4UUZA

Mcm2-histone complex
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
78
structure length
78
Chain Sequence
STELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords HISTONE H3
publication title Structural Insight Into How the Human Helicase Subunit Mcm2 May Act as a Histone Chaperone Together with Asf1 at the Replication Fork.
pubmed doi rcsb
source organism Drosophila melanogaster
total genus 24
structure length 78
sequence length 78
ec nomenclature
pdb deposition date 2014-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4uuzA00
3MNNB 2BYKB 3AZJA 3AZFB 5B32D 5BNXB 5DNMB 3AZGA 1BH8A 3AZED 3X1SB 1P3BA 3MGRA 1EQZA 2NQBD 1P3AB 3MVDC 3REID 3KXBA 3W96C 4KGCA 3WTPC 3LZ0C 5AVCD 4EO5C 4ZBJC 3X1UC 5F99C 4AWLC 5AV5C 1M19A 4DRAA 5CP6D 4WNNB 1P3MC 3W99A 1U35C 1TAFA 3MGQD 3AN2D 3MGSC 5AV9C 3AZJB 2AROC 3B6FC 4YS3C 3A6NC 3AZGB 1BH8B 3WKJC 4X23A 4ZUXC 5BT1D 3W98C 3MGRB 1EQZB 3AZNC 3WAAA 5AY8B 1P34D 3C1BB 1HQ3D 2CV5D 3MGPD 3W99B 1TAFB 5AV6B 5AVBC 5B0YD 5B2IA 1P3ID 5B40D 3REHD 3VH6A 5GT3A 2F8ND 3LJAA 4J8WA 5CPIB 1KU5A 1ID3C 1P3LA 3WAAB 5B31C 3LELA 3AZMA 5DNNA 3C1CD 3LZ1D 3B6GC 4XZQD 2HUEC 4XUJC 3R45A 1BH9B 3NQUA 3B0BA 1BFMA 4Z66C 5GT0D 2F8NH 3MNND 5B2IB 4WV4B 4KUDD 5E5AA 3AZFD 4WZSB 3O62C 1P3GB 5DNMD 4J8WB 1KX4C 3AZLD 1P3LB 1ZLAC 3X1SD 3WA9C 5AY8C 3AZKB 4J8XC 5B24C 3LELB 3AZMB 2BYMA 3C1BC 5B2JA 1P3AD 3W97A 1TZYC 4LD9A 2FJ7C 3R45B 3NQUB 3X1VB 5JA4A 4NE5A 3UTAD 5B1LA 3REKA 1S32C 5GXQA 1P3OA 3AV2C 4Z2MH 5B1MA 3AN2B 4WU9A 3KWQA 3AZJD 5E5AB 4E44A 2JSSA 3UTBA 3AZGD 3KUYA 1P3FC 5B33C 4H9OA 4H9SA 1P3BD 4QLCC 3MGRD 1EQZD 3KSYA 2BYMB 5JRGC 3B0DB 5B2JB 3TU4C 4KGCD 3RELA 3W97B 1P34B 1M19D 4NE3A 3UT9A 5JA4B 3LZ0A 1M1AA 5CHLB 2CV5B 3W99D 5BS7C 5GXQB 5AV6D 5B1MB 4WU9B 3KWQB 5B32C 1N1JA 5B40B 5B0ZA 4NE6A 3KUYB 3MGSA 3AZEC 5AV9A 4H9OB 1H3OA 4X23D 5CPID 2NQBC 4J8VA 3AZIA 3WAAD 3A6NA 3REIC 3AZHA 3V9RA 5AVCC 2CWEA 3LZ1B 3AFAA 3AYWB 4XZQB 1M1AB 5CP6C 3MGQC 3AN2C 4Z5TA 3AV1A 5B2ID 5C3IC 4KUDB 2PYOB 5GSUA 5B0ZB 1P3GD 5GT3D 2HIOA 5BT1C 1H3OB 1F1EA 4J8WD 4J8UA 4J8VB 3AZLB 1P3LD 2LY8A 3X1TA 5BO0B 2RVQD 3AZIB 3AZKD 3AZHB 1P34C 2IO5C 3V9RB 3LELD 3AZMD 3VH6T 4WU8A 4R8PA 1R4VA 1HQ3C 1M18A 2CV5C 3MGPC 3X1VD 5CPKA 5B0YC 3UTAB 2NZDB 3AV1B 1P3IC 1KX3B 5B40C 4H9NA 3REHC 5E5AD 5GSUB 1P3KA 2HIOB 4G92C 1P3PA 4J8UB 4JJNA 3X1TB 1P3BB 2YFVA 5FUGA 3VH5W 4E45A 3C1CC 5B2JD 4WU8B 3LZ1C 3KXBB 3W97D 4XZQC 5AV8A 4KGCB 4R8PB 1M18B 1KX5A 1M19B 4CSRA 5G49A 5GT0C 3REJA 1TZYA 3MNNC 2FJ7A 4KUDC 5GXQD 4CAYA 4H9NB 5B1MD 4WU9D 3AZFC 3KWQD 5DNMC 1P3KB 3UTBD 3AZLC 3AV2A 3KUYD 3X1SC 4JJNB 4X23B 2YFVB 5FUGB 1P3AC 1P3FA 5B33A 1B67A 3RELD 5AV8B 4QLCA 1KX5B 3AYWD 3UT9D 3UTAC 4CSRB 1M1AD 5G49B 3REJB 4CAYB 3B0CW 3AZJC 4M6BA 3AZGC 2PYOD 5B0ZD 4H9QA 5GT3B 4UUZA 1P3BC 3MGRC 3LJAB 1F66A 1EQZC 4J8VD 3NQJA 5BNVA 3AZID 5CPJA 3AZHD 4KGCC 2NQBA 5DNNB 1M19C 3REIA 3AFAD 3W99C 4YM6A 5AV6C 4Z5TD 4KHAA 1AOIA 3AV1D 1KX3D 2NZDD 4HGAB 4H9RA 5GSUD 4H9QB 4X23C 5CPIC 2HIOD 4J8UD 3WAAC 3X1TD 5CPJB 4WU8D 3KXBD 4G91B 4R8PD 1M18D 4LD9B 3MVDA 3W96A 4YM6B 3WTPA 5CPKD 5B2IC 4KHAB 5B1LB 3REKB 1AOIB 3X1UA 5F99A 5AV5A 1P3OB 1P3GC 4H9RB 5GT3C 1P3KD 1P3MA 4J8WC 3UTBB 1U35A 1P3LC 1P3PD 5B31G 2RVQC 4JJND 3AZKC 2F8NA 2AROA 3LELC 3AZMC 3B6FA 4YS3A 3WKJA 4ZUXA 5AV8D 3RELB 3W98A 1KX5D 3AZNA 3X1VC 3MVDB 3UT9B 3W96B 3WTPB 3REJD 3LZ0B 4EO5B 4ZBJB 3X1UB 5F99B 5AV5B 5E5AC 3MNNA 1N1JB 1U35B 5AVBA 3MGSB 5AV9B 3LJAD 2AROB 4YS3B 3B0DC 5B2JC 3A6NB 3W97C 2L5AA 4G91C 3WKJB 5DNND 1ID3A 3VH5T 3AZNB 5B31A 3AFAB 2F8NK 5GXQC 3B6GA 5B1MC 4WU9C 4Z5TB 3KWQC 4XUJA 4WNNA 3UTBC 4Z66A 3KUYC 1JFIA 5AVBB 4H9SC 1F66D 1ULYA 5CPJD 3O62A 3RELC 1KX4A 1ID3B 4NFTA 1ZLAA 3WA9A 5AY8A 3UT9C 3AYWC 5B31B 4J8XA 5B24A 1M1AC 4LD9D 3C1BA 4YM6D 3B6GB 5CPKB 5B32G 5B1LD 3REKD 1AOID 2HUEB 4XUJB 2PYOC 1P3OD 5B0ZC 5AV6A 4Z66B 1JFIB 3B0CT 1S32A 4J8VC 1P3PB 5KDMA 3AZIC 3VH5A 3AZHC 3O62B 5CPIA 3VH6W 1KX4B 3AFAC 1HTAA 1ZLAB 3WA9B 4J8XB 5B24B 4H9PA 3TU4A 5JRGA 3MVDD 3W96D 4Z5TC 3WTPD 3LZ0D 2NZDC 3AV1C 1KX3C 1BH9A 1TZYB 2FJ7B 3X1UD 5F99D 5AV5D 5GSUC 2HIOC 1P3MD 1S32B 5BS7A 4J8UC 1U35D 3AV2B 5KDMB 3X1TC 3MGSD 1P3GA 5AV9D 1WWSA 5B32A 2AROD 3B6FD 1A7WA 1Q9CA 4YS3D 4WU8C 3A6ND 3KXBC 3AZEA 5B33B 1P3FB 3WKJD 3AZKA 4R8PC 4ZUXD 1M18C 3W98D 4QLCB 4DRBA 4H9PB 3AZND 3TU4B 5JRGB 5CPKC 5AVCA 3X1VA 2F8NG 1P3KC 5CP6A 1P3PC 3MGQA 3AN2A 4JJNC 5AVBD 4UUZB 1F66B 5B32B 3NQJB 5BNVB 3AZEB 5AV8C 2NQBB 1KX5C 1ID3D 5B31D 3REIB 1P34A 3REJC 5AVCB 3B6GD 1HQ3A 4XUJD 3MGPA 4Z2MG 2CV5A 5CP6B 1WWIA 4Z66D 5B0YA 3MGQB 3LJAC 1P3IA 5B40A 5C3IB 3REHA 3O62D 5DNNC 1KX4D 1ZLAD 3WA9D 5AY8D 4J8XD 5B24D 2IO5B 3C1CA 3C1BD 3LZ1A 3AYWA 1B6WA 4XZQA 1HQ3B 1TZYD 4HGAC 2FJ7D 3MGPB 2YFWA 4AWLB 5GT0A 5B0YB 1F66C 1S32D 1P3IB 1P3MB 4KUDA 2PYOA 2BYKA 3WTPE 3AV2D 3REHB 3AZFA 5CPJC 5BNXA 2F8NB 5DNMA 3B6FB 3AZLA 4G92B 5BO0A 1P3FD 3X1SA 5B33D 4ZUXB 4QLCD 3W98B 4LD9C 1P3AA 3C1CB 4YM6C 5JRGD 3TU4D 5B1LC 3REKC 1AOIC 1P3OC 2YFWB 3UTAA 2NZDA 5GT0B 1KX3A
