5B0YC

Crystal structure of the nucleosome containing histone h3 with the crotonylated lysine 122
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
105
structure length
105
Chain Sequence
AKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.2
publication title Crystal structure of the nucleosome containing histone H3 with crotonylated lysine 122
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein
total genus 32
structure length 105
sequence length 105
chains with identical sequence G
ec nomenclature
pdb deposition date 2015-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5b0yC00
3W96B 3AZFB 1P3KA 4H9QA 5B1MC 5B1MB 4X23D 2NQBA 5AY8A 4XUJB 3UTBA 1BH8A 5CP6C 3WTPC 3B0CT 5B1LA 3WTPB 5AV6A 4Z66A 5B32C 1ZLAC 4J8WB 4UUZA 5B32B 4YS3A 5FUGB 1ZLAB 3REIC 1JFIB 4KUDC 5B31B 3AZIA 4KUDB 5B2JD 3X1SB 4H9OA 4Z5TD 3AZNA 5B33B 5JRGC 4KGCD 1P34C 5B40B 5JRGB 4J8VA 3LZ0A 1P34B 4LD9A 3KWQC 3WAAD 4ZUXC 3KWQB 3UTAD 3W98C 4ZUXB 3B0DC 5CPJB 2YFWB 3LELA 5B0YA 1U35D 3W98B 3B0DB 3B6FC 5F99A 3B6FB 5AVBA 3MGSD 3LJAA 5B2IA 4CAYA 1HQ3D 3UT9C 1M1AC 1P3GA 5AV8C 3UT9B 3AZFD 3A6NC 1M1AB 3W96D 5AV8B 3A6NB 2F8NH 2JSSA 5B1MD 2BYMA 3KXBA 5CPKC 3MGQC 3TU4C 2NZDC 5CPKB 1P3AA 3MGQB 3TU4B 4YM6B 4XUJD 3B6GC 5GXQA 5BNXB 5BO0A 3WTPD 3AZLA 1M18A 1B67A 4Z2MH 2PYOA 4H9QB 4ZBJB 4J8WD 5DNNA 5B32D 1ZLAD 5B31D 2NQBC 5AY8C 5BT1C 4KUDD 2NQBB 5AY8B 3UTBC 5CP6A 3UTBB 3X1SD 1S32A 1BH8B 5B1LC 5B33D 5AV6C 3AV2A 5B1LB 4Z66C 5B40D 5JRGD 5AV6B 5GT3C 3AZGD 1P34D 4Z66B 4YS3C 1AOIC 3KWQD 3REJA 3REIA 4ZUXD 4YS3B 5CPJD 3AZIC 3W98D 3AZIB 2RVQC 3X1VA 3AZNC 4J8XA 1WWSA 4H9OB 3AZNB 4J8VC 4J8VB 3AN2A 3LZ1A 3LZ0B 3UT9D 1M1AD 5B0YC 1H3OA 5AV8D 3A6ND 3LELB 1P3LC 5B0YB 5F99C 5F99B 5AVBC 3B0CW 1P3PA 5AVBB 3LJAC 5B2IC 5CPKD 3LJAB 3MGQD 5B2IB 4R8PA 3TU4D 4CAYB 4YM6D 3VH5A 1P3GC 4H9NA 1P3GB 3WTPE 3AV1A 1P3KD 3KXBC 2NZDA 2BYMB 3KXBB 1P3AC 1P3AB 2NQBD 5AY8D 3MNNA 3B6GA 5BT1D 3UTBD 3VH6A 5GXQB 3MGRC 2F8NG 3AZKA 5C3IC 3AZLC 1M18C 5B1LD 5BO0B 3AZLB 5C3IB 5AV6D 1M18B 2PYOC 4Z66D 2PYOB 5AV5A 5BNVA 5DNNC 1P3IA 1WWIA 5DNNB 4YS3D 3AZID 4Z2MG 2RVQD 1S32C 5CP6B 3X1UC 3AV2C 1S32B 3NQUA 3AZND 2YFVA 3AV2B 5GT3A 5B0ZA 4J8VD 3LZ0D 3REHA 1AOIA 4LD9D 3REJC 2HIOA 3O62C 3REJB 3REIB 3LELD 5B0YD 5F99D 3X1VC 3X1VB 5AVBD 4J8XC 4J8XB 3LJAD 4H9RA 2HUEC 5B2ID 3AN2C 3LZ1C 2HUEB 3AN2B 3LZ1B 1P3GD 5GT0A 4XZQA 1P3LA 1H3OB 1P3PC 1P3PB 5GSUC 3KXBD 3WA9A 4R8PC 4NE5A 1F66C 1P3AD 4R8PB 3NQJA 3WKJA 5GXQD 3REKA 4H9NB 3AV1C 2F8NK 3AZLD 3AV1B 2PYOD 2IO5C 4WZSB 3MGPA 3X1TA 2IO5B 5DNND 1P3FA 1KX5A 2NZDB 3R45A 3MNNC 1TZYA 3MNNB 3B6GB 3MGRA 5CP6D 3AZKC 1S32D 4NE6A 3AZJA 3AZKB 1R4VA 5AV5C 1P3IC 3AZEA 5AV5B 5BNVB 1P3IB 4JJNA 3REJD 3REID 3AFAA 3W99A 4WU9A 4QLCC 3RELA 3X1VD 3X1UA 4AWLC 4J8XD 3NQUB 4AWLB 5B0ZC 2YFVB 5GT3B 3W97C 5B0ZB 3REHC 3AN2D 3LZ1D 4KHAA 3W97B 2HIOC 3REHB 3O62A 1AOIB 5B24A 2HIOB 5AV9A 5E5AC 3B6FD 5CPIA 5DNMA 1KU5A 5B32G 5B31G 4H9RB 4R8PD 1KX3A 5GT0C 3AYWA 4XZQC 5G49A 5GT0B 4XZQB 3AV1D 2AROA 1P3LB 2CWEA 4DRAA 5GSUA 4NE3A 5BS7A 3WA9C 2BYKA 2CV5A 1F66A 1F1EA 2NZDD 3KUYA 3WA9B 1P3OA 3MNND 1KX4A 4WU8A 3B6GD 3WKJC 3AZGA 3REKC 3NQJB 3WKJB 3REKB 3AZKD 3X1TC 3MGPC 5AV5D 3X1TB 3MGPB 1P3ID 1P3FC 5KDMA 1KX5C 1P3FB 1KX5B 1TZYC 3R45B 1TZYB 2LY8A 1BFMA 3MGRB 3C1BA 3C1CA 3AZJC 5AVCA 3AZJB 1ID3A 1Q9CA 5GT3D 5B0ZD 3AZEC 3AZEB 3REHD 4JJNC 1M19A 1AOID 1ULYA 2HIOD 4H9SC 4JJNB 1EQZA 2F8NA 3AFAC 3W99C 4WU9C 4QLCA 3AFAB 3W99B 4WU9B 3RELC 3KSYA 3RELB 1P3BA 3X1UB 4E45A 3W97A 3AZHA 5B24C 4KHAB 3O62B 5B24B 5AV9C 3AZMA 5GT0D 5E5AA 4XZQD 2FJ7A 5AV9B 4J8UA 3V9RA 1P3LD 5CPIC 3MVDA 1BH9A 5DNMC 1P3MA 5CPIB 4CSRA 5DNMB 5CHLB 4XUJC 3WA9D 1HTAA 4G92C 1KX3C 4G92B 1KX3B 3AYWC 4J8WC 3WKJD 3REKD 3AYWB 4X23A 2AROC 5G49B 5B31C 2AROB 4WNNA 3X1TD 3MGPD 5GSUB 5BS7C 2CV5C 3X1SC 1P3FD 1KX5D 2L5AA 3KUYC 2BYKB 4H9PA 5B33C 2CV5B 1F66B 3KUYB 5B40C 1P3OC 1KX4C 4WU8C 1TZYD 3AZGC 1P3OB 1KX4B 4WU8B 3MGRD 3AZGB 1B6WA 1M18D 4DRBA 3AZJD 5CPJC 3AZED 5B2JA 4JJND 5KDMB 4Z5TA 4KGCA 4G91C 3AFAD 3W99D 4WU9D 4G91B 4E44A 3WAAA 1TAFA 3C1BC 3C1CC 3RELD 5AVCC 3X1UD 3AV2D 3UTAA 1ID3C 3C1BB 3C1CB 5AVCB 1U35A 1ID3B 3VH5W 1M19C 4H9SA 3O62D 1M19B 5B24D 1EQZC 3MGSA 2F8NB 1EQZB 4WV4B 