HIO B;  4H9O A;  5AVB D;  1TZY D;  5GXQ D;  5GT0 B;  5AV5 D;  3LZ0 B;  1P3O D;  4G91 B;  2BYK A;  5JA4 A;  3REK D;  3B0C W;  5AV6 C;  4KGC A;  1AOI B;  3W97 A;  5AVC B;  5CP6 A;  3MGR A;  3A6N A;  3X1U A;  1F66 D;  3AN2 D;  4H9S C;  3REL C;  1P34 C;  3LZ0 D;  3LEL D;  3AZK B;  5B32 B;  4J8U C;  1ID3 D;  3AYW B;  3AV1 C;  5GSU B;  3REK B;  3KUY D;  3AZL A;  5B1L C;  1M19 B;  3B0D C;  5DNM C;  4H9R B;  3MGS C;  2HIO D;  4UUZ B;  4JJN A;  4WU9 B;  1P3K B;  3VH5 W;  5B31 G;  4KGC C;  5B2J B;  3REI A;  3UTB A;  3B6F A;  3C1C A;  4YS3 B;  1S32 A;  4CAY A;  1BH9 A;  5AY8 B;  3AV2 C;  5AV8 D;  3X1S C;  3AZE A;  3AZM B;  4H9P B;  4CAY B;  1P3O C;  4KUD C;  4YS3 A;  5BS7 C;  5B1L A;  1P3F D;  3REH B;  3MGR D;  4E45 A;  4Z66 A;  5B1M D;  5GT3 C;  2NQB C;  4WU8 B;  1P3M B;  1KX5 C;  5G49 B;  3NQJ B;  2YFV B;  5AV8 A;  3C1B D;  4XUJ B;  4XZQ C;  5B32 G;  5E5A D;  1JFI A;  3KXB A;  3AZN B;  1P3G A;  4ZUX C;  1EQZ D;  3R45 A;  5BNX A;  5B0Y A;  3X1S A;  5BNV B;  1M18 B;  3AZG C;  1P34 D;  3VH5 T;  5BT1 C;  5AV6 A;  5CPJ A;  1HQ3 C;  5E5A B;  5B2I B;  2BYM A;  2FJ7 D;  4KGC B;  3AZL D;  3AZH D;  5AY8 D;  2CV5 D;  1P3A D;  2NZD D;  3LZ0 A;  2CV5 A;  4J8W C;  2PYO B;  4H9Q A;  3AYW D;  4KUD A;  4J8X D;  3X1T B;  3C1C D;  5F99 C;  1P3B A;  5GT0 A;  1P3F B;  5B0Z A;  5B1L B;  1M19 C;  3W98 C;  4H9P A;  4KGC D;  4LD9 B;  5CPI A;  3W99 B;  5CHL B;  4JJN C;  4J8U B;  4EO5 C;  1P3G D;  3LJA D;  4ZUX A;  5DNM A;  3KXB D;  1P3I B;  2NZD C;  1P3B B;  1P3I C;  1M1A C;  3B6F C;  3NQU B;  1ULY A;  4J8X C;  1ID3 A;  3AFA C;  5BT1 D;  3LZ0 C;  3VH6 T;  4M6B A;  3AN2 A;  1ZLA D;  1HQ3 A;  4Z5T B;  5AV9 D;  3KSY A;  3X1U D;  1U35 B;  1F66 A;  4JJN B;  5B1L D;  3C1C C;  5B0Z C;  4XUJ C;  5BS7 A;  4YS3 D;  1M18 A;  3AV2 A;  3AZE D;  1TZY B;  5GXQ B;  4QLC C;  5GT3 A;  4YM6 A;  3W99 D;  5CPJ B;  2NQB A;  4J8W B;  2PYO C;  3REL D;  3AZH C;  5AVB A;  3AZI B;  3B6F D;  4Z2M H;  3WA9 A;  5B24 C;  5FUG A;  3AZF C;  1P3O B;  5GT0 D;  5G49 A;  4WV4 B;  5JRG A;  1HQ3 B;  1ID3 B;  1ZLA B;  2BYK B;  3MVD D;  2HUE B;  5B1M C;  5GT3 D;  2F8N K;  2NQB D;  1WWS A;  4Z66 B;  3AZE B;  3UT9 A;  4ZUX B;  3AZI C;  1BH9 B;  1B67 A;  5GSU D;  3MGS B;  3MGQ D;  4J8V B;  1TAF A;  3KWQ B;  3UT9 B;  3TU4 D;  3REH C;  3O62 B;  4NE6 A;  5B0Z B;  5JRG B;  3WA9 D;  5DNM D;  5B40 D;  3AZF A;  3REL B;  3AZK C;  4J8X B;  2JSS A;  4DRB A;  1P34 B;  4UUZ A;  5AV6 B;  2RVQ D;  3W98 A;  1A7W A;  5AY8 C;  3AZL B;  5AVB B;  5CPI C;  4G91 