chains in the Genus database with same CATH superfamily
3MNNB 2BYKB 3AZJA 3AZFB 5B32D 5BNXB 5DNMB 3AZGA 1BH8A 3AZED 3X1SB 1P3BA 3MGRA 1PZRA 1EQZA 2NQBD 1P3AB 3MVDC 3REID 3KXBA 3W96C 4KGCA 3WTPC 3LZ0C 5AVCD 4EO5C 4ZBJC 3X1UC 5F99C 4AWLC 5AV5C 1M19A 4DRAA 2ZY3A 4WNNB 5CP6D 1P3MC 3W99A 1U35C 1TAFA 3MGQD 3AN2D 3MGSC 4WJ3C 2Y2HA 5AV9C 3AZJB 2AROC 2Y2MA 3B6FC 4YS3C 2ZY4A 3A6NC 3AZGB 1BH8B 3WKJC 2XD1A 4X23A 2VQRA 4ZUXC 5BT1D 3W98C 3MGRB 1EQZB 2Y2IA 3AZNC 3WAAA 5AY8B 1P34D 3C1BB 1HQ3D 2CV5D 3MGPD 3W99B 1TAFB 5AV6B 5AVBC 5B0YD 5B2IA 1P3ID 5B40D 3REHD 3VH6A 5GT3A 2F8ND 3LJAA 4J8WA 5CPIB 1KU5A 1ID3C 1P3LA 3WAAB 5B31C 3LELA 3AZMA 5DNNA 3C1CD 3LZ1D 3B6GC 4XZQD 2HUEC 4XUJC 3R45A 1BH9B 3NQUA 3B0BA 1BFMA 4Z66C 5GT0D 2F8NH 3MNND 5B2IB 2G5HC 4WV4B 4KUDD 5E5AA 3AZFD 4WZSB 3O62C 1P3GB 5DNMD 4J8WB 1KX4C 3AZLD 3EPLA 1P3LB 1ZLAC 3X1SD 3WA9C 5AY8C 3AZKB 4J8XC 5B24C 3LELB 3AZMB 2BYMA 3C1BC 5B2JA 1P3AD 3W97A 1TZYC 4LD9A 2FJ7C 3R45B 3NQUB 3X1VB 5JA4A 4NE5A 3UTAD 2J8PA 2RIQA 5B1LA 3REKA 1S32C 5GXQA 1P3OA 3AV2C 1T3UA 4Z2MH 5B1MA 3AN2B 4WU9A 2BG1A 3KWQA 3AZJD 5E5AB 4E44A 2JSSA 3UTBA 3AZGD 3KUYA 1P3FC 5B33C 4H9OA 4H9SA 1P3BD 4QLCC 3MGRD 1EQZD 3KSYA 2W8SA 2BYMB 5JRGC 3B0DB 5B2JB 3TU4C 4KGCD 3RELA 3W97B 1P34B 1M19D 4NE3A 3UT9A 5JA4B 3LZ0A 1M1AA 5CHLB 2CV5B 3W99D 2Y2LA 5BS7C 5GXQB 5AV6D 5B1MB 4WU9B 3KWQB 5B32C 3IP4C 1N1JA 5B40B 2ZY2A 5B0ZA 4NE6A 2Y2JA 3H0MC 3MGSA 3KUYB 5AV9A 4H9OB 1H3OA 4X23D 3AZEC 5CPID 2NQBC 4J8VA 3AZIA 3WAAD 3A6NA 3REIC 3AZHA 3V9RA 5AVCC 2CWEA 3LZ1B 3AFAA 3AYWB 4XZQB 1M1AB 5CP6C 2Y2PA 3MGQC 3AN2C 4Z5TA 3AV1A 5B2ID 5C3IC 4KUDB 2PYOB 5GSUA 5B0ZB 1P3GD 5GT3D 2HIOA 5BT1C 1H3OB 1F1EA 4J8WD 4J8UA 4J8VB 3AZLB 1P3LD 2LY8A 3X1TA 5BO0B 2RVQD 3AZIB 3AZKD 3AZHB 1P34C 2IO5C 3V9RB 3LELD 3AZMD 2G5IC 3VH6T 4WU8A 4R8PA 1R4VA 1HQ3C 1M18A 2CV5C 3MGPC 3X1VD 5CPKA 5B0YC 3UTAB 2NZDB 3AV1B 1P3IC 1KX3B 5B40C 4H9NA 3REHC 5E5AD 5GSUB 1P3KA 2HIOB 4G92C 1P3PA 4J8UB 4JJNA 3X1TB 1P3BB 2YFVA 5FUGA 3VH5W 4E45A 3C1CC 5B2JD 4WU8B 3LZ1C 3KXBB 3W97D 4XZQC 5AV8A 4KGCB 4R8PB 1M18B 1KX5A 1M19B 4CSRA 3H0LC 5G49A 5GT0C 3REJA 1TZYA 3MNNC 2FJ7A 4KUDC 5GXQD 4CAYA 4H9NB 5B1MD 4WU9D 1W2EA 3KWQD 3AZFC 2UWXA 5DNMC 1P3KB 3UTBD 3AZLC 3AV2A 3KUYD 3X1SC 4JJNB 4X23B 2FFFB 2YFVB 5FUGB 1P3AC 1P3FA 5B33A 1B67A 3RELD 5AV8B 4QLCA 1KX5B 3AYWD 3UT9D 3UTAC 4CSRB 1M1AD 5G49B 3REJB 4CAYB 3B0CW 3AZJC 4M6BA 3AZGC 2PYOD 5B0ZD 4H9QA 5GT3B 4UUZA 1P3BC 3MGRC 3LJAB 1F66A 1EQZC 4J8VD 3NQJA 5BNVA 4DQYB 3AZID 5CPJA 3AZHD 4KGCC 2NQBA 5DNNB 2Y2OA 1M19C 3REIA 3AFAD 3W99C 4YM6A 5AV6C 4Z5TD 4KHAA 1AOIA 3AV1D 1KX3D 2NZDD 4HGAB 4H9RA 5GSUD 4H9QB 4X23C 5CPIC 2HIOD 3EPKA 4J8UD 3WAAC 3X1TD 5CPJB 2ZM5A 4WU8D 3KXBD 4G91B 4R8PD 1M18D 4LD9B 3MVDA 3W96A 4YM6B 3WTPA 5CPKD 5B2IC 4KHAB 5B1LB 3REKB 1AOIB 3X1UA 5F99A 5AV5A 1P3OB 2Y2NA 1P3GC 4H9RB 5GT3C 1P3KD 1P3MA 4J8WC 3UTBB 1U35A 1P3LC 1P3PD 5B31G 2RVQC 4JJND 3AZKC 2F8NA 2AROA 3LELC 3AZMC 3B6FA 4YS3A 3WKJA 2DF4C 4ZUXA 5AV8D 3RELB 3W98A 1KX5D 3AZNA 3X1VC 3MVDB 3UT9B 3W96B 3WTPB 3REJD 3LZ0B 4EO5B 4ZBJB 3X1UB 5F99B 5AV5B 5E5AC 3MNNA 1N1JB 1U35B 5AVBA 3A1IA 3MGSB 5AV9B 3LJAD 2AROB 4YS3B 3B0DC 5B2JC 3A6NB 3W97C 2L5AA 4G91C 3WKJB 5DNND 1ID3A 3VH5T 3AZNB 5B31A 3AFAB 2F8NK 1Z2CB 5GXQC 3B6GA 5B1MC 2DQNC 4WU9C 4Z5TB 3KWQC 4XUJA 4WNNA 3UTBC 4Z66A 3KUYC 1JFIA 5AVBB 4H9SC 1F66D 1ULYA 5CPJD 3O62A 3RELC 1KX4A 1ID3B 4NFTA 3EG5B 1ZLAA 5AY8A 3UT9C 3AYWC 5B31B 3WA9A 4J8XA 5B24A 1M1AC 4LD9D 3C1BA 3A1KA 4YM6D 3B6GB 5CPKB 5B32G 5B1LD 3EPHA 3REKD 1AOID 2HUEB 4XUJB 2PYOC 2F2AC 1P3OD 5B0ZC 5AV6A 4Z66B 1JFIB 3B0CT 1S32A 4J8VC 1P3PB 5KDMA 3AL0C 3AZIC 2JCHA 3VH5A 3AZHC 3O62B 5CPIA 3VH6W 1KX4B 3AFAC 1HTAA 1ZLAB 3WA9B 4J8XB 5B24B 4H9PA 3H0RC 3TU4A 5JRGA 3MVDD 3W96D 4Z5TC 3WTPD 3LZ0D 2NZDC 3AV1C 1KX3C 1BH9A 1TZYB 2FJ7B 3X1UD 5F99D 5AV5D 5GSUC 2HIOC 1P3MD 1S32B 5BS7A 4J8UC 1U35D 3AV2B 5KDMB 3X1TC 3MGSD 1P3GA 5AV9D 1WWSA 5B32A 2AROD 3B6FD 