5AV9D 1N1JA 4QLCB 5JA4A 5CPID 1HQ3A 5DNMD 4YM6C 1P3BC 3W96A 1P3BB 3AZFA 3AZHC 1P3KC 3AZHB 4EO5C 1P3KB 1KX3D 4EO5B 4ZBJC 3AZMC 3VH6W 5B1MA 3AYWD 2FJ7C 3AZMB 4J8UC 5E5AB 3MVDC 2FJ7B 1P3MC 2AROD 4J8UB 3V9RB 3MVDB 1BH9B 1P3PD 1P3MB 4XUJA 4CSRB 5GSUD 3WTPA 2CV5D 1F66D 3KUYD 1P3OD 4NFTA 4J8WA 4WU8D 1KX4D 4HGAC 5B32A 1ZLAA 5FUGA 4X23C 4HGAB 1JFIA 5B31A 4X23B 4UUZB 4KUDA 4WNNB 3VH5T 3X1SA 1A7WA 5B33A 5B40A 5JRGA 4H9PB 1P34A 3B0BA 3LZ0C 4LD9C 3KWQA 3C1BD 3C1CD 4ZUXA 5AVCD 5CPJA 4LD9B 2YFWA 1ID3D 3W98A 4M6BA 3LELC 3B6FA 5B2JC 1M19D 4Z5TC 3VH6T 4KGCC 5B2JB 2F8ND 1EQZD 4Z5TB 4KGCB 4QLCD 3WAAC 3WAAB 3UTAC 1TAFB 3UT9A 1P3BD 1M1AA 3UTAB 1U35C 5AV8A 3A6NA 3W97D 1U35B 3AZHD 3MGSC 3AZMD 3MGSB 5E5AD 5CPKA 2FJ7D 3MGQA 4J8UD 3TU4A 1N1JB 1HQ3C 4YM6A 3MVDD 1P3MD 5JA4B 1HQ3B 3W96C 3AZFC 5BNXA 5GXQC
chains in the Genus database with same CATH superfamily
3W96B 3AZFB 1P3KA 4H9QA 5B1MC 2FJ7A 5B1MB 4X23D 2NQBA 5AY8A 3EPHA 4XUJB 3UTBA 1BH8A 5CP6C 3WTPC 3B0CT 5B1LA 3EPJA 3WTPB 5AV6A 4Z66A 5B32C 1ZLAC 4J8WB 4UUZA 5B32B 4YS3A 5FUGB 1ZLAB 3REIC 1JFIB 4KUDC 5B31B 3AZIA 4KUDB 5B2JD 3X1SB 4H9OA 4Z5TD 3AZNA 5B33B 5JRGC 4KGCD 1P34C 5B40B 5JRGB 4J8VA 3LZ0A 1P34B 4LD9A 3KWQC 3WAAD 3AL0C 4ZUXC 3KWQB 3UTAD 3W98C 4ZUXB 3B0DC 5CPJB 2YFWB 3LELA 5B0YA 1U35D 3W98B 3B0DB 3B6FC 5F99A 3EPLA 3B6FB 5AVBA 3MGSD 3LJAA 5B2IA 4CAYA 1HQ3D 2Y2NA 3UT9C 1M1AC 1P3GA 5AV8C 3UT9B 3AZFD 3A6NC 1M1AB 3W96D 5AV8B 3A6NB 2F8NH 2JSSA 1W2EA 5B1MD 2BYMA 3KXBA 5CPKC 3MGQC 3TU4C 2NZDC 5CPKB 1P3AA 3MGQB 3TU4B 4YM6B 4XUJD 3B6GC 5GXQA 5BNXB 5BO0A 3WTPD 3AZLA 1M18A 1B67A 4Z2MH 2PYOA 2DQNC 4H9QB 4ZBJB 4J8WD 5DNNA 5B32D 1ZLAD 2Y2KA 5B31D 2NQBC 5AY8C 5BT1C 4KUDD 2NQBB 5AY8B 3UTBC 5CP6A 3UTBB 3X1SD 1S32A 1BH8B 5B1LC 5B33D 5AV6C 3AV2A 5B1LB 5B40D 4Z66C 5AV6B 5JRGD 5GT3C 3AZGD 1P34D 4Z66B 4YS3C 1AOIC 3KWQD 3REJA 3REIA 4ZUXD 4YS3B 5CPJD 3AZIC 3W98D 2JE5A 2DF4C 2RVQC 3AZIB 3X1VA 3AZNC 4J8XA 1WWSA 4H9OB 3AZNB 4J8VC 3EPKA 4J8VB 3AN2A 3LZ1A 3LZ0B 1PZRA 3UT9D 1M1AD 2W8SA 5B0YC 1H3OA 5AV8D 3A6ND 3LELB 1P3LC 5B0YB 5F99C 5F99B 5AVBC 3B0CW 1P3PA 5AVBB 3LJAC 5B2IC 5CPKD 3LJAB 3MGQD 5B2IB 4R8PA 3TU4D 4CAYB 4YM6D 3VH5A 1P3GC 4H9NA 2ZY3A 1P3GB 3WTPE 3AV1A 1P3KD 3F6TA 3P5JB 3KXBC 2NZDA 2BYMB 3KXBB 1P3AC 1P3AB 2NQBD 5AY8D 3MNNA 3B6GA 5BT1D 3UTBD 3VH6A 5GXQB 3MGRC 2F8NG 3AZKA 5C3IC 3AZLC 1M18C 5B1LD 5BO0B 3AZLB 5C3IB 5AV6D 1M18B 2PYOC 4Z66D 2PYOB 5AV5A 5BNVA 5DNNC 1P3IA 1WWIA 5DNNB 2ZM5A 4YS3D 3AZID 4Z2MG 2RVQD 1S32C 5CP6B 3X1UC 3AV2C 1S32B 3NQUA 3AZND 2YFVA 3AV2B 5GT3A 4WJ3C 2FFFB 5B0ZA 4J8VD 3LZ0D 3REHA 1AOIA 4LD9D 2Y2GA 3REJC 2Y2PA 2HIOA 3O62C 3REJB 2XD1A 3REIB 3LELD 5B0YD 5F99D 3X1VC 3X1VB 5AVBD 4J8XC 2Y2MA 4J8XB 3LJAD 4H9RA 2HUEC 5B2ID 3AN2C 3LZ1C 2HUEB 3AN2B 3LZ1B 1P3GD 5GT0A 4XZQA 1P3LA 1H3OB 1P3PC 1P3PB 5GSUC 3KXBD 3WA9A 4R8PC 3A1IA 4NE5A 1F66C 1P3AD 4R8PB 3NQJA 3WKJA 5GXQD 3REKA 4H9NB 3AV1C 2F8NK 3IP4C 3AZLD 3AV1B 2PYOD 2IO5C 4WZSB 3MGPA 3X1TA 2IO5B 5DNND 2ZY4A 1P3FA 1KX5A 2NZDB 3R45A 3MNNC 1TZYA 3MNNB 3B6GB 3MGRA 5CP6D 3AZKC 1S32D 4NE6A 3AZJA 3AZKB 1R4VA 5AV5C 1P3IC 3AZEA 5AV5B 5BNVB 1P3IB 4JJNA 3REJD 3REID 3AFAA 3W99A 4WU9A 4QLCC 3RELA 1Z2CB 3X1UA 3X1VD 4AWLC 4J8XD 3NQUB 4AWLB 5B0ZC 2YFVB 5GT3B 3W97C 5B0ZB 3REHC 3AN2D 3LZ1D 4KHAA 3W97B 2HIOC 3REHB 3O62A 1AOIB 5B24A 2HIOB 5AV9A 5E5AC 3B6FD 5CPIA 5DNMA 1KU5A 5B32G 5B31G 4H9RB 4R8PD 2Y2HA 1KX3A 5GT0C 3AYWA 4XZQC 2XD5A 5G49A 5GT0B 4XZQB 3AV1D 2AROA 1P3LB 2CWEA 4DRAA 2G5IC 5GSUA 4NE3A 4DQYB 5BS7A 3WA9C 2BYKA 2CV5A 1F66A 1F1EA 2NZDD 3KUYA 3WA9B 1P3OA 3MNND 2JCHA 4WU8A 1KX4A 2Y2IA 3B6GD 3AZGA 3REKC 3WKJC 3NQJB 3WKJB 3REKB 3AZKD 3X1TC 3MGPC 5AV5D 3X1TB 3MGPB 1P3ID 1P3FC 5KDMA 1KX5C 1P3FB 1KX5B 1TZYC 3R45B 1TZYB 1T3UA 2LY8A 1BFMA 3MGRB 3C1BA 3C1CA 3AZJC 5AVCA 3AZJB 1ID3A 1Q9CA 5GT3D 5B0ZD 3AZEC 3H0RC 3AZEB 3REHD 4JJNC 1M19A 1AOID 2F2AC 1ULYA 2G5HC 2HIOD 4H9SC 4JJNB 1EQZA 2F8NA 3AFAC 3W99C 4WU9C 4QLCA 3AFAB 3W99B 4WU9B 3RELC 3KSYA 3RELB 1P3BA 3X1UB 4E45A 3W97A 3AZHA 5B24C 4KHAB 3O62B 5B24B 5AV9C 3AZMA 5GT0D 5E5AA 2BG1A 2Y2QA 4XZQD 5AV9B 4J8UA 3V9RA 1P3LD 5CPIC 3MVDA 1BH9A 5DNMC 4UPKA 1P3MA 5CPIB 4CSRA 5DNMB 5CHLB 4XUJC 3WA9D 1HTAA 4G92C 1KX3C 4G92B 1KX3B 