C;  4Z66 D;  4LD9 D;  3WKJ D;  4KHA A;  5B0Z D;  3AV1 D;  3WA9 B;  1P3K D;  3MGQ A;  1HQ3 D;  4YM6 B;  3V9R B;  3REJ A;  1KX3 C;  3AYW A;  3W99 C;  4NFT A;  3W98 B;  3UT9 D;  4KHA B;  3LZ1 B;  2NZD A;  1F66 C;  3O62 C;  1F1E A;  3KXB B;  2ARO B;  4Z5T A;  5CP6 C;  4R8P D;  4XUJ A;  2ARO C;  5CP6 B;  4ZUX D;  3MVD A;  3AV1 B;  1P34 A;  3X1T C;  3KWQ D;  4CSR A;  4Z66 C;  4X23 B;  5CPI D;  3A6N C;  3REH A;  1BFM A;  3WA9 C;  5AVC C;  2HIO A;  4H9O B;  1P3M D;  3MGS A;  2F8N H;  5E5A C;  4KUD D;  1Q9C A;  4ZBJ B;  3W99 A;  1P3A A;  3MGP A;  5AY8 A;  5KDM B;  4CSR B;  4X23 A;  4NE3 A;  5F99 D;  3VH6 W;  3X1V A;  5CPJ D;  3AZN C;  3B6G C;  1P3F A;  4XZQ B;  3W97 D;  3UT9 C;  3W96 A;  3WTP D;  2IO5 B;  2PYO D;  3X1S D;  2IO5 C;  5FUG B;  4R8P C;  1P3O A;  5B2I A;  1EQZ A;  3LZ1 A;  3KWQ C;  4WU8 C;  1M19 A;  3VH6 A;  4H9R A;  1H3O B;  3REJ B;  5E5A A;  3WAA D;  4J8W A;  3MNN C;  1P3L C;  3AZE C;  4ZBJ C;  3AZI A;  3C1B A;  3AFA D;  3X1S B;  3AV2 B;  3V9R A;  1BH8 A;  3AZK A;  3X1U B;  1U35 D;  3UTA C;  5AVC A;  3MGR B;  5AV9 C;  4WNN B;  5C3I C;  3WTP C;  3AN2 B;  1P3G C;  3VH5 A;  2CWE A;  3KUY C;  4NE5 A;  3AZF B;  5CPK D;  1M1A D;  3NQU A;  3MGQ C;  5JA4 B;  3NQJ A;  1P3I A;  3MGP B;  3AZN D;  3TU4 C;  5CPJ C;  1TZY C;  5GXQ C;  3B6G A;  1P3F C;  5GSU C;  5DNM B;  3AZJ C;  4H9N B;  1P3A B;  4QLC A;  4WU9 D;  4J8V A;  3REK C;  1KX5 D;  5CPK B;  1KX4 D;  3B6G B;  3W97 C;  5B0Y D;  1KX3 B;  3C1C B;  4H9N A;  5AV5 A;  3LZ1 D;  5B24 A;  4Z5T C;  4YM6 C;  3MNN A;  1P3L A;  2CV5 B;  3AZG B;  5B2J A;  1AOI C;  4WU9 A;  2CV5 C;  3KUY A;  3X1T A;  4H9Q B;  5BO0 A;  3MVD B;  5B1M A;  4X23 C;  5CPK C;  5CP6 D;  1M1A A;  5B40 B;  3X1V C;  2F8N D;  4J8V C;  4HGA B;  3REK A;  3LEL C;  5B24 D;  5B0Y B;  1KX3 D;  3MGP C;  5B31 C;  1P3P C;  3TU4 B;  1TZY A;  5GT3 B;  5AV5 C;  5GXQ A;  2NQB B;  1S32 D;  1U35 A;  1F66 B;  3O62 D;  3AZJ A;  3REI D;  3B0B A;  3UTB D;  1KX5 A;  2HUE C;  1KX4 C;  3AZG D;  4QLC D;  3AZM C;  5B33 C;  5BO0 B;  5B32 D;  5AV8 C;  3AZJ D;  3KUY B;  4JJN D;  5AVB C;  3X1U C;  3LJA C;  4H9S A;  1N1J A;  4G92 B;  5CPK A;  3WTP A;  3C1B C;  2YFW B;  4LD9 A;  3REJ C;  1N1J B;  5JRG C;  1AOI D;  3LEL A;  3W98 D;  5DNN C;  1S32 B;  3AZH B;  3B0D B;  3A6N D;  1S32 C;  3WKJ B;  4J8W D;  1HTA A;  5B31 D;  3MNN D;  1P3L D;  5B33 A;  1P3P D;  1KX5 B;  4KUD B;  4AWL B;  3AZM D;  3MGS D;  1M19 D;  4WNN A;  3REI C;  3UTB C;  1U35 C;  3TU4 A;  2FJ7 C;  2ARO A;  4G92 C;  1KX4 