1A7WA 1Q9CA 4YS3D 4WU8C 3A6ND 3KXBC 3AZEA 5B33B 1P3FB 3WKJD 3AZKA 4R8PC 4ZUXD 1M18C 3W98D 4QLCB 4DRBA 4H9PB 3AZND 3TU4B 5JRGB 5CPKC 5AVCA 3X1VA 2F8NG 1P3KC 5CP6A 1P3PC 3EPJA 3MGQA 3AN2A 4JJNC 5AVBD 4UUZB 1F66B 5B32B 3NQJB 5BNVB 2Y2GA 3AZEB 5AV8C 2NQBB 3P5JB 1KX5C 1ID3D 5B31D 3REIB 1P34A 3REJC 5AVCB 3B6GD 1HQ3A 4XUJD 3MGPA 4Z2MG 2CV5A 5CP6B 2XD5A 1WWIA 4Z66D 5B0YA 3MGQB 3LJAC 1P3IA 5B40A 5C3IB 3REHA 3O62D 5DNNC 1KX4D 4UPKA 1ZLAD 3WA9D 5AY8D 4J8XD 5B24D 2IO5B 3C1CA 3C1BD 3LZ1A 3AYWA 1B6WA 4XZQA 1HQ3B 1TZYD 4HGAC 2FJ7D 2Y2QA 3MGPB 2YFWA 4AWLB 5GT0A 2ZY5A 5B0YB 1F66C 1S32D 1P3IB 1P3MB 4KUDA 2PYOA 2BYKA 3WTPE 3AV2D 3REHB 3AZFA 5CPJC 5BNXA 2F8NB 5DNMA 3KFUG 3B6FB 3AZLA 4G92B 5BO0A 1P3FD 3X1SA 5B33D 2Y2KA 3FDDA 4ZUXB 4QLCD 3W98B 4LD9C 2JE5A 1P3AA 3C1CB 4YM6C 5JRGD 3TU4D 5B1LC 3REKC 1AOIC 1P3OC 2YFWB 3F6TA 3UTAA 2NZDA 5GT0B 1KX3A
chains in the Genus database with same CATH topology
3MNNB 2BYKB 3AZJA 3AZFB 5B32D 5BNXB 5DNMB 3AZGA 1BH8A 3AZED 3X1SB 1P3BA 3MGRA 1PZRA 1EQZA 2NQBD 1P3AB 3MVDC 3REID 3KXBA 3W96C 4KGCA 3WTPC 3LZ0C 5AVCD 4EO5C 4ZBJC 3X1UC 5F99C 4AWLC 5AV5C 1M19A 4DRAA 2ZY3A 4WNNB 5CP6D 1P3MC 3W99A 1U35C 1TAFA 3MGQD 3AN2D 3MGSC 4WJ3C 2Y2HA 5AV9C 3AZJB 2AROC 2Y2MA 3B6FC 4YS3C 2ZY4A 3A6NC 3AZGB 1BH8B 3WKJC 2XD1A 4X23A 2VQRA 4ZUXC 5BT1D 3W98C 3MGRB 1EQZB 2Y2IA 3AZNC 3WAAA 5AY8B 1P34D 3C1BB 1HQ3D 2CV5D 3MGPD 3W99B 1TAFB 5AV6B 5AVBC 5B0YD 5B2IA 1P3ID 5B40D 3REHD 3VH6A 5GT3A 2F8ND 3LJAA 4J8WA 5CPIB 1KU5A 1ID3C 1P3LA 3WAAB 5B31C 3LELA 3AZMA 5DNNA 3C1CD 3LZ1D 3B6GC 4XZQD 2HUEC 4XUJC 3R45A 1BH9B 3NQUA 3B0BA 1BFMA 4Z66C 5GT0D 2F8NH 3MNND 5B2IB 2G5HC 4WV4B 4KUDD 5E5AA 3AZFD 4WZSB 3O62C 1P3GB 5DNMD 4J8WB 1KX4C 3AZLD 3EPLA 1P3LB 1ZLAC 3X1SD 3WA9C 5AY8C 3AZKB 4J8XC 5B24C 3LELB 3AZMB 2BYMA 3C1BC 5B2JA 1P3AD 3W97A 1TZYC 4LD9A 2FJ7C 3R45B 3NQUB 3X1VB 5JA4A 4NE5A 3UTAD 2J8PA 2RIQA 5B1LA 3REKA 1S32C 5GXQA 1P3OA 3AV2C 1T3UA 4Z2MH 5B1MA 3AN2B 4WU9A 2BG1A 3KWQA 3AZJD 5E5AB 4E44A 2JSSA 3UTBA 3AZGD 3KUYA 1P3FC 5B33C 4H9OA 4H9SA 1P3BD 4QLCC 3MGRD 1EQZD 3KSYA 2W8SA 2BYMB 5JRGC 3B0DB 5B2JB 3TU4C 4KGCD 3RELA 3W97B 1P34B 1M19D 4NE3A 3UT9A 5JA4B 3LZ0A 1M1AA 5CHLB 2CV5B 3W99D 2Y2LA 5BS7C 5GXQB 5AV6D 5B1MB 4WU9B 3KWQB 5B32C 3IP4C 1N1JA 5B40B 2ZY2A 5B0ZA 4NE6A 2Y2JA 3H0MC 3MGSA 3KUYB 5AV9A 4H9OB 1H3OA 4X23D 3AZEC 5CPID 2NQBC 4J8VA 3AZIA 3WAAD 3A6NA 3REIC 3AZHA 3V9RA 5AVCC 2CWEA 3LZ1B 3AFAA 3AYWB 4XZQB 1M1AB 5CP6C 2Y2PA 3MGQC 3AN2C 4Z5TA 3AV1A 5B2ID 5C3IC 4KUDB 2PYOB 5GSUA 5B0ZB 1P3GD 5GT3D 2HIOA 5BT1C 1H3OB 1F1EA 4J8WD 4J8UA 4J8VB 3AZLB 1P3LD 2LY8A 3X1TA 5BO0B 2RVQD 3AZIB 3AZKD 3AZHB 1P34C 2IO5C 3V9RB 3LELD 3AZMD 2G5IC 3VH6T 4WU8A 4R8PA 1R4VA 1HQ3C 1M18A 2CV5C 3MGPC 3X1VD 5CPKA 5B0YC 3UTAB 2NZDB 3AV1B 1P3IC 1KX3B 5B40C 4H9NA 3REHC 5E5AD 5GSUB 1P3KA 2HIOB 4G92C 1P3PA 4J8UB 4JJNA 3X1TB 1P3BB 2YFVA 5FUGA 3VH5W 4E45A 3C1CC 5B2JD 4WU8B 3LZ1C 3KXBB 3W97D 4XZQC 5AV8A 4KGCB 4R8PB 1M18B 1KX5A 1M19B 4CSRA 3H0LC 5G49A 5GT0C 3REJA 1TZYA 3MNNC 2FJ7A 4KUDC 5GXQD 4CAYA 4H9NB 5B1MD 4WU9D 1W2EA 3KWQD 3AZFC 2UWXA 5DNMC 1P3KB 3UTBD 3AZLC 3AV2A 3KUYD 3X1SC 4JJNB 4X23B 2FFFB 2YFVB 5FUGB 1P3AC 1P3FA 5B33A 1B67A 3RELD 5AV8B 4QLCA 1KX5B 3AYWD 3UT9D 3UTAC 4CSRB 1M1AD 5G49B 3REJB 4CAYB 3B0CW 3AZJC 4M6BA 3AZGC 2PYOD 5B0ZD 4H9QA 5GT3B 4UUZA 1P3BC 3MGRC 3LJAB 1F66A 1EQZC 4J8VD 3NQJA 5BNVA 4DQYB 3AZID 5CPJA 3AZHD 4KGCC 2NQBA 5DNNB 2Y2OA 1M19C 3REIA 3AFAD 3W99C 4YM6A 5AV6C 4Z5TD 4KHAA 1AOIA 3AV1D 1KX3D 2NZDD 4HGAB 4H9RA 5GSUD 4H9QB 4X23C 5CPIC 2HIOD 3EPKA 4J8UD 3WAAC 3X1TD 5CPJB 2ZM5A 4WU8D 3KXBD 4G91B 4R8PD 1M18D 4LD9B 3MVDA 3W96A 4YM6B 3WTPA 5CPKD 5B2IC 4KHAB 5B1LB 3REKB 1AOIB 3X1UA 5F99A 5AV5A 1P3OB 2Y2NA 1P3GC 4H9RB 5GT3C 1P3KD 1P3MA 4J8WC 3UTBB 1U35A 1P3LC 1P3PD 5B31G 2RVQC 4JJND 3AZKC 2F8NA 2AROA 3LELC 3AZMC 3B6FA 4YS3A 3WKJA 2DF4C 4ZUXA 5AV8D 3RELB 3W98A 1KX5D 3AZNA 3X1VC 3MVDB 3UT9B 3W96B 3WTPB 3REJD 3LZ0B 4EO5B 4ZBJB 3X1UB 5F99B 5AV5B 5E5AC 3MNNA 1N1JB 1U35B 5AVBA 3A1IA 3MGSB 5AV9B 3LJAD 2AROB 4YS3B 3B0DC 5B2JC 3A6NB 3W97C 2L5AA 4G91C 3WKJB 5DNND 1ID3A 3VH5T 3AZNB 5B31A 3AFAB 2F8NK 1Z2CB 5GXQC 3B6GA 5B1MC 2DQNC 4WU9C 4Z5TB 3KWQC 4XUJA 4WNNA 3UTBC 4Z66A 3KUYC 1JFIA 5AVBB 4H9SC 1F66D 1ULYA 5CPJD 3O62A 3RELC 1KX4A 1ID3B 4NFTA 3EG5B 1ZLAA 5AY8A 3UT9C 3AYWC 5B31B 3WA9A 4J8XA 5B24A 1M1AC 4LD9D 3C1BA 3A1KA 4YM6D 3B6GB 5CPKB 5B32G 5B1LD 3EPHA 3REKD 1AOID 2HUEB 4XUJB 2PYOC 2F2AC 1P3OD 5B0ZC 5AV6A 4Z66B 1JFIB 3B0CT 