3AYWC 4J8WC 3WKJD 3KFUG 3REKD 3AYWB 4X23A 2AROC 5G49B 2UWXA 2AROB 4WNNA 5B31C 3X1TD 3MGPD 3A1KA 5GSUB 5BS7C 2CV5C 3X1SC 1P3FD 1KX5D 2L5AA 3KUYC 2BYKB 4H9PA 5B33C 2CV5B 1F66B 3KUYB 5B40C 1P3OC 1KX4C 4WU8C 1TZYD 3AZGC 1P3OB 1KX4B 4WU8B 3MGRD 3AZGB 1B6WA 1M18D 4DRBA 3AZJD 5CPJC 3AZED 5B2JA 4JJND 5KDMB 4Z5TA 4KGCA 4G91C 3AFAD 3W99D 2Y2LA 2ZY5A 4WU9D 4G91B 4E44A 3WAAA 1TAFA 3C1BC 3C1CC 3RELD 5AVCC 3X1UD 3AV2D 3UTAA 1ID3C 3C1BB 3C1CB 5AVCB 1U35A 1ID3B 3VH5W 1M19C 4H9SA 3O62D 1M19B 5B24D 1EQZC 3MGSA 2F8NB 1EQZB 4WV4B 5AV9D 3EG5B 1N1JA 4QLCB 5JA4A 5CPID 1HQ3A 5DNMD 4YM6C 1P3BC 3W96A 1P3BB 3AZFA 3AZHC 2RIQA 1P3KC 3AZHB 4EO5C 1P3KB 1KX3D 4EO5B 4ZBJC 3AZMC 3VH6W 5B1MA 3AYWD 2FJ7C 3AZMB 4J8UC 5E5AB 3MVDC 2FJ7B 1P3MC 2AROD 4J8UB 3V9RB 3H0MC 3MVDB 1BH9B 1P3PD 1P3MB 2Y2JA 4XUJA 4CSRB 5GSUD 3WTPA 2CV5D 1F66D 3KUYD 1P3OD 4NFTA 4J8WA 4WU8D 1KX4D 4HGAC 5B32A 1ZLAA 5FUGA 4X23C 4HGAB 1JFIA 5B31A 4X23B 4UUZB 2J8PA 4KUDA 4WNNB 3VH5T 3X1SA 1A7WA 5B33A 5B40A 5JRGA 4H9PB 1P34A 3B0BA 3FDDA 2Y2OA 3LZ0C 4LD9C 3KWQA 2ZY2A 3C1BD 3C1CD 4ZUXA 5AVCD 5CPJA 4LD9B 2YFWA 1ID3D 3W98A 4M6BA 3LELC 3B6FA 5B2JC 1M19D 3H0LC 4Z5TC 3VH6T 4KGCC 5B2JB 2F8ND 1EQZD 4Z5TB 4KGCB 4QLCD 3WAAC 3WAAB 3UTAC 1TAFB 3UT9A 1P3BD 1M1AA 3UTAB 1U35C 5AV8A 3A6NA 3W97D 1U35B 3AZHD 2VQRA 3MGSC 3AZMD 3MGSB 5E5AD 5CPKA 2FJ7D 3MGQA 4J8UD 3TU4A 1N1JB 1HQ3C 4YM6A 3MVDD 1P3MD 5JA4B 1HQ3B 3W96C 3AZFC 5BNXA 5GXQC
chains in the Genus database with same CATH topology
3W96B 3AZFB 1P3KA 4H9QA 5B1MC 2FJ7A 5B1MB 4X23D 2NQBA 5AY8A 3EPHA 4XUJB 3UTBA 1BH8A 5CP6C 3WTPC 3B0CT 5B1LA 3EPJA 3WTPB 5AV6A 4Z66A 5B32C 1ZLAC 4J8WB 4UUZA 5B32B 4YS3A 5FUGB 1ZLAB 3REIC 1JFIB 4KUDC 5B31B 3AZIA 4KUDB 5B2JD 3X1SB 4H9OA 4Z5TD 3AZNA 5B33B 5JRGC 4KGCD 1P34C 5B40B 5JRGB 4J8VA 3LZ0A 1P34B 4LD9A 3KWQC 3WAAD 3AL0C 4ZUXC 3KWQB 3UTAD 3W98C 4ZUXB 3B0DC 5CPJB 2YFWB 3LELA 5B0YA 1U35D 3W98B 3B0DB 3B6FC 5F99A 3EPLA 3B6FB 5AVBA 3MGSD 3LJAA 5B2IA 4CAYA 1HQ3D 2Y2NA 3UT9C 1M1AC 1P3GA 5AV8C 3UT9B 3AZFD 3A6NC 1M1AB 3W96D 5AV8B 3A6NB 2F8NH 2JSSA 1W2EA 5B1MD 2BYMA 3KXBA 5CPKC 3MGQC 3TU4C 2NZDC 5CPKB 1P3AA 3MGQB 3TU4B 4YM6B 4XUJD 3B6GC 5GXQA 5BNXB 5BO0A 3WTPD 3AZLA 1M18A 1B67A 4Z2MH 2PYOA 2DQNC 4H9QB 4ZBJB 4J8WD 5DNNA 5B32D 1ZLAD 2Y2KA 5B31D 2NQBC 5AY8C 5BT1C 4KUDD 2NQBB 5AY8B 3UTBC 5CP6A 3UTBB 3X1SD 1S32A 1BH8B 5B1LC 5B33D 5AV6C 3AV2A 5B1LB 5B40D 4Z66C 5AV6B 5JRGD 5GT3C 3AZGD 1P34D 4Z66B 4YS3C 1AOIC 3KWQD 3REJA 3REIA 4ZUXD 4YS3B 5CPJD 3AZIC 3W98D 2JE5A 2DF4C 2RVQC 3AZIB 3X1VA 3AZNC 4J8XA 1WWSA 4H9OB 3AZNB 4J8VC 3EPKA 4J8VB 3AN2A 3LZ1A 3LZ0B 1PZRA 3UT9D 1M1AD 2W8SA 5B0YC 1H3OA 5AV8D 3A6ND 3LELB 1P3LC 5B0YB 5F99C 5F99B 5AVBC 3B0CW 1P3PA 5AVBB 3LJAC 5B2IC 5CPKD 3LJAB 3MGQD 5B2IB 4R8PA 3TU4D 4CAYB 4YM6D 3VH5A 1P3GC 4H9NA 2ZY3A 1P3GB 3WTPE 3AV1A 1P3KD 3F6TA 3P5JB 3KXBC 2NZDA 2BYMB 3KXBB 1P3AC 1P3AB 2NQBD 5AY8D 3MNNA 3B6GA 5BT1D 3UTBD 3VH6A 5GXQB 3MGRC 2F8NG 3AZKA 5C3IC 3AZLC 1M18C 5B1LD 5BO0B 3AZLB 5C3IB 5AV6D 1M18B 2PYOC 4Z66D 2PYOB 5AV5A 5BNVA 5DNNC 1P3IA 1WWIA 5DNNB 2ZM5A 4YS3D 3AZID 4Z2MG 2RVQD 1S32C 5CP6B 3X1UC 3AV2C 1S32B 3NQUA 3AZND 2YFVA 3AV2B 5GT3A 4WJ3C 2FFFB 5B0ZA 4J8VD 3LZ0D 3REHA 1AOIA 4LD9D 2Y2GA 3REJC 2Y2PA 2HIOA 3O62C 3REJB 2XD1A 3REIB 3LELD 5B0YD 5F99D 3X1VC 3X1VB 5AVBD 4J8XC 2Y2MA 4J8XB 3LJAD 4H9RA 2HUEC 5B2ID 3AN2C 3LZ1C 2HUEB 3AN2B 3LZ1B 1P3GD 5GT0A 4XZQA 1P3LA 1H3OB 1P3PC 1P3PB 5GSUC 3KXBD 3WA9A 4R8PC 3A1IA 4NE5A 1F66C 1P3AD 4R8PB 3NQJA 3WKJA 5GXQD 3REKA 4H9NB 3AV1C 2F8NK 3IP4C 3AZLD 3AV1B 2PYOD 2IO5C 4WZSB 3MGPA 3X1TA 2IO5B 5DNND 2ZY4A 1P3FA 1KX5A 2NZDB 3R45A 3MNNC 1TZYA 3MNNB 3B6GB 3MGRA 5CP6D 3AZKC 1S32D 4NE6A 3AZJA 3AZKB 1R4VA 5AV5C 1P3IC 3AZEA 5AV5B 5BNVB 1P3IB 4JJNA 3REJD 3REID 3AFAA 3W99A 4WU9A 4QLCC 3RELA 1Z2CB 3X1UA 3X1VD 4AWLC 4J8XD 3NQUB 4AWLB 5B0ZC 2YFVB 5GT3B 3W97C 5B0ZB 3REHC 3AN2D 3LZ1D 4KHAA 3W97B 2HIOC 3REHB 3O62A 1AOIB 5B24A 2HIOB 5AV9A 5E5AC 3B6FD 5CPIA 5DNMA 1KU5A 5B32G 5B31G 4H9RB 4R8PD 2Y2HA 1KX3A 5GT0C 3AYWA 4XZQC 2XD5A 5G49A 5GT0B 4XZQB 3AV1D 2AROA 1P3LB 2CWEA 4DRAA 2G5IC 5GSUA 4NE3A 4DQYB 5BS7A 3WA9C 2BYKA 2CV5A 1F66A 1F1EA 2NZDD 3KUYA 3WA9B 1P3OA 3MNND 2JCHA 4WU8A 1KX4A 2Y2IA 3B6GD 3AZGA 3REKC 3WKJC 3NQJB 3WKJB 3REKB 3AZKD 3X1TC 3MGPC 5AV5D 3X1TB 3MGPB 1P3ID 1P3FC 5KDMA 1KX5C 1P3FB 1KX5B 1TZYC 3R45B 1TZYB 1T3UA 2LY8A 1BFMA 3MGRB 3C1BA 3C1CA 3AZJC 5AVCA 3AZJB 1ID3A 1Q9CA 5GT3D 5B0ZD 3AZEC 3H0RC 3AZEB 3REHD 4JJNC 1M19A 1AOID 2F2AC 1ULYA 2G5HC 2HIOD 4H9SC 4JJNB 1EQZA 2F8NA 3AFAC 3W99C 4WU9C 4QLCA 3AFAB 3W99B 4WU9B 3RELC 3KSYA 3RELB 1P3BA 3X1UB 4E45A 3W97A 3AZHA 5B24C 4KHAB 3O62B 5B24B 5AV9C 3AZMA 5GT0D 5E5AA 2BG1A 2Y2QA 4XZQD 5AV9B 4J8UA 3V9RA 1P3LD 5CPIC 3MVDA 1BH9A 5DNMC 4UPKA 1P3MA 5CPIB 4CSRA 5DNMB 5CHLB 4XUJC 3WA9D 1HTAA 4G92C 1KX3C 4G92B 1KX3B 3AYWC 4J8WC 3WKJD 3KFUG 3REKD 3AYWB 4X23A 2AROC 5G49B 2UWXA 2AROB 4WNNA 5B31C 3X1TD 3MGPD 3A1KA 5GSUB 5BS7C 2CV5C 3X1SC 1P3FD 1KX5D 2L5AA 3KUYC 2BYKB 4H9PA 5B33C 2CV5B 1F66B 3KUYB 5B40C 1P3OC 1KX4C 4WU8C 1TZYD 3AZGC 1P3OB 1KX4B 4WU8B 3MGRD 3AZGB 1B6WA 1M18D 4DRBA 3AZJD 5CPJC 3AZED 5B2JA 4JJND 5KDMB 4Z5TA 4KGCA 4G91C 3AFAD 3W99D 2Y2LA 2ZY5A 4WU9D 4G91B 4E44A 3WAAA 1TAFA 3C1BC 3C1CC 3RELD 5AVCC 3X1UD 3AV2D 3UTAA 1ID3C 3C1BB 3C1CB 5AVCB 1U35A 1ID3B 3VH5W 1M19C 4H9SA 3O62D 1M19B 5B24D 1EQZC 3MGSA 2F8NB 1EQZB 4WV4B 5AV9D 3EG5B 1N1JA 4QLCB 5JA4A 5CPID 1HQ3A 5DNMD 4YM6C 1P3BC 3W96A 1P3BB 3AZFA 3AZHC 2RIQA 1P3KC 3AZHB 4EO5C 1P3KB 1KX3D 4EO5B 4ZBJC 3AZMC 3VH6W 5B1MA 3AYWD 2FJ7C 3AZMB 4J8UC 5E5AB 3MVDC 2FJ7B 1P3MC 2AROD 4J8UB 3V9RB 3H0MC 3MVDB 1BH9B 1P3PD 1P3MB 2Y2JA 4XUJA 4CSRB 5GSUD 3WTPA 2CV5D 1F66D 3KUYD 1P3OD 4NFTA 4J8WA 4WU8D 1KX4D 4HGAC 5B32A 1ZLAA 5FUGA 4X23C 4HGAB 1JFIA 5B31A 4X23B 4UUZB 2J8PA 4KUDA 4WNNB 3VH5T 3X1SA 1A7WA 5B33A 5B40A 5JRGA 4H9PB 1P34A 3B0BA 3FDDA 2Y2OA 3LZ0C 4LD9C 3KWQA 2ZY2A 3C1BD 3C1CD 4ZUXA 5AVCD 5CPJA 4LD9B 2YFWA 1ID3D 3W98A 4M6BA 3LELC 3B6FA 5B2JC 1M19D 3H0LC 4Z5TC 3VH6T 4KGCC 5B2JB 2F8ND 1EQZD 4Z5TB 4KGCB 4QLCD 3WAAC 3WAAB 3UTAC 1TAFB 3UT9A 1P3BD 1M1AA 3UTAB 1U35C 5AV8A 3A6NA 3W97D 1U35B 3AZHD 2VQRA 3MGSC 3AZMD 3MGSB 5E5AD 5CPKA 2FJ7D 3MGQA 4J8UD 3TU4A 1N1JB 1HQ3C 4YM6A 3MVDD 1P3MD 5JA4B 1HQ3B 3W96C 3AZFC 5BNXA 5GXQC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3W96 B;  3AZF B;  1P3K A;  4H9Q A;  5B1M C;  5B1M B;  4X23 D;  2NQB A;  5AY8 A;  4XUJ B;  3UTB A;  1BH8 A;  5CP6 C;  3WTP C;  3B0C T;  5B1L A;  3WTP B;  5AV6 A;  4Z66 A;  5B32 C;  1ZLA C;  4J8W B;  4UUZ A;  5B32 B;  4YS3 A;  5FUG B;  1ZLA B;  3REI C;  1JFI B;  4KUD C;  5B31 B;  3AZI A;  4KUD B;  5B2J D;  3X1S B;  4H9O A;  4Z5T D;  3AZN A;  5B33 B;  5JRG C;  4KGC D;  1P34 C;  5B40 B;  5JRG B;  4J8V A;  3LZ0 A;  1P34 B;  4LD9 A;  3KWQ C;  3WAA D;  4ZUX C;  3KWQ B;  3UTA D;  3W98 C;  4ZUX B;  3B0D C;  5CPJ B;  2YFW B;  3LEL A;  5B0Y A;  1U35 D;  3W98 B;  3B0D B;  3B6F C;  5F99 A;  3B6F B;  5AVB A;  3MGS D;  3LJA A;  5B2I A;  4CAY A;  1HQ3 D;  3UT9 C;  1M1A C;  1P3G A;  5AV8 C;  3UT9 B;  3AZF D;  3A6N C;  1M1A B;  3W96 D;  5AV8 B;  3A6N B;  2F8N H;  2JSS A;  5B1M D;  2BYM A;  3KXB A;  5CPK C;  3MGQ C;  3TU4 C;  2NZD C;  5CPK B;  1P3A A;  3MGQ B;  3TU4 B;  4YM6 B;  4XUJ D;  3B6G C;  5GXQ A;  5BNX B;  5BO0 A;  3WTP D;  3AZL A;  1M18 A;  1B67 A;  4Z2M H;  2PYO A;  4H9Q B;  4ZBJ B;  4J8W D;  5DNN A;  5B32 D;  1ZLA D;  5B31 D;  2NQB C;  5AY8 C;  5BT1 C;  4KUD D;  2NQB B;  5AY8 B;  3UTB C;  5CP6 A;  3UTB B;  3X1S D;  1S32 A;  1BH8 B;  5B1L C;  5B33 D;  5AV6 C;  3AV2 A;  5B1L B;  4Z66 C;  5B40 D;  5JRG D;  5AV6 B;  5GT3 C;  3AZG D;  1P34 D;  4Z66 B;  4YS3 C;  1AOI C;  3KWQ D;  3REJ A;  3REI A;  4ZUX D;  4YS3 B;  5CPJ D;  3AZI C;  3W98 D;  3AZI B;  2RVQ C;  3X1V A;  3AZN C;  4J8X A;  1WWS A;  4H9O B;  3AZN B;  4J8V C;  4J8V B;  3AN2 A;  3LZ1 A;  3LZ0 B;  3UT9 D;  1M1A D;  5B0Y C;  1H3O A;  5AV8 D;  3A6N D;  3LEL B;  1P3L C;  5B0Y B;  5F99 C;  5F99 B;  5AVB C;  3B0C W;  1P3P A;  5AVB B;  3LJA C;  5B2I C;  5CPK D;  3LJA B;  3MGQ D;  5B2I B;  4R8P A;  3TU4 D;  4CAY B;  4YM6 D;  3VH5 A;  1P3G C;  4H9N A;  1P3G B;  3WTP E;  3AV1 A;  1P3K D;  3KXB C;  2NZD A;  2BYM B;  3KXB B;  1P3A C;  1P3A B;  2NQB D;  5AY8 D;  3MNN A;  3B6G A;  5BT1 D;  3UTB D;  3VH6 A;  5GXQ B;  3MGR C;  2F8N G;  3AZK A;  5C3I C;  3AZL C;  1M18 C;  5B1L D;  5BO0 B;  3AZL B;  5C3I B;  5AV6 D;  1M18 B;  2PYO C;  4Z66 