A;  5GSU A;  2BYM B;  2NZD B;  3UTA D;  1BH8 B;  4WZS B;  1M1A B;  3B6G D;  5F99 A;  1P3B C;  5GT0 C;  4XUJ D;  4YS3 C;  1KX4 B;  1P3I D;  2RVQ C;  2HIO C;  5DNN A;  3A6N B;  1P3K C;  3REJ D;  4XZQ D;  3W97 B;  4LD9 C;  4HGA C;  3WKJ A;  5B40 C;  4J8U D;  5B0Y C;  3X1V B;  1P3M A;  3WAA C;  3KXB C;  3AZG A;  5AVC D;  3LZ1 C;  3KWQ A;  4WU8 A;  2LY8 A;  3O62 A;  4DRA A;  3AFA A;  1R4V A;  4Z2M G;  1TAF B;  1KX3 A;  3WTP B;  3MVD C;  4J8U A;  3AZM A;  4R8P A;  4Z5T D;  2YFW A;  5AV9 B;  3AFA B;  5B31 A;  3MGR C;  3AV2 D;  3AZL C;  1P3P A;  3B6F B;  5B2I D;  3WTP E;  5CPI B;  2FJ7 B;  5C3I B;  1M18 C;  1ZLA A;  3REI B;  3UTB B;  2PYO A;  4AWL C;  3W96 D;  4EO5 B;  1P3K A;  3AV1 A;  2F8N B;  3X1V D;  2L5A A;  3WKJ C;  1WWI A;  3AZJ B;  3UTA A;  3X1T D;  4X23 D; 
#chains in the Genus database with same CATH topology
 5B2J D;  3MGP D;  1P3A C;  3A1I A;  3LJA A;  5DNN B;  5F99 B;  1KU5 A;  3B0C T;  5B40 A;  3R45 B;  5BNX B;  3AZF D;  5B33 D;  5BNV A;  3C1B B;  5B32 A;  3MGQ B;  3LJA B;  4J8V D;  3AN2 C;  1P3G B;  3REH D;  1H3O A;  2G5H C;  1P3B D;  5B2I C;  4WU8 D;  1EQZ C;  5B1M B;  4J8X A;  1ID3 C;  3AZN A;  1EQZ B;  1ZLA C;  3W96 B;  1JFI B;  2YFV A;  5AV8 B;  3REL A;  3W96 C;  5B2J C;  1AOI A;  3UTA B;  1B6W A;  4YM6 D;  3MNN B;  1P3L B;  5B33 B;  3AZH A;  1M18 D;  2F8N A;  5B24 B;  4XZQ A;  2FJ7 A;  5AV6 D;  5DNN D;  2ZY2 A;  5AV9 A;  4R8P B;  5KDM A;  4WU9 C;  5JRG D;  5AV5 B;  3WAA B;  4QLC B;  5B31 B;  3LEL B;  3AZK D;  1P3P B;  2XD1 A;  3AYW C;  3AZI D;  2F8N G;  4E44 A;  5B32 C;  1P3M C;  3WAA A;  2FFF B;  2ARO D;  2HIO B;  4H9O A;  5AVB D;  1TZY D;  5GXQ D;  5GT0 B;  5AV5 D;  3LZ0 B;  1P3O D;  4G91 B;  2BYK A;  5JA4 A;  3REK D;  2JE5 A;  3B0C W;  5AV6 C;  4KGC A;  1AOI B;  3W97 A;  5AVC B;  5CP6 A;  3MGR A;  3A6N A;  3X1U A;  1F66 D;  3AN2 D;  4H9S C;  3REL C;  2Y2H A;  1P34 C;  3LZ0 D;  3LEL D;  3AZK B;  5B32 B;  4J8U C;  1ID3 D;  3AYW B;  3AV1 C;  5GSU B;  3REK B;  3KUY D;  3AZL A;  5B1L C;  1M19 B;  3B0D C;  5DNM C;  4H9R B;  3MGS C;  2HIO D;  4UUZ B;  3EPL A;  4JJN A;  4WU9 B;  1P3K B;  3VH5 W;  5B31 G;  4KGC C;  5B2J B;  3REI A;  3UTB A;  3B6F A;  3C1C A;  4YS3 B;  1S32 A;  4CAY A;  1BH9 A;  5AY8 B;  3AV2 C;  5AV8 D;  3X1S C;  3AZE A;  2Y2I A;  3AZM B;  4H9P B;  4CAY B;  1P3O C;  4KUD C;  4YS3 A;  5BS7 C;  2ZM5 A;  5B1L A;  1P3F D;  3REH B;  3MGR D;  4E45 A;  4Z66 A;  5B1M D;  5GT3 C;  2NQB C;  4WU8 B;  1P3M B;  1KX5 C;  3H0L C;  2Y2P A;  5G49 B;  3NQJ B;  2YFV B;  5AV8 A;  3C1B D;  4XUJ B;  4XZQ C;  3P5J B;  5B32 G;  5E5A D;  1JFI A;  3KXB A;  3AZN B;  1P3G A;  4ZUX C;  1EQZ D;  3R45 A;  5BNX A;  5B0Y A;  3FDD A;  3X1S A;  5BNV B;  1M18 B;  3AZG C;  1P34 D;  3VH5 T;  5BT1 C;  5AV6 A;  5CPJ A;  1HQ3 C;  3H0M C;  5E5A B;  5B2I B;  2BYM A;  2FJ7 D;  4KGC B;  3AZL D;  3AZH D;  5AY8 D;  2CV5 D;  1P3A D;  2NZD D;  3LZ0 A;  2CV5 A;  4J8W C;  2PYO B;  2W8S A;  4H9Q A;  3AYW D;  4KUD A;  4J8X D;  2J8P A;  3X1T B;  3C1C D;  5F99 C;  1P3B A;  5GT0 A;  1P3F B;  5B0Z A;  5B1L B;  1M19 C;  3W98 C;  4H9P A;  4KGC D;  4LD9 B;  5CPI A;  3W99 B;  5CHL B;  4JJN C;  4J8U B;  4EO5 C;  1P3G D;  3LJA D;  4ZUX A;  5DNM A;  3KXB D;  1P3I B;  2NZD C;  1P3B B;  1P3I C;  2F2A C;  1M1A C;  3B6F C;  3NQU B;  1ULY A;  4J8X C;  1ID3 A;  3AFA C;  5BT1 D;  3LZ0 C;  3VH6 T;  4M6B A;  3AN2 A;  1ZLA D;  1HQ3 A;  4Z5T B;  5AV9 D;  3KSY A;  3X1U D;  1U35 B;  1F66 A;  4JJN B;  5B1L D;  3C1C C;  5B0Z C;  4XUJ C;  5BS7 A;  4YS3 D;  3A1K A;  1M18 A;  4UPK A;  3AV2 A;  3AZE D;  1TZY B;  5GXQ B;  4QLC C;  5GT3 A;  4YM6 A;  3W99 D;  5CPJ B;  2NQB A;  4J8W B;  2PYO C;  3REL D;  3AZH C;  5AVB A;  3AZI B;  3B6F D;  4Z2M H;  3WA9 A;  5B24 C;  5FUG A;  3AZF C;  1P3O B;  5GT0 D;  5G49 A;  4WV4 B;  5JRG A;  1HQ3 B;  1ID3 B;  1ZLA B;  2BYK B;  3EPK A;  3MVD D;  2HUE B;  5B1M C;  5GT3 D;  2F8N K;  2NQB D;  2DF4 C;  1WWS A;  4Z66 B;  3AZE B;  3UT9 A;  4ZUX B;  3AZI C;  1BH9 B;  1B67 A;  5GSU D;  3MGS B;  3MGQ D;  4J8V B;  1TAF A;  2UWX A;  3KWQ B;  3UT9 B;  3TU4 D;  3REH C;  3O62 B;  4NE6 A;  5B0Z B;  5JRG B;  3WA9 D;  5DNM D;  5B40 D;  3AZF A;  3REL B;  3AZK C;  2Y2O A;  4J8X B;  2JSS A;  4DRB A;  1P34 B;  2ZY4 A;  4UUZ A;  5AV6 B;  2RVQ D;  3W98 A;  1A7W A;  5AY8 C;  3AZL B;  5AVB B;  5CPI C;  4G91 C;  4Z66 D;  4LD9 D;  3WKJ D;  4KHA A;  5B0Z D;  3AV1 D;  3WA9 B;  1P3K D;  3MGQ A;  1HQ3 D;  4YM6 B;  3V9R B;  3REJ A;  1KX3 C;  3AYW A;  3W99 C;  4NFT A;  3W98 B;  3UT9 D;  4KHA B;  3LZ1 B;  2NZD A;  1F66 C;  3O62 C;  1F1E A;  3KXB B;  3EPH A;  2ARO B;  4Z5T A;  5CP6 C;  4R8P D;  4XUJ A;  2ARO C;  5CP6 B;  4ZUX D;  3MVD A;  3AV1 B;  3EPJ A;  1P34 A;  3X1T C;  2Y2K A;  3KWQ D;  4CSR A;  4Z66 C;  4X23 B;  1W2E A;  3A6N C;  3REH A;  5CPI D;  1BFM A;  3WA9 C;  5AVC C;  2HIO A;  4H9O B;  3AZJ B;  1P3M D;  3MGS A;  2F8N H;  5E5A C;  3EG5 B;  4KUD D;  1Q9C A;  4WJ3 C;  4ZBJ B;  3W99 A;  1P3A A;  3MGP A;  5AY8 A;  5KDM B;  4CSR B;  4X23 A;  3KFU G;  4NE3 A;  5F99 D;  3VH6 W;  