4UUZA

Mcm2-histone complex
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
78
structure length
78
Chain Sequence
STELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HISTONE H3
publication title Structural Insight Into How the Human Helicase Subunit Mcm2 May Act as a Histone Chaperone Together with Asf1 at the Replication Fork.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Dna binding protein
total genus 24
structure length 78
sequence length 78
ec nomenclature
pdb deposition date 2014-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4uuzA00
2HIOD 1S32A 3W97D 4J8WA 3AZLB 3AZJD 4YM6A 5B0YB 4NFTA 1M19A 5DNMB 2CV5C 1P3IB 5B2IB 3AV1D 1AOID 3VH5W 5AVCA 5B32A 3REJD 4ZBJB 5B33C 1M19B 1BH9A 3LJAD 4XZQB 1N1JA 5AV5C 3X1SA 3MVDD 3REKD 5CPJA 3KUYB 5B1LB 5AV6D 3LZ1C 4WU9A 4CAYA 3AZFC 3AZLD 4LD9D 3REIA 1KX3D 1TZYC 3MGSB 3VH6T 5CPJB 5B0YD 3WA9A 3VH6A 4WU9B 5DNMD 4CAYB 4J8WD 2NQBA 1P3ID 3KSYA 4H9SA 4CSRA 1M19D 5B31G 4XZQD 1P3KA 5B32D 2YFWA 3A6NA 1WWSA 2HIOC 3KWQA 3W97C 2F8NG 3KUYD 5B1LD 3AZJC 4YS3C 3C1CB 3AZHB 4E44A 5CPJD 3MGSD 5B24A 4WU9D 3UTAA 3AV1C 1P3GB 1AOIC 4AWLB 3REJC 5DNNC 5G49A 3LJAC 3UTAB 3MVDC 4J8UB 3REKC 4Z2MH 3AZLC 4LD9C 3MNNA 5B0YC 1F66A 5DNMC 3AZHD 4J8WC 3AZGB 1P3IC 3MNNB 4H9RA 1P3GD 4R8PB 4ZBJC 1M19C 3UTBB 3VH6W 5B24D 4XZQC 3UTAD 4XUJB 3AZNA 5AV8A 5B1LC 3KUYC 5JA4B 2RVQD 1TAFB 3MGSC 5CPJC 5KDMB 2AROA 4WU9C 2BYKA 3WTPB 3RELA 3AZGD 3MNND 4R8PD 1B6WA 5AVBA 3X1VA 3MGPB 1HQ3B 5F99B 4J8XA 3AZMA 4H9NB 1KX5A 3MGQB 1F1EA 3NQJA 3AZHC 1A7WA 5BT1D 3REHB 3X1TB 1P3GC 4AWLC 2BYMA 3B0CT 4Z66A 2AROD 3O62B 3B6FB 4KUDA 3UTAC 4NE3A 1P34B 4J8UC 2F8NA 3MGPD 3AYWB 1HQ3D 5F99D 2RVQC 3X1VD 3W98B 3MGQD 5B1MA 3AZGC 3MNNC 3MGRA 1H3OA 4R8PC 1Q9CA 3UTBC 5B1MB 3B6FD 3NQUA 3AN2B 5BO0A 3TU4A 4XUJC 1H3OB 1P34D 1P3FA 1TZYB 3B6GA 4KHAA 3AYWD 4KUDD 3B6GB 5BO0B 3TU4B 4WZSB 1P3PB 5BT1C 5CPIB 1KU5A 3WTPC 1KX4B 5B1MD 2NZDA 4UUZB 5C3IB 4NE6A 3AN2D 3MGPC 4JJNA 1HQ3C 5F99C 2NZDB 3B0CW 4G91B 1AOIB 2F8NH 3LELB 3TU4D 3B6GD 3AV2A 3MGQC 3AFAA 1P3PD 4H9PB 1R4VA 2PYOA 3REHC 3X1TC 1KX4D 5AV6B 3O62C 3V9RA 2PYOB 3B6FC 4LD9B 1P34C 1KX3B 5B40B 5FUGA 1S32B 3AYWC 1ZLAA 4J8WB 4KUDC 2NZDD 4EO5B 4YM6B 3LELD 5FUGB 3AZKA 3W98C 4JJND 5AVCB 5B32B 2LY8A 3W99A 3AZKB 2HUEB 1BH9B 5B1MC 1N1JB 3X1SB 2PYOD 3AN2C 3WKJA 5B40D 1U35A 1S32D 3B6GC 3TU4C 3REIB 5B2JA 4YM6D 3WA9B 1P3PC 5CP6A 1ZLAD 5BNVA 2NQBB 5CPIC 1KX4C 5AVCD 4CSRB 3KXBA 3AZKD 4DRAA 3UT9A 1P3KB 3X1SD 5C3IC 3A6NB 2YFWB 5JRGA 3KWQB 4KGCA 5GT0A 2NZDC 4G91C 3LELC 5JRGB 3REID 3WA9D 5GT0B 5B24B 1U35D 2NQBD 5G49B 5CP6D 5AV6C 1BH8A 2PYOC 1P3AA 1ULYA 1P3KD 1KX3C 5B40C 3A6ND 3R45A 5BS7A 3KWQD 1S32C 4EO5C 4YM6C 5JRGD 1F66B 4H9OA 5GT0D 4H9RB 5AVCC 2FJ7A 5B32C 5GSUA 5GT3A 3AZKC 2HUEC 1P3LA 4G92B 2F8NK 1P3MA 3X1SC 2FJ7B 3AZIA 3AZNB 5GT3B 5AV8B 1P3MB 5GXQA 1P3AD 4QLCA 3REIC 3WA9C 2AROB 1M18A 3B0BA 1U35C 1F66D 2BYKB 5GXQB 2NQBC 3RELB 1M18B 4H9SC 5CP6C 5AVBB 3X1VB 4WNNA 1P3KC 1WWIA 2FJ7D 3A6NC 3AZND 3KWQC 5GT3D 4J8XB 3AZMB 1BFMA 5AV8D 1B67A 1P3MD 1KX5B 3AZID 5JRGC 5B31A 3NQJB 1P3OA 5GT0C 5B24C 5GXQD 2JSSA 3RELD 5B31B 2YFVA 2BYMB 4Z66B 3W96A 1M18D 4KUDB 4X23A 5AVBD 2F8NB 2YFVB 3W96B 4J8XD 3AZMD 3AZEA 1KX5D 5BS7C 1F66C 4WU8A 3WTPE 3MGRB 5B31D 1P3OD 4Z66D 4G92C 3NQUB 4WU8B 1P3FB 2FJ7C 2CV5A 4KHAB 3AZNC 2F8ND 5GT3C 3X1UA 3W96D 5B33A 5AV8C 1P3MC 5AV5A 3X1UB 2AROC 5GXQC 3RELC 3AZED 3MGRD 1M18C 3AZFA 4HGAB 1P3BA 5AVBC 3X1VC 3LZ0A 4WU8D 1P3FD 4JJNB 4J8XC 3AZMC 1P3BB 3LZ0B 1KX5C 3AV2B 3X1UD 5B0ZA 3AFAB 5B31C 3AZJA 5AV5D 5B0ZB 4YS3A 4Z66C 3V9RB 1EQZA 4Z5TA 3W96C 1ZLAB 1EQZB 5DNNA 1P3BD 3LZ0D 3LJAA 5AY8A 3REKA 5BNXA 3AV2D 3AFAD 3MGRC 3W99B 5AY8B 3AZLA 1ID3A 5BNXB 5B0ZD 5B0YA 4WU8C 1P3FC 5DNMA 3WKJB 1ID3B 1P3IA 5B2IA 4YS3D 1U35B 1EQZD 4Z5TD 5B2JB 4XZQA 4ZUXA 5CP6B 3X1UC 5BNVB 5DNND 3KUYA 5B1LA 4ZUXB 3KXBB 3W99D 5AY8D 4HGAC 3MGSA 3UT9B 2IO5B 3WKJD 1ID3D 4KGCB 4JJNC 1P3BC 3LZ0C 5CPKA 3B0DB 5B2JD 3AV2C 5B2ID 3AFAC 5CPKB 4ZUXD 5B0ZC 3KXBD 1BH8B 2CWEA 3C1CA 1P3AB 3AZHA 3UT9D 3R45B 1P3GA 1ZLAC 1EQZC 4WV4B 4KGCD 4Z5TC 5AV9A 4J8UA 4H9OB 5AV9B 5CPKD 3W99C 5AY8C 5E5AA 5GSUB 1P3LB 4M6BA 3AZIB 3WKJC 5E5AB 1ID3C 3AZGA 4R8PA 3C1CD 3UTBA 4QLCB 5B2JC 5B2IC 4H9QA 4XUJA 3C1BA 5AV9D 2L5AA 5JA4A 4ZUXC 4H9QB 3KXBC 3C1BB 5GSUD 1P3LD 4J8UD 1TAFA 4WNNB 5KDMA 3UT9C 2IO5C 5E5AD 3WTPA 4KGCC 1M1AA 4QLCD 3B0DC 1P3OB 3MGPA 1M1AB 4DRBA 3UTBD 5CPKC 1HQ3A 5F99A 4H9NA 4XUJD 3C1BD 4X23B 1P3AC 3MGQA 4J8VA 3REHA 3X1TA 3WAAA 3C1CC 3AZEB 3B6FA 3O62A 5B32G 4J8VB 4NE5A 3WTPD 1P34A 3WAAB 5AV9C 1M1AD 4Z2MG 3AYWA 5GSUC 1P3LC 4X23D 2CV5B 3W98A 3AZIC 5E5AC 5B33B 4E45A 4QLCC 3LZ1A 5AV5B 4J8VD 3REHD 3X1TD 3AN2A 3WAAD 1TZYA 3LZ1B 3O62D 3VH5T 3VH5A 3AZFB 3C1BC 5CHLB 1P3PA 2CV5D 5CPIA 1KX4A 5B33D 2HIOA 3W97A 3W98D 4UUZA 1HTAA 1P3OC 1M1AC 2HIOB 3W97B 3LZ1D 3AZJB 4YS3B 3AV1A 1AOIA 3LELA 3REJA 3AZFD 1TZYD 4X23C 4Z5TB 1JFIA 4H9PA 3AV1B 3MVDA 3REJB 5DNNB 1JFIB 3LJAB 3AZEC 5AV6A 4J8VC 3MVDB 4LD9A 5CPID 3REKB 1KX3A 3WAAC 5B40A