D;  2PYO B;  5AV5 A;  5BNV A;  5DNN C;  1P3I A;  1WWI A;  5DNN B;  4YS3 D;  3AZI D;  4Z2M G;  2RVQ D;  1S32 C;  5CP6 B;  3X1U C;  3AV2 C;  1S32 B;  3NQU A;  3AZN D;  2YFV A;  3AV2 B;  5GT3 A;  5B0Z A;  4J8V D;  3LZ0 D;  3REH A;  1AOI A;  4LD9 D;  3REJ C;  2HIO A;  3O62 C;  3REJ B;  3REI B;  3LEL D;  5B0Y D;  5F99 D;  3X1V C;  3X1V B;  5AVB D;  4J8X C;  4J8X B;  3LJA D;  4H9R A;  2HUE C;  5B2I D;  3AN2 C;  3LZ1 C;  2HUE B;  3AN2 B;  3LZ1 B;  1P3G D;  5GT0 A;  4XZQ A;  1P3L A;  1H3O B;  1P3P C;  1P3P B;  5GSU C;  3KXB D;  3WA9 A;  4R8P C;  4NE5 A;  1F66 C;  1P3A D;  4R8P B;  3NQJ A;  3WKJ A;  5GXQ D;  3REK A;  4H9N B;  3AV1 C;  2F8N K;  3AZL D;  3AV1 B;  2PYO D;  2IO5 C;  4WZS B;  3MGP A;  3X1T A;  2IO5 B;  5DNN D;  1P3F A;  1KX5 A;  2NZD B;  3R45 A;  3MNN C;  1TZY A;  3MNN B;  3B6G B;  3MGR A;  5CP6 D;  3AZK C;  1S32 D;  4NE6 A;  3AZJ A;  3AZK B;  1R4V A;  5AV5 C;  1P3I C;  3AZE A;  5AV5 B;  5BNV B;  1P3I B;  4JJN A;  3REJ D;  3REI D;  3AFA A;  3W99 A;  4WU9 A;  4QLC C;  3REL A;  3X1V D;  3X1U A;  4AWL C;  4J8X D;  3NQU B;  4AWL B;  5B0Z C;  2YFV B;  5GT3 B;  3W97 C;  5B0Z B;  3REH C;  3AN2 D;  3LZ1 D;  4KHA A;  3W97 B;  2HIO C;  3REH B;  3O62 A;  1AOI B;  5B24 A;  2HIO B;  5AV9 A;  5E5A C;  3B6F D;  5CPI A;  5DNM A;  1KU5 A;  5B32 G;  5B31 G;  4H9R B;  4R8P D;  1KX3 A;  5GT0 C;  3AYW A;  4XZQ C;  5G49 A;  5GT0 B;  4XZQ B;  3AV1 D;  2ARO A;  1P3L B;  2CWE A;  4DRA A;  5GSU A;  4NE3 A;  5BS7 A;  3WA9 C;  2BYK A;  2CV5 A;  1F66 A;  1F1E A;  2NZD D;  3KUY A;  3WA9 B;  1P3O A;  3MNN D;  1KX4 A;  4WU8 A;  3B6G D;  3WKJ C;  3AZG A;  3REK C;  3NQJ B;  3WKJ B;  3REK B;  3AZK D;  3X1T C;  3MGP C;  5AV5 D;  3X1T B;  3MGP B;  1P3I D;  1P3F C;  5KDM A;  1KX5 C;  1P3F B;  1KX5 B;  1TZY C;  3R45 B;  1TZY B;  2LY8 A;  1BFM A;  3MGR B;  3C1B A;  3C1C A;  3AZJ C;  5AVC A;  3AZJ B;  1ID3 A;  1Q9C A;  5GT3 D;  5B0Z D;  3AZE C;  3AZE B;  3REH D;  4JJN C;  1M19 A;  1AOI D;  1ULY A;  2HIO D;  4H9S C;  4JJN B;  1EQZ A;  2F8N A;  3AFA C;  3W99 C;  4WU9 C;  4QLC A;  3AFA B;  3W99 B;  4WU9 B;  3REL C;  3KSY A;  3REL B;  1P3B A;  3X1U B;  4E45 A;  3W97 A;  3AZH A;  5B24 C;  4KHA B;  3O62 B;  5B24 B;  5AV9 C;  3AZM A;  5GT0 D;  5E5A A;  4XZQ D;  2FJ7 A;  5AV9 B;  4J8U A;  3V9R A;  1P3L D;  5CPI C;  3MVD A;  1BH9 A;  5DNM C;  1P3M A;  5CPI B;  4CSR A;  5DNM B;  5CHL B;  4XUJ C;  3WA9 D;  1HTA A;  4G92 C;  1KX3 C;  4G92 B;  1KX3 B;  3AYW C;  4J8W C;  3WKJ D;  3REK D;  3AYW B;  4X23 A;  2ARO C;  5G49 B;  5B31 C;  2ARO B;  4WNN A;  3X1T D;  3MGP D;  5GSU B;  5BS7 C;  2CV5 C;  3X1S C;  1P3F D;  1KX5 D;  2L5A A;  3KUY C;  2BYK B;  4H9P A;  5B33 C;  2CV5 B;  1F66 B;  3KUY B;  5B40 C;  1P3O C;  1KX4 C;  4WU8 C;  1TZY D;  3AZG C;  1P3O B;  1KX4 B;  4WU8 B;  3MGR D;  3AZG B;  1B6W A;  1M18 D;  4DRB A;  3AZJ D;  5CPJ C;  3AZE D;  5B2J A;  4JJN D;  5KDM B;  4Z5T A;  4KGC A;  4G91 C;  3AFA D;  3W99 D;  4WU9 D;  4G91 B;  4E44 A;  3WAA A;  1TAF A;  3C1B C;  3C1C C;  3REL D;  5AVC C;  3X1U D;  3AV2 D;  3UTA A;  1ID3 C;  3C1B B;  3C1C B;  5AVC B;  1U35 A;  1ID3 B;  3VH5 W;  1M19 C;  4H9S A;  3O62 D;  1M19 B;  5B24 D;  1EQZ C;  3MGS A;  2F8N B;  1EQZ B;  4WV4 B;  5AV9 D;  1N1J A;  4QLC B;  5JA4 A;  5CPI D;  1HQ3 A;  5DNM D;  4YM6 C;  1P3B C;  3W96 A;  1P3B B;  3AZF A;  3AZH C;  1P3K C;  3AZH B;  4EO5 C;  1P3K B;  1KX3 D;  4EO5 B;  4ZBJ C;  3AZM C;  3VH6 W;  5B1M A;  3AYW D;  2FJ7 C;  3AZM B;  4J8U C;  5E5A B;  3MVD C;  2FJ7 B;  1P3M C;  2ARO D;  4J8U B;  3V9R B;  3MVD B;  1BH9 B;  1P3P D;  1P3M B;  4XUJ A;  4CSR B;  5GSU D;  3WTP A;  2CV5 D;  1F66 D;  3KUY D;  1P3O D;  4NFT A;  4J8W A;  4WU8 D;  1KX4 D;  4HGA C;  5B32 A;  1ZLA A;  5FUG A;  4X23 C;  4HGA B;  1JFI A;  5B31 A;  4X23 B;  4UUZ B;  4KUD A;  4WNN B;  3VH5 T;  3X1S A;  1A7W A;  5B33 A;  5B40 A;  5JRG A;  4H9P B;  1P34 A;  3B0B A;  3LZ0 C;  4LD9 C;  3KWQ A;  3C1B D;  3C1C D;  4ZUX A;  5AVC D;  5CPJ A;  4LD9 B;  2YFW A;  1ID3 D;  3W98 A;  4M6B A;  3LEL C;  3B6F A;  5B2J C;  1M19 D;  4Z5T C;  3VH6 T;  4KGC C;  5B2J B;  2F8N D;  1EQZ D;  4Z5T B;  4KGC B;  4QLC D;  3WAA C;  3WAA B;  3UTA C;  1TAF B;  3UT9 A;  1P3B D;  1M1A A;  3UTA B;  1U35 C;  5AV8 A;  3A6N A;  3W97 D;  1U35 B;  3AZH D;  3MGS C;  3AZM D;  3MGS B;  5E5A D;  5CPK A;  2FJ7 D;  3MGQ A;  4J8U D;  3TU4 A;  1N1J B;  1HQ3 C;  4YM6 A;  3MVD D;  1P3M D;  5JA4 B;  1HQ3 B;  3W96 C;  3AZF C;  5BNX A;  5GXQ C; 