1S32A 4J8VC 1P3PB 5KDMA 3AL0C 3AZIC 2JCHA 3VH5A 3AZHC 3O62B 5CPIA 3VH6W 1KX4B 3AFAC 1HTAA 1ZLAB 3WA9B 4J8XB 5B24B 4H9PA 3H0RC 3TU4A 5JRGA 3MVDD 3W96D 4Z5TC 3WTPD 3LZ0D 2NZDC 3AV1C 1KX3C 1BH9A 1TZYB 2FJ7B 3X1UD 5F99D 5AV5D 5GSUC 2HIOC 1P3MD 1S32B 5BS7A 4J8UC 1U35D 3AV2B 5KDMB 3X1TC 3MGSD 1P3GA 5AV9D 1WWSA 5B32A 2AROD 3B6FD 1A7WA 1Q9CA 4YS3D 4WU8C 3A6ND 3KXBC 3AZEA 5B33B 1P3FB 3WKJD 3AZKA 4R8PC 4ZUXD 1M18C 3W98D 4QLCB 4DRBA 4H9PB 3AZND 3TU4B 5JRGB 5CPKC 5AVCA 3X1VA 2F8NG 1P3KC 5CP6A 1P3PC 3EPJA 3MGQA 3AN2A 4JJNC 5AVBD 4UUZB 1F66B 5B32B 3NQJB 5BNVB 2Y2GA 3AZEB 5AV8C 2NQBB 3P5JB 1KX5C 1ID3D 5B31D 3REIB 1P34A 3REJC 5AVCB 3B6GD 1HQ3A 4XUJD 3MGPA 4Z2MG 2CV5A 5CP6B 2XD5A 1WWIA 4Z66D 5B0YA 3MGQB 3LJAC 1P3IA 5B40A 5C3IB 3REHA 3O62D 5DNNC 1KX4D 4UPKA 1ZLAD 3WA9D 5AY8D 4J8XD 5B24D 2IO5B 3C1CA 3C1BD 3LZ1A 3AYWA 1B6WA 4XZQA 1HQ3B 1TZYD 4HGAC 2FJ7D 2Y2QA 3MGPB 2YFWA 4AWLB 5GT0A 2ZY5A 5B0YB 1F66C 1S32D 1P3IB 1P3MB 4KUDA 2PYOA 2BYKA 3WTPE 3AV2D 3REHB 3AZFA 5CPJC 5BNXA 2F8NB 5DNMA 3KFUG 3B6FB 3AZLA 4G92B 5BO0A 1P3FD 3X1SA 5B33D 2Y2KA 3FDDA 4ZUXB 4QLCD 3W98B 4LD9C 2JE5A 1P3AA 3C1CB 4YM6C 5JRGD 3TU4D 5B1LC 3REKC 1AOIC 1P3OC 2YFWB 3F6TA 3UTAA 2NZDA 5GT0B 1KX3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MNN B;  2BYK B;  3AZJ A;  3AZF B;  5B32 D;  5BNX B;  5DNM B;  3AZG A;  1BH8 A;  3AZE D;  3X1S B;  1P3B A;  3MGR A;  1EQZ A;  2NQB D;  1P3A B;  3MVD C;  3REI D;  3KXB A;  3W96 C;  4KGC A;  3WTP C;  3LZ0 C;  5AVC D;  4EO5 C;  4ZBJ C;  3X1U C;  5F99 C;  4AWL C;  5AV5 C;  1M19 A;  4DRA A;  5CP6 D;  4WNN B;  1P3M C;  3W99 A;  1U35 C;  1TAF A;  3MGQ D;  3AN2 D;  3MGS C;  5AV9 C;  3AZJ B;  2ARO C;  3B6F C;  4YS3 C;  3A6N C;  3AZG B;  1BH8 B;  3WKJ C;  4X23 A;  4ZUX C;  5BT1 D;  3W98 C;  3MGR B;  1EQZ B;  3AZN C;  3WAA A;  5AY8 B;  1P34 D;  3C1B B;  1HQ3 D;  2CV5 D;  3MGP D;  3W99 B;  1TAF B;  5AV6 B;  5AVB C;  5B0Y D;  5B2I A;  1P3I D;  5B40 D;  3REH D;  3VH6 A;  5GT3 A;  2F8N D;  3LJA A;  4J8W A;  5CPI B;  1KU5 A;  1ID3 C;  1P3L A;  3WAA B;  5B31 C;  3LEL A;  3AZM A;  5DNN A;  3C1C D;  3LZ1 D;  3B6G C;  4XZQ D;  2HUE C;  4XUJ C;  3R45 A;  1BH9 B;  3NQU A;  3B0B A;  1BFM A;  4Z66 C;  5GT0 D;  2F8N H;  3MNN D;  5B2I B;  4WV4 B;  4KUD D;  5E5A A;  3AZF D;  4WZS B;  3O62 C;  1P3G B;  5DNM D;  4J8W B;  1KX4 C;  3AZL D;  1P3L B;  1ZLA C;  3X1S D;  3WA9 C;  5AY8 C;  3AZK B;  4J8X C;  5B24 C;  3LEL B;  3AZM B;  2BYM A;  3C1B C;  5B2J A;  1P3A D;  3W97 A;  1TZY C;  4LD9 A;  2FJ7 C;  3R45 B;  3NQU B;  3X1V B;  5JA4 A;  4NE5 A;  3UTA D;  5B1L A;  3REK A;  1S32 C;  5GXQ A;  1P3O A;  3AV2 C;  4Z2M H;  5B1M A;  3AN2 B;  4WU9 A;  3KWQ A;  3AZJ D;  5E5A B;  4E44 A;  2JSS A;  3UTB A;  3AZG D;  3KUY A;  1P3F C;  5B33 C;  4H9O A;  4H9S A;  1P3B D;  4QLC C;  3MGR D;  1EQZ D;  3KSY A;  2BYM B;  5JRG C;  3B0D B;  5B2J B;  3TU4 C;  4KGC D;  3REL A;  3W97 B;  1P34 B;  1M19 D;  4NE3 A;  3UT9 A;  5JA4 B;  3LZ0 A;  1M1A A;  5CHL B;  2CV5 B;  3W99 D;  5BS7 C;  5GXQ B;  5AV6 D;  5B1M B;  4WU9 B;  3KWQ B;  5B32 C;  1N1J A;  5B40 B;  5B0Z A;  4NE6 A;  3KUY B;  3MGS A;  3AZE C;  5AV9 A;  4H9O B;  1H3O A;  4X23 D;  5CPI D;  2NQB C;  4J8V A;  3AZI A;  3WAA D;  3A6N A;  3REI C;  3AZH A;  3V9R A;  5AVC C;  2CWE A;  3LZ1 B;  3AFA A;  3AYW B;  4XZQ B;  1M1A B;  5CP6 C;  3MGQ C;  3AN2 C;  4Z5T A;  3AV1 A;  5B2I D;  5C3I C;  4KUD B;  2PYO B;  5GSU A;  5B0Z B;  1P3G D;  5GT3 D;  2HIO A;  5BT1 C;  1H3O B;  1F1E A;  4J8W D;  4J8U A;  4J8V B;  3AZL B;  1P3L D;  2LY8 A;  3X1T A;  5BO0 B;  2RVQ D;  3AZI B;  3AZK D;  3AZH B;  1P34 C;  2IO5 C;  3V9R B;  3LEL D;  3AZM D;  3VH6 T;  4WU8 A;  4R8P A;  1R4V A;  1HQ3 C;  1M18 A;  2CV5 C;  3MGP C;  3X1V D;  5CPK A;  5B0Y C;  3UTA B;  2NZD B;  3AV1 B;  1P3I C;  1KX3 B;  5B40 C;  4H9N A;  3REH C;  5E5A D;  5GSU B;  1P3K A;  2HIO B;  4G92 C;  1P3P A;  4J8U B;  4JJN A;  3X1T B;  1P3B B;  2YFV A;  5FUG A;  3VH5 W;  4E45 A;  3C1C C;  5B2J D;  4WU8 B;  3LZ1 C;  3KXB B;  3W97 D;  4XZQ C;  5AV8 A;  4KGC B;  4R8P B;  1M18 B;  1KX5 A;  1M19 B;  4CSR A;  5G49 A;  5GT0 C;  3REJ A;  1TZY A;  3MNN C;  2FJ7 A;  4KUD C;  5GXQ D;  4CAY A;  4H9N B;  5B1M D;  4WU9 D;  3AZF C;  3KWQ D;  5DNM C;  1P3K B;  3UTB D;  3AZL C;  3AV2 A;  3KUY D;  3X1S C;  4JJN B;  4X23 B;  2YFV B;  5FUG B;  1P3A C;  1P3F A;  5B33 A;  1B67 A;  3REL D;  5AV8 B;  4QLC A;  1KX5 B;  3AYW D;  3UT9 D;  3UTA C;  4CSR B;  