chains in the Genus database with same CATH superfamily
2HIOD 1S32A 3W97D 4J8WA 3AZLB 3AZJD 4YM6A 5B0YB 4NFTA 1M19A 5DNMB 2CV5C 1P3IB 5B2IB 3AV1D 1AOID 3VH5W 5AVCA 5B32A 3REJD 4ZBJB 5B33C 1M19B 1BH9A 3LJAD 4XZQB 1N1JA 5AV5C 3X1SA 3MVDD 3REKD 5CPJA 3KUYB 5B1LB 5AV6D 3LZ1C 4WU9A 4CAYA 3AZFC 3AZLD 4LD9D 3REIA 1KX3D 1TZYC 3MGSB 3VH6T 5CPJB 5B0YD 3WA9A 3VH6A 4WU9B 1PZRA 5DNMD 4CAYB 4J8WD 2NQBA 1P3ID 3KSYA 4H9SA 4CSRA 1M19D 5B31G 4XZQD 1P3KA 4DQYB 2XD5A 5B32D 2YFWA 3A6NA 1T3UA 1WWSA 2HIOC 3KWQA 3W97C 2F8NG 3KUYD 5B1LD 3AZJC 4YS3C 2ZY3A 3C1CB 3AZHB 4E44A 5CPJD 3MGSD 2JCHA 2DF4C 5B24A 4WU9D 3UTAA 3AV1C 1P3GB 1AOIC 4AWLB 3REJC 5DNNC 5G49A 3LJAC 3UTAB 3MVDC 4J8UB 3REKC 4Z2MH 3AZLC 4LD9C 3MNNA 5B0YC 1F66A 5DNMC 3AZHD 4J8WC 3AZGB 1P3IC 3MNNB 4H9RA 1P3GD 4R8PB 4ZBJC 1M19C 3UTBB 3VH6W 5B24D 4XZQC 3UTAD 4XUJB 3AZNA 5AV8A 5B1LC 3KUYC 5JA4B 2RVQD 1TAFB 3MGSC 5CPJC 5KDMB 2AROA 4WU9C 2BYKA 3WTPB 2VQRA 3RELA 3AZGD 3MNND 4R8PD 1B6WA 5AVBA 3EPKA 3X1VA 3MGPB 1HQ3B 5F99B 4J8XA 3AZMA 4H9NB 1KX5A 2J8PA 2Y2IA 3MGQB 1F1EA 3NQJA 3AZHC 1A7WA 5BT1D 3REHB 3X1TB 1P3GC 4AWLC 2BYMA 3B0CT 2AROD 4Z66A 3O62B 3B6FB 4KUDA 3UTAC 4NE3A 1P34B 4J8UC 2F8NA 3MGPD 3AYWB 1HQ3D 5F99D 2RVQC 3X1VD 3W98B 3MGQD 5B1MA 3AZGC 3MNNC 3MGRA 1H3OA 4R8PC 1Q9CA 3UTBC 5B1MB 3B6FD 3NQUA 3AN2B 5BO0A 3A1KA 4XUJC 1H3OB 3TU4A 1P34D 1TZYB 1P3FA 4KHAA 3AYWD 4KUDD 3B6GB 5BO0B 3TU4B 4WZSB 1P3PB 5BT1C 3H0RC 5CPIB 1KU5A 3WTPC 1KX4B 5B1MD 2NZDA 4UUZB 5C3IB 4NE6A 3AN2D 3MGPC 2Y2LA 4JJNA 1HQ3C 5F99C 2NZDB 3B0CW 4G91B 1AOIB 2F8NH 3LELB 3TU4D 3B6GD 3AV2A 3MGQC 3AFAA 1P3PD 4H9PB 1R4VA 2PYOA 3REHC 3X1TC 1KX4D 2Y2NA 5AV6B 3O62C 3V9RA 2PYOB 3B6FC 2Y2GA 4LD9B 1P34C 1KX3B 5B40B 3EG5B 5FUGA 1S32B 3AYWC 1ZLAA 4J8WB 4KUDC 2NZDD 3H0LC 4EO5B 4YM6B 3LELD 3P5JB 5FUGB 3AZKA 3W98C 4JJND 5AVCB 2UWXA 5B32B 2G5IC 2LY8A 3W99A 3AZKB 2HUEB 1BH9B 5B1MC 1N1JB 3X1SB 2PYOD 3AN2C 2JE5A 3WKJA 5B40D 1U35A 1S32D 3B6GC 3TU4C 3REIB 5B2JA 4YM6D 3WA9B 1P3PC 5CP6A 2FFFB 1ZLAD 5BNVA 2NQBB 2G5HC 5CPIC 1KX4C 2Y2HA 5AVCD 2DQNC 4CSRB 3KXBA 3AZKD 4DRAA 3UT9A 1P3KB 3X1SD 5C3IC 3A6NB 2YFWB 5JRGA 3KWQB 2Y2JA 4KGCA 5GT0A 2NZDC 4G91C 3LELC 5JRGB 3REID 3H0MC 3WA9D 5GT0B 5B24B 1U35D 2NQBD 5G49B 5CP6D 5AV6C 1BH8A 2PYOC 3F6TA 1P3AA 1ULYA 1P3KD 1KX3C 5B40C 3A6ND 3R45A 5BS7A 3KWQD 1S32C 4EO5C 4YM6C 5JRGD 1F66B 4H9OA 5GT0D 4H9RB 5AVCC 2FJ7A 5B32C 5GSUA 5GT3A 3AZKC 2HUEC 2Y2OA 4G92B 1P3LA 2F8NK 1P3MA 3X1SC 2FJ7B 3AZIA 3AZNB 5GT3B 5AV8B 1P3MB 5GXQA 1P3AD 4QLCA 3REIC 3WA9C 2AROB 1M18A 3B0BA 1U35C 1F66D 2BYKB 5GXQB 2ZM5A 2NQBC 3RELB 1M18B 4H9SC 5CP6C 5AVBB 3X1VB 4WNNA 1P3KC 1WWIA 2FJ7D 3A6NC 2RIQA 3AZND 3KWQC 5GT3D 4J8XB 3AZMB 1BFMA 5AV8D 1B67A 1P3MD 1KX5B 3AZID 5JRGC 5B31A 3NQJB 1P3OA 5GT0C 5B24C 5GXQD 2JSSA 3RELD 5B31B 2YFVA 2BYMB 4Z66B 3W96A 1M18D 4KUDB 4X23A 5AVBD 2F8NB 2YFVB 3W96B 4J8XD 3AZMD 3AZEA 1KX5D 5BS7C 1F66C 4WU8A 3WTPE 3MGRB 5B31D 1P3OD 4Z66D 4G92C 3NQUB 4WU8B 1P3FB 2FJ7C 2CV5A 4KHAB 3AZNC 2F8ND 5GT3C 3X1UA 3W96D 5B33A 5AV8C 1P3MC 5AV5A 3X1UB 1Z2CB 2AROC 4UPKA 5GXQC 3RELC 3AZED 3MGRD 1M18C 3AZFA 4HGAB 1P3BA 5AVBC 3X1VC 3LZ0A 4WU8D 1P3FD 2W8SA 4JJNB 4J8XC 3AZMC 1P3BB 3LZ0B 1KX5C 3AV2B 3X1UD 5B0ZA 3AFAB 5B31C 3AZJA 5AV5D 5B0ZB 4YS3A 4Z66C 3V9RB 1EQZA 4Z5TA 3W96C 1ZLAB 1EQZB 5DNNA 1P3BD 3LZ0D 3LJAA 5AY8A 3REKA 5BNXA 3AV2D 3AFAD 3MGRC 3KFUG 3W99B 5AY8B 3AZLA 1ID3A 5BNXB 5B0ZD 5B0YA 4WU8C 1P3FC 5DNMA 3B6GA 3WKJB 1ID3B 1P3IA 5B2IA 4YS3D 1U35B 1EQZD 4Z5TD 5B2JB 4XZQA 4ZUXA 5CP6B 3X1UC 2ZY5A 5BNVB 5DNND 3KUYA 5B1LA 4ZUXB 3KXBB 3W99D 5AY8D 4HGAC 3MGSA 3UT9B 2IO5B 3WKJD 1ID3D 4KGCB 4JJNC 1P3BC 3LZ0C 3AL0C 5CPKA 3B0DB 5B2JD 3AV2C 5B2ID 3FDDA 3AFAC 3A1IA 5CPKB 4ZUXD 5B0ZC 3KXBD 1BH8B 2CWEA 3C1CA 1P3AB 3AZHA 3UT9D 3R45B 1P3GA 1ZLAC 1EQZC 4WV4B 4KGCD 4Z5TC 5AV9A 4J8UA 4H9OB 5AV9B 3EPJA 5CPKD 3W99C 5AY8C 5E5AA 5GSUB 1P3LB 4M6BA 3AZIB 2BG1A 3WKJC 5E5AB 1ID3C 3AZGA 4R8PA 3EPHA 3C1CD 