3X1V A;  5CPJ D;  3AZN C;  3B6G C;  1P3F A;  4XZQ B;  3W97 D;  3UT9 C;  3W96 A;  3WTP D;  2IO5 B;  2PYO D;  3X1S D;  2IO5 C;  5FUG B;  4R8P C;  1P3O A;  5B2I A;  2G5I C;  3LZ1 A;  3KWQ C;  4WU8 C;  1EQZ A;  1M19 A;  3VH6 A;  4H9R A;  1H3O B;  3REJ B;  5E5A A;  3WAA D;  4J8W A;  3MNN C;  1P3L C;  3AZE C;  4ZBJ C;  3AZI A;  3AL0 C;  3C1B A;  3AFA D;  3X1S B;  3AV2 B;  3V9R A;  1BH8 A;  3AZK A;  3X1U B;  1U35 D;  3UTA C;  5AVC A;  3MGR B;  5AV9 C;  4WNN B;  2Y2G A;  5C3I C;  3WTP C;  3AN2 B;  1P3G C;  3VH5 A;  2CWE A;  2ZY5 A;  3KUY C;  4NE5 A;  3AZF B;  5CPK D;  1M1A D;  2XD5 A;  3NQU A;  3MGQ C;  5JA4 B;  3NQJ A;  1P3I A;  3MGP B;  3AZN D;  3TU4 C;  5CPJ C;  1TZY C;  5GXQ C;  3B6G A;  1P3F C;  2JCH A;  5GSU C;  5DNM B;  3AZJ C;  4H9N B;  1P3A B;  4QLC A;  4WU9 D;  4J8V A;  3REK C;  1KX5 D;  5CPK B;  1KX4 D;  2ZY3 A;  3B6G B;  3W97 C;  2Y2L A;  5B0Y D;  1KX3 B;  3C1C B;  4H9N A;  5AV5 A;  3LZ1 D;  5B24 A;  4Z5T C;  4YM6 C;  3MNN A;  1P3L A;  3IP4 C;  2CV5 B;  3AZG B;  5B2J A;  1AOI C;  4WU9 A;  2CV5 C;  3KUY A;  3X1T A;  4H9Q B;  5BO0 A;  3MVD B;  5B1M A;  4X23 C;  5CPK C;  5CP6 D;  1M1A A;  5B40 B;  3X1V C;  2F8N D;  4J8V C;  4HGA B;  3REK A;  3LEL C;  5B24 D;  5B0Y B;  1KX3 D;  3MGP C;  5B31 C;  1P3P C;  3TU4 B;  1TZY A;  5GT3 B;  5AV5 C;  5GXQ A;  2NQB B;  1S32 D;  1U35 A;  1F66 B;  1T3U A;  3O62 D;  3AZJ A;  3REI D;  3B0B A;  3UTB D;  1KX5 A;  2HUE C;  1KX4 C;  2VQR A;  4QLC D;  3AZG D;  3AZM C;  5B33 C;  5BO0 B;  5B32 D;  5AV8 C;  3AZJ D;  3KUY B;  4JJN D;  3F6T A;  5AVB C;  3X1U C;  3LJA C;  4H9S A;  1N1J A;  4G92 B;  5CPK A;  4DQY B;  2Y2J A;  3WTP A;  2Y2Q A;  3C1B C;  2YFW B;  4LD9 A;  3REJ C;  1N1J B;  5JRG C;  1AOI D;  3LEL A;  3W98 D;  3H0R C;  5DNN C;  1S32 B;  3AZH B;  3B0D B;  3A6N D;  1S32 C;  3WKJ B;  4J8W D;  1HTA A;  5B31 D;  3MNN D;  1P3L D;  5B33 A;  1P3P D;  1KX5 B;  4KUD B;  4AWL B;  3AZM D;  3MGS D;  1M19 D;  4WNN A;  3REI C;  3UTB C;  1U35 C;  3TU4 A;  2BG1 A;  2FJ7 C;  2ARO A;  2DQN C;  4G92 C;  1KX4 A;  2Y2N A;  5GSU A;  2BYM B;  2NZD B;  3UTA D;  1BH8 B;  4WZS B;  1M1A B;  3B6G D;  5F99 A;  1P3B C;  5GT0 C;  4XUJ D;  4YS3 C;  1KX4 B;  1P3I D;  2RVQ C;  2HIO C;  5DNN A;  1PZR A;  3A6N B;  1P3K C;  3REJ D;  4XZQ D;  3W97 B;  4LD9 C;  4HGA C;  3WKJ A;  5B40 C;  4J8U D;  5B0Y C;  3X1V B;  1P3M A;  2RIQ A;  3WAA C;  3KXB C;  3AZG A;  5AVC D;  3LZ1 C;  3KWQ A;  4WU8 A;  2LY8 A;  3O62 A;  4DRA A;  3AFA A;  1R4V A;  4Z2M G;  1TAF B;  1KX3 A;  3WTP B;  3MVD C;  4J8U A;  3AZM A;  5AV9 B;  4Z5T D;  2YFW A;  4R8P A;  3AFA B;  5B31 A;  3MGR C;  3AV2 D;  3AZL C;  1P3P A;  3B6F B;  5B2I D;  3WTP E;  5CPI B;  2Y2M A;  5C3I B;  2FJ7 B;  1M18 C;  1ZLA A;  3REI B;  3UTB B;  2PYO A;  4AWL C;  3W96 D;  4EO5 B;  1P3K A;  3AV1 A;  2F8N B;  3X1V D;  2L5A A;  3WKJ C;  1WWI A;  1Z2C B;  3UTA A;  3X1T D;  4X23 D; 