1M1A D;  5G49 B;  3REJ B;  4CAY B;  3B0C W;  3AZJ C;  4M6B A;  3AZG C;  2PYO D;  5B0Z D;  4H9Q A;  5GT3 B;  4UUZ A;  1P3B C;  3MGR C;  3LJA B;  1F66 A;  1EQZ C;  4J8V D;  3NQJ A;  5BNV A;  3AZI D;  5CPJ A;  3AZH D;  4KGC C;  2NQB A;  5DNN B;  1M19 C;  3REI A;  3AFA D;  3W99 C;  4YM6 A;  5AV6 C;  4Z5T D;  4KHA A;  1AOI A;  3AV1 D;  1KX3 D;  2NZD D;  4HGA B;  4H9R A;  5GSU D;  4H9Q B;  4X23 C;  5CPI C;  2HIO D;  4J8U D;  3WAA C;  3X1T D;  5CPJ B;  4WU8 D;  3KXB D;  4G91 B;  4R8P D;  1M18 D;  4LD9 B;  3MVD A;  3W96 A;  4YM6 B;  3WTP A;  5CPK D;  5B2I C;  4KHA B;  5B1L B;  3REK B;  1AOI B;  3X1U A;  5F99 A;  5AV5 A;  1P3O B;  1P3G C;  4H9R B;  5GT3 C;  1P3K D;  1P3M A;  4J8W C;  3UTB B;  1U35 A;  1P3L C;  1P3P D;  5B31 G;  2RVQ C;  4JJN D;  3AZK C;  2F8N A;  2ARO A;  3LEL C;  3AZM C;  3B6F A;  4YS3 A;  3WKJ A;  4ZUX A;  5AV8 D;  3REL B;  3W98 A;  1KX5 D;  3AZN A;  3X1V C;  3MVD B;  3UT9 B;  3W96 B;  3WTP B;  3REJ D;  3LZ0 B;  4EO5 B;  4ZBJ B;  3X1U B;  5F99 B;  5AV5 B;  5E5A C;  3MNN A;  1N1J B;  1U35 B;  5AVB A;  3MGS B;  5AV9 B;  3LJA D;  2ARO B;  4YS3 B;  3B0D C;  5B2J C;  3A6N B;  3W97 C;  2L5A A;  4G91 C;  3WKJ B;  5DNN D;  1ID3 A;  3VH5 T;  3AZN B;  5B31 A;  3AFA B;  2F8N K;  5GXQ C;  3B6G A;  5B1M C;  4WU9 C;  4Z5T B;  3KWQ C;  4XUJ A;  4WNN A;  3UTB C;  4Z66 A;  3KUY C;  1JFI A;  5AVB B;  4H9S C;  1F66 D;  1ULY A;  5CPJ D;  3O62 A;  3REL C;  1KX4 A;  1ID3 B;  4NFT A;  1ZLA A;  3WA9 A;  5AY8 A;  3UT9 C;  3AYW C;  5B31 B;  4J8X A;  5B24 A;  1M1A C;  4LD9 D;  3C1B A;  4YM6 D;  3B6G B;  5CPK B;  5B32 G;  5B1L D;  3REK D;  1AOI D;  2HUE B;  4XUJ B;  2PYO C;  1P3O D;  5B0Z C;  5AV6 A;  4Z66 B;  1JFI B;  3B0C T;  1S32 A;  4J8V C;  1P3P B;  5KDM A;  3AZI C;  3VH5 A;  3AZH C;  3O62 B;  5CPI A;  3VH6 W;  1KX4 B;  3AFA C;  1HTA A;  1ZLA B;  3WA9 B;  4J8X B;  5B24 B;  4H9P A;  3TU4 A;  5JRG A;  3MVD D;  3W96 D;  4Z5T C;  3WTP D;  3LZ0 D;  2NZD C;  3AV1 C;  1KX3 C;  1BH9 A;  1TZY B;  2FJ7 B;  3X1U D;  5F99 D;  5AV5 D;  5GSU C;  2HIO C;  1P3M D;  1S32 B;  5BS7 A;  4J8U C;  1U35 D;  3AV2 B;  5KDM B;  3X1T C;  3MGS D;  1P3G A;  5AV9 D;  1WWS A;  5B32 A;  2ARO D;  3B6F D;  1A7W A;  1Q9C A;  4YS3 D;  4WU8 C;  3A6N D;  3KXB C;  3AZE A;  5B33 B;  1P3F B;  3WKJ D;  3AZK A;  4R8P C;  4ZUX D;  1M18 C;  3W98 D;  4QLC B;  4DRB A;  4H9P B;  3AZN D;  3TU4 B;  5JRG B;  5CPK C;  5AVC A;  3X1V A;  2F8N G;  1P3K C;  5CP6 A;  1P3P C;  3MGQ A;  3AN2 A;  4JJN C;  5AVB D;  4UUZ B;  1F66 B;  5B32 B;  3NQJ B;  5BNV B;  3AZE B;  5AV8 C;  2NQB B;  1KX5 C;  1ID3 D;  5B31 D;  3REI B;  1P34 A;  3REJ C;  5AVC B;  3B6G D;  1HQ3 A;  4XUJ D;  3MGP A;  4Z2M G;  2CV5 A;  5CP6 B;  1WWI A;  4Z66 D;  5B0Y A;  3MGQ B;  3LJA C;  1P3I A;  5B40 A;  5C3I B;  3REH A;  3O62 D;  5DNN C;  1KX4 D;  1ZLA D;  3WA9 D;  5AY8 D;  4J8X D;  5B24 D;  2IO5 B;  3C1C A;  3C1B D;  3LZ1 A;  3AYW A;  1B6W A;  4XZQ A;  1HQ3 B;  1TZY D;  4HGA C;  2FJ7 D;  3MGP B;  2YFW A;  4AWL B;  5GT0 A;  5B0Y B;  1F66 C;  1S32 D;  1P3I B;  1P3M B;  4KUD A;  2PYO A;  2BYK A;  3WTP E;  3AV2 D;  3REH B;  3AZF A;  5CPJ C;  5BNX A;  2F8N B;  5DNM A;  3B6F B;  3AZL A;  4G92 B;  5BO0 A;  1P3F D;  3X1S A;  5B33 D;  4ZUX B;  4QLC D;  3W98 B;  4LD9 C;  1P3A A;  3C1C B;  4YM6 C;  5JRG D;  3TU4 D;  5B1L C;  3REK C;  1AOI C;  1P3O C;  2YFW B;  3UTA A;  2NZD A;  5GT0 B;  1KX3 A; 
#chains in the Genus database with same CATH topology
 3MNN B;  2BYK B;  3AZJ A;  3AZF B;  5B32 D;  5BNX B;  5DNM B;  3AZG A;  1BH8 A;  3AZE D;  3X1S B;  1P3B A;  3MGR A;  1PZR A;  1EQZ A;  2NQB D;  1P3A B;  3MVD C;  3REI D;  3KXB A;  3W96 C;  4KGC A;  3WTP C;  3LZ0 C;  5AVC D;  4EO5 C;  4ZBJ C;  3X1U C;  5F99 C;  4AWL C;  5AV5 C;  1M19 A;  4DRA A;  2ZY3 A;  4WNN B;  5CP6 D;  1P3M C;  3W99 A;  1U35 C;  1TAF A;  3MGQ D;  3AN2 D;  3MGS C;  4WJ3 C;  2Y2H A;  5AV9 C;  3AZJ B;  2ARO C;  2Y2M A;  3B6F C;  4YS3 C;  2ZY4 A;  3A6N C;  3AZG B;  1BH8 B;  3WKJ C;  2XD1 A;  4X23 A;  2VQR A;  4ZUX C;  5BT1 D;  3W98 C;  3MGR B;  1EQZ B;  2Y2I A;  3AZN C;  3WAA A;  5AY8 B;  1P34 D;  3C1B B;  1HQ3 D;  2CV5 D;  3MGP D;  3W99 B;  1TAF B;  5AV6 B;  5AVB C;  5B0Y D;  5B2I A;  1P3I D;  5B40 D;  3REH D;  3VH6 A;  5GT3 A;  2F8N D;  3LJA A;  4J8W A;  5CPI B;  1KU5 A;  1ID3 C;  1P3L A;  3WAA B;  5B31 C;  3LEL A;  3AZM A;  5DNN A;  3C1C D;  3LZ1 D;  3B6G C;  4XZQ D;  2HUE C;  4XUJ C;  3R45 A;  1BH9 