3UTBA 4QLCB 4WJ3C 5B2JC 5B2IC 4H9QA 4XUJA 3C1BA 3EPLA 5AV9D 2L5AA 5JA4A 4ZUXC 4H9QB 3KXBC 3C1BB 5GSUD 1P3LD 4J8UD 1TAFA 4WNNB 5KDMA 3UT9C 2IO5C 5E5AD 3WTPA 4KGCC 1M1AA 4QLCD 3B0DC 1P3OB 3MGPA 1M1AB 4DRBA 3UTBD 5CPKC 1HQ3A 5F99A 4H9NA 4XUJD 3C1BD 4X23B 1P3AC 3MGQA 2ZY2A 4J8VA 3REHA 3X1TA 2Y2QA 3WAAA 3C1CC 3AZEB 3B6FA 3O62A 5B32G 4J8VB 4NE5A 3WTPD 1P34A 3WAAB 5AV9C 1M1AD 4Z2MG 3AYWA 5GSUC 1P3LC 4X23D 2CV5B 3W98A 3AZIC 2XD1A 5E5AC 5B33B 4E45A 4QLCC 3LZ1A 2F2AC 2Y2KA 5AV5B 4J8VD 3REHD 3X1TD 3AN2A 3WAAD 1TZYA 3LZ1B 3O62D 3VH5T 3VH5A 3AZFB 3IP4C 3C1BC 2ZY4A 5CHLB 1P3PA 2CV5D 2Y2MA 5CPIA 1W2EA 1KX4A 5B33D 2HIOA 3W97A 3W98D 4UUZA 1HTAA 1P3OC 1M1AC 2HIOB 3W97B 3LZ1D 3AZJB 4YS3B 3AV1A 1AOIA 3LELA 3REJA 3AZFD 1TZYD 4X23C 4Z5TB 1JFIA 4H9PA 3AV1B 3MVDA 3REJB 5DNNB 1JFIB 3LJAB 3AZEC 5AV6A 4J8VC 3MVDB 4LD9A 5CPID 3REKB 1KX3A 3WAAC 5B40A 2Y2PA
chains in the Genus database with same CATH topology
2HIOD 1S32A 3W97D 4J8WA 3AZLB 3AZJD 4YM6A 5B0YB 4NFTA 1M19A 5DNMB 2CV5C 1P3IB 5B2IB 3AV1D 1AOID 3VH5W 5AVCA 5B32A 3REJD 4ZBJB 5B33C 1M19B 1BH9A 3LJAD 4XZQB 1N1JA 5AV5C 3X1SA 3MVDD 3REKD 5CPJA 3KUYB 5B1LB 5AV6D 3LZ1C 4WU9A 4CAYA 3AZFC 3AZLD 4LD9D 3REIA 1KX3D 1TZYC 3MGSB 3VH6T 5CPJB 5B0YD 3WA9A 3VH6A 4WU9B 1PZRA 5DNMD 4CAYB 4J8WD 2NQBA 1P3ID 3KSYA 4H9SA 4CSRA 1M19D 5B31G 4XZQD 1P3KA 4DQYB 2XD5A 5B32D 2YFWA 3A6NA 1T3UA 1WWSA 2HIOC 3KWQA 3W97C 2F8NG 3KUYD 5B1LD 3AZJC 4YS3C 2ZY3A 3C1CB 3AZHB 4E44A 5CPJD 3MGSD 2JCHA 2DF4C 5B24A 4WU9D 3UTAA 3AV1C 1P3GB 1AOIC 4AWLB 3REJC 5DNNC 5G49A 3LJAC 3UTAB 3MVDC 4J8UB 3REKC 4Z2MH 3AZLC 4LD9C 3MNNA 5B0YC 1F66A 5DNMC 3AZHD 4J8WC 3AZGB 1P3IC 3MNNB 4H9RA 1P3GD 4R8PB 4ZBJC 1M19C 3UTBB 3VH6W 5B24D 4XZQC 3UTAD 4XUJB 3AZNA 5AV8A 5B1LC 3KUYC 5JA4B 2RVQD 1TAFB 3MGSC 5CPJC 5KDMB 2AROA 4WU9C 2BYKA 3WTPB 2VQRA 3RELA 3AZGD 3MNND 4R8PD 1B6WA 5AVBA 3EPKA 3X1VA 3MGPB 1HQ3B 5F99B 4J8XA 3AZMA 4H9NB 1KX5A 2J8PA 2Y2IA 3MGQB 1F1EA 3NQJA 3AZHC 1A7WA 5BT1D 3REHB 3X1TB 1P3GC 4AWLC 2BYMA 3B0CT 2AROD 4Z66A 3O62B 3B6FB 4KUDA 3UTAC 4NE3A 1P34B 4J8UC 2F8NA 3MGPD 3AYWB 1HQ3D 5F99D 2RVQC 3X1VD 3W98B 3MGQD 5B1MA 3AZGC 3MNNC 3MGRA 1H3OA 4R8PC 1Q9CA 3UTBC 5B1MB 3B6FD 3NQUA 3AN2B 5BO0A 3A1KA 4XUJC 1H3OB 3TU4A 1P34D 1TZYB 1P3FA 4KHAA 3AYWD 4KUDD 3B6GB 5BO0B 3TU4B 4WZSB 1P3PB 5BT1C 3H0RC 5CPIB 1KU5A 3WTPC 1KX4B 5B1MD 2NZDA 4UUZB 5C3IB 4NE6A 3AN2D 3MGPC 2Y2LA 4JJNA 1HQ3C 5F99C 2NZDB 3B0CW 4G91B 1AOIB 2F8NH 3LELB 3TU4D 3B6GD 3AV2A 3MGQC 3AFAA 1P3PD 4H9PB 1R4VA 2PYOA 3REHC 3X1TC 1KX4D 2Y2NA 5AV6B 3O62C 3V9RA 2PYOB 3B6FC 2Y2GA 4LD9B 1P34C 1KX3B 5B40B 3EG5B 5FUGA 1S32B 3AYWC 1ZLAA 4J8WB 4KUDC 2NZDD 3H0LC 4EO5B 4YM6B 3LELD 3P5JB 5FUGB 3AZKA 3W98C 4JJND 5AVCB 2UWXA 5B32B 2G5IC 2LY8A 3W99A 3AZKB 2HUEB 1BH9B 5B1MC 1N1JB 3X1SB 2PYOD 3AN2C 2JE5A 3WKJA 5B40D 1U35A 1S32D 3B6GC 3TU4C 3REIB 5B2JA 4YM6D 3WA9B 1P3PC 5CP6A 2FFFB 1ZLAD 5BNVA 2NQBB 2G5HC 5CPIC 1KX4C 2Y2HA 5AVCD 2DQNC 4CSRB 3KXBA 3AZKD 4DRAA 3UT9A 1P3KB 3X1SD 5C3IC 3A6NB 2YFWB 5JRGA 3KWQB 2Y2JA 4KGCA 5GT0A 2NZDC 4G91C 3LELC 5JRGB 3REID 3H0MC 3WA9D 5GT0B 5B24B 1U35D 2NQBD 5G49B 5CP6D 5AV6C 1BH8A 2PYOC 3F6TA 1P3AA 1ULYA 1P3KD 1KX3C 5B40C 3A6ND 3R45A 5BS7A 3KWQD 1S32C 4EO5C 4YM6C 5JRGD 1F66B 4H9OA 5GT0D 4H9RB 5AVCC 2FJ7A 5B32C 5GSUA 5GT3A 3AZKC 2HUEC 2Y2OA 4G92B 1P3LA 2F8NK 1P3MA 3X1SC 2FJ7B 3AZIA 3AZNB 5GT3B 5AV8B 1P3MB 5GXQA 1P3AD 4QLCA 3REIC 3WA9C 2AROB 1M18A 3B0BA 1U35C 1F66D 2BYKB 5GXQB 2ZM5A 2NQBC 3RELB 1M18B 4H9SC 5CP6C 5AVBB 3X1VB 4WNNA 1P3KC 1WWIA 2FJ7D 3A6NC 2RIQA 3AZND 3KWQC 5GT3D 4J8XB 3AZMB 1BFMA 5AV8D 1B67A 1P3MD 1KX5B 3AZID 5JRGC 5B31A 3NQJB 1P3OA 5GT0C 5B24C 5GXQD 2JSSA 3RELD 5B31B 2YFVA 2BYMB 4Z66B 3W96A 1M18D 4KUDB 4X23A 5AVBD 2F8NB 2YFVB 3W96B 4J8XD 3AZMD 3AZEA 1KX5D 5BS7C 1F66C 4WU8A 3WTPE 3MGRB 5B31D 1P3OD 4Z66D 4G92C 3NQUB 4WU8B 1P3FB 2FJ7C 2CV5A 4KHAB 3AZNC 2F8ND 5GT3C 3X1UA 3W96D 5B33A 5AV8C 1P3MC 5AV5A 3X1UB 1Z2CB 2AROC 4UPKA 5GXQC 3RELC 3AZED 3MGRD 1M18C 3AZFA 4HGAB 1P3BA 5AVBC 3X1VC 3LZ0A 4WU8D 1P3FD 2W8SA 4JJNB 4J8XC 3AZMC 1P3BB 3LZ0B 1KX5C 3AV2B 3X1UD 5B0ZA 3AFAB 5B31C 3AZJA 5AV5D 5B0ZB 4YS3A 4Z66C 3V9RB 1EQZA 4Z5TA 3W96C 1ZLAB 1EQZB 5DNNA 1P3BD 3LZ0D 3LJAA 5AY8A 3REKA 5BNXA 3AV2D 3AFAD 3MGRC 3KFUG 3W99B 5AY8B 3AZLA 1ID3A 5BNXB 5B0ZD 5B0YA 4WU8C 1P3FC 5DNMA 3B6GA 3WKJB 1ID3B 1P3IA 5B2IA 4YS3D 1U35B 1EQZD 4Z5TD 5B2JB 4XZQA 4ZUXA 5CP6B 3X1UC 2ZY5A 5BNVB 5DNND 3KUYA 5B1LA 4ZUXB 3KXBB 3W99D 5AY8D 4HGAC 3MGSA 