4UUZA

Mcm2-histone complex
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
78
structure length
78
Chain Sequence
b'STELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGER'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HISTONE H3
publication title Structural Insight Into How the Human Helicase Subunit Mcm2 May Act as a Histone Chaperone Together with Asf1 at the Replication Fork.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Dna binding protein
total genus 24
structure length 78
sequence length 78
ec nomenclature
pdb deposition date 2014-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4uuzA00
4XUJD 5B0ZC 4JJNA 5B31D 5B0ZB 3MVDA 1P3KA 1TAFA 1F66A 1P3IB 1P3GC 5B2JC 1HQ3C 3AFAA 2NQBB 5C3IC 3REHD 1B6WA 1HQ3B 3AN2B 3WTPA 4J8VA 3A6NA 2CV5B 4JJNC 3LZ1D 1KX5C 1P3KC 3AZLA 3AFAC 5AV8D 3MNND 4CSRA 5BO0B 5B0YD 5B40A 2PYOB 5AVBC 5E5AA 3AYWA 1P3BB 1AOIC 2YFVB 5AVBB 4WU8C 3UTBB 1AOIB 3AZJD 3AV1D 3REKB 4WU8B 1M19A 5AV5B 5B40C 4ZUXA 5CPIB 5E5AC 5B31G 3MVDD 1F66D 2HIOC 4KUDB 4H9QA 1M19C 3WTPD 4J8VD 4ZUXC 3X1UA 3A6ND 2BYKB 1P3MD 3AZNA 1P34A 2IO5C 3KWQA 3AZIA 3AZKA 3AZFA 3AZLD 2NZDA 1N1JB 2AROA 1M1AB 4H9RB 4M6BA 3AYWD 3AZNC 3NQJA 3VH5W 5GT0A 5DNMD 3KWQC 5GXQA 3R45B 1TZYA 3LELA 4Z5TB 4LD9A 1BH8B 1S32A 4HGAC 3KXBD 4ZBJB 4AWLC 5KDMB 4HGAB 5B32A 4AWLB 3AZMC 1WWIA 4H9PB 4H9NA 3AZMB 1HTAA 3X1UD 3AV2B 5JRGB 1S32C 3MGRA 1P34D 3AZKD 3AZID 3AZFD 2NZDD 5CPJB 5B32C 1P3OA 4J8UA 2AROD 3W98D 3B6FA 3MGSB 5AY8A 1KX3C 2FJ7C 4J8XA 1KX3B 2FJ7B 3LZ0A 3MGRC 5B24B 5G49B 5GT0D 3AZEB 3REIC 5GXQD 4WU9B 4WZSB 2YFWB 3UT9A 2JSSA 4J8UC 3REIB 4Z66A 3MGQA 5GSUA 3TU4D 1TZYD 5AVCD 3LELD 3WA9D 1B67A 4LD9D 3LJAC 3MGPA 3B6GA 5BNVA 3LJAB 4QLCC 5AV6C 5GT3A 4WNNA 3C1BC 4QLCB 2RVQC 4J8WB 4Z66C 5GSUC 1BFMA 4NFTA 3MGPC 5CPKA 3MGRD 4G91C 5B1LB 4G91B 5GT3C 1P3OD 3B6FD 1KU5A 5AY8D 1WWSA 3X1VB 1P3AA 3W99C 3RELA 1P3PA 4YS3B 4J8XD 4X23B 3KUYA 3LZ0D 1KX4B 1Q9CA 3UT9D 3X1SC 5B0ZA 3MGQD 3RELC 4KHAB 3X1SB 1EQZB 3B0BA 2NQBA 1HQ3A 3AZHC 3KUYC 3AN2A 3B6GD 4XZQD 3AZHB 2CV5A 5BS7C 1H3OA 1P3IC 3REJC 1KX5A 4XUJB 2NQBC 3REJB 5BT1C 3AN2C 5CPKD 2PYOA 2BYMB 3WAAC 4H9OB 2CV5C 5F99D 5AV9D 2YFVA 5AVBA 3WAAB 3REHB 3UTBA 1AOIA 3W96C 1P3AD 1P3PD 1ZLAD 3C1CD 4WU8A 3W96B 5AV5A 4YM6D 5B1MD 2PYOC 1P3BC 3W97D 3MNNB 4E44A 3UTBC 5B0ZD 3REKC 4KUDA 2HIOA 5DNNC 1P3GD 5B2JD 1HQ3D 5AV5C 5DNNB 5CPIC 2BYKA 5B33C 4NE6A 5B33B 4JJND 1KX5D 1N1JA 4KUDC 1P3KD 1M1AA 4H9SC 3AFAD 4H9RA 4Z2MG 1F66B 5B2IC 5AVBD 5B2IB 5FUGA 1AOID 2F8NB 3WTPB 4WU8D 1P3MB 3R45A 3O62C 1M1AC 4Z5TA 3O62B 1BH8A 5B40D 5E5AD 5KDMA 3AYWB 2HIOD 5CHLB 4H9PA 3AZMA 1A7WA 4Z5TC 5DNMB 1M19D 1JFIB 5JRGA 4ZUXD 4ZBJC 1U35C 1ID3C 3UTAC 1U35B 5CPJA 1P3FC 1ID3B 3KXBB 3UTAB 3X1TC 1P3FB 3AV2C 1KX3A 3X1TB 2FJ7A 5JRGC 5B24A 5G49A 4H9QB 3AZEA 3AZND 4WU9A 5CPJC 3KWQD 3REIA 3MGSC 4DRBA 4KGCC 4KGCB 3W98B 5B24C 3LJAA 3AZEC 4WU9C 4QLCA 4J8WA 5AV6A 3C1BA 3AZMD 2L5AA 4DRAA 4CAYB 3TU4B 5B1LA 1TZYB 5AVCB 1S32D 3WA9B 4Z2MH 4J8WC 3X1VA 5B32D 4YS3A 4X23A 3NQUB 1KX3D 3W99A 4UUZB 2FJ7D 1P3LC 5BNXB 1KX4A 5B1LC 4H9NB 1P3LB 3REID 4NE5A 3X1VC 3AZGC 4J8UD 2HUEC 1R4VA 4KHAA 3X1SA 4YS3C 4X23C 1EQZA 4R8PC 3AZGB 2HUEB 3B0CT 1P3OB 4R8PB 5AY8B 1KX4C 3LJAD 3AZHA 4J8XB 1BH9B 4QLCD 5BS7A 5AV6D 3C1BD 2RVQD 5CP6C 4Z66D 4XUJA 5GSUD 3REJA 3UT9B 1P3IA 1EQZC 5CP6B 2BYMA 3B0DB 4H9OA 3MGPD 3WKJC 3WAAA 3REHA 5B32G 1M18C 5JA4B 5GT3D 4XZQB 3WKJB 1M18B 3W96A 4YS3D 4X23D 4XUJC 3W99D 5B31C 5BO0A 5B31B 3MNNA 1P3BA 3REHC 5CPKB 3X1SD 5F99B 5AV9B 3REKA 3RELD 3LZ1C 5DNNA 1ZLAB 3LZ1B 3C1CB 3KUYD 3AZHD 5AV8C 5CPIA 3MNNC 5B0YC 5B1MB 5AV8B 5B33A 4YM6B 2LY8A 5B0YB 3W97B 1P3ID 3REJD 3V9RB 3VH6A 2NQBD 4H9SA 5BT1D 3AZJC 3AN2D 3AV1C 3AZJB 3AV1B 3WAAD 1P3GB 5B2JB 5B2IA 2CV5D 2F8NA 5C3IB 1P3MA 3W96D 1H3OB 4NE3A 3O62A 3MVDC 1F66C 4JJNB 1KX5B 2PYOD 3MVDB 1P3KB 1TAFB 1P3BD 3AFAB 3WTPC 4J8VC 3A6NC 2CWEA 3UTBD 1P3MC 4J8VB 3A6NB 3REKD 5DNMA 5DNND 5AV5D 3AZLC 1JFIA 5CPID 3AZLB 5B33D 4CSRB 1U35A 3AYWC 5B40B 3KXBA 4WV4B 3UTAA 1ID3A 3KSYA 5E5AB 1P3FA 5DNMC 4KUDD 3X1TA 3AV2A 2HIOB 5B2ID 2F8ND 1ULYA 1M19B 4ZUXB 3KXBC 3MGSA 3O62D 1M1AD 4KGCA 2IO5B 2F8NK 3W98A 3X1UC 1F1EA 2YFWA 3X1UB 1P34C 3AZKC 5FUGB 3AZFC 3AZNB 3AZIC 4CAYA 2NZDC 1P34B 4Z5TD 3KWQB 3AZIB 3AZKB 2AROC 3AZFB 3W98C 3TU4A 2NZDB 5AVCA 2AROB 3WA9A 1U35D 1ID3D 3UTAD 1P3FD 5GT0C 5GXQC 3NQJB 3NQUA 3X1TD 5GT0B 4UUZA 3VH5T 3AV2D 5GXQB 5BNXA 2F8NG 3TU4C 1TZYC 5AVCC 5JRGD 3LELC 1P3LA 3WA9C 4LD9C 3LELB 5CPJD 4LD9B 3MGSD 3B0CW 1S32B 4KGCD 3AZGA 4E45A 3VH5A 4R8PA 5B32B 5B24D 1BH9A 3AZED 4WU9D 3MGRB 3WTPE 5CP6A 1P3OC 3B6FC 5AY8C 4J8UB 3B6FB 4J8XC 5JA4A 3LZ0C 4XZQA 3WKJA 4J8WD 1M18A 3LZ0B 3UT9C 4G92C 5AV6B 3B0DC 3MGQC 3C1BB 5B31A 4G92B 1P3LD 4Z66B 3MGQB 5GSUB 5B1LD 3B6GC 4XZQC 3MGPB 5F99A 3B6GB 3X1VD 5AV9A 3VH6W 3AZGD 5BNVB 5GT3B 4WNNB 4R8PD 1ZLAA 3LZ1A 3C1CA 1KX4D 3W99B 4YM6A 5B1MA 5AV8A 5CPKC 5B0YA 3W97A 5F99C 5AV9C 3V9RA 5CP6D 1EQZD 1P3AC 1P3PC 1ZLAC 3C1CC 3VH6T 1P3AB 3AZJA 3AV1A 1P3PB 1P3GA 5B2JA 3RELB 4YM6C 5B1MC 2F8NH 3WKJD 4EO5C 1M18D 3KUYB 3W97C 4EO5B