#chains in the Genus database with same CATH topology
 3W96 B;  3AZF B;  1P3K A;  4H9Q A;  5B1M C;  2FJ7 A;  5B1M B;  4X23 D;  2NQB A;  5AY8 A;  3EPH A;  4XUJ B;  3UTB A;  1BH8 A;  5CP6 C;  3WTP C;  3B0C T;  5B1L A;  3EPJ A;  3WTP B;  5AV6 A;  4Z66 A;  5B32 C;  1ZLA C;  4J8W B;  4UUZ A;  5B32 B;  4YS3 A;  5FUG B;  1ZLA B;  3REI C;  1JFI B;  4KUD C;  5B31 B;  3AZI A;  4KUD B;  5B2J D;  3X1S B;  4H9O A;  4Z5T D;  3AZN A;  5B33 B;  5JRG C;  4KGC D;  1P34 C;  5B40 B;  5JRG B;  4J8V A;  3LZ0 A;  1P34 B;  4LD9 A;  3KWQ C;  3WAA D;  3AL0 C;  4ZUX C;  3KWQ B;  3UTA D;  3W98 C;  4ZUX B;  3B0D C;  5CPJ B;  2YFW B;  3LEL A;  5B0Y A;  1U35 D;  3W98 B;  3B0D B;  3B6F C;  5F99 A;  3EPL A;  3B6F B;  5AVB A;  3MGS D;  3LJA A;  5B2I A;  4CAY A;  1HQ3 D;  2Y2N A;  3UT9 C;  1M1A C;  1P3G A;  5AV8 C;  3UT9 B;  3AZF D;  3A6N C;  1M1A B;  3W96 D;  5AV8 B;  3A6N B;  2F8N H;  2JSS A;  1W2E A;  5B1M D;  2BYM A;  3KXB A;  5CPK C;  3MGQ C;  3TU4 C;  2NZD C;  5CPK B;  1P3A A;  3MGQ B;  3TU4 B;  4YM6 B;  4XUJ D;  3B6G C;  5GXQ A;  5BNX B;  5BO0 A;  3WTP D;  3AZL A;  1M18 A;  1B67 A;  4Z2M H;  2PYO A;  2DQN C;  4H9Q B;  4ZBJ B;  4J8W D;  5DNN A;  5B32 D;  1ZLA D;  2Y2K A;  5B31 D;  2NQB C;  5AY8 C;  5BT1 C;  4KUD D;  2NQB B;  5AY8 B;  3UTB C;  5CP6 A;  3UTB B;  3X1S D;  1S32 A;  1BH8 B;  5B1L C;  5B33 D;  5AV6 C;  3AV2 A;  5B1L B;  5B40 D;  4Z66 C;  5AV6 B;  5JRG D;  5GT3 C;  3AZG D;  1P34 D;  4Z66 B;  4YS3 C;  1AOI C;  3KWQ D;  3REJ A;  3REI A;  4ZUX D;  4YS3 B;  5CPJ D;  3AZI C;  3W98 D;  2JE5 A;  2DF4 C;  2RVQ C;  3AZI B;  3X1V A;  3AZN C;  4J8X A;  1WWS A;  4H9O B;  3AZN B;  4J8V C;  3EPK A;  4J8V B;  3AN2 A;  3LZ1 A;  3LZ0 B;  1PZR A;  3UT9 D;  1M1A D;  2W8S A;  5B0Y C;  1H3O A;  5AV8 D;  3A6N D;  3LEL B;  1P3L C;  5B0Y B;  5F99 C;  5F99 B;  5AVB C;  3B0C W;  1P3P A;  5AVB B;  3LJA C;  5B2I C;  5CPK D;  3LJA B;  3MGQ D;  5B2I B;  4R8P A;  3TU4 D;  4CAY B;  4YM6 D;  3VH5 A;  1P3G C;  4H9N A;  2ZY3 A;  1P3G B;  3WTP E;  3AV1 A;  1P3K D;  3F6T A;  3P5J B;  3KXB C;  2NZD A;  2BYM B;  3KXB B;  1P3A C;  1P3A B;  2NQB D;  5AY8 D;  3MNN A;  3B6G A;  5BT1 D;  3UTB D;  3VH6 A;  5GXQ B;  3MGR C;  2F8N G;  3AZK A;  5C3I C;  3AZL C;  1M18 C;  5B1L D;  5BO0 B;  3AZL B;  5C3I B;  5AV6 D;  1M18 B;  2PYO C;  4Z66 D;  2PYO B;  5AV5 A;  5BNV A;  5DNN C;  1P3I A;  1WWI A;  5DNN B;  2ZM5 A;  4YS3 D;  3AZI D;  4Z2M G;  2RVQ D;  1S32 C;  5CP6 B;  3X1U C;  3AV2 C;  1S32 B;  3NQU A;  3AZN D;  2YFV A;  3AV2 B;  5GT3 A;  4WJ3 C;  2FFF B;  5B0Z A;  4J8V D;  3LZ0 D;  3REH A;  1AOI A;  4LD9 D;  2Y2G A;  3REJ C;  2Y2P A;  2HIO A;  3O62 C;  3REJ B;  2XD1 A;  3REI B;  3LEL D;  5B0Y D;  5F99 D;  3X1V C;  3X1V B;  5AVB D;  4J8X C;  2Y2M A;  4J8X B;  3LJA D;  4H9R A;  2HUE C;  5B2I D;  3AN2 C;  3LZ1 C;  2HUE B;  3AN2 B;  3LZ1 B;  1P3G D;  5GT0 A;  4XZQ A;  1P3L A;  1H3O B;  1P3P C;  1P3P B;  5GSU C;  3KXB D;  3WA9 A;  4R8P C;  3A1I A;  4NE5 A;  1F66 C;  1P3A D;  4R8P B;  3NQJ A;  3WKJ A;  5GXQ D;  3REK A;  4H9N B;  3AV1 C;  2F8N K;  3IP4 C;  3AZL D;  3AV1 B;  2PYO D;  2IO5 C;  4WZS B;  3MGP A;  3X1T A;  2IO5 B;  5DNN D;  2ZY4 A;  1P3F A;  1KX5 A;  2NZD B;  3R45 A;  3MNN C;  1TZY A;  3MNN B;  3B6G B;  3MGR A;  5CP6 D;  3AZK C;  1S32 D;  4NE6 A;  3AZJ A;  3AZK B;  1R4V A;  5AV5 C;  1P3I C;  3AZE A;  5AV5 B;  5BNV B;  1P3I B;  4JJN A;  3REJ D;  3REI D;  3AFA A;  3W99 A;  4WU9 A;  4QLC C;  3REL A;  1Z2C B;  3X1U A;  3X1V D;  4AWL C;  4J8X D;  3NQU B;  4AWL B;  5B0Z C;  2YFV B;  5GT3 B;  3W97 C;  5B0Z B;  3REH C;  3AN2 D;  3LZ1 D;  4KHA A;  3W97 B;  2HIO C;  3REH B;  3O62 A;  1AOI B;  5B24 A;  2HIO B;  5AV9 A;  5E5A C;  3B6F D;  5CPI A;  5DNM A;  1KU5 A;  5B32 G;  5B31 G;  4H9R B;  4R8P D;  2Y2H A;  1KX3 A;  5GT0 C;  3AYW A;  4XZQ C;  2XD5 A;  5G49 A;  5GT0 B;  4XZQ B;  3AV1 D;  2ARO A;  1P3L B;  2CWE A;  4DRA A;  