3UT9B 2IO5B 3WKJD 1ID3D 4KGCB 4JJNC 1P3BC 3LZ0C 3AL0C 5CPKA 3B0DB 5B2JD 3AV2C 5B2ID 3FDDA 3AFAC 3A1IA 5CPKB 4ZUXD 5B0ZC 3KXBD 1BH8B 2CWEA 3C1CA 1P3AB 3AZHA 3UT9D 3R45B 1P3GA 1ZLAC 1EQZC 4WV4B 4KGCD 4Z5TC 5AV9A 4J8UA 4H9OB 5AV9B 3EPJA 5CPKD 3W99C 5AY8C 5E5AA 5GSUB 1P3LB 4M6BA 3AZIB 2BG1A 3WKJC 5E5AB 1ID3C 3AZGA 4R8PA 3EPHA 3C1CD 3UTBA 4QLCB 4WJ3C 5B2JC 5B2IC 4H9QA 4XUJA 3C1BA 3EPLA 5AV9D 2L5AA 5JA4A 4ZUXC 4H9QB 3KXBC 3C1BB 5GSUD 1P3LD 4J8UD 1TAFA 4WNNB 5KDMA 3UT9C 2IO5C 5E5AD 3WTPA 4KGCC 1M1AA 4QLCD 3B0DC 1P3OB 3MGPA 1M1AB 4DRBA 3UTBD 5CPKC 1HQ3A 5F99A 4H9NA 4XUJD 3C1BD 4X23B 1P3AC 3MGQA 2ZY2A 4J8VA 3REHA 3X1TA 2Y2QA 3WAAA 3C1CC 3AZEB 3B6FA 3O62A 5B32G 4J8VB 4NE5A 3WTPD 1P34A 3WAAB 5AV9C 1M1AD 4Z2MG 3AYWA 5GSUC 1P3LC 4X23D 2CV5B 3W98A 3AZIC 2XD1A 5E5AC 5B33B 4E45A 4QLCC 3LZ1A 2F2AC 2Y2KA 5AV5B 4J8VD 3REHD 3X1TD 3AN2A 3WAAD 1TZYA 3LZ1B 3O62D 3VH5T 3VH5A 3AZFB 3IP4C 3C1BC 2ZY4A 5CHLB 1P3PA 2CV5D 2Y2MA 5CPIA 1W2EA 1KX4A 5B33D 2HIOA 3W97A 3W98D 4UUZA 1HTAA 1P3OC 1M1AC 2HIOB 3W97B 3LZ1D 3AZJB 4YS3B 3AV1A 1AOIA 3LELA 3REJA 3AZFD 1TZYD 4X23C 4Z5TB 1JFIA 4H9PA 3AV1B 3MVDA 3REJB 5DNNB 1JFIB 3LJAB 3AZEC 5AV6A 4J8VC 3MVDB 4LD9A 5CPID 3REKB 1KX3A 3WAAC 5B40A 2Y2PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HIO D;  1S32 A;  3W97 D;  4J8W A;  3AZL B;  3AZJ D;  4YM6 A;  5B0Y B;  4NFT A;  1M19 A;  5DNM B;  2CV5 C;  1P3I B;  5B2I B;  3AV1 D;  1AOI D;  3VH5 W;  5AVC A;  5B32 A;  3REJ D;  4ZBJ B;  5B33 C;  1M19 B;  1BH9 A;  3LJA D;  4XZQ B;  1N1J A;  5AV5 C;  3X1S A;  3MVD D;  3REK D;  5CPJ A;  3KUY B;  5B1L B;  5AV6 D;  3LZ1 C;  4WU9 A;  4CAY A;  3AZF C;  3AZL D;  4LD9 D;  3REI A;  1KX3 D;  1TZY C;  3MGS B;  3VH6 T;  5CPJ B;  5B0Y D;  3WA9 A;  3VH6 A;  4WU9 B;  5DNM D;  4CAY B;  4J8W D;  2NQB A;  1P3I D;  3KSY A;  4H9S A;  4CSR A;  1M19 D;  5B31 G;  4XZQ D;  1P3K A;  5B32 D;  2YFW A;  3A6N A;  1WWS A;  2HIO C;  3KWQ A;  3W97 C;  2F8N G;  3KUY D;  5B1L D;  3AZJ C;  4YS3 C;  3C1C B;  3AZH B;  4E44 A;  5CPJ D;  3MGS D;  5B24 A;  4WU9 D;  3UTA A;  3AV1 C;  1P3G B;  1AOI C;  4AWL B;  3REJ C;  5DNN C;  5G49 A;  3LJA C;  3UTA B;  3MVD C;  4J8U B;  3REK C;  4Z2M H;  3AZL C;  4LD9 C;  3MNN A;  5B0Y C;  1F66 A;  5DNM C;  3AZH D;  4J8W C;  3AZG B;  1P3I C;  3MNN B;  4H9R A;  1P3G D;  4R8P B;  4ZBJ C;  1M19 C;  3UTB B;  3VH6 W;  5B24 D;  4XZQ C;  3UTA D;  4XUJ B;  3AZN A;  5AV8 A;  5B1L C;  3KUY C;  5JA4 B;  2RVQ D;  1TAF B;  3MGS C;  5CPJ C;  5KDM B;  2ARO A;  4WU9 C;  2BYK A;  3WTP B;  3REL A;  3AZG D;  3MNN D;  4R8P D;  1B6W A;  5AVB A;  3X1V A;  3MGP B;  1HQ3 B;  5F99 B;  4J8X A;  3AZM A;  4H9N B;  1KX5 A;  3MGQ B;  1F1E A;  3NQJ A;  3AZH C;  1A7W A;  5BT1 D;  3REH B;  3X1T B;  1P3G C;  4AWL C;  2BYM A;  3B0C T;  4Z66 A;  2ARO D;  3O62 B;  3B6F B;  4KUD A;  3UTA C;  4NE3 A;  1P34 B;  4J8U C;  2F8N A;  3MGP D;  3AYW B;  1HQ3 D;  5F99 D;  2RVQ C;  3X1V D;  3W98 B;  3MGQ D;  5B1M A;  3AZG C;  3MNN C;  3MGR A;  1H3O A;  4R8P C;  1Q9C A;  3UTB C;  5B1M B;  3B6F D;  3NQU A;  3AN2 B;  5BO0 A;  3TU4 A;  4XUJ C;  1H3O B;  1P34 D;  1P3F A;  1TZY B;  3B6G A;  4KHA A;  3AYW D;  4KUD D;  3B6G B;  5BO0 B;  3TU4 B;  4WZS B;  1P3P B;  5BT1 C;  5CPI B;  1KU5 A;  3WTP C;  1KX4 B;  5B1M D;  2NZD A;  4UUZ B;  5C3I B;  4NE6 A;  3AN2 D;  3MGP C;  4JJN A;  1HQ3 C;  5F99 C;  2NZD B;  3B0C W;  4G91 B;  1AOI B;  2F8N H;  3LEL B;  3TU4 D;  3B6G D;  3AV2 A;  3MGQ C;  3AFA A;  1P3P D;  4H9P B;  1R4V A;  2PYO A;  3REH C;  3X1T C;  1KX4 D;  5AV6 B;  3O62 C;  3V9R A;  2PYO B;  3B6F C;  4LD9 B;  1P34 C;  1KX3 B;  5B40 B;  5FUG A;  1S32 B;  3AYW C;  1ZLA A;  4J8W B;  4KUD C;  2NZD D;  4EO5 B;  4YM6 B;  3LEL D;  5FUG B;  3AZK A;  3W98 C;  4JJN D;  5AVC B;  5B32 B;  2LY8 A;  3W99 A;  3AZK B;  2HUE B;  1BH9 B;  5B1M C;  1N1J B;  3X1S B;  2PYO D;  3AN2 C;  3WKJ A;  5B40 D;  1U35 A;  1S32 D;  3B6G C;  3TU4 C;  3REI B;  5B2J A;  4YM6 D;  3WA9 B;  1P3P C;  5CP6 A;  1ZLA D;  5BNV A;  2NQB B;  5CPI C;  1KX4 C;  5AVC D;  4CSR B;  3KXB A;  3AZK D;  4DRA A;  3UT9 A;  1P3K B;  3X1S D;  5C3I C;  3A6N B;  2YFW B;  5JRG A;  3KWQ B;  4KGC A;  5GT0 A;  2NZD C;  4G91 C;  3LEL C;  5JRG B;  3REI D;  3WA9 D;  5GT0 B;  5B24 B;  1U35 D;  2NQB D;  5G49 B;  5CP6 D;  5AV6 C;  1BH8 A;  2PYO C;  1P3A A;  1ULY A;  1P3K D;  1KX3 C;  5B40 C;  3A6N D;  3R45 A;  5BS7 A;  3KWQ D;  1S32 C;  4EO5 C;  4YM6 C;  5JRG D;  1F66 B;  4H9O A;  5GT0 