chains in the Genus database with same CATH superfamily
4XUJD 5B0ZC 4JJNA 5B31D 5B0ZB 3MVDA 1P3KA 1TAFA 1F66A 1P3IB 1P3GC 5B2JC 1HQ3C 3AFAA 2NQBB 5C3IC 3REHD 1B6WA 1HQ3B 3IP4C 3AN2B 3WTPA 4J8VA 3A6NA 2CV5B 4JJNC 3LZ1D 1KX5C 1P3KC 3AZLA 3AFAC 5AV8D 3MNND 4CSRA 5BO0B 5B0YD 5B40A 2PYOB 5AVBC 5E5AA 3AYWA 1P3BB 1AOIC 3KFUG 2YFVB 5AVBB 4WU8C 3UTBB 1AOIB 3AZJD 3AV1D 3REKB 4WU8B 1M19A 5AV5B 5B40C 4ZUXA 5CPIB 5E5AC 5B31G 3MVDD 1F66D 2HIOC 4KUDB 3EG5B 4H9QA 1M19C 3WTPD 4J8VD 4ZUXC 3X1UA 3A6ND 2BYKB 1P3MD 3AZNA 1P34A 2IO5C 3KWQA 3AZIA 3AZKA 3AZFA 3AZLD 2NZDA 1N1JB 2AROA 1M1AB 4H9RB 4M6BA 3AYWD 3AZNC 2JCHA 3NQJA 3VH5W 5GT0A 3P5JB 5DNMD 3A1IA 3KWQC 5GXQA 3R45B 4WJ3C 1TZYA 2JE5A 3LELA 4Z5TB 4LD9A 1BH8B 1S32A 4HGAC 3KXBD 4ZBJB 4AWLC 5KDMB 4HGAB 3EPLA 5B32A 4AWLB 3AZMC 1W2EA 1WWIA 4H9PB 4H9NA 3AZMB 1HTAA 3X1UD 3AV2B 5JRGB 1S32C 3MGRA 1P34D 3AZKD 3AZID 3EPKA 3AZFD 2NZDD 5CPJB 5B32C 1P3OA 4J8UA 2AROD 3W98D 3B6FA 3MGSB 5AY8A 1KX3C 2FJ7C 4J8XA 1KX3B 2XD5A 2FJ7B 3LZ0A 2BG1A 3MGRC 5B24B 5G49B 5GT0D 3AZEB 3REIC 5GXQD 4WU9B 4WZSB 2YFWB 3UT9A 2JSSA 4J8UC 3REIB 4Z66A 3MGQA 5GSUA 3TU4D 1TZYD 5AVCD 3LELD 3WA9D 1B67A 1Z2CB 2Y2KA 4LD9D 3LJAC 3MGPA 3B6GA 2Y2MA 5BNVA 3LJAB 4QLCC 3EPHA 5AV6C 5GT3A 4WNNA 3C1BC 2RVQC 4QLCB 4J8WB 4Z66C 5GSUC 1BFMA 3A1KA 4NFTA 3MGPC 5CPKA 3MGRD 2ZY4A 4G91C 5B1LB 4UPKA 4G91B 5GT3C 1P3OD 3B6FD 1KU5A 5AY8D 1WWSA 3X1VB 1P3AA 3W99C 3RELA 1P3PA 4YS3B 4J8XD 4X23B 3KUYA 3LZ0D 1KX4B 1Q9CA 3UT9D 3X1SC 5B0ZA 3MGQD 3RELC 4KHAB 3X1SB 1EQZB 2G5IC 3B0BA 2NQBA 1HQ3A 3AZHC 3KUYC 3AN2A 3B6GD 4XZQD 3AZHB 2CV5A 5BS7C 1H3OA 1P3IC 2Y2LA 3REJC 1KX5A 4XUJB 2NQBC 3REJB 5BT1C 3AN2C 5CPKD 2PYOA 2BYMB 3WAAC 4H9OB 2CV5C 5F99D 5AV9D 2YFVA 5AVBA 3WAAB 3REHB 3UTBA 1AOIA 3W96C 1P3AD 1P3PD 1ZLAD 3C1CD 4WU8A 3W96B 2Y2QA 5AV5A 4YM6D 5B1MD 2PYOC 1P3BC 3W97D 3MNNB 4E44A 3UTBC 5B0ZD 2DF4C 3REKC 4KUDA 2HIOA 5DNNC 1P3GD 5B2JD 5AV5C 1HQ3D 5DNNB 3H0MC 5CPIC 2BYKA 5B33C 4NE6A 5B33B 4JJND 1KX5D 1N1JA 4KUDC 1P3KD 1M1AA 4H9SC 3AFAD 4H9RA 4Z2MG 1F66B 5B2IC 5AVBD 5B2IB 5FUGA 1AOID 2F8NB 3WTPB 4WU8D 1P3MB 3R45A 3O62C 1M1AC 4Z5TA 3O62B 1BH8A 5B40D 5E5AD 5KDMA 3AYWB 2HIOD 5CHLB 2Y2IA 4H9PA 3AZMA 1A7WA 4Z5TC 5DNMB 1M19D 1JFIB 5JRGA 4ZUXD 4ZBJC 1U35C 1ID3C 3UTAC 1U35B 5CPJA 1P3FC 1ID3B 3KXBB 3UTAB 3X1TC 2F2AC 1P3FB 3AV2C 1KX3A 3X1TB 2FJ7A 5JRGC 5B24A 5G49A 4H9QB 3AZEA 3AZND 4WU9A 5CPJC 3KWQD 3REIA 3MGSC 4DRBA 4KGCC 4KGCB 3W98B 5B24C 3LJAA 3AZEC 4WU9C 4QLCA 4J8WA 5AV6A 3AL0C 3C1BA 3AZMD 2L5AA 4DRAA 4CAYB 3TU4B 5B1LA 1TZYB 5AVCB 1S32D 3WA9B 4Z2MH 4J8WC 2W8SA 3X1VA 5B32D 4YS3A 4X23A 3NQUB 1KX3D 3W99A 4UUZB 2FJ7D 1P3LC 5BNXB 1KX4A 5B1LC 4H9NB 1P3LB 3REID 4NE5A 2DQNC 3X1VC 3AZGC 4J8UD 2HUEC 1R4VA 2J8PA 4KHAA 3X1SA 4YS3C 4X23C 1EQZA 4R8PC 3AZGB 2HUEB 3B0CT 1P3OB 4R8PB 5AY8B 1KX4C 3LJAD 3AZHA 4J8XB 1BH9B 4QLCD 5BS7A 5AV6D 1PZRA 3C1BD 2RVQD 5CP6C 4Z66D 4XUJA 5GSUD 3REJA 3UT9B 1P3IA 1EQZC 5CP6B 2BYMA 3B0DB 4H9OA 3MGPD 3WKJC 3WAAA 3REHA 5B32G 1M18C 5JA4B 5GT3D 4XZQB 3WKJB 1M18B 3W96A 4YS3D 4X23D 4XUJC 3W99D 5B31C 5BO0A 5B31B 3MNNA 2Y2JA 1P3BA 3REHC 5CPKB 3X1SD 5F99B 5AV9B 3REKA 3RELD 3LZ1C 5DNNA 1ZLAB 3LZ1B 3C1CB 3KUYD 2Y2HA 3AZHD 3H0LC 5AV8C 3MNNC 5CPIA 2Y2GA 5B0YC 5B1MB 5AV8B 5B33A 4YM6B 2LY8A 5B0YB 3W97B 1P3ID 3REJD 3V9RB 3VH6A 2NQBD 4H9SA 5BT1D 3AZJC 3AN2D 3AV1C 3AZJB 3AV1B 3WAAD 1P3GB 5B2JB 5B2IA 2CV5D 2F8NA 5C3IB 2ZY2A 1P3MA 3W96D 1H3OB 4NE3A 3O62A 3MVDC 1F66C 4JJNB 1KX5B 2Y2PA 2PYOD 3MVDB 1P3KB 1TAFB 3EPJA 1P3BD 3AFAB 3WTPC 4J8VC 3A6NC 2CWEA 3UTBD 1P3MC 4J8VB 3A6NB 3REKD 4DQYB 5DNMA 5DNND 5AV5D 3AZLC 1JFIA 3F6TA 2Y2NA 5CPID 3AZLB 5B33D 4CSRB 1U35A 3AYWC 5B40B 3KXBA 4WV4B 3UTAA 1ID3A 3KSYA 5E5AB 1P3FA 5DNMC 4KUDD 3X1TA 3AV2A 2HIOB 5B2ID 2F8ND 1ULYA 1M19B 4ZUXB 3KXBC 3MGSA 3O62D 1M1AD 4KGCA 2IO5B 2F8NK 3W98A 2Y2OA 3X1UC 1F1EA 2ZY5A 2YFWA 3X1UB 1P34C 3AZKC 5FUGB 