#chains in the Genus database with same CATH homology
 5B2J D;  3MGP D;  1P3A C;  3A1I A;  3LJA A;  5DNN B;  5F99 B;  1KU5 A;  3B0C T;  5B40 A;  3R45 B;  5BNX B;  3AZF D;  5B33 D;  5BNV A;  3C1B B;  5B32 A;  3MGQ B;  3LJA B;  4J8V D;  3AN2 C;  1P3G B;  3REH D;  1H3O A;  2G5H C;  1P3B D;  5B2I C;  4WU8 D;  1EQZ C;  5B1M B;  4J8X A;  1ID3 C;  3AZN A;  1EQZ B;  1ZLA C;  3W96 B;  1JFI B;  2YFV A;  5AV8 B;  3REL A;  3W96 C;  5B2J C;  1AOI A;  3UTA B;  1B6W A;  4YM6 D;  3MNN B;  1P3L B;  5B33 B;  3AZH A;  1M18 D;  2F8N A;  5B24 B;  4XZQ A;  2FJ7 A;  5AV6 D;  5DNN D;  2ZY2 A;  5AV9 A;  4R8P B;  5KDM A;  4WU9 C;  5JRG D;  5AV5 B;  3WAA B;  4QLC B;  5B31 B;  3LEL B;  3AZK D;  1P3P B;  2XD1 A;  3AYW C;  3AZI D;  2F8N G;  4E44 A;  5B32 C;  1P3M C;  3WAA A;  2FFF B;  2ARO D;  2HIO B;  4H9O A;  5AVB D;  1TZY D;  5GXQ D;  5GT0 B;  5AV5 D;  3LZ0 B;  1P3O D;  4G91 B;  2BYK A;  5JA4 A;  3REK D;  2JE5 A;  3B0C W;  5AV6 C;  4KGC A;  1AOI B;  3W97 A;  5AVC B;  5CP6 A;  3MGR A;  3A6N A;  3X1U A;  1F66 D;  3AN2 D;  4H9S C;  3REL C;  2Y2H A;  1P34 C;  3LZ0 D;  3LEL D;  3AZK B;  5B32 B;  4J8U C;  1ID3 D;  3AYW B;  3AV1 C;  5GSU B;  3REK B;  3KUY D;  3AZL A;  5B1L C;  1M19 B;  3B0D C;  5DNM C;  4H9R B;  3MGS C;  2HIO D;  4UUZ B;  3EPL A;  4JJN A;  4WU9 B;  1P3K B;  3VH5 W;  5B31 G;  4KGC C;  5B2J B;  3REI A;  3UTB A;  3B6F A;  3C1C A;  4YS3 B;  1S32 A;  4CAY A;  1BH9 A;  5AY8 B;  3AV2 C;  5AV8 D;  3X1S C;  3AZE A;  2Y2I A;  3AZM B;  4H9P B;  4CAY B;  1P3O C;  4KUD C;  4YS3 A;  5BS7 C;  2ZM5 A;  5B1L A;  1P3F D;  3REH B;  3MGR D;  4E45 A;  4Z66 A;  5B1M D;  5GT3 C;  2NQB C;  4WU8 B;  1P3M B;  1KX5 C;  3H0L C;  2Y2P A;  5G49 B;  3NQJ B;  2YFV B;  5AV8 A;  3C1B D;  4XUJ B;  4XZQ C;  3P5J B;  5B32 G;  5E5A D;  1JFI A;  3KXB A;  3AZN B;  1P3G A;  4ZUX C;  1EQZ D;  3R45 A;  5BNX A;  5B0Y A;  3FDD A;  3X1S A;  5BNV B;  1M18 B;  3AZG C;  1P34 D;  3VH5 T;  5BT1 C;  5AV6 A;  5CPJ A;  1HQ3 C;  3H0M C;  5E5A B;  5B2I B;  2BYM A;  2FJ7 D;  4KGC B;  3AZL D;  3AZH D;  5AY8 D;  2CV5 D;  1P3A D;  2NZD D;  3LZ0 A;  2CV5 A;  4J8W C;  2PYO B;  2W8S A;  4H9Q