D;  4H9R B;  5AVC C;  2FJ7 A;  5B32 C;  5GSU A;  5GT3 A;  3AZK C;  2HUE C;  1P3L A;  4G92 B;  2F8N K;  1P3M A;  3X1S C;  2FJ7 B;  3AZI A;  3AZN B;  5GT3 B;  5AV8 B;  1P3M B;  5GXQ A;  1P3A D;  4QLC A;  3REI C;  3WA9 C;  2ARO B;  1M18 A;  3B0B A;  1U35 C;  1F66 D;  2BYK B;  5GXQ B;  2NQB C;  3REL B;  1M18 B;  4H9S C;  5CP6 C;  5AVB B;  3X1V B;  4WNN A;  1P3K C;  1WWI A;  2FJ7 D;  3A6N C;  3AZN D;  3KWQ C;  5GT3 D;  4J8X B;  3AZM B;  1BFM A;  5AV8 D;  1B67 A;  1P3M D;  1KX5 B;  3AZI D;  5JRG C;  5B31 A;  3NQJ B;  1P3O A;  5GT0 C;  5B24 C;  5GXQ D;  2JSS A;  3REL D;  5B31 B;  2YFV A;  2BYM B;  4Z66 B;  3W96 A;  1M18 D;  4KUD B;  4X23 A;  5AVB D;  2F8N B;  2YFV B;  3W96 B;  4J8X D;  3AZM D;  3AZE A;  1KX5 D;  5BS7 C;  1F66 C;  4WU8 A;  3WTP E;  3MGR B;  5B31 D;  1P3O D;  4Z66 D;  4G92 C;  3NQU B;  4WU8 B;  1P3F B;  2FJ7 C;  2CV5 A;  4KHA B;  3AZN C;  2F8N D;  5GT3 C;  3X1U A;  3W96 D;  5B33 A;  5AV8 C;  1P3M C;  5AV5 A;  3X1U B;  2ARO C;  5GXQ C;  3REL C;  3AZE D;  3MGR D;  1M18 C;  3AZF A;  4HGA B;  1P3B A;  5AVB C;  3X1V C;  3LZ0 A;  4WU8 D;  1P3F D;  4JJN B;  4J8X C;  3AZM C;  1P3B B;  3LZ0 B;  1KX5 C;  3AV2 B;  3X1U D;  5B0Z A;  3AFA B;  5B31 C;  3AZJ A;  5AV5 D;  5B0Z B;  4YS3 A;  4Z66 C;  3V9R B;  1EQZ A;  4Z5T A;  3W96 C;  1ZLA B;  1EQZ B;  5DNN A;  1P3B D;  3LZ0 D;  3LJA A;  5AY8 A;  3REK A;  5BNX A;  3AV2 D;  3AFA D;  3MGR C;  3W99 B;  5AY8 B;  3AZL A;  1ID3 A;  5BNX B;  5B0Z D;  5B0Y A;  4WU8 C;  1P3F C;  5DNM A;  3WKJ B;  1ID3 B;  1P3I A;  5B2I A;  4YS3 D;  1U35 B;  1EQZ D;  4Z5T D;  5B2J B;  4XZQ A;  4ZUX A;  5CP6 B;  3X1U C;  5BNV B;  5DNN D;  3KUY A;  5B1L A;  4ZUX B;  3KXB B;  3W99 D;  5AY8 D;  4HGA C;  3MGS A;  3UT9 B;  2IO5 B;  3WKJ D;  1ID3 D;  4KGC B;  4JJN C;  1P3B C;  3LZ0 C;  5CPK A;  3B0D B;  5B2J D;  3AV2 C;  5B2I D;  3AFA C;  5CPK B;  4ZUX D;  5B0Z C;  3KXB D;  1BH8 B;  2CWE A;  3C1C A;  1P3A B;  3AZH A;  3UT9 D;  3R45 B;  1P3G A;  1ZLA C;  1EQZ C;  4WV4 B;  4KGC D;  4Z5T C;  5AV9 A;  4J8U A;  4H9O B;  5AV9 B;  5CPK D;  3W99 C;  5AY8 C;  5E5A A;  5GSU B;  1P3L B;  4M6B A;  3AZI B;  3WKJ C;  5E5A B;  1ID3 C;  3AZG A;  4R8P A;  3C1C D;  3UTB A;  4QLC B;  5B2J C;  5B2I C;  4H9Q A;  4XUJ A;  3C1B A;  5AV9 D;  2L5A A;  5JA4 A;  4ZUX C;  4H9Q B;  3KXB C;  3C1B B;  5GSU D;  1P3L D;  4J8U D;  1TAF A;  4WNN B;  5KDM A;  3UT9 C;  2IO5 C;  5E5A D;  3WTP A;  4KGC C;  1M1A A;  4QLC D;  3B0D C;  1P3O B;  3MGP A;  1M1A B;  4DRB A;  3UTB D;  5CPK C;  1HQ3 A;  5F99 A;  4H9N A;  4XUJ D;  3C1B D;  4X23 B;  1P3A C;  3MGQ A;  4J8V A;  3REH A;  3X1T A;  3WAA A;  3C1C C;  3AZE B;  3B6F A;  3O62 A;  5B32 G;  4J8V B;  4NE5 A;  3WTP D;  1P34 A;  3WAA B;  5AV9 C;  1M1A D;  4Z2M G;  3AYW A;  5GSU C;  1P3L C;  4X23 D;  2CV5 B;  3W98 A;  3AZI C;  5E5A C;  5B33 B;  4E45 A;  4QLC C;  3LZ1 A;  5AV5 B;  4J8V D;  3REH D;  3X1T D;  3AN2 A;  3WAA D;  1TZY A;  3LZ1 B;  3O62 D;  3VH5 T;  3VH5 A;  3AZF B;  3C1B C;  5CHL B;  1P3P A;  2CV5 D;  5CPI A;  1KX4 A;  5B33 D;  2HIO A;  3W97 A;  3W98 D;  4UUZ A;  1HTA A;  1P3O C;  1M1A C;  2HIO B;  3W97 B;  3LZ1 D;  3AZJ B;  4YS3 B;  3AV1 A;  1AOI A;  3LEL A;  3REJ A;  3AZF D;  1TZY D;  4X23 C;  4Z5T B;  1JFI A;  4H9P A;  3AV1 B;  3MVD A;  3REJ B;  5DNN B;  1JFI B;  3LJA B;  3AZE C;  5AV6 A;  4J8V C;  3MVD B;  4LD9 A;  5CPI D;  3REK B;  1KX3 A;  3WAA C;  5B40 A; 
#chains in the Genus database with same CATH topology
 2HIO D;  1S32 A;  3W97 D;  4J8W A;  3AZL B;  3AZJ D;  4YM6 A;  5B0Y B;  4NFT A;  1M19 A;  5DNM B;  2CV5 C;  1P3I B;  5B2I B;  3AV1 D;  1AOI D;  3VH5 W;  5AVC A;  5B32 A;  3REJ D;  4ZBJ B;  5B33 C;  1M19 B;  1BH9 A;  3LJA D;  4XZQ B;  1N1J A;  5AV5 C;  3X1S A;  3MVD D;  3REK D;  5CPJ A;  3KUY B;  5B1L B;  5AV6 D;  3LZ1 C;  4WU9 A;  4CAY A;  3AZF C;  3AZL D;  4LD9 D;  3REI A;  1KX3 D;  1TZY C;  3MGS B;  3VH6 T;  5CPJ B;  5B0Y D;  3WA9 A;  3VH6 A;  4WU9 B;  1PZR A;  5DNM D;  4CAY B;  4J8W D;  2NQB A;  1P3I D;  3KSY A;  4H9S A;  4CSR A;  1M19 D;  5B31 G;  4XZQ D;  1P3K A;  4DQY B;  2XD5 A;  5B32 D;  2YFW A;  3A6N A;  1T3U A;  1WWS A;  2HIO C;  3KWQ A;  3W97 C;  2F8N G;  3KUY D;  5B1L D;  3AZJ C;  4YS3 C;  2ZY3 A;  3C1C B;  3AZH B;  4E44 A;  5CPJ D;  3MGS D;  2JCH A;  2DF4 C;  5B24 A;  4WU9 D;  3UTA A;  3AV1 C;  1P3G B;  1AOI C;  4AWL B;  3REJ C;  5DNN C;  5G49 A;  3LJA C;  3UTA B;  3MVD C;  4J8U B;  3REK C;  4Z2M H;  