3AZFC 3AZNB 3AZIC 4CAYA 2NZDC 1P34B 4Z5TD 3KWQB 3AZIB 3AZKB 2AROC 3AZFB 3W98C 2G5HC 3TU4A 2NZDB 5AVCA 2AROB 3WA9A 1U35D 1ID3D 3UTAD 1P3FD 5GT0C 5GXQC 3NQJB 3NQUA 3X1TD 5GT0B 4UUZA 3VH5T 2ZY3A 5GXQB 5BNXA 3AV2D 2F8NG 3TU4C 1TZYC 5AVCC 2FFFB 5JRGD 3LELC 1P3LA 3WA9C 4LD9C 3LELB 3FDDA 5CPJD 4LD9B 3MGSD 3B0CW 1T3UA 1S32B 4KGCD 3AZGA 4E45A 3VH5A 4R8PA 5B32B 5B24D 1BH9A 3AZED 4WU9D 2XD1A 3MGRB 3WTPE 5CP6A 1P3OC 3B6FC 5AY8C 3H0RC 4J8UB 2RIQA 3B6FB 4J8XC 5JA4A 3LZ0C 4XZQA 3WKJA 4J8WD 1M18A 3LZ0B 3UT9C 4G92C 5AV6B 2ZM5A 3B0DC 3MGQC 3C1BB 5B31A 4G92B 1P3LD 4Z66B 3MGQB 5GSUB 5B1LD 3B6GC 4XZQC 3MGPB 5F99A 3B6GB 3X1VD 5AV9A 3VH6W 3AZGD 5BNVB 5GT3B 4WNNB 2VQRA 4R8PD 3LZ1A 3C1CA 1ZLAA 1KX4D 3W99B 4YM6A 5B1MA 5AV8A 5CPKC 5B0YA 3W97A 5F99C 5AV9C 3V9RA 5CP6D 1EQZD 1P3AC 1P3PC 1ZLAC 3C1CC 3VH6T 1P3AB 3AZJA 3AV1A 1P3PB 1P3GA 5B2JA 3RELB 4YM6C 5B1MC 2F8NH 3WKJD 4EO5C 1M18D 3KUYB 2UWXA 3W97C 4EO5B
chains in the Genus database with same CATH topology
4XUJD 5B0ZC 4JJNA 5B31D 5B0ZB 3MVDA 1P3KA 1TAFA 1F66A 1P3IB 1P3GC 5B2JC 1HQ3C 3AFAA 2NQBB 5C3IC 3REHD 1B6WA 1HQ3B 3IP4C 3AN2B 3WTPA 4J8VA 3A6NA 2CV5B 4JJNC 3LZ1D 1KX5C 1P3KC 3AZLA 3AFAC 5AV8D 3MNND 4CSRA 5BO0B 5B0YD 5B40A 2PYOB 5AVBC 5E5AA 3AYWA 1P3BB 1AOIC 3KFUG 2YFVB 5AVBB 4WU8C 3UTBB 1AOIB 3AZJD 3AV1D 3REKB 4WU8B 1M19A 5AV5B 5B40C 4ZUXA 5CPIB 5E5AC 5B31G 3MVDD 1F66D 2HIOC 4KUDB 3EG5B 4H9QA 1M19C 3WTPD 4J8VD 4ZUXC 3X1UA 3A6ND 2BYKB 1P3MD 3AZNA 1P34A 2IO5C 3KWQA 3AZIA 3AZKA 3AZFA 3AZLD 2NZDA 1N1JB 2AROA 1M1AB 4H9RB 4M6BA 3AYWD 3AZNC 2JCHA 3NQJA 3VH5W 5GT0A 3P5JB 5DNMD 3A1IA 3KWQC 5GXQA 3R45B 4WJ3C 1TZYA 2JE5A 3LELA 4Z5TB 4LD9A 1BH8B 1S32A 4HGAC 3KXBD 4ZBJB 4AWLC 5KDMB 4HGAB 3EPLA 5B32A 4AWLB 3AZMC 1W2EA 1WWIA 4H9PB 4H9NA 3AZMB 1HTAA 3X1UD 3AV2B 5JRGB 1S32C 3MGRA 1P34D 3AZKD 3AZID 3EPKA 3AZFD 2NZDD 5CPJB 5B32C 1P3OA 4J8UA 2AROD 3W98D 3B6FA 3MGSB 5AY8A 1KX3C 2FJ7C 4J8XA 1KX3B 2XD5A 2FJ7B 3LZ0A 2BG1A 3MGRC 5B24B 5G49B 5GT0D 3AZEB 3REIC 5GXQD 4WU9B 4WZSB 2YFWB 3UT9A 2JSSA 4J8UC 3REIB 4Z66A 3MGQA 5GSUA 3TU4D 1TZYD 5AVCD 3LELD 3WA9D 1B67A 1Z2CB 2Y2KA 4LD9D 3LJAC 3MGPA 3B6GA 2Y2MA 5BNVA 3LJAB 4QLCC 3EPHA 5AV6C 5GT3A 4WNNA 3C1BC 2RVQC 4QLCB 4J8WB 4Z66C 5GSUC 1BFMA 3A1KA 4NFTA 3MGPC 5CPKA 3MGRD 2ZY4A 4G91C 5B1LB 4UPKA 4G91B 5GT3C 1P3OD 3B6FD 1KU5A 5AY8D 1WWSA 3X1VB 1P3AA 3W99C 3RELA 1P3PA 4YS3B 4J8XD 4X23B 3KUYA 3LZ0D 1KX4B 1Q9CA 3UT9D 3X1SC 5B0ZA 3MGQD 3RELC 4KHAB 3X1SB 1EQZB 2G5IC 3B0BA 2NQBA 1HQ3A 3AZHC 3KUYC 3AN2A 3B6GD 4XZQD 3AZHB 2CV5A 5BS7C 1H3OA 1P3IC 2Y2LA 3REJC 1KX5A 4XUJB 2NQBC 3REJB 5BT1C 3AN2C 5CPKD 2PYOA 2BYMB 3WAAC 4H9OB 2CV5C 5F99D 5AV9D 2YFVA 5AVBA 3WAAB 3REHB 3UTBA 1AOIA 3W96C 1P3AD 1P3PD 1ZLAD 3C1CD 4WU8A 3W96B 2Y2QA 5AV5A 4YM6D 5B1MD 2PYOC 1P3BC 3W97D 3MNNB 4E44A 3UTBC 5B0ZD 2DF4C 3REKC 4KUDA 2HIOA 5DNNC 1P3GD 5B2JD 5AV5C 1HQ3D 5DNNB 3H0MC 5CPIC 2BYKA 5B33C 4NE6A 5B33B 4JJND 1KX5D 1N1JA 4KUDC 1P3KD 1M1AA 4H9SC 3AFAD 4H9RA 4Z2MG 1F66B 5B2IC 5AVBD 5B2IB 5FUGA 1AOID 2F8NB 3WTPB 4WU8D 1P3MB 3R45A 3O62C 1M1AC 4Z5TA 3O62B 1BH8A 5B40D 5E5AD 5KDMA 3AYWB 2HIOD 5CHLB 2Y2IA 4H9PA 3AZMA 1A7WA 4Z5TC 5DNMB 1M19D 1JFIB 5JRGA 4ZUXD 4ZBJC 1U35C 1ID3C 3UTAC 1U35B 5CPJA 1P3FC 1ID3B 3KXBB 3UTAB 3X1TC 2F2AC 1P3FB 3AV2C 1KX3A 3X1TB 2FJ7A 5JRGC 5B24A 5G49A 4H9QB 3AZEA 3AZND 4WU9A 5CPJC 3KWQD 3REIA 3MGSC 4DRBA 4KGCC 4KGCB 3W98B 5B24C 3LJAA 3AZEC 4WU9C 4QLCA 4J8WA 5AV6A 3AL0C 3C1BA 3AZMD 2L5AA 4DRAA 4CAYB 3TU4B 5B1LA 1TZYB 5AVCB 1S32D 3WA9B 4Z2MH 4J8WC 2W8SA 3X1VA 5B32D 4YS3A 4X23A 3NQUB 1KX3D 3W99A 4UUZB 2FJ7D 1P3LC 5BNXB 1KX4A 5B1LC 4H9NB 1P3LB 3REID 4NE5A 2DQNC 3X1VC 3AZGC 4J8UD 2HUEC 1R4VA 2J8PA 4KHAA 3X1SA 4YS3C 4X23C 1EQZA 4R8PC 3AZGB 2HUEB 3B0CT 1P3OB 4R8PB 5AY8B 1KX4C 3LJAD 3AZHA 4J8XB 1BH9B 4QLCD 5BS7A 5AV6D 1PZRA 3C1BD 2RVQD 5CP6C 4Z66D 4XUJA 5GSUD 3REJA 3UT9B 1P3IA 1EQZC 5CP6B 2BYMA 3B0DB 4H9OA 3MGPD 3WKJC 3WAAA 3REHA 5B32G 1M18C 5JA4B 5GT3D 4XZQB 3WKJB 1M18B 3W96A 4YS3D 4X23D 4XUJC 3W99D 5B31C 5BO0A 5B31B 3MNNA 2Y2JA 1P3BA 3REHC 5CPKB 3X1SD 5F99B 5AV9B 3REKA 3RELD 3LZ1C 5DNNA 1ZLAB 3LZ1B 3C1CB 3KUYD 2Y2HA 3AZHD 3H0LC 5AV8C 3MNNC 5CPIA 2Y2GA 5B0YC 5B1MB 5AV8B 5B33A 4YM6B 2LY8A 5B0YB 3W97B 1P3ID 3REJD 3V9RB 3VH6A 2NQBD 4H9SA 5BT1D 3AZJC 3AN2D 3AV1C 3AZJB 3AV1B 3WAAD 1P3GB 5B2JB 5B2IA 2CV5D 2F8NA 5C3IB 2ZY2A 1P3MA 3W96D 1H3OB 4NE3A 3O62A 3MVDC 1F66C 4JJNB 1KX5B 2Y2PA 2PYOD 3MVDB 1P3KB 1TAFB 3EPJA 1P3BD 3AFAB 3WTPC 4J8VC 3A6NC 2CWEA 3UTBD 