B;  3NQU A;  3B0B A;  1BFM A;  4Z66 C;  5GT0 D;  2F8N H;  3MNN D;  5B2I B;  2G5H C;  4WV4 B;  4KUD D;  5E5A A;  3AZF D;  4WZS B;  3O62 C;  1P3G B;  5DNM D;  4J8W B;  1KX4 C;  3AZL D;  3EPL A;  1P3L B;  1ZLA C;  3X1S D;  3WA9 C;  5AY8 C;  3AZK B;  4J8X C;  5B24 C;  3LEL B;  3AZM B;  2BYM A;  3C1B C;  5B2J A;  1P3A D;  3W97 A;  1TZY C;  4LD9 A;  2FJ7 C;  3R45 B;  3NQU B;  3X1V B;  5JA4 A;  4NE5 A;  3UTA D;  2J8P A;  2RIQ A;  5B1L A;  3REK A;  1S32 C;  5GXQ A;  1P3O A;  3AV2 C;  1T3U A;  4Z2M H;  5B1M A;  3AN2 B;  4WU9 A;  2BG1 A;  3KWQ A;  3AZJ D;  5E5A B;  4E44 A;  2JSS A;  3UTB A;  3AZG D;  3KUY A;  1P3F C;  5B33 C;  4H9O A;  4H9S A;  1P3B D;  4QLC C;  3MGR D;  1EQZ D;  3KSY A;  2W8S A;  2BYM B;  5JRG C;  3B0D B;  5B2J B;  3TU4 C;  4KGC D;  3REL A;  3W97 B;  1P34 B;  1M19 D;  4NE3 A;  3UT9 A;  5JA4 B;  3LZ0 A;  1M1A A;  5CHL B;  2CV5 B;  3W99 D;  2Y2L A;  5BS7 C;  5GXQ B;  5AV6 D;  5B1M B;  4WU9 B;  3KWQ B;  5B32 C;  3IP4 C;  1N1J A;  5B40 B;  2ZY2 A;  5B0Z A;  4NE6 A;  2Y2J A;  3H0M C;  3MGS A;  3KUY B;  5AV9 A;  4H9O B;  1H3O A;  4X23 D;  3AZE C;  5CPI D;  2NQB C;  4J8V A;  3AZI A;  3WAA D;  3A6N A;  3REI C;  3AZH A;  3V9R A;  5AVC C;  2CWE A;  3LZ1 B;  3AFA A;  3AYW B;  4XZQ B;  1M1A B;  5CP6 C;  2Y2P A;  3MGQ C;  3AN2 C;  4Z5T A;  3AV1 A;  5B2I D;  5C3I C;  4KUD B;  2PYO B;  5GSU A;  5B0Z B;  1P3G D;  5GT3 D;  2HIO A;  5BT1 C;  1H3O B;  1F1E A;  4J8W D;  4J8U A;  4J8V B;  3AZL B;  1P3L D;  2LY8 A;  3X1T A;  5BO0 B;  2RVQ D;  3AZI B;  3AZK D;  3AZH B;  1P34 C;  2IO5 C;  3V9R B;  3LEL D;  3AZM D;  2G5I C;  3VH6 T;  4WU8 A;  4R8P A;  1R4V A;  1HQ3 C;  1M18 A;  2CV5 C;  3MGP C;  3X1V D;  5CPK A;  5B0Y C;  3UTA B;  2NZD B;  3AV1 B;  1P3I C;  1KX3 B;  5B40 C;  4H9N A;  3REH C;  5E5A D;  5GSU B;  1P3K A;  2HIO B;  4G92 C;  1P3P A;  4J8U B;  4JJN A;  3X1T B;  1P3B B;  2YFV A;  5FUG A;  3VH5 W;  4E45 A;  3C1C C;  5B2J D;  4WU8 B;  3LZ1 C;  3KXB B;  3W97 D;  4XZQ C;  5AV8 A;  4KGC B;  4R8P B;  1M18 B;  1KX5 A;  1M19 B;  4CSR A;  3H0L C;  5G49 A;  5GT0 C;  3REJ A;  1TZY A;  3MNN C;  2FJ7 A;  4KUD C;  5GXQ D;  4CAY A;  4H9N B;  5B1M D;  4WU9 D;  1W2E A;  3KWQ D;  3AZF C;  2UWX A;  5DNM C;  1P3K B;  3UTB D;  3AZL C;  3AV2 A;  3KUY D;  3X1S C;  4JJN B;  4X23 B;  2FFF B;  2YFV B;  5FUG B;  1P3A C;  1P3F A;  5B33 A;  1B67 A;  3REL D;  5AV8 B;  4QLC A;  1KX5 B;  3AYW D;  3UT9 D;  3UTA C;  4CSR B;  1M1A D;  5G49 B;  3REJ B;  4CAY B;  3B0C W;  3AZJ C;  4M6B A;  3AZG C;  2PYO D;  5B0Z D;  4H9Q A;  5GT3 B;  4UUZ A;  1P3B C;  3MGR C;  3LJA B;  1F66 A;  1EQZ C;  4J8V D;  3NQJ A;  5BNV A;  4DQY B;  3AZI D;  5CPJ A;  3AZH D;  4KGC C;  2NQB A;  5DNN B;  2Y2O A;  1M19 C;  3REI A;  3AFA D;  3W99 C;  4YM6 A;  5AV6 C;  4Z5T D;  4KHA A;  1AOI A;  3AV1 D;  1KX3 D;  2NZD D;  4HGA B;  4H9R A;  5GSU D;  4H9Q B;  4X23 C;  5CPI C;  2HIO D;  3EPK A;  4J8U D;  3WAA C;  3X1T D;  5CPJ B;  2ZM5 A;  4WU8 D;  3KXB D;  4G91 B;  4R8P D;  1M18 D;  4LD9 B;  3MVD A;  3W96 A;  4YM6 B;  3WTP A;  5CPK D;  5B2I C;  4KHA B;  5B1L B;  3REK B;  1AOI B;  3X1U A;  5F99 A;  5AV5 A;  1P3O B;  2Y2N A;  1P3G C;  4H9R B;  5GT3 C;  1P3K D;  1P3M A;  4J8W C;  3UTB B;  1U35 A;  1P3L C;  1P3P D;  5B31 G;  2RVQ C;  4JJN D;  3AZK C;  2F8N A;  2ARO A;  3LEL C;  3AZM C;  3B6F A;  4YS3 A;  3WKJ A;  2DF4 C;  4ZUX A;  5AV8 D;  3REL B;  3W98 A;  1KX5 D;  3AZN A;  3X1V C;  3MVD B;  3UT9 B;  3W96 B;  3WTP B;  3REJ D;  3LZ0 B;  4EO5 B;  4ZBJ B;  3X1U B;  5F99 B;  5AV5 B;  5E5A C;  3MNN A;  1N1J B;  1U35 B;  5AVB A;  3A1I A;  3MGS B;  5AV9 B;  3LJA D;  2ARO B;  4YS3 B;  3B0D C;  5B2J C;  3A6N B;  3W97 C;  2L5A A;  4G91 C;  3WKJ B;  5DNN D;  1ID3 A;  3VH5 T;  3AZN B;  5B31 A;  3AFA B;  2F8N K;  1Z2C B;  5GXQ C;  3B6G A;  5B1M C;  2DQN C;  4WU9 C;  4Z5T B;  3KWQ C;  4XUJ A;  4WNN A;  3UTB C;  4Z66 A;  3KUY C;  1JFI A;  5AVB B;  4H9S C;  1F66 D;  1ULY A;  5CPJ D;  3O62 A;  3REL C;  1KX4 A;  1ID3 B;  4NFT A;  3EG5 B;  1ZLA A;  5AY8 A;  3UT9 C;  3AYW C;  5B31 B;  3WA9 A;  4J8X A;  5B24 A;  1M1A C;  4LD9 D;  3C1B A;  3A1K A;  4YM6 D;  3B6G B;  5CPK B;  5B32 G;  5B1L D;  3EPH A;  3REK D;  1AOI D;  2HUE B;  4XUJ B;  2PYO C;  2F2A C;  1P3O D;  5B0Z C;  5AV6 A;  4Z66 B;  1JFI B;  3B0C T;  1S32 A;  4J8V C;  1P3P B;  5KDM A;  3AL0 C;  3AZI C;  2JCH A;  3VH5 A;  3AZH C;  3O62 B;  5CPI A;  3VH6 W;  1KX4 B;  3AFA C;  1HTA A;  1ZLA B;  