3AZL C;  4LD9 C;  3MNN A;  5B0Y C;  1F66 A;  5DNM C;  3AZH D;  4J8W C;  3AZG B;  1P3I C;  3MNN B;  4H9R A;  1P3G D;  4R8P B;  4ZBJ C;  1M19 C;  3UTB B;  3VH6 W;  5B24 D;  4XZQ C;  3UTA D;  4XUJ B;  3AZN A;  5AV8 A;  5B1L C;  3KUY C;  5JA4 B;  2RVQ D;  1TAF B;  3MGS C;  5CPJ C;  5KDM B;  2ARO A;  4WU9 C;  2BYK A;  3WTP B;  2VQR A;  3REL A;  3AZG D;  3MNN D;  4R8P D;  1B6W A;  5AVB A;  3EPK A;  3X1V A;  3MGP B;  1HQ3 B;  5F99 B;  4J8X A;  3AZM A;  4H9N B;  1KX5 A;  2J8P A;  2Y2I A;  3MGQ B;  1F1E A;  3NQJ A;  3AZH C;  1A7W A;  5BT1 D;  3REH B;  3X1T B;  1P3G C;  4AWL C;  2BYM A;  3B0C T;  2ARO D;  4Z66 A;  3O62 B;  3B6F B;  4KUD A;  3UTA C;  4NE3 A;  1P34 B;  4J8U C;  2F8N A;  3MGP D;  3AYW B;  1HQ3 D;  5F99 D;  2RVQ C;  3X1V D;  3W98 B;  3MGQ D;  5B1M A;  3AZG C;  3MNN C;  3MGR A;  1H3O A;  4R8P C;  1Q9C A;  3UTB C;  5B1M B;  3B6F D;  3NQU A;  3AN2 B;  5BO0 A;  3A1K A;  4XUJ C;  1H3O B;  3TU4 A;  1P34 D;  1TZY B;  1P3F A;  4KHA A;  3AYW D;  4KUD D;  3B6G B;  5BO0 B;  3TU4 B;  4WZS B;  1P3P B;  5BT1 C;  3H0R C;  5CPI B;  1KU5 A;  3WTP C;  1KX4 B;  5B1M D;  2NZD A;  4UUZ B;  5C3I B;  4NE6 A;  3AN2 D;  3MGP C;  2Y2L A;  4JJN A;  1HQ3 C;  5F99 C;  2NZD B;  3B0C W;  4G91 B;  1AOI B;  2F8N H;  3LEL B;  3TU4 D;  3B6G D;  3AV2 A;  3MGQ C;  3AFA A;  1P3P D;  4H9P B;  1R4V A;  2PYO A;  3REH C;  3X1T C;  1KX4 D;  2Y2N A;  5AV6 B;  3O62 C;  3V9R A;  2PYO B;  3B6F C;  2Y2G A;  4LD9 B;  1P34 C;  1KX3 B;  5B40 B;  3EG5 B;  5FUG A;  1S32 B;  3AYW C;  1ZLA A;  4J8W B;  4KUD C;  2NZD D;  3H0L C;  4EO5 B;  4YM6 B;  3LEL D;  3P5J B;  5FUG B;  3AZK A;  3W98 C;  4JJN D;  5AVC B;  2UWX A;  5B32 B;  2G5I C;  2LY8 A;  3W99 A;  3AZK B;  2HUE B;  1BH9 B;  5B1M C;  1N1J B;  3X1S B;  2PYO D;  3AN2 C;  2JE5 A;  3WKJ A;  5B40 D;  1U35 A;  1S32 D;  3B6G C;  3TU4 C;  3REI B;  5B2J A;  4YM6 D;  3WA9 B;  1P3P C;  5CP6 A;  2FFF B;  1ZLA D;  5BNV A;  2NQB B;  2G5H C;  5CPI C;  1KX4 C;  2Y2H A;  5AVC D;  2DQN C;  4CSR B;  3KXB A;  3AZK D;  4DRA A;  3UT9 A;  1P3K B;  3X1S D;  5C3I C;  3A6N B;  2YFW B;  5JRG A;  3KWQ B;  2Y2J A;  4KGC A;  5GT0 A;  2NZD C;  4G91 C;  3LEL C;  5JRG B;  3REI D;  3H0M C;  3WA9 D;  5GT0 B;  5B24 B;  1U35 D;  2NQB D;  5G49 B;  5CP6 D;  5AV6 C;  1BH8 A;  2PYO C;  3F6T A;  1P3A A;  1ULY A;  1P3K D;  1KX3 C;  5B40 C;  3A6N D;  3R45 A;  5BS7 A;  3KWQ D;  1S32 C;  4EO5 C;  4YM6 C;  5JRG D;  1F66 B;  4H9O A;  5GT0 D;  4H9R B;  5AVC C;  2FJ7 A;  5B32 C;  5GSU A;  5GT3 A;  3AZK C;  2HUE C;  2Y2O A;  4G92 B;  1P3L A;  2F8N K;  1P3M A;  3X1S C;  2FJ7 B;  3AZI A;  3AZN B;  5GT3 B;  5AV8 B;  1P3M B;  5GXQ A;  1P3A D;  4QLC A;  3REI C;  3WA9 C;  2ARO B;  1M18 A;  3B0B A;  1U35 C;  1F66 D;  2BYK B;  5GXQ B;  2ZM5 A;  2NQB C;  3REL B;  1M18 B;  4H9S C;  5CP6 C;  5AVB B;  3X1V B;  4WNN A;  1P3K C;  1WWI A;  2FJ7 D;  3A6N C;  2RIQ A;  3AZN D;  3KWQ C;  5GT3 D;  4J8X B;  3AZM B;  1BFM A;  5AV8 D;  1B67 A;  1P3M D;  1KX5 B;  3AZI D;  5JRG C;  5B31 A;  3NQJ B;  1P3O A;  5GT0 C;  5B24 C;  5GXQ D;  2JSS A;  3REL D;  5B31 B;  2YFV A;  2BYM B;  4Z66 B;  3W96 A;  1M18 D;  4KUD B;  4X23 A;  5AVB D;  2F8N B;  2YFV B;  3W96 B;  4J8X D;  3AZM D;  3AZE A;  1KX5 D;  5BS7 C;  1F66 C;  4WU8 A;  3WTP E;  3MGR B;  5B31 D;  1P3O D;  4Z66 D;  4G92 C;  3NQU B;  4WU8 B;  1P3F B;  2FJ7 C;  2CV5 A;  4KHA B;  3AZN C;  2F8N D;  5GT3 C;  3X1U A;  3W96 D;  5B33 A;  5AV8 C;  1P3M C;  5AV5 A;  3X1U B;  1Z2C B;  2ARO C;  4UPK A;  5GXQ C;  3REL C;  3AZE D;  3MGR D;  1M18 C;  3AZF A;  4HGA B;  1P3B A;  5AVB C;  3X1V C;  3LZ0 A;  4WU8 D;  1P3F D;  2W8S A;  4JJN B;  4J8X C;  3AZM C;  1P3B B;  3LZ0 B;  1KX5 C;  3AV2 B;  3X1U D;  5B0Z A;  3AFA B;  5B31 C;  3AZJ A;  5AV5 D;  5B0Z B;  4YS3 A;  4Z66 C;  3V9R B;  1EQZ A;  4Z5T A;  3W96 C;  1ZLA B;  1EQZ B;  5DNN A;  1P3B D;  3LZ0 D;  3LJA A;  5AY8 A;  3REK A;  5BNX A;  3AV2 D;  3AFA D;  3MGR C;  3KFU G;  3W99 B;  5AY8 B;  3AZL A;  1ID3 A;  5BNX B;  5B0Z D;  5B0Y A;  4WU8 C;  1P3F C;  5DNM A;  3B6G A;  3WKJ B;  1ID3 B;  1P3I A;  5B2I A;  4YS3 D;  1U35 B;  1EQZ D;  4Z5T D;  5B2J B;  4XZQ A;  4ZUX A;  5CP6 B;  3X1U C;  2ZY5 A;  5BNV B;  5DNN D;  3KUY A;  5B1L A;  4ZUX B;  3KXB B;  3W99 D;  5AY8 D;  4HGA C;  3MGS A;  3UT9 B;  2IO5 B;  3WKJ D;  1ID3 D;  4KGC B;  4JJN C;  1P3B C;  3LZ0 C;  3AL0 C;  5CPK A;  3B0D B;  5B2J D;  3AV2 C;  5B2I D;  3FDD A;  3AFA C;  3A1I A;  5CPK