A;  3AYW D;  4KUD A;  4J8X D;  2J8P A;  3X1T B;  3C1C D;  5F99 C;  1P3B A;  5GT0 A;  1P3F B;  5B0Z A;  5B1L B;  1M19 C;  3W98 C;  4H9P A;  4KGC D;  4LD9 B;  5CPI A;  3W99 B;  5CHL B;  4JJN C;  4J8U B;  4EO5 C;  1P3G D;  3LJA D;  4ZUX A;  5DNM A;  3KXB D;  1P3I B;  2NZD C;  1P3B B;  1P3I C;  2F2A C;  1M1A C;  3B6F C;  3NQU B;  1ULY A;  4J8X C;  1ID3 A;  3AFA C;  5BT1 D;  3LZ0 C;  3VH6 T;  4M6B A;  3AN2 A;  1ZLA D;  1HQ3 A;  4Z5T B;  5AV9 D;  3KSY A;  3X1U D;  1U35 B;  1F66 A;  4JJN B;  5B1L D;  3C1C C;  5B0Z C;  4XUJ C;  5BS7 A;  4YS3 D;  3A1K A;  1M18 A;  4UPK A;  3AV2 A;  3AZE D;  1TZY B;  5GXQ B;  4QLC C;  5GT3 A;  4YM6 A;  3W99 D;  5CPJ B;  2NQB A;  4J8W B;  2PYO C;  3REL D;  3AZH C;  5AVB A;  3AZI B;  3B6F D;  4Z2M H;  3WA9 A;  5B24 C;  5FUG A;  3AZF C;  1P3O B;  5GT0 D;  5G49 A;  4WV4 B;  5JRG A;  1HQ3 B;  1ID3 B;  1ZLA B;  2BYK B;  3EPK A;  3MVD D;  2HUE B;  5B1M C;  5GT3 D;  2F8N K;  2NQB D;  2DF4 C;  1WWS A;  4Z66 B;  3AZE B;  3UT9 A;  4ZUX B;  3AZI C;  1BH9 B;  1B67 A;  5GSU D;  3MGS B;  3MGQ D;  4J8V B;  1TAF A;  2UWX A;  3KWQ B;  3UT9 B;  3TU4 D;  3REH C;  3O62 B;  4NE6 A;  5B0Z B;  5JRG B;  3WA9 D;  5DNM D;  5B40 D;  3AZF A;  3REL B;  3AZK C;  2Y2O A;  4J8X B;  2JSS A;  4DRB A;  1P34 B;  2ZY4 A;  4UUZ A;  5AV6 B;  2RVQ D;  3W98 A;  1A7W A;  5AY8 C;  3AZL B;  5AVB B;  5CPI C;  4G91 C;  4Z66 D;  4LD9 D;  3WKJ D;  4KHA A;  5B0Z D;  3AV1 D;  3WA9 B;  1P3K D;  3MGQ A;  1HQ3 D;  4YM6 B;  3V9R B;  3REJ A;  1KX3 C;  3AYW A;  3W99 C;  4NFT A;  3W98 B;  3UT9 D;  4KHA B;  3LZ1 B;  2NZD A;  1F66 C;  3O62 C;  1F1E A;  3KXB B;  3EPH A;  2ARO B;  4Z5T A;  5CP6 C;  4R8P D;  4XUJ A;  2ARO C;  5CP6 B;  4ZUX D;  3MVD A;  3AV1 B;  3EPJ A;  1P34 A;  3X1T C;  2Y2K A;  3KWQ D;  4CSR A;  4Z66 C;  4X23 B;  1W2E A;  3A6N C;  3REH A;  5CPI D;  1BFM A;  3WA9 C;  5AVC C;  2HIO A;  4H9O B;  3AZJ B;  1P3M D;  3MGS A;  2F8N H;  5E5A C;  3EG5 B;  4KUD D;  1Q9C A;  4WJ3 C;  4ZBJ B;  3W99 A;  1P3A A;  3MGP A;  5AY8 A;  5KDM B;  4CSR B;  4X23 A;  3KFU G;  4NE3 A;  5F99 D;  3VH6 W;  3X1V A;  5CPJ D;  3AZN C;  3B6G C;  1P3F A;  4XZQ B;  3W97 D;  3UT9 C;  3W96 A;  3WTP D;  2IO5 B;  2PYO D;  3X1S D;  2IO5 C;  5FUG B;  4R8P C;  1P3O A;  5B2I A;  2G5I C;  3LZ1 A;  3KWQ C;  4WU8 C;  1EQZ A;  1M19 A;  3VH6 A;  4H9R A;  1H3O B;  3REJ B;  5E5A A;  3WAA D;  4J8W A;  3MNN C;  1P3L C;  3AZE C;  4ZBJ C;  3AZI A;  3AL0 C;  3C1B A;  3AFA D;  3X1S B;  3AV2 B;  3V9R A;  1BH8 A;  3AZK A;  3X1U B;  1U35 