1P3MC 4J8VB 3A6NB 3REKD 4DQYB 5DNMA 5DNND 5AV5D 3AZLC 1JFIA 3F6TA 2Y2NA 5CPID 3AZLB 5B33D 4CSRB 1U35A 3AYWC 5B40B 3KXBA 4WV4B 3UTAA 1ID3A 3KSYA 5E5AB 1P3FA 5DNMC 4KUDD 3X1TA 3AV2A 2HIOB 5B2ID 2F8ND 1ULYA 1M19B 4ZUXB 3KXBC 3MGSA 3O62D 1M1AD 4KGCA 2IO5B 2F8NK 3W98A 2Y2OA 3X1UC 1F1EA 2ZY5A 2YFWA 3X1UB 1P34C 3AZKC 5FUGB 3AZFC 3AZNB 3AZIC 4CAYA 2NZDC 1P34B 4Z5TD 3KWQB 3AZIB 3AZKB 2AROC 3AZFB 3W98C 2G5HC 3TU4A 2NZDB 5AVCA 2AROB 3WA9A 1U35D 1ID3D 3UTAD 1P3FD 5GT0C 5GXQC 3NQJB 3NQUA 3X1TD 5GT0B 4UUZA 3VH5T 2ZY3A 5GXQB 5BNXA 3AV2D 2F8NG 3TU4C 1TZYC 5AVCC 2FFFB 5JRGD 3LELC 1P3LA 3WA9C 4LD9C 3LELB 3FDDA 5CPJD 4LD9B 3MGSD 3B0CW 1T3UA 1S32B 4KGCD 3AZGA 4E45A 3VH5A 4R8PA 5B32B 5B24D 1BH9A 3AZED 4WU9D 2XD1A 3MGRB 3WTPE 5CP6A 1P3OC 3B6FC 5AY8C 3H0RC 4J8UB 2RIQA 3B6FB 4J8XC 5JA4A 3LZ0C 4XZQA 3WKJA 4J8WD 1M18A 3LZ0B 3UT9C 4G92C 5AV6B 2ZM5A 3B0DC 3MGQC 3C1BB 5B31A 4G92B 1P3LD 4Z66B 3MGQB 5GSUB 5B1LD 3B6GC 4XZQC 3MGPB 5F99A 3B6GB 3X1VD 5AV9A 3VH6W 3AZGD 5BNVB 5GT3B 4WNNB 2VQRA 4R8PD 3LZ1A 3C1CA 1ZLAA 1KX4D 3W99B 4YM6A 5B1MA 5AV8A 5CPKC 5B0YA 3W97A 5F99C 5AV9C 3V9RA 5CP6D 1EQZD 1P3AC 1P3PC 1ZLAC 3C1CC 3VH6T 1P3AB 3AZJA 3AV1A 1P3PB 1P3GA 5B2JA 3RELB 4YM6C 5B1MC 2F8NH 3WKJD 4EO5C 1M18D 3KUYB 2UWXA 3W97C 4EO5B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XUJ D;  5B0Z C;  4JJN A;  5B31 D;  5B0Z B;  3MVD A;  1P3K A;  1TAF A;  1F66 A;  1P3I B;  1P3G C;  5B2J C;  1HQ3 C;  3AFA A;  2NQB B;  5C3I C;  3REH D;  1B6W A;  1HQ3 B;  3AN2 B;  3WTP A;  4J8V A;  3A6N A;  2CV5 B;  4JJN C;  3LZ1 D;  1KX5 C;  1P3K C;  3AZL A;  3AFA C;  5AV8 D;  3MNN D;  4CSR A;  5BO0 B;  5B0Y D;  5B40 A;  2PYO B;  5AVB C;  5E5A A;  3AYW A;  1P3B B;  1AOI C;  2YFV B;  5AVB B;  4WU8 C;  3UTB B;  1AOI B;  3AZJ D;  3AV1 D;  3REK B;  4WU8 B;  1M19 A;  5AV5 B;  5B40 C;  4ZUX A;  5CPI B;  5E5A C;  5B31 G;  3MVD D;  1F66 D;  2HIO C;  4KUD B;  4H9Q A;  1M19 C;  3WTP D;  4J8V D;  4ZUX C;  3X1U A;  3A6N D;  2BYK B;  1P3M D;  3AZN A;  1P34 A;  2IO5 C;  3KWQ A;  3AZI A;  3AZK A;  3AZF A;  3AZL D;  2NZD A;  1N1J B;  2ARO A;  1M1A B;  4H9R B;  4M6B A;  3AYW D;  3AZN C;  3NQJ A;  3VH5 W;  5GT0 A;  5DNM D;  3KWQ C;  5GXQ A;  3R45 B;  1TZY A;  3LEL A;  4Z5T B;  4LD9 A;  1BH8 B;  1S32 A;  4HGA C;  3KXB D;  4ZBJ B;  4AWL C;  5KDM B;  4HGA B;  5B32 A;  4AWL B;  3AZM C;  1WWI A;  4H9P B;  4H9N A;  3AZM B;  1HTA A;  3X1U D;  3AV2 B;  5JRG B;  1S32 C;  3MGR A;  1P34 D;  3AZK D;  3AZI D;  3AZF D;  2NZD D;  5CPJ B;  5B32 C;  1P3O A;  4J8U A;  2ARO D;  3W98 D;  3B6F A;  3MGS B;  5AY8 A;  1KX3 C;  2FJ7 C;  4J8X A;  1KX3 B;  2FJ7 B;  3LZ0 A;  3MGR C;  5B24 B;  5G49 B;  5GT0 D;  3AZE B;  3REI C;  5GXQ D;  4WU9 B;  4WZS B;  2YFW B;  3UT9 A;  2JSS A;  4J8U C;  3REI B;  4Z66 A;  3MGQ A;  5GSU A;  3TU4 D;  1TZY D;  5AVC D;  3LEL D;  3WA9 D;  1B67 A;  4LD9 D;  3LJA C;  3MGP A;  3B6G A;  5BNV A;  3LJA B;  4QLC C;  5AV6 C;  5GT3 A;  4WNN A;  3C1B C;  4QLC B;  2RVQ C;  4J8W B;  4Z66 C;  5GSU C;  1BFM A;  4NFT A;  3MGP C;  5CPK A;  3MGR D;  4G91 C;  5B1L B;  4G91 B;  5GT3 C;  1P3O D;  3B6F D;  1KU5 A;  5AY8 D;  1WWS A;  3X1V B;  1P3A A;  3W99 C;  3REL A;  1P3P A;  4YS3 B;  4J8X D;  4X23 B;  3KUY A;  3LZ0 D;  1KX4 B;  1Q9C A;  3UT9 D;  3X1S C;  5B0Z A;  3MGQ D;  3REL C;  4KHA B;  3X1S B;  1EQZ B;  3B0B A;  2NQB A;  1HQ3 A;  3AZH C;  3KUY C;  3AN2 A;  3B6G D;  4XZQ D;  3AZH B;  2CV5 A;  5BS7 C;  1H3O A;  1P3I C;  3REJ C;  1KX5 A;  4XUJ B;  2NQB C;  3REJ B;  5BT1 C;  3AN2 C;  5CPK D;  2PYO A;  2BYM B;  3WAA C;  4H9O B;  2CV5 C;  5F99 D;  5AV9 D;  2YFV A;  5AVB A;  3WAA B;  3REH B;  3UTB A;  1AOI A;  3W96 C;  1P3A D;  1P3P D;  1ZLA D;  3C1C D;  4WU8 A;  3W96 B;  5AV5 A;  4YM6 D;  5B1M D;  2PYO C;  1P3B C;  3W97 D;  3MNN B;  4E44 A;  3UTB C;  5B0Z D;  3REK C;  4KUD A;  2HIO A;  5DNN C;  1P3G D;  5B2J D;  1HQ3 D;  5AV5 C;  5DNN B;  5CPI C;  2BYK A;  5B33 C;  4NE6 A;  5B33 B;  4JJN D;  1KX5 D;  1N1J A;  4KUD C;  1P3K D;  1M1A A;  4H9S C;  3AFA D;  4H9R A;  4Z2M G;  1F66 B;  5B2I C;  5AVB D;  5B2I B;  5FUG A;  1AOI D;  2F8N B;  3WTP B;  4WU8 D;  1P3M B;  3R45 A;  3O62 C;  1M1A C;  4Z5T A;  3O62 B;  1BH8 A;  5B40 D;  5E5A D;  5KDM A;  3AYW B;  2HIO D;  5CHL B;  4H9P A;  3AZM A;  1A7W A;  4Z5T C;  5DNM B;  1M19 D;  1JFI B;  5JRG A;  4ZUX D;  4ZBJ C;  1U35 C;  1ID3 C;  3UTA C;  1U35 B;  5CPJ A;  1P3F C;  1ID3 B;  3KXB B;  3UTA B;  3X1T C;  1P3F B;  3AV2 C;  