2G5I C;  5GSU A;  4NE3 A;  4DQY B;  5BS7 A;  3WA9 C;  2BYK A;  2CV5 A;  1F66 A;  1F1E A;  2NZD D;  3KUY A;  3WA9 B;  1P3O A;  3MNN D;  2JCH A;  4WU8 A;  1KX4 A;  2Y2I A;  3B6G D;  3AZG A;  3REK C;  3WKJ C;  3NQJ B;  3WKJ B;  3REK B;  3AZK D;  3X1T C;  3MGP C;  5AV5 D;  3X1T B;  3MGP B;  1P3I D;  1P3F C;  5KDM A;  1KX5 C;  1P3F B;  1KX5 B;  1TZY C;  3R45 B;  1TZY B;  1T3U A;  2LY8 A;  1BFM A;  3MGR B;  3C1B A;  3C1C A;  3AZJ C;  5AVC A;  3AZJ B;  1ID3 A;  1Q9C A;  5GT3 D;  5B0Z D;  3AZE C;  3H0R C;  3AZE B;  3REH D;  4JJN C;  1M19 A;  1AOI D;  2F2A C;  1ULY A;  2G5H C;  2HIO D;  4H9S C;  4JJN B;  1EQZ A;  2F8N A;  3AFA C;  3W99 C;  4WU9 C;  4QLC A;  3AFA B;  3W99 B;  4WU9 B;  3REL C;  3KSY A;  3REL B;  1P3B A;  3X1U B;  4E45 A;  3W97 A;  3AZH A;  5B24 C;  4KHA B;  3O62 B;  5B24 B;  5AV9 C;  3AZM A;  5GT0 D;  5E5A A;  2BG1 A;  2Y2Q A;  4XZQ D;  5AV9 B;  4J8U A;  3V9R A;  1P3L D;  5CPI C;  3MVD A;  1BH9 A;  5DNM C;  4UPK A;  1P3M A;  5CPI B;  4CSR A;  5DNM B;  5CHL B;  4XUJ C;  3WA9 D;  1HTA A;  4G92 C;  1KX3 C;  4G92 B;  1KX3 B;  3AYW C;  4J8W C;  3WKJ D;  3KFU G;  3REK D;  3AYW B;  4X23 A;  2ARO C;  5G49 B;  2UWX A;  2ARO B;  4WNN A;  5B31 C;  3X1T D;  3MGP D;  3A1K A;  5GSU B;  5BS7 C;  2CV5 C;  3X1S C;  1P3F D;  1KX5 D;  2L5A A;  3KUY C;  2BYK B;  4H9P A;  5B33 C;  2CV5 B;  1F66 B;  3KUY B;  5B40 C;  1P3O C;  1KX4 C;  4WU8 C;  1TZY D;  3AZG C;  1P3O B;  1KX4 B;  4WU8 B;  3MGR D;  3AZG B;  1B6W A;  1M18 D;  4DRB A;  3AZJ D;  5CPJ C;  3AZE D;  5B2J A;  4JJN D;  5KDM B;  4Z5T A;  4KGC A;  4G91 C;  3AFA D;  3W99 D;  2Y2L A;  2ZY5 A;  4WU9 D;  4G91 B;  4E44 A;  3WAA A;  1TAF A;  3C1B C;  3C1C C;  3REL D;  5AVC C;  3X1U D;  3AV2 D;  3UTA A;  1ID3 C;  3C1B B;  3C1C B;  5AVC B;  1U35 A;  1ID3 B;  3VH5 W;  1M19 C;  4H9S A;  3O62 D;  1M19 B;  5B24 D;  1EQZ C;  3MGS A;  2F8N B;  1EQZ B;  4WV4 B;  5AV9 D;  3EG5 B;  1N1J A;  4QLC B;  5JA4 A;  5CPI D;  1HQ3 A;  5DNM D;  4YM6 C;  1P3B C;  3W96 A;  1P3B B;  3AZF A;  3AZH C;  2RIQ A;  1P3K C;  3AZH B;  4EO5 C;  1P3K B;  1KX3 D;  4EO5 B;  4ZBJ C;  3AZM C;  3VH6 W;  5B1M A;  3AYW D;  2FJ7 C;  3AZM B;  4J8U C;  5E5A B;  3MVD C;  2FJ7 B;  1P3M C;  2ARO D;  4J8U B;  3V9R B;  3H0M C;  3MVD B;  1BH9 B;  1P3P D;  1P3M B;  2Y2J A;  4XUJ A;  4CSR B;  5GSU D;  3WTP A;  2CV5 D;  1F66 D;  3KUY D;  1P3O D;  4NFT A;  4J8W A;  4WU8 D;  1KX4 D;  4HGA C;  5B32 A;  1ZLA A;  5FUG A;  4X23 C;  4HGA B;  1JFI A;  5B31 A;  4X23 B;  4UUZ B;  2J8P A;  4KUD A;  4WNN B;  3VH5 T;  3X1S A;  1A7W A;  5B33 A;  5B40 A;  5JRG A;  4H9P B;  1P34 A;  3B0B A;  3FDD A;  2Y2O A;  3LZ0 C;  4LD9 C;  3KWQ A;  2ZY2 A;  3C1B D;  3C1C D;  4ZUX A;  5AVC D;  5CPJ A;  4LD9 B;  2YFW A;  1ID3 D;  3W98 A;  4M6B A;  3LEL C;  3B6F A;  5B2J C;  1M19 D;  3H0L C;  4Z5T C;  3VH6 T;  4KGC C;  5B2J B;  2F8N D;  1EQZ D;  4Z5T B;  4KGC B;  4QLC D;  3WAA C;  3WAA B;  3UTA C;  1TAF B;  3UT9 A;  1P3B D;  1M1A A;  3UTA B;  1U35 C;  5AV8 A;  3A6N A;  3W97 D;  1U35 B;  3AZH D;  2VQR A;  3MGS C;  3AZM D;  3MGS B;  5E5A D;  5CPK A;  2FJ7 D;  3MGQ A;  4J8U D;  3TU4 A;  1N1J B;  1HQ3 C;  4YM6 A;  3MVD D;  1P3M D;  5JA4 B;  1HQ3 B;  3W96 C;  3AZF C;  5BNX A;  5GXQ C; 
#chains in the Genus database with same CATH homology
 3W96 B;  3AZF B;  1P3K A;  4H9Q A;  5B1M C;  2FJ7 A;  5B1M B;  4X23 D;  2NQB A;  5AY8 A;  3EPH A;  4XUJ B;  3UTB A;  1BH8 A;  5CP6 C;  3WTP C;  3B0C T;  5B1L A;  3EPJ A;  3WTP B;  5AV6 A;  4Z66 A;  5B32 C;  1ZLA C;  4J8W B;  4UUZ A;  5B32 B;  4YS3 A;  5FUG B;  1ZLA B;  3REI C;  1JFI B;  4KUD C;  5B31 B;  3AZI A;  4KUD B;  5B2J D;  3X1S B;  4H9O A;  4Z5T D;  3AZN A;  5B33 B;  5JRG C;  4KGC D;  1P34 C;  5B40 B;  5JRG B;  4J8V A;  3LZ0 A;  1P34 B;  4LD9 A;  3KWQ C;  3WAA D;  3AL0 C;  4ZUX C;  3KWQ B;  3UTA D;  3W98 C;  4ZUX B;  3B0D C;  5CPJ B;  2YFW B;  3LEL A;  5B0Y A;  1U35 D;  3W98 B;  3B0D B;  3B6F C;  5F99 A;  3EPL A;  3B6F B;  5AVB A;  3MGS D;  3LJA A;  5B2I A;  4CAY A;  1HQ3 D;  2Y2N A;  3UT9 C;  1M1A C;  1P3G A;  5AV8 C;  3UT9 B;  3AZF D;  3A6N C;  1M1A B;  3W96 D;  5AV8 B;  3A6N B;  2F8N H;  2JSS A;  1W2E A;  5B1M D;  2BYM