D;  3UTA C;  5AVC A;  3MGR B;  5AV9 C;  4WNN B;  2Y2G A;  5C3I C;  3WTP C;  3AN2 B;  1P3G C;  3VH5 A;  2CWE A;  2ZY5 A;  3KUY C;  4NE5 A;  3AZF B;  5CPK D;  1M1A D;  2XD5 A;  3NQU A;  3MGQ C;  5JA4 B;  3NQJ A;  1P3I A;  3MGP B;  3AZN D;  3TU4 C;  5CPJ C;  1TZY C;  5GXQ C;  3B6G A;  1P3F C;  2JCH A;  5GSU C;  5DNM B;  3AZJ C;  4H9N B;  1P3A B;  4QLC A;  4WU9 D;  4J8V A;  3REK C;  1KX5 D;  5CPK B;  1KX4 D;  2ZY3 A;  3B6G B;  3W97 C;  2Y2L A;  5B0Y D;  1KX3 B;  3C1C B;  4H9N A;  5AV5 A;  3LZ1 D;  5B24 A;  4Z5T C;  4YM6 C;  3MNN A;  1P3L A;  3IP4 C;  2CV5 B;  3AZG B;  5B2J A;  1AOI C;  4WU9 A;  2CV5 C;  3KUY A;  3X1T A;  4H9Q B;  5BO0 A;  3MVD B;  5B1M A;  4X23 C;  5CPK C;  5CP6 D;  1M1A A;  5B40 B;  3X1V C;  2F8N D;  4J8V C;  4HGA B;  3REK A;  3LEL C;  5B24 D;  5B0Y B;  1KX3 D;  3MGP C;  5B31 C;  1P3P C;  3TU4 B;  1TZY A;  5GT3 B;  5AV5 C;  5GXQ A;  2NQB B;  1S32 D;  1U35 A;  1F66 B;  1T3U A;  3O62 D;  3AZJ A;  3REI D;  3B0B A;  3UTB D;  1KX5 A;  2HUE C;  1KX4 C;  2VQR A;  4QLC D;  3AZG D;  3AZM C;  5B33 C;  5BO0 B;  5B32 D;  5AV8 C;  3AZJ D;  3KUY B;  4JJN D;  3F6T A;  5AVB C;  3X1U C;  3LJA C;  4H9S A;  1N1J A;  4G92 B;  5CPK A;  4DQY B;  2Y2J A;  3WTP A;  2Y2Q A;  3C1B C;  2YFW B;  4LD9 A;  3REJ C;  1N1J B;  5JRG C;  1AOI D;  3LEL A;  3W98 D;  3H0R C;  5DNN C;  1S32 B;  3AZH B;  3B0D B;  3A6N D;  1S32 C;  3WKJ B;  4J8W D;  1HTA A;  5B31 D;  3MNN D;  1P3L D;  5B33 A;  1P3P D;  1KX5 B;  4KUD B;  4AWL B;  3AZM D;  3MGS D;  1M19 D;  4WNN A;  3REI C;  3UTB C;  1U35 C;  3TU4 A;  2BG1 A;  2FJ7 C;  2ARO A;  2DQN C;  4G92 C;  1KX4 A;  2Y2N A;  5GSU A;  2BYM B;  2NZD B;  3UTA D;  1BH8 B;  4WZS B;  1M1A B;  3B6G D;  5F99 A;  1P3B C;  5GT0 C;  4XUJ D;  4YS3 C;  1KX4 B;  1P3I D;  2RVQ C;  2HIO C;  5DNN A;  1PZR A;  3A6N B;  1P3K C;  3REJ D;  4XZQ D;  3W97 B;  4LD9 C;  4HGA C;  3WKJ A;  5B40 C;  4J8U D;  5B0Y C;  3X1V B;  1P3M A;  2RIQ A;  3WAA C;  3KXB C;  3AZG A;  5AVC D;  3LZ1 C;  3KWQ A;  4WU8 A;  2LY8 A;  3O62 A;  4DRA A;  3AFA A;  1R4V A;  4Z2M G;  1TAF B;  1KX3 A;  3WTP B;  3MVD C;  4J8U A;  3AZM A;  5AV9 B;  4Z5T D;  2YFW A;  4R8P A;  3AFA B;  5B31 A;  3MGR C;  3AV2 D;  3AZL C;  1P3P A;  3B6F B;  5B2I D;  3WTP E;  5CPI B;  2Y2M A;  5C3I B;  2FJ7 B;  1M18 C;  1ZLA A;  3REI B;  3UTB B;  2PYO A;  4AWL C;  3W96 D;  4EO5 B;  1P3K A;  3AV1 A;  2F8N B;  3X1V D;  2L5A A;  3WKJ C;  1WWI A;  1Z2C B;  3UTA A;  3X1T D;  4X23 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...