1KX3 A;  3X1T B;  2FJ7 A;  5JRG C;  5B24 A;  5G49 A;  4H9Q B;  3AZE A;  3AZN D;  4WU9 A;  5CPJ C;  3KWQ D;  3REI A;  3MGS C;  4DRB A;  4KGC C;  4KGC B;  3W98 B;  5B24 C;  3LJA A;  3AZE C;  4WU9 C;  4QLC A;  4J8W A;  5AV6 A;  3C1B A;  3AZM D;  2L5A A;  4DRA A;  4CAY B;  3TU4 B;  5B1L A;  1TZY B;  5AVC B;  1S32 D;  3WA9 B;  4Z2M H;  4J8W C;  3X1V A;  5B32 D;  4YS3 A;  4X23 A;  3NQU B;  1KX3 D;  3W99 A;  4UUZ B;  2FJ7 D;  1P3L C;  5BNX B;  1KX4 A;  5B1L C;  4H9N B;  1P3L B;  3REI D;  4NE5 A;  3X1V C;  3AZG C;  4J8U D;  2HUE C;  1R4V A;  4KHA A;  3X1S A;  4YS3 C;  4X23 C;  1EQZ A;  4R8P C;  3AZG B;  2HUE B;  3B0C T;  1P3O B;  4R8P B;  5AY8 B;  1KX4 C;  3LJA D;  3AZH A;  4J8X B;  1BH9 B;  4QLC D;  5BS7 A;  5AV6 D;  3C1B D;  2RVQ D;  5CP6 C;  4Z66 D;  4XUJ A;  5GSU D;  3REJ A;  3UT9 B;  1P3I A;  1EQZ C;  5CP6 B;  2BYM A;  3B0D B;  4H9O A;  3MGP D;  3WKJ C;  3WAA A;  3REH A;  5B32 G;  1M18 C;  5JA4 B;  5GT3 D;  4XZQ B;  3WKJ B;  1M18 B;  3W96 A;  4YS3 D;  4X23 D;  4XUJ C;  3W99 D;  5B31 C;  5BO0 A;  5B31 B;  3MNN A;  1P3B A;  3REH C;  5CPK B;  3X1S D;  5F99 B;  5AV9 B;  3REK A;  3REL D;  3LZ1 C;  5DNN A;  1ZLA B;  3LZ1 B;  3C1C B;  3KUY D;  3AZH D;  5AV8 C;  5CPI A;  3MNN C;  5B0Y C;  5B1M B;  5AV8 B;  5B33 A;  4YM6 B;  2LY8 A;  5B0Y B;  3W97 B;  1P3I D;  3REJ D;  3V9R B;  3VH6 A;  2NQB D;  4H9S A;  5BT1 D;  3AZJ C;  3AN2 D;  3AV1 C;  3AZJ B;  3AV1 B;  3WAA D;  1P3G B;  5B2J B;  5B2I A;  2CV5 D;  2F8N A;  5C3I B;  1P3M A;  3W96 D;  1H3O B;  4NE3 A;  3O62 A;  3MVD C;  1F66 C;  4JJN B;  1KX5 B;  2PYO D;  3MVD B;  1P3K B;  1TAF B;  1P3B D;  3AFA B;  3WTP C;  4J8V C;  3A6N C;  2CWE A;  3UTB D;  1P3M C;  4J8V B;  3A6N B;  3REK D;  5DNM A;  5DNN D;  5AV5 D;  3AZL C;  1JFI A;  5CPI D;  3AZL B;  5B33 D;  4CSR B;  1U35 A;  3AYW C;  5B40 B;  3KXB A;  4WV4 B;  3UTA A;  1ID3 A;  3KSY A;  5E5A B;  1P3F A;  5DNM C;  4KUD D;  3X1T A;  3AV2 A;  2HIO B;  5B2I D;  2F8N D;  1ULY A;  1M19 B;  4ZUX B;  3KXB C;  3MGS A;  3O62 D;  1M1A D;  4KGC A;  2IO5 B;  2F8N K;  3W98 A;  3X1U C;  1F1E A;  2YFW A;  3X1U B;  1P34 C;  3AZK C;  5FUG B;  3AZF C;  3AZN B;  3AZI C;  4CAY A;  2NZD C;  1P34 B;  4Z5T D;  3KWQ B;  3AZI B;  3AZK B;  2ARO C;  3AZF B;  3W98 C;  3TU4 A;  2NZD B;  5AVC A;  2ARO B;  3WA9 A;  1U35 D;  1ID3 D;  3UTA D;  1P3F D;  5GT0 C;  5GXQ C;  3NQJ B;  3NQU A;  3X1T D;  5GT0 B;  4UUZ A;  3VH5 T;  3AV2 D;  5GXQ B;  5BNX A;  2F8N G;  3TU4 C;  1TZY C;  5AVC C;  5JRG D;  3LEL C;  1P3L A;  3WA9 C;  4LD9 C;  3LEL B;  5CPJ D;  4LD9 B;  3MGS D;  3B0C W;  1S32 B;  4KGC D;  3AZG A;  4E45 A;  3VH5 A;  4R8P A;  5B32 B;  5B24 D;  1BH9 A;  3AZE D;  4WU9 D;  3MGR B;  3WTP E;  5CP6 A;  1P3O C;  3B6F C;  5AY8 C;  4J8U B;  3B6F B;  4J8X C;  5JA4 A;  3LZ0 C;  4XZQ A;  3WKJ A;  4J8W D;  1M18 A;  3LZ0 B;  3UT9 C;  4G92 C;  5AV6 B;  3B0D C;  3MGQ C;  3C1B B;  5B31 A;  4G92 B;  1P3L D;  4Z66 B;  3MGQ B;  5GSU B;  5B1L D;  3B6G C;  4XZQ C;  3MGP B;  5F99 A;  3B6G B;  3X1V D;  5AV9 A;  3VH6 W;  3AZG D;  5BNV B;  5GT3 B;  4WNN B;  4R8P D;  1ZLA A;  3LZ1 A;  3C1C A;  1KX4 D;  3W99 B;  4YM6 A;  5B1M A;  5AV8 A;  5CPK C;  5B0Y A;  3W97 A;  5F99 C;  5AV9 C;  3V9R A;  5CP6 D;  1EQZ D;  1P3A C;  1P3P C;  1ZLA C;  3C1C C;  3VH6 T;  1P3A B;  3AZJ A;  3AV1 A;  1P3P B;  1P3G A;  5B2J A;  3REL B;  4YM6 C;  5B1M C;  2F8N H;  3WKJ D;  4EO5 C;  1M18 D;  3KUY B;  3W97 C;  4EO5 B; 
#chains in the Genus database with same CATH topology
 4XUJ D;  5B0Z C;  4JJN A;  5B31 D;  5B0Z B;  3MVD A;  1P3K A;  1TAF A;  1F66 A;  1P3I B;  1P3G C;  5B2J C;  1HQ3 C;  3AFA A;  2NQB B;  5C3I C;  3REH D;  1B6W A;  1HQ3 B;  3IP4 C;  3AN2 B;  3WTP A;  4J8V A;  3A6N A;  2CV5 B;  4JJN C;  3LZ1 D;  1KX5 C;  1P3K C;  3AZL A;  3AFA C;  5AV8 D;  3MNN D;  4CSR A;  5BO0 B;  5B0Y D;  5B40 A;  2PYO B;  5AVB C;  5E5A A;  3AYW A;  1P3B B;  1AOI C;  3KFU G;  2YFV B;  5AVB B;  4WU8 C;  3UTB B;  1AOI B;  3AZJ D;  3AV1 D;  3REK B;  4WU8 B;  1M19 A;  5AV5 B;  5B40 C;  4ZUX A;  5CPI B;  5E5A C;  5B31 G;  3MVD D;  1F66 D;  2HIO C;  4KUD B;  3EG5 B;  4H9Q A;  1M19 C;  3WTP D;  4J8V D;  4ZUX C;  3X1U A;  3A6N D;  2BYK B;  1P3M D;  3AZN A;  1P34 A;  2IO5 C;  3KWQ A;  3AZI A;  3AZK A;  3AZF A;  3AZL D;  2NZD A;  1N1J B;  2ARO A;  1M1A B;  4H9R B;  4M6B A;  3AYW D;  3AZN C;  2JCH A;  3NQJ A;  3VH5 W;  5GT0 A;  3P5J B;  5DNM D;  3A1I A;  3KWQ C;  5GXQ A;  3R45 B;  4WJ3 