B;  4ZUX D;  5B0Z C;  3KXB D;  1BH8 B;  2CWE A;  3C1C A;  1P3A B;  3AZH A;  3UT9 D;  3R45 B;  1P3G A;  1ZLA C;  1EQZ C;  4WV4 B;  4KGC D;  4Z5T C;  5AV9 A;  4J8U A;  4H9O B;  5AV9 B;  3EPJ A;  5CPK D;  3W99 C;  5AY8 C;  5E5A A;  5GSU B;  1P3L B;  4M6B A;  3AZI B;  2BG1 A;  3WKJ C;  5E5A B;  1ID3 C;  3AZG A;  4R8P A;  3EPH A;  3C1C D;  3UTB A;  4QLC B;  4WJ3 C;  5B2J C;  5B2I C;  4H9Q A;  4XUJ A;  3C1B A;  3EPL A;  5AV9 D;  2L5A A;  5JA4 A;  4ZUX C;  4H9Q B;  3KXB C;  3C1B B;  5GSU D;  1P3L D;  4J8U D;  1TAF A;  4WNN B;  5KDM A;  3UT9 C;  2IO5 C;  5E5A D;  3WTP A;  4KGC C;  1M1A A;  4QLC D;  3B0D C;  1P3O B;  3MGP A;  1M1A B;  4DRB A;  3UTB D;  5CPK C;  1HQ3 A;  5F99 A;  4H9N A;  4XUJ D;  3C1B D;  4X23 B;  1P3A C;  3MGQ A;  2ZY2 A;  4J8V A;  3REH A;  3X1T A;  2Y2Q A;  3WAA A;  3C1C C;  3AZE B;  3B6F A;  3O62 A;  5B32 G;  4J8V B;  4NE5 A;  3WTP D;  1P34 A;  3WAA B;  5AV9 C;  1M1A D;  4Z2M G;  3AYW A;  5GSU C;  1P3L C;  4X23 D;  2CV5 B;  3W98 A;  3AZI C;  2XD1 A;  5E5A C;  5B33 B;  4E45 A;  4QLC C;  3LZ1 A;  2F2A C;  2Y2K A;  5AV5 B;  4J8V D;  3REH D;  3X1T D;  3AN2 A;  3WAA D;  1TZY A;  3LZ1 B;  3O62 D;  3VH5 T;  3VH5 A;  3AZF B;  3IP4 C;  3C1B C;  2ZY4 A;  5CHL B;  1P3P A;  2CV5 D;  2Y2M A;  5CPI A;  1W2E A;  1KX4 A;  5B33 D;  2HIO A;  3W97 A;  3W98 D;  4UUZ A;  1HTA A;  1P3O C;  1M1A C;  2HIO B;  3W97 B;  3LZ1 D;  3AZJ B;  4YS3 B;  3AV1 A;  1AOI A;  3LEL A;  3REJ A;  3AZF D;  1TZY D;  4X23 C;  4Z5T B;  1JFI A;  4H9P A;  3AV1 B;  3MVD A;  3REJ B;  5DNN B;  1JFI B;  3LJA B;  3AZE C;  5AV6 A;  4J8V C;  3MVD B;  4LD9 A;  5CPI D;  3REK B;  1KX3 A;  3WAA C;  5B40 A;  2Y2P A; 
#chains in the Genus database with same CATH homology
 2HIO D;  1S32 A;  3W97 D;  4J8W A;  3AZL B;  3AZJ D;  4YM6 A;  5B0Y B;  4NFT A;  1M19 A;  5DNM B;  2CV5 C;  1P3I B;  5B2I B;  3AV1 D;  1AOI D;  3VH5 W;  5AVC A;  5B32 A;  3REJ D;  4ZBJ B;  5B33 C;  1M19 B;  1BH9 A;  3LJA D;  4XZQ B;  1N1J A;  5AV5 C;  3X1S A;  3MVD D;  3REK D;  5CPJ A;  3KUY B;  5B1L B;  5AV6 D;  3LZ1 C;  4WU9 A;  4CAY A;  3AZF C;  3AZL D;  4LD9 D;  3REI A;  1KX3 D;  1TZY C;  3MGS B;  3VH6 T;  5CPJ B;  5B0Y D;  3WA9 A;  3VH6 A;  4WU9 B;  1PZR A;  5DNM D;  4CAY B;  4J8W D;  2NQB A;  1P3I D;  3KSY A;  4H9S A;  4CSR A;  1M19 D;  5B31 G;  4XZQ D;  1P3K A;  4DQY B;  2XD5 A;  5B32 D;  2YFW A;  3A6N A;  1T3U A;  1WWS A;  2HIO C;  3KWQ A;  3W97 C;  2F8N G;  3KUY D;  5B1L D;  3AZJ C;  4YS3 C;  2ZY3 A;  3C1C B;  3AZH B;  4E44 A;  5CPJ D;  3MGS D;  2JCH A;  2DF4 C;  5B24 A;  4WU9 D;  3UTA A;  3AV1 C;  1P3G B;  1AOI C;  4AWL B;  3REJ C;  5DNN C;  5G49 A;  3LJA C;  3UTA B;  3MVD C;  4J8U B;  3REK C;  4Z2M H;  3AZL C;  4LD9 C;  3MNN A;  5B0Y C;  1F66 A;  5DNM C;  3AZH D;  4J8W C;  3AZG B;  1P3I C;  3MNN B;  4H9R A;  1P3G D;  4R8P B;  4ZBJ C;  1M19 C;  3UTB B;  3VH6 W;  5B24 D;  4XZQ C;  3UTA D;  4XUJ B;  3AZN A;  5AV8 A;  5B1L C;  3KUY C;  5JA4 B;  2RVQ D;  1TAF B;  3MGS C;  5CPJ C;  5KDM B;  2ARO A;  4WU9 C;  2BYK A;  3WTP B;  2VQR A;  3REL A;  3AZG D;  3MNN D;  4R8P D;  1B6W A;  5AVB A;  3EPK A;  3X1V A;  3MGP B;  1HQ3 B;  5F99 B;  4J8X A;  3AZM A;  4H9N B;  1KX5 A;  2J8P A;  2Y2I A;  3MGQ B;  1F1E A;  3NQJ A;  3AZH C;  1A7W A;  5BT1 D;  3REH B;  3X1T B;  1P3G C;  4AWL C;  2BYM A;  3B0C T;  2ARO D;  4Z66 A;  3O62 B;  3B6F B;  4KUD A;  3UTA C;  4NE3 A;  1P34 B;  4J8U C;  2F8N A;  3MGP D;  3AYW B;  1HQ3 D;  5F99 D;  2RVQ C;  3X1V D;  3W98 B;  3MGQ D;  5B1M A;  3AZG C;  3MNN C;  3MGR A;  1H3O A;  4R8P C;  1Q9C A;  3UTB C;  5B1M B;  3B6F D;  3NQU A;  3AN2 B;  5BO0 A;  3A1K A;  4XUJ C;  1H3O B;  3TU4 A;  1P34 D;  1TZY B;  1P3F A;  4KHA A;  3AYW D;  4KUD D;  3B6G B;  5BO0 B;  3TU4 B;  4WZS B;  1P3P B;  5BT1 C;  3H0R C;  5CPI B;  1KU5 A;  3WTP C;  1KX4 B;  5B1M D;  2NZD A;  4UUZ B;  5C3I B;  4NE6 A;  3AN2 D;  3MGP C;  2Y2L A;  4JJN A;  1HQ3 C;  5F99 C;  2NZD B;  3B0C W;  4G91 B;  1AOI B;  2F8N H;  3LEL B;  3TU4 D;  3B6G D;  3AV2 A;  3MGQ C;  3AFA A;  1P3P D;  4H9P B;  1R4V A;  2PYO A;  3REH C;  3X1T C;  1KX4 D;  2Y2N A;  5AV6 B;  3O62 C;  3V9R A;  2PYO B;  3B6F C;  2Y2G A;  4LD9 B;  1P34 C;  1KX3 B;  5B40 B;  3EG5 B;  5FUG A;  1S32 B;  3AYW C;  1ZLA A;  4J8W B;  4KUD C;  2NZD D;  3H0L C;  4EO5 B;  4YM6 B;  3LEL D;  3P5J B;  5FUG B;  3AZK A;  3W98 C;  4JJN D;  5AVC B;  2UWX A;  5B32 B;  2G5I C;  2LY8 A;  3W99 A;  3AZK B;  2HUE B;  