3WA9 B;  4J8X B;  5B24 B;  4H9P A;  3H0R C;  3TU4 A;  5JRG A;  3MVD D;  3W96 D;  4Z5T C;  3WTP D;  3LZ0 D;  2NZD C;  3AV1 C;  1KX3 C;  1BH9 A;  1TZY B;  2FJ7 B;  3X1U D;  5F99 D;  5AV5 D;  5GSU C;  2HIO C;  1P3M D;  1S32 B;  5BS7 A;  4J8U C;  1U35 D;  3AV2 B;  5KDM B;  3X1T C;  3MGS D;  1P3G A;  5AV9 D;  1WWS A;  5B32 A;  2ARO D;  3B6F D;  1A7W A;  1Q9C A;  4YS3 D;  4WU8 C;  3A6N D;  3KXB C;  3AZE A;  5B33 B;  1P3F B;  3WKJ D;  3AZK A;  4R8P C;  4ZUX D;  1M18 C;  3W98 D;  4QLC B;  4DRB A;  4H9P B;  3AZN D;  3TU4 B;  5JRG B;  5CPK C;  5AVC A;  3X1V A;  2F8N G;  1P3K C;  5CP6 A;  1P3P C;  3EPJ A;  3MGQ A;  3AN2 A;  4JJN C;  5AVB D;  4UUZ B;  1F66 B;  5B32 B;  3NQJ B;  5BNV B;  2Y2G A;  3AZE B;  5AV8 C;  2NQB B;  3P5J B;  1KX5 C;  1ID3 D;  5B31 D;  3REI B;  1P34 A;  3REJ C;  5AVC B;  3B6G D;  1HQ3 A;  4XUJ D;  3MGP A;  4Z2M G;  2CV5 A;  5CP6 B;  2XD5 A;  1WWI A;  4Z66 D;  5B0Y A;  3MGQ B;  3LJA C;  1P3I A;  5B40 A;  5C3I B;  3REH A;  3O62 D;  5DNN C;  1KX4 D;  4UPK A;  1ZLA D;  3WA9 D;  5AY8 D;  4J8X D;  5B24 D;  2IO5 B;  3C1C A;  3C1B D;  3LZ1 A;  3AYW A;  1B6W A;  4XZQ A;  1HQ3 B;  1TZY D;  4HGA C;  2FJ7 D;  2Y2Q A;  3MGP B;  2YFW A;  4AWL B;  5GT0 A;  2ZY5 A;  5B0Y B;  1F66 C;  1S32 D;  1P3I B;  1P3M B;  4KUD A;  2PYO A;  2BYK A;  3WTP E;  3AV2 D;  3REH B;  3AZF A;  5CPJ C;  5BNX A;  2F8N B;  5DNM A;  3KFU G;  3B6F B;  3AZL A;  4G92 B;  5BO0 A;  1P3F D;  3X1S A;  5B33 D;  2Y2K A;  3FDD A;  4ZUX B;  4QLC D;  3W98 B;  4LD9 C;  2JE5 A;  1P3A A;  3C1C B;  4YM6 C;  5JRG D;  3TU4 D;  5B1L C;  3REK C;  1AOI C;  1P3O C;  2YFW B;  3F6T A;  3UTA A;  2NZD A;  5GT0 B;  1KX3 A; 
#chains in the Genus database with same CATH homology
 3MNN B;  2BYK B;  3AZJ A;  3AZF B;  5B32 D;  5BNX B;  5DNM B;  3AZG A;  1BH8 A;  3AZE D;  3X1S B;  1P3B A;  3MGR A;  1PZR A;  1EQZ A;  2NQB D;  1P3A B;  3MVD C;  3REI D;  3KXB A;  3W96 C;  4KGC A;  3WTP C;  3LZ0 C;  5AVC D;  4EO5 C;  4ZBJ C;  3X1U C;  5F99 C;  4AWL C;  5AV5 C;  1M19 A;  4DRA A;  2ZY3 A;  4WNN B;  5CP6 D;  1P3M C;  3W99 A;  1U35 C;  1TAF A;  3MGQ D;  3AN2 D;  3MGS C;  4WJ3 C;  2Y2H A;  5AV9 C;  3AZJ B;  2ARO C;  2Y2M A;  3B6F C;  4YS3 C;  2ZY4 A;  3A6N C;  3AZG B;  1BH8 B;  3WKJ C;  2XD1 A;  4X23 A;  2VQR A;  4ZUX C;  5BT1 D;  3W98 C;  3MGR B;  1EQZ B;  2Y2I A;  3AZN C;  3WAA A;  5AY8 B;  1P34 D;  3C1B B;  1HQ3 D;  2CV5 D;  3MGP D;  3W99 B;  1TAF B;  5AV6 B;  5AVB C;  5B0Y D;  5B2I A;  1P3I D;  5B40 D;  3REH D;  3VH6 A;  5GT3 A;  2F8N D;  3LJA A;  4J8W A;  5CPI B;  1KU5 A;  1ID3 C;  1P3L A;  3WAA B;  5B31 C;  3LEL A;  3AZM A;  5DNN A;  3C1C D;  3LZ1 D;  3B6G C;  4XZQ D;  2HUE C;  4XUJ C;  3R45 A;  1BH9 B;  3NQU A;  3B0B A;  1BFM A;  4Z66 C;  5GT0 D;  2F8N H;  3MNN D;  5B2I B;  2G5H C;  4WV4 B;  4KUD D;  5E5A A;  3AZF D;  4WZS B;  3O62 C;  1P3G B;  5DNM D;  4J8W B;  1KX4 C;  3AZL D;  3EPL A;  1P3L B;  1ZLA C;  3X1S D;  3WA9 C;  5AY8 C;  3AZK B;  4J8X C;  5B24 C;  3LEL B;  3AZM B;  2BYM A;  3C1B C;  5B2J A;  1P3A D;  3W97 A;  1TZY C;  4LD9 A;  2FJ7 C;  3R45 B;  3NQU B;  3X1V B;  5JA4 A;  4NE5 A;  3UTA D;  2J8P A;  2RIQ A;  5B1L A;  3REK A;  1S32 C;  5GXQ A;  1P3O A;  3AV2 C;  1T3U A;  4Z2M H;  5B1M A;  3AN2 B;  4WU9 A;  2BG1 A;  3KWQ A;  3AZJ D;  5E5A B;  4E44 A;  2JSS A;  3UTB A;  3AZG D;  3KUY A;  1P3F C;  5B33 C;  4H9O A;  4H9S A;  1P3B D;  4QLC C;  3MGR D;  1EQZ D;  3KSY A;  2W8S A;  2BYM B;  5JRG C;  3B0D B;  5B2J B;  3TU4 C;  4KGC D;  3REL A;  3W97 B;  1P34 B;  1M19 D;  4NE3 A;  3UT9 A;  5JA4 B;  3LZ0 A;  1M1A A;  5CHL B;  2CV5 B;  3W99 D;  2Y2L A;  5BS7 C;  5GXQ B;  5AV6 D;  5B1M B;  4WU9 B;  3KWQ B;  5B32 C;  3IP4 C;  1N1J A;  5B40 B;  2ZY2 A;  5B0Z A;  4NE6 A;  2Y2J A;  3H0M C;  3MGS A;  3KUY B;  5AV9 A;  4H9O B;  1H3O A;  4X23 D;  3AZE C;  5CPI D;  2NQB C;  4J8V A;  3AZI A;  3WAA D;  3A6N A;  3REI C;  3AZH A;  3V9R A;  5AVC C;  2CWE A;  3LZ1 B;  3AFA A;  3AYW B;  4XZQ B;  1M1A B;  5CP6 C;  2Y2P A;  3MGQ C;  3AN2 C;  4Z5T A;  3AV1 A;  5B2I D;  5C3I C;  4KUD B;  2PYO B;  5GSU A;  5B0Z B;  1P3G D;  5GT3 D;  2HIO A;  5BT1 C;  1H3O B;  1F1E A;  4J8W D;  4J8U A;  4J8V B;  3AZL B;  1P3L D;  2LY8 A;  3X1T A;  5BO0 B;  2RVQ D;  3AZI B;  3AZK D;  3AZH B;  1P34 C;  2IO5 C;  3V9R B;  3LEL D;  3AZM D;  2G5I C;  3VH6 T;  4WU8 A;  4R8P A;  1R4V A;  1HQ3 C;  1M18 A;  2CV5 C;  3MGP C;  3X1V D;  5CPK A;  5B0Y C;  3UTA B;  