C;  1TZY A;  2JE5 A;  3LEL A;  4Z5T B;  4LD9 A;  1BH8 B;  1S32 A;  4HGA C;  3KXB D;  4ZBJ B;  4AWL C;  5KDM B;  4HGA B;  3EPL A;  5B32 A;  4AWL B;  3AZM C;  1W2E A;  1WWI A;  4H9P B;  4H9N A;  3AZM B;  1HTA A;  3X1U D;  3AV2 B;  5JRG B;  1S32 C;  3MGR A;  1P34 D;  3AZK D;  3AZI D;  3EPK A;  3AZF D;  2NZD D;  5CPJ B;  5B32 C;  1P3O A;  4J8U A;  2ARO D;  3W98 D;  3B6F A;  3MGS B;  5AY8 A;  1KX3 C;  2FJ7 C;  4J8X A;  1KX3 B;  2XD5 A;  2FJ7 B;  3LZ0 A;  2BG1 A;  3MGR C;  5B24 B;  5G49 B;  5GT0 D;  3AZE B;  3REI C;  5GXQ D;  4WU9 B;  4WZS B;  2YFW B;  3UT9 A;  2JSS A;  4J8U C;  3REI B;  4Z66 A;  3MGQ A;  5GSU A;  3TU4 D;  1TZY D;  5AVC D;  3LEL D;  3WA9 D;  1B67 A;  1Z2C B;  2Y2K A;  4LD9 D;  3LJA C;  3MGP A;  3B6G A;  2Y2M A;  5BNV A;  3LJA B;  4QLC C;  3EPH A;  5AV6 C;  5GT3 A;  4WNN A;  3C1B C;  2RVQ C;  4QLC B;  4J8W B;  4Z66 C;  5GSU C;  1BFM A;  3A1K A;  4NFT A;  3MGP C;  5CPK A;  3MGR D;  2ZY4 A;  4G91 C;  5B1L B;  4UPK A;  4G91 B;  5GT3 C;  1P3O D;  3B6F D;  1KU5 A;  5AY8 D;  1WWS A;  3X1V B;  1P3A A;  3W99 C;  3REL A;  1P3P A;  4YS3 B;  4J8X D;  4X23 B;  3KUY A;  3LZ0 D;  1KX4 B;  1Q9C A;  3UT9 D;  3X1S C;  5B0Z A;  3MGQ D;  3REL C;  4KHA B;  3X1S B;  1EQZ B;  2G5I C;  3B0B A;  2NQB A;  1HQ3 A;  3AZH C;  3KUY C;  3AN2 A;  3B6G D;  4XZQ D;  3AZH B;  2CV5 A;  5BS7 C;  1H3O A;  1P3I C;  2Y2L A;  3REJ C;  1KX5 A;  4XUJ B;  2NQB C;  3REJ B;  5BT1 C;  3AN2 C;  5CPK D;  2PYO A;  2BYM B;  3WAA C;  4H9O B;  2CV5 C;  5F99 D;  5AV9 D;  2YFV A;  5AVB A;  3WAA B;  3REH B;  3UTB A;  1AOI A;  3W96 C;  1P3A D;  1P3P D;  1ZLA D;  3C1C D;  4WU8 A;  3W96 B;  2Y2Q A;  5AV5 A;  4YM6 D;  5B1M D;  2PYO C;  1P3B C;  3W97 D;  3MNN B;  4E44 A;  3UTB C;  5B0Z D;  2DF4 C;  3REK C;  4KUD A;  2HIO A;  5DNN C;  1P3G D;  5B2J D;  5AV5 C;  1HQ3 D;  5DNN B;  3H0M C;  5CPI C;  2BYK A;  5B33 C;  4NE6 A;  5B33 B;  4JJN D;  1KX5 D;  1N1J A;  4KUD C;  1P3K D;  1M1A A;  4H9S C;  3AFA D;  4H9R A;  4Z2M G;  1F66 B;  5B2I C;  5AVB D;  5B2I B;  5FUG A;  1AOI D;  2F8N B;  3WTP B;  4WU8 D;  1P3M B;  3R45 A;  3O62 C;  1M1A C;  4Z5T A;  3O62 B;  1BH8 A;  5B40 D;  5E5A D;  5KDM A;  3AYW B;  2HIO D;  5CHL B;  2Y2I A;  4H9P A;  3AZM A;  1A7W A;  4Z5T C;  5DNM B;  1M19 D;  1JFI B;  5JRG A;  4ZUX D;  4ZBJ C;  1U35 C;  1ID3 C;  3UTA C;  1U35 B;  5CPJ A;  1P3F C;  1ID3 B;  3KXB B;  3UTA B;  3X1T C;  2F2A C;  1P3F B;  3AV2 C;  1KX3 A;  3X1T B;  2FJ7 A;  5JRG C;  5B24 A;  5G49 A;  4H9Q B;  3AZE A;  3AZN D;  4WU9 A;  5CPJ C;  3KWQ D;  3REI A;  3MGS C;  4DRB A;  4KGC C;  4KGC B;  3W98 B;  5B24 C;  3LJA A;  3AZE C;  4WU9 C;  4QLC A;  4J8W A;  5AV6 A;  3AL0 C;  3C1B A;  3AZM D;  2L5A A;  4DRA A;  4CAY B;  3TU4 B;  5B1L A;  1TZY B;  5AVC B;  1S32 D;  3WA9 B;  4Z2M H;  4J8W C;  2W8S A;  3X1V A;  5B32 D;  4YS3 A;  4X23 A;  3NQU B;  1KX3 D;  3W99 A;  4UUZ B;  2FJ7 D;  1P3L C;  5BNX B;  1KX4 A;  5B1L C;  4H9N B;  1P3L B;  3REI D;  4NE5 A;  2DQN C;  3X1V C;  3AZG C;  4J8U D;  2HUE C;  1R4V A;  2J8P A;  4KHA A;  3X1S A;  4YS3 C;  4X23 C;  1EQZ A;  4R8P C;  3AZG B;  2HUE B;  3B0C T;  1P3O B;  4R8P B;  5AY8 B;  1KX4 C;  3LJA D;  3AZH A;  4J8X B;  1BH9 B;  4QLC D;  5BS7 A;  5AV6 D;  1PZR A;  3C1B D;  2RVQ D;  5CP6 C;  4Z66 D;  4XUJ A;  5GSU D;  3REJ A;  3UT9 B;  1P3I A;  1EQZ C;  5CP6 B;  2BYM A;  3B0D B;  4H9O A;  3MGP D;  3WKJ C;  3WAA A;  3REH A;  5B32 G;  1M18 C;  5JA4 B;  5GT3 D;  4XZQ B;  3WKJ B;  1M18 B;  3W96 A;  4YS3 D;  4X23 D;  4XUJ C;  3W99 D;  5B31 C;  5BO0 A;  5B31 B;  3MNN A;  2Y2J A;  1P3B A;  3REH C;  5CPK B;  3X1S D;  5F99 B;  5AV9 B;  3REK A;  3REL D;  3LZ1 C;  5DNN A;  1ZLA B;  3LZ1 B;  3C1C B;  3KUY D;  2Y2H A;  3AZH D;  3H0L C;  5AV8 C;  3MNN C;  5CPI A;  2Y2G A;  5B0Y C;  5B1M B;  5AV8 B;  5B33 A;  4YM6 B;  2LY8 A;  5B0Y B;  3W97 B;  1P3I D;  3REJ D;  3V9R B;  3VH6 A;  2NQB D;  4H9S A;  5BT1 D;  3AZJ C;  3AN2 D;  3AV1 C;  3AZJ B;  3AV1 B;  3WAA D;  1P3G B;  5B2J B;  5B2I A;  2CV5 D;  2F8N A;  5C3I B;  2ZY2 A;  1P3M A;  3W96 D;  1H3O B;  4NE3 A;  3O62 A;  3MVD C;  1F66 C;  4JJN B;  1KX5 B;  2Y2P A;  2PYO D;  3MVD B;  1P3K B;  1TAF B;  3EPJ A;  1P3B D;  3AFA B;  3WTP C;  4J8V C;  3A6N C;  2CWE A;  3UTB D;  1P3M C;  4J8V B;  3A6N B;  3REK D;  4DQY B;  5DNM A;  5DNN D;  5AV5 D;  3AZL C;  1JFI A;  3F6T A;  2Y2N A;  5CPI D;  3AZL B;  5B33 D;  4CSR B;  1U35 A;  3AYW C;  5B40 B;  3KXB A;  4WV4 B;  3UTA A;  