1BH9 B;  5B1M C;  1N1J B;  3X1S B;  2PYO D;  3AN2 C;  2JE5 A;  3WKJ A;  5B40 D;  1U35 A;  1S32 D;  3B6G C;  3TU4 C;  3REI B;  5B2J A;  4YM6 D;  3WA9 B;  1P3P C;  5CP6 A;  2FFF B;  1ZLA D;  5BNV A;  2NQB B;  2G5H C;  5CPI C;  1KX4 C;  2Y2H A;  5AVC D;  2DQN C;  4CSR B;  3KXB A;  3AZK D;  4DRA A;  3UT9 A;  1P3K B;  3X1S D;  5C3I C;  3A6N B;  2YFW B;  5JRG A;  3KWQ B;  2Y2J A;  4KGC A;  5GT0 A;  2NZD C;  4G91 C;  3LEL C;  5JRG B;  3REI D;  3H0M C;  3WA9 D;  5GT0 B;  5B24 B;  1U35 D;  2NQB D;  5G49 B;  5CP6 D;  5AV6 C;  1BH8 A;  2PYO C;  3F6T A;  1P3A A;  1ULY A;  1P3K D;  1KX3 C;  5B40 C;  3A6N D;  3R45 A;  5BS7 A;  3KWQ D;  1S32 C;  4EO5 C;  4YM6 C;  5JRG D;  1F66 B;  4H9O A;  5GT0 D;  4H9R B;  5AVC C;  2FJ7 A;  5B32 C;  5GSU A;  5GT3 A;  3AZK C;  2HUE C;  2Y2O A;  4G92 B;  1P3L A;  2F8N K;  1P3M A;  3X1S C;  2FJ7 B;  3AZI A;  3AZN B;  5GT3 B;  5AV8 B;  1P3M B;  5GXQ A;  1P3A D;  4QLC A;  3REI C;  3WA9 C;  2ARO B;  1M18 A;  3B0B A;  1U35 C;  1F66 D;  2BYK B;  5GXQ B;  2ZM5 A;  2NQB C;  3REL B;  1M18 B;  4H9S C;  5CP6 C;  5AVB B;  3X1V B;  4WNN A;  1P3K C;  1WWI A;  2FJ7 D;  3A6N C;  2RIQ A;  3AZN D;  3KWQ C;  5GT3 D;  4J8X B;  3AZM B;  1BFM A;  5AV8 D;  1B67 A;  1P3M D;  1KX5 B;  3AZI D;  5JRG C;  5B31 A;  3NQJ B;  1P3O A;  5GT0 C;  5B24 C;  5GXQ D;  2JSS A;  3REL D;  5B31 B;  2YFV A;  2BYM B;  4Z66 B;  3W96 A;  1M18 D;  4KUD B;  4X23 A;  5AVB D;  2F8N B;  2YFV B;  3W96 B;  4J8X D;  3AZM D;  3AZE A;  1KX5 D;  5BS7 C;  1F66 C;  4WU8 A;  3WTP E;  3MGR B;  5B31 D;  1P3O D;  4Z66 D;  4G92 C;  3NQU B;  4WU8 B;  1P3F B;  2FJ7 C;  2CV5 A;  4KHA B;  3AZN C;  2F8N D;  5GT3 C;  3X1U A;  3W96 D;  5B33 A;  5AV8 C;  1P3M C;  5AV5 A;  3X1U B;  1Z2C B;  2ARO C;  4UPK A;  5GXQ C;  3REL C;  3AZE D;  3MGR D;  1M18 C;  3AZF A;  4HGA B;  1P3B A;  5AVB C;  3X1V C;  3LZ0 A;  4WU8 D;  1P3F D;  2W8S A;  4JJN B;  4J8X C;  3AZM C;  1P3B B;  3LZ0 B;  1KX5 C;  3AV2 B;  3X1U D;  5B0Z A;  3AFA B;  5B31 C;  3AZJ A;  5AV5 D;  5B0Z B;  4YS3 A;  4Z66 C;  3V9R B;  1EQZ A;  4Z5T A;  3W96 C;  1ZLA B;  1EQZ B;  5DNN A;  1P3B D;  3LZ0 D;  3LJA A;  5AY8 A;  3REK A;  5BNX A;  3AV2 D;  3AFA D;  3MGR C;  3KFU G;  3W99 B;  5AY8 B;  3AZL A;  1ID3 A;  5BNX B;  5B0Z D;  5B0Y A;  4WU8 C;  1P3F C;  5DNM A;  3B6G A;  3WKJ B;  1ID3 B;  1P3I A;  5B2I A;  4YS3 D;  1U35 B;  1EQZ D;  4Z5T D;  5B2J B;  4XZQ A;  4ZUX A;  5CP6 B;  3X1U C;  2ZY5 A;  5BNV B;  5DNN D;  3KUY A;  5B1L A;  4ZUX B;  3KXB B;  3W99 D;  5AY8 D;  4HGA C;  3MGS A;  3UT9 B;  2IO5 B;  3WKJ D;  1ID3 D;  4KGC B;  4JJN C;  1P3B C;  3LZ0 C;  3AL0 C;  5CPK A;  3B0D B;  5B2J D;  3AV2 C;  5B2I D;  3FDD A;  3AFA C;  3A1I A;  5CPK B;  4ZUX D;  5B0Z C;  3KXB D;  1BH8 B;  2CWE A;  3C1C A;  1P3A B;  3AZH A;  3UT9 D;  3R45 B;  1P3G A;  1ZLA C;  1EQZ C;  4WV4 B;  4KGC D;  4Z5T C;  5AV9 A;  4J8U A;  4H9O B;  5AV9 B;  3EPJ A;  5CPK D;  3W99 C;  5AY8 C;  5E5A A;  5GSU B;  1P3L B;  4M6B A;  3AZI B;  2BG1 A;  3WKJ C;  5E5A B;  1ID3 C;  3AZG A;  4R8P A;  3EPH A;  3C1C D;  3UTB A;  4QLC B;  4WJ3 C;  5B2J C;  5B2I C;  4H9Q A;  4XUJ A;  3C1B A;  3EPL A;  5AV9 D;  2L5A A;  5JA4 A;  4ZUX C;  4H9Q B;  3KXB C;  3C1B B;  5GSU D;  1P3L D;  4J8U D;  1TAF A;  4WNN B;  5KDM A;  3UT9 C;  2IO5 C;  5E5A D;  3WTP A;  4KGC C;  1M1A A;  4QLC D;  3B0D C;  1P3O B;  3MGP A;  1M1A B;  4DRB A;  3UTB D;  5CPK C;  1HQ3 A;  5F99 A;  4H9N A;  4XUJ D;  3C1B D;  4X23 B;  1P3A C;  3MGQ A;  2ZY2 A;  4J8V A;  3REH A;  3X1T A;  2Y2Q A;  3WAA A;  3C1C C;  3AZE B;  3B6F A;  3O62 A;  5B32 G;  4J8V B;  4NE5 A;  3WTP D;  1P34 A;  3WAA B;  5AV9 C;  1M1A D;  4Z2M G;  3AYW A;  5GSU C;  1P3L C;  4X23 D;  2CV5 B;  3W98 A;  3AZI C;  2XD1 A;  5E5A C;  5B33 B;  4E45 A;  4QLC C;  3LZ1 A;  2F2A C;  2Y2K A;  5AV5 B;  4J8V D;  3REH D;  3X1T D;  3AN2 A;  3WAA D;  1TZY A;  3LZ1 B;  3O62 D;  3VH5 T;  3VH5 A;  3AZF B;  3IP4 C;  3C1B C;  2ZY4 A;  5CHL B;  1P3P A;  2CV5 D;  2Y2M A;  5CPI A;  1W2E A;  1KX4 A;  5B33 D;  2HIO A;  3W97 A;  3W98 D;  4UUZ A;  1HTA A;  1P3O C;  1M1A C;  2HIO B;  3W97 B;  3LZ1 D;  3AZJ B;  4YS3 B;  3AV1 A;  1AOI A;  3LEL A;  3REJ A;  3AZF D;  1TZY D;  4X23 C;  4Z5T B;  1JFI A;  4H9P A;  3AV1 B;  3MVD A;  3REJ B;  5DNN B;  1JFI B;  3LJA B;  3AZE C;  5AV6 A;  4J8V C;  3MVD B;  4LD9 A;  5CPI D;  3REK B;  1KX3 A;  3WAA C;  5B40 A;  2Y2P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...