2NZD B;  3AV1 B;  1P3I C;  1KX3 B;  5B40 C;  4H9N A;  3REH C;  5E5A D;  5GSU B;  1P3K A;  2HIO B;  4G92 C;  1P3P A;  4J8U B;  4JJN A;  3X1T B;  1P3B B;  2YFV A;  5FUG A;  3VH5 W;  4E45 A;  3C1C C;  5B2J D;  4WU8 B;  3LZ1 C;  3KXB B;  3W97 D;  4XZQ C;  5AV8 A;  4KGC B;  4R8P B;  1M18 B;  1KX5 A;  1M19 B;  4CSR A;  3H0L C;  5G49 A;  5GT0 C;  3REJ A;  1TZY A;  3MNN C;  2FJ7 A;  4KUD C;  5GXQ D;  4CAY A;  4H9N B;  5B1M D;  4WU9 D;  1W2E A;  3KWQ D;  3AZF C;  2UWX A;  5DNM C;  1P3K B;  3UTB D;  3AZL C;  3AV2 A;  3KUY D;  3X1S C;  4JJN B;  4X23 B;  2FFF B;  2YFV B;  5FUG B;  1P3A C;  1P3F A;  5B33 A;  1B67 A;  3REL D;  5AV8 B;  4QLC A;  1KX5 B;  3AYW D;  3UT9 D;  3UTA C;  4CSR B;  1M1A D;  5G49 B;  3REJ B;  4CAY B;  3B0C W;  3AZJ C;  4M6B A;  3AZG C;  2PYO D;  5B0Z D;  4H9Q A;  5GT3 B;  4UUZ A;  1P3B C;  3MGR C;  3LJA B;  1F66 A;  1EQZ C;  4J8V D;  3NQJ A;  5BNV A;  4DQY B;  3AZI D;  5CPJ A;  3AZH D;  4KGC C;  2NQB A;  5DNN B;  2Y2O A;  1M19 C;  3REI A;  3AFA D;  3W99 C;  4YM6 A;  5AV6 C;  4Z5T D;  4KHA A;  1AOI A;  3AV1 D;  1KX3 D;  2NZD D;  4HGA B;  4H9R A;  5GSU D;  4H9Q B;  4X23 C;  5CPI C;  2HIO D;  3EPK A;  4J8U D;  3WAA C;  3X1T D;  5CPJ B;  2ZM5 A;  4WU8 D;  3KXB D;  4G91 B;  4R8P D;  1M18 D;  4LD9 B;  3MVD A;  3W96 A;  4YM6 B;  3WTP A;  5CPK D;  5B2I C;  4KHA B;  5B1L B;  3REK B;  1AOI B;  3X1U A;  5F99 A;  5AV5 A;  1P3O B;  2Y2N A;  1P3G C;  4H9R B;  5GT3 C;  1P3K D;  1P3M A;  4J8W C;  3UTB B;  1U35 A;  1P3L C;  1P3P D;  5B31 G;  2RVQ C;  4JJN D;  3AZK C;  2F8N A;  2ARO A;  3LEL C;  3AZM C;  3B6F A;  4YS3 A;  3WKJ A;  2DF4 C;  4ZUX A;  5AV8 D;  3REL B;  3W98 A;  1KX5 D;  3AZN A;  3X1V C;  3MVD B;  3UT9 B;  3W96 B;  3WTP B;  3REJ D;  3LZ0 B;  4EO5 B;  4ZBJ B;  3X1U B;  5F99 B;  5AV5 B;  5E5A C;  3MNN A;  1N1J B;  1U35 B;  5AVB A;  3A1I A;  3MGS B;  5AV9 B;  3LJA D;  2ARO B;  4YS3 B;  3B0D C;  5B2J C;  3A6N B;  3W97 C;  2L5A A;  4G91 C;  3WKJ B;  5DNN D;  1ID3 A;  3VH5 T;  3AZN B;  5B31 A;  3AFA B;  2F8N K;  1Z2C B;  5GXQ C;  3B6G A;  5B1M C;  2DQN C;  4WU9 C;  4Z5T B;  3KWQ C;  4XUJ A;  4WNN A;  3UTB C;  4Z66 A;  3KUY C;  1JFI A;  5AVB B;  4H9S C;  1F66 D;  1ULY A;  5CPJ D;  3O62 A;  3REL C;  1KX4 A;  1ID3 B;  4NFT A;  3EG5 B;  1ZLA A;  5AY8 A;  3UT9 C;  3AYW C;  5B31 B;  3WA9 A;  4J8X A;  5B24 A;  1M1A C;  4LD9 D;  3C1B A;  3A1K A;  4YM6 D;  3B6G B;  5CPK B;  5B32 G;  5B1L D;  3EPH A;  3REK D;  1AOI D;  2HUE B;  4XUJ B;  2PYO C;  2F2A C;  1P3O D;  5B0Z C;  5AV6 A;  4Z66 B;  1JFI B;  3B0C T;  1S32 A;  4J8V C;  1P3P B;  5KDM A;  3AL0 C;  3AZI C;  2JCH A;  3VH5 A;  3AZH C;  3O62 B;  5CPI A;  3VH6 W;  1KX4 B;  3AFA C;  1HTA A;  1ZLA B;  3WA9 B;  4J8X B;  5B24 B;  4H9P A;  3H0R C;  3TU4 A;  5JRG A;  3MVD D;  3W96 D;  4Z5T C;  3WTP D;  3LZ0 D;  2NZD C;  3AV1 C;  1KX3 C;  1BH9 A;  1TZY B;  2FJ7 B;  3X1U D;  5F99 D;  5AV5 D;  5GSU C;  2HIO C;  1P3M D;  1S32 B;  5BS7 A;  4J8U C;  1U35 D;  3AV2 B;  5KDM B;  3X1T C;  3MGS D;  1P3G A;  5AV9 D;  1WWS A;  5B32 A;  2ARO D;  3B6F D;  1A7W A;  1Q9C A;  4YS3 D;  4WU8 C;  3A6N D;  3KXB C;  3AZE A;  5B33 B;  1P3F B;  3WKJ D;  3AZK A;  4R8P C;  4ZUX D;  1M18 C;  3W98 D;  4QLC B;  4DRB A;  4H9P B;  3AZN D;  3TU4 B;  5JRG B;  5CPK C;  5AVC A;  3X1V A;  2F8N G;  1P3K C;  5CP6 A;  1P3P C;  3EPJ A;  3MGQ A;  3AN2 A;  4JJN C;  5AVB D;  4UUZ B;  1F66 B;  5B32 B;  3NQJ B;  5BNV B;  2Y2G A;  3AZE B;  5AV8 C;  2NQB B;  3P5J B;  1KX5 C;  1ID3 D;  5B31 D;  3REI B;  1P34 A;  3REJ C;  5AVC B;  3B6G D;  1HQ3 A;  4XUJ D;  3MGP A;  4Z2M G;  2CV5 A;  5CP6 B;  2XD5 A;  1WWI A;  4Z66 D;  5B0Y A;  3MGQ B;  3LJA C;  1P3I A;  5B40 A;  5C3I B;  3REH A;  3O62 D;  5DNN C;  1KX4 D;  4UPK A;  1ZLA D;  3WA9 D;  5AY8 D;  4J8X D;  5B24 D;  2IO5 B;  3C1C A;  3C1B D;  3LZ1 A;  3AYW A;  1B6W A;  4XZQ A;  1HQ3 B;  1TZY D;  4HGA C;  2FJ7 D;  2Y2Q A;  3MGP B;  2YFW A;  4AWL B;  5GT0 A;  2ZY5 A;  5B0Y B;  1F66 C;  1S32 D;  1P3I B;  1P3M B;  4KUD A;  2PYO A;  2BYK A;  3WTP E;  3AV2 D;  3REH B;  3AZF A;  5CPJ C;  5BNX A;  2F8N B;  5DNM A;  3KFU G;  3B6F B;  3AZL A;  4G92 B;  5BO0 A;  1P3F D;  3X1S A;  5B33 D;  2Y2K A;  3FDD A;  4ZUX B;  4QLC D;  3W98 B;  4LD9 C;  2JE5 A;  1P3A A;  3C1C B;  4YM6 C;  5JRG D;  3TU4 D;  5B1L C;  3REK C;  1AOI C;  1P3O C;  2YFW B;  3F6T A;  3UTA A;  2NZD A;  5GT0 B;  1KX3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...