1ID3 A;  3KSY A;  5E5A B;  1P3F A;  5DNM C;  4KUD D;  3X1T A;  3AV2 A;  2HIO B;  5B2I D;  2F8N D;  1ULY A;  1M19 B;  4ZUX B;  3KXB C;  3MGS A;  3O62 D;  1M1A D;  4KGC A;  2IO5 B;  2F8N K;  3W98 A;  2Y2O A;  3X1U C;  1F1E A;  2ZY5 A;  2YFW A;  3X1U B;  1P34 C;  3AZK C;  5FUG B;  3AZF C;  3AZN B;  3AZI C;  4CAY A;  2NZD C;  1P34 B;  4Z5T D;  3KWQ B;  3AZI B;  3AZK B;  2ARO C;  3AZF B;  3W98 C;  2G5H C;  3TU4 A;  2NZD B;  5AVC A;  2ARO B;  3WA9 A;  1U35 D;  1ID3 D;  3UTA D;  1P3F D;  5GT0 C;  5GXQ C;  3NQJ B;  3NQU A;  3X1T D;  5GT0 B;  4UUZ A;  3VH5 T;  2ZY3 A;  5GXQ B;  5BNX A;  3AV2 D;  2F8N G;  3TU4 C;  1TZY C;  5AVC C;  2FFF B;  5JRG D;  3LEL C;  1P3L A;  3WA9 C;  4LD9 C;  3LEL B;  3FDD A;  5CPJ D;  4LD9 B;  3MGS D;  3B0C W;  1T3U A;  1S32 B;  4KGC D;  3AZG A;  4E45 A;  3VH5 A;  4R8P A;  5B32 B;  5B24 D;  1BH9 A;  3AZE D;  4WU9 D;  2XD1 A;  3MGR B;  3WTP E;  5CP6 A;  1P3O C;  3B6F C;  5AY8 C;  3H0R C;  4J8U B;  2RIQ A;  3B6F B;  4J8X C;  5JA4 A;  3LZ0 C;  4XZQ A;  3WKJ A;  4J8W D;  1M18 A;  3LZ0 B;  3UT9 C;  4G92 C;  5AV6 B;  2ZM5 A;  3B0D C;  3MGQ C;  3C1B B;  5B31 A;  4G92 B;  1P3L D;  4Z66 B;  3MGQ B;  5GSU B;  5B1L D;  3B6G C;  4XZQ C;  3MGP B;  5F99 A;  3B6G B;  3X1V D;  5AV9 A;  3VH6 W;  3AZG D;  5BNV B;  5GT3 B;  4WNN B;  2VQR A;  4R8P D;  3LZ1 A;  3C1C A;  1ZLA A;  1KX4 D;  3W99 B;  4YM6 A;  5B1M A;  5AV8 A;  5CPK C;  5B0Y A;  3W97 A;  5F99 C;  5AV9 C;  3V9R A;  5CP6 D;  1EQZ D;  1P3A C;  1P3P C;  1ZLA C;  3C1C C;  3VH6 T;  1P3A B;  3AZJ A;  3AV1 A;  1P3P B;  1P3G A;  5B2J A;  3REL B;  4YM6 C;  5B1M C;  2F8N H;  3WKJ D;  4EO5 C;  1M18 D;  3KUY B;  2UWX A;  3W97 C;  4EO5 B; 
#chains in the Genus database with same CATH homology
 4XUJ D;  5B0Z C;  4JJN A;  5B31 D;  5B0Z B;  3MVD A;  1P3K A;  1TAF A;  1F66 A;  1P3I B;  1P3G C;  5B2J C;  1HQ3 C;  3AFA A;  2NQB B;  5C3I C;  3REH D;  1B6W A;  1HQ3 B;  3IP4 C;  3AN2 B;  3WTP A;  4J8V A;  3A6N A;  2CV5 B;  4JJN C;  3LZ1 D;  1KX5 C;  1P3K C;  3AZL A;  3AFA C;  5AV8 D;  3MNN D;  4CSR A;  5BO0 B;  5B0Y D;  5B40 A;  2PYO B;  5AVB C;  5E5A A;  3AYW A;  1P3B B;  1AOI C;  3KFU G;  2YFV B;  5AVB B;  4WU8 C;  3UTB B;  1AOI B;  3AZJ D;  3AV1 D;  3REK B;  4WU8 B;  1M19 A;  5AV5 B;  5B40 C;  4ZUX A;  5CPI B;  5E5A C;  5B31 G;  3MVD D;  1F66 D;  2HIO C;  4KUD B;  3EG5 B;  4H9Q A;  1M19 C;  3WTP D;  4J8V D;  4ZUX C;  3X1U A;  3A6N D;  2BYK B;  1P3M D;  3AZN A;  1P34 A;  2IO5 C;  3KWQ A;  3AZI A;  3AZK A;  3AZF A;  3AZL D;  2NZD A;  1N1J B;  2ARO A;  1M1A B;  4H9R B;  4M6B A;  3AYW D;  3AZN C;  2JCH A;  3NQJ A;  3VH5 W;  5GT0 A;  3P5J B;  5DNM D;  3A1I A;  3KWQ C;  5GXQ A;  3R45 B;  4WJ3 C;  1TZY A;  2JE5 A;  3LEL A;  4Z5T B;  4LD9 A;  1BH8 B;  1S32 A;  4HGA C;  3KXB D;  4ZBJ B;  4AWL C;  5KDM B;  4HGA B;  3EPL A;  5B32 A;  4AWL B;  3AZM C;  1W2E A;  1WWI A;  4H9P B;  4H9N A;  3AZM B;  1HTA A;  3X1U D;  3AV2 B;  5JRG B;  1S32 C;  3MGR A;  1P34 D;  3AZK D;  3AZI D;  3EPK A;  3AZF D;  2NZD D;  5CPJ B;  5B32 C;  1P3O A;  4J8U A;  2ARO D;  3W98 D;  3B6F A;  3MGS B;  5AY8 A;  1KX3 C;  2FJ7 C;  4J8X A;  1KX3 B;  2XD5 A;  2FJ7 B;  3LZ0 A;  2BG1 A;  3MGR C;  5B24 B;  5G49 B;  5GT0 D;  3AZE B;  3REI C;  5GXQ D;  4WU9 B;  4WZS B;  2YFW B;  3UT9 A;  2JSS A;  4J8U C;  3REI B;  4Z66 A;  3MGQ A;  5GSU A;  3TU4 D;  1TZY D;  5AVC D;  3LEL D;  3WA9 D;  1B67 A;  1Z2C B;  2Y2K A;  4LD9 D;  3LJA C;  3MGP A;  3B6G A;  2Y2M A;  5BNV A;  3LJA B;  4QLC C;  3EPH A;  5AV6 C;  5GT3 A;  4WNN A;  3C1B C;  2RVQ C;  4QLC B;  4J8W B;  4Z66 C;  5GSU C;  1BFM A;  3A1K A;  4NFT A;  3MGP C;  5CPK A;  3MGR D;  2ZY4 A;  4G91 C;  5B1L B;  4UPK A;  4G91 B;  5GT3 C;  1P3O D;  3B6F D;  1KU5 A;  5AY8 D;  1WWS A;  3X1V B;  1P3A A;  3W99 C;  3REL A;  1P3P A;  4YS3 B;  4J8X D;  4X23 B;  3KUY A;  3LZ0 D;  1KX4 B;  1Q9C A;  3UT9 D;  3X1S C;  5B0Z A;  3MGQ D;  3REL C;  4KHA B;  3X1S B;  1EQZ B;  2G5I C;  3B0B A;  2NQB A;  1HQ3 A;  3AZH C;  3KUY C;  3AN2 A;  3B6G D;  4XZQ D;  3AZH B;  2CV5 A;  5BS7 C;  1H3O A;  1P3I C;  2Y2L A;  3REJ C;  1KX5 A;  4XUJ B;  2NQB C;  3REJ B;  5BT1 C;  3AN2 C;  5CPK D;  2PYO A;  2BYM B;  3WAA C;  4H9O B;  2CV5 C;  5F99 D;  5AV9 D;  2YFV A;  5AVB A;  3WAA B;  3REH B;  3UTB A;  1AOI A;  3W96 C;  1P3A D;  1P3P D;  1ZLA D;  3C1C D;  4WU8 A;  3W96 B;  2Y2Q A;  5AV5 A;  4YM6 D;  5B1M D;  2PYO C;  1P3B C;  3W97 D;  3MNN B;  4E44 A;  3UTB C;  5B0Z D;  2DF4 C;  3REK C;  4KUD A;  2HIO A;  5DNN C;  1P3G D;  5B2J D;  5AV5 C;  1HQ3 D;  5DNN B;  3H0M C;  5CPI C;  2BYK A;  5B33 C;  4NE6 A;  5B33 B;  4JJN D;  1KX5 D;  1N1J A;  4KUD C;  1P3K D;  1M1A A;  4H9S C;  3AFA D;  4H9R A;  4Z2M G;  1F66 B;  5B2I C;  5AVB D;  5B2I B;  5FUG A;  1AOI D;  2F8N B;  3WTP B;  4WU8 D;  1P3M B;  3R45 A;  3O62 C;  1M1A C;  4Z5T A;  3O62 B;  1BH8 A;  5B40 D;  5E5A D;  5KDM A;  3AYW B;  2HIO D;  5CHL B;  2Y2I A;  4H9P A;  3AZM A;  1A7W A;  4Z5T C;  5DNM B;  1M19 D;  1JFI B;  5JRG A;  4ZUX D;  4ZBJ C;  1U35 C;  1ID3 C;  3UTA C;  1U35 B;  5CPJ A;  1P3F C;  1ID3 B;  3KXB B;  3UTA B;  3X1T C;  2F2A C;  1P3F B;  3AV2 C;  1KX3 A;  3X1T B;  2FJ7 A;  5JRG C;  5B24 A;  5G49 A;  4H9Q B;  3AZE A;  3AZN D;  4WU9 A;  5CPJ C;  3KWQ D;  3REI A;  3MGS C;  4DRB A;  4KGC C;  4KGC B;  3W98 B;  5B24 C;  3LJA A;  3AZE C;  4WU9 C;  4QLC A;  4J8W A;  5AV6 A;  3AL0 C;  3C1B A;  3AZM D;  2L5A A;  4DRA A;  4CAY B;  3TU4 B;  5B1L A;  1TZY B;  5AVC B;  1S32 D;  3WA9 B;  4Z2M H;  4J8W C;  2W8S A;  3X1V A;  5B32 D;  4YS3 A;  4X23 A;  3NQU B;  1KX3 D;  3W99 A;  4UUZ B;  2FJ7 D;  1P3L C;  5BNX B;  1KX4 A;  5B1L C;  4H9N B;  1P3L B;  3REI D;  4NE5 A;  2DQN C;  3X1V C;  3AZG C;  4J8U D;  2HUE C;  1R4V A;  2J8P A;  4KHA A;  3X1S A;  4YS3 C;  4X23 C;  1EQZ A;  4R8P C;  3AZG B;  2HUE B;  3B0C T;  1P3O B;  4R8P B;  5AY8 B;  1KX4 C;  3LJA D;  3AZH A;  4J8X B;  1BH9 B;  4QLC D;  5BS7 A;  5AV6 D;  1PZR A;  3C1B D;  2RVQ D;  5CP6 C;  4Z66 D;  4XUJ A;  5GSU D;  3REJ A;  3UT9 B;  1P3I A;  1EQZ C;  5CP6 B;  2BYM A;  3B0D B;  4H9O A;  3MGP D;  3WKJ C;  3WAA A;  3REH A;  5B32 G;  1M18 C;  5JA4 B;  5GT3 D;  4XZQ B;  3WKJ B;  1M18 B;  3W96 A;  4YS3 D;  4X23 D;  4XUJ C;  3W99 D;  5B31 C;  5BO0 A;  5B31 B;  3MNN A;  2Y2J A;  1P3B A;  3REH C;  5CPK B;  3X1S D;  5F99 B;  5AV9 B;  3REK A;  3REL D;  3LZ1 C;  5DNN A;  1ZLA B;  3LZ1 B;  3C1C B;  3KUY D;  2Y2H A;  3AZH D;  3H0L C;  5AV8 C;  3MNN C;  5CPI A;  2Y2G A;  5B0Y C;  5B1M B;  5AV8 B;  5B33 A;  4YM6 B;  2LY8 A;  5B0Y B;  3W97 B;  1P3I D;  3REJ D;  3V9R B;  3VH6 A;  2NQB D;  4H9S A;  5BT1 D;  3AZJ C;  3AN2 D;  3AV1 C;  3AZJ B;  3AV1 B;  3WAA D;  1P3G B;  5B2J B;  5B2I A;  2CV5 D;  2F8N A;  5C3I B;  2ZY2 A;  1P3M A;  3W96 D;  1H3O B;  4NE3 A;  3O62 A;  3MVD C;  1F66 C;  4JJN B;  1KX5 B;  2Y2P A;  2PYO D;  3MVD B;  1P3K B;  1TAF B;  3EPJ A;  1P3B D;  3AFA B;  3WTP C;  4J8V C;  3A6N C;  2CWE A;  3UTB D;  1P3M C;  4J8V B;  3A6N B;  3REK D;  4DQY B;  5DNM A;  5DNN D;  5AV5 D;  3AZL C;  1JFI A;  3F6T A;  2Y2N A;  5CPI D;  3AZL B;  5B33 D;  4CSR B;  1U35 A;  3AYW C;  5B40 B;  3KXB A;  4WV4 B;  3UTA A;  1ID3 A;  3KSY A;  5E5A B;  1P3F A;  5DNM C;  4KUD D;  3X1T A;  3AV2 A;  2HIO B;  5B2I D;  2F8N D;  1ULY A;  1M19 B;  4ZUX B;  3KXB C;  3MGS A;  3O62 D;  1M1A D;  4KGC A;  2IO5 B;  2F8N K;  3W98 A;  2Y2O A;  3X1U C;  1F1E A;  2ZY5 A;  2YFW A;  3X1U B;  1P34 C;  3AZK C;  5FUG B;  3AZF C;  3AZN B;  3AZI C;  4CAY A;  2NZD C;  1P34 B;  4Z5T D;  3KWQ B;  3AZI B;  3AZK B;  2ARO C;  3AZF B;  3W98 C;  2G5H C;  3TU4 A;  2NZD B;  5AVC A;  2ARO B;  3WA9 A;  1U35 D;  1ID3 D;  3UTA D;  1P3F D;  5GT0 C;  5GXQ C;  3NQJ B;  3NQU A;  3X1T D;  5GT0 B;  4UUZ A;  3VH5 T;  2ZY3 A;  5GXQ B;  5BNX A;  3AV2 D;  2F8N G;  3TU4 C;  1TZY C;  5AVC C;  2FFF B;  5JRG D;  3LEL C;  1P3L A;  3WA9 C;  4LD9 C;  3LEL B;  3FDD A;  5CPJ D;  4LD9 B;  3MGS D;  3B0C W;  1T3U A;  1S32 B;  4KGC D;  3AZG A;  4E45 A;  3VH5 A;  4R8P A;  5B32 B;  5B24 D;  1BH9 A;  3AZE D;  4WU9 D;  2XD1 A;  3MGR B;  3WTP E;  5CP6 A;  1P3O C;  3B6F C;  5AY8 C;  3H0R C;  4J8U B;  2RIQ A;  3B6F B;  4J8X C;  5JA4 A;  3LZ0 C;  4XZQ A;  3WKJ A;  4J8W D;  1M18 A;  3LZ0 B;  3UT9 C;  4G92 C;  5AV6 B;  2ZM5 A;  3B0D C;  3MGQ C;  3C1B B;  5B31 A;  4G92 B;  1P3L D;  4Z66 B;  3MGQ B;  5GSU B;  5B1L D;  3B6G C;  4XZQ C;  3MGP B;  5F99 A;  3B6G B;  3X1V D;  5AV9 A;  3VH6 W;  3AZG D;  5BNV B;  5GT3 B;  4WNN B;  2VQR A;  4R8P D;  3LZ1 A;  3C1C A;  1ZLA A;  1KX4 D;  3W99 B;  4YM6 A;  5B1M A;  5AV8 A;  5CPK C;  5B0Y A;  3W97 A;  5F99 C;  5AV9 C;  3V9R A;  5CP6 D;  1EQZ D;  1P3A C;  1P3P C;  1ZLA C;  3C1C C;  3VH6 T;  1P3A B;  3AZJ A;  3AV1 A;  1P3P B;  1P3G A;  5B2J A;  3REL B;  4YM6 C;  5B1M C;  2F8N H;  3WKJ D;  4EO5 C;  1M18 D;  3KUY B;  2UWX A;  3W97 C;  4EO5 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...