A;  3KXB A;  5CPK C;  3MGQ C;  3TU4 C;  2NZD C;  5CPK B;  1P3A A;  3MGQ B;  3TU4 B;  4YM6 B;  4XUJ D;  3B6G C;  5GXQ A;  5BNX B;  5BO0 A;  3WTP D;  3AZL A;  1M18 A;  1B67 A;  4Z2M H;  2PYO A;  2DQN C;  4H9Q B;  4ZBJ B;  4J8W D;  5DNN A;  5B32 D;  1ZLA D;  2Y2K A;  5B31 D;  2NQB C;  5AY8 C;  5BT1 C;  4KUD D;  2NQB B;  5AY8 B;  3UTB C;  5CP6 A;  3UTB B;  3X1S D;  1S32 A;  1BH8 B;  5B1L C;  5B33 D;  5AV6 C;  3AV2 A;  5B1L B;  5B40 D;  4Z66 C;  5AV6 B;  5JRG D;  5GT3 C;  3AZG D;  1P34 D;  4Z66 B;  4YS3 C;  1AOI C;  3KWQ D;  3REJ A;  3REI A;  4ZUX D;  4YS3 B;  5CPJ D;  3AZI C;  3W98 D;  2JE5 A;  2DF4 C;  2RVQ C;  3AZI B;  3X1V A;  3AZN C;  4J8X A;  1WWS A;  4H9O B;  3AZN B;  4J8V C;  3EPK A;  4J8V B;  3AN2 A;  3LZ1 A;  3LZ0 B;  1PZR A;  3UT9 D;  1M1A D;  2W8S A;  5B0Y C;  1H3O A;  5AV8 D;  3A6N D;  3LEL B;  1P3L C;  5B0Y B;  5F99 C;  5F99 B;  5AVB C;  3B0C W;  1P3P A;  5AVB B;  3LJA C;  5B2I C;  5CPK D;  3LJA B;  3MGQ D;  5B2I B;  4R8P A;  3TU4 D;  4CAY B;  4YM6 D;  3VH5 A;  1P3G C;  4H9N A;  2ZY3 A;  1P3G B;  3WTP E;  3AV1 A;  1P3K D;  3F6T A;  3P5J B;  3KXB C;  2NZD A;  2BYM B;  3KXB B;  1P3A C;  1P3A B;  2NQB D;  5AY8 D;  3MNN A;  3B6G A;  5BT1 D;  3UTB D;  3VH6 A;  5GXQ B;  3MGR C;  2F8N G;  3AZK A;  5C3I C;  3AZL C;  1M18 C;  5B1L D;  5BO0 B;  3AZL B;  5C3I B;  5AV6 D;  1M18 B;  2PYO C;  4Z66 D;  2PYO B;  5AV5 A;  5BNV A;  5DNN C;  1P3I A;  1WWI A;  5DNN B;  2ZM5 A;  4YS3 D;  3AZI D;  4Z2M G;  2RVQ D;  1S32 C;  5CP6 B;  3X1U C;  3AV2 C;  1S32 B;  3NQU A;  3AZN D;  2YFV A;  3AV2 B;  5GT3 A;  4WJ3 C;  2FFF B;  5B0Z A;  4J8V D;  3LZ0 D;  3REH A;  1AOI A;  4LD9 D;  2Y2G A;  3REJ C;  2Y2P A;  2HIO A;  3O62 C;  3REJ B;  2XD1 A;  3REI B;  3LEL D;  5B0Y D;  5F99 D;  3X1V C;  3X1V B;  5AVB D;  4J8X C;  2Y2M A;  4J8X B;  3LJA D;  4H9R A;  2HUE C;  5B2I D;  3AN2 C;  3LZ1 C;  2HUE B;  3AN2 B;  3LZ1 B;  1P3G D;  5GT0 A;  4XZQ A;  1P3L A;  1H3O B;  1P3P C;  1P3P B;  5GSU C;  3KXB D;  3WA9 A;  4R8P C;  3A1I A;  4NE5 A;  1F66 C;  1P3A D;  4R8P B;  3NQJ A;  3WKJ A;  5GXQ D;  3REK A;  4H9N B;  3AV1 C;  2F8N K;  3IP4 C;  3AZL D;  3AV1 B;  2PYO D;  2IO5 C;  4WZS B;  3MGP A;  3X1T A;  2IO5 B;  5DNN D;  2ZY4 A;  1P3F A;  1KX5 A;  2NZD B;  3R45 A;  3MNN C;  1TZY A;  3MNN B;  3B6G B;  3MGR A;  5CP6 D;  3AZK C;  1S32 D;  4NE6 A;  3AZJ A;  3AZK B;  1R4V A;  5AV5 C;  1P3I C;  3AZE A;  5AV5 B;  5BNV B;  1P3I B;  4JJN A;  3REJ D;  3REI D;  3AFA A;  3W99 A;  4WU9 A;  4QLC C;  3REL A;  1Z2C B;  3X1U A;  3X1V D;  4AWL C;  4J8X D;  3NQU B;  4AWL B;  5B0Z C;  2YFV B;  5GT3 B;  3W97 C;  5B0Z B;  3REH C;  3AN2 D;  3LZ1 D;  4KHA A;  3W97 B;  2HIO C;  3REH B;  3O62 A;  1AOI B;  5B24 A;  2HIO B;  5AV9 A;  5E5A C;  3B6F D;  5CPI A;  5DNM A;  1KU5 A;  5B32 G;  5B31 G;  4H9R B;  4R8P D;  2Y2H A;  1KX3 A;  5GT0 C;  3AYW A;  4XZQ C;  2XD5 A;  5G49 A;  5GT0 B;  4XZQ B;  3AV1 D;  2ARO A;  1P3L B;  2CWE A;  4DRA A;  2G5I C;  5GSU A;  4NE3 A;  4DQY B;  5BS7 A;  3WA9 C;  2BYK A;  2CV5 A;  1F66 A;  1F1E A;  2NZD D;  3KUY A;  3WA9 B;  1P3O A;  3MNN D;  2JCH A;  4WU8 A;  1KX4 A;  2Y2I A;  3B6G D;  3AZG A;  3REK C;  3WKJ C;  3NQJ B;  3WKJ B;  3REK B;  3AZK D;  3X1T C;  3MGP C;  5AV5 D;  3X1T B;  3MGP B;  1P3I D;  1P3F C;  5KDM A;  1KX5 C;  1P3F B;  1KX5 B;  1TZY C;  3R45 B;  1TZY B;  1T3U A;  2LY8 A;  1BFM A;  3MGR B;  3C1B A;  3C1C A;  3AZJ C;  5AVC A;  3AZJ B;  1ID3 A;  1Q9C A;  5GT3 D;  5B0Z D;  3AZE C;  3H0R C;  3AZE B;  3REH D;  4JJN C;  1M19 A;  1AOI D;  2F2A C;  1ULY A;  2G5H C;  2HIO D;  4H9S C;  4JJN B;  1EQZ A;  2F8N A;  3AFA C;  3W99 C;  4WU9 C;  4QLC A;  3AFA B;  3W99 B;  4WU9 B;  3REL C;  3KSY A;  3REL B;  1P3B A;  3X1U B;  4E45 A;  3W97 A;  3AZH A;  5B24 C;  4KHA B;  3O62 B;  5B24 B;  5AV9 C;  3AZM A;  5GT0 D;  5E5A A;  2BG1 A;  2Y2Q A;  4XZQ D;  5AV9 B;  4J8U A;  3V9R A;  1P3L D;  5CPI C;  3MVD A;  1BH9 A;  5DNM C;  4UPK A;  1P3M A;  5CPI B;  4CSR A;  5DNM B;  5CHL B;  4XUJ C;  3WA9 D;  1HTA A;  4G92 C;  1KX3 C;  4G92 B;  1KX3 B;  3AYW C;  4J8W C;  3WKJ D;  3KFU G;  3REK D;  3AYW B;  4X23 A;  2ARO C;  5G49 B;  2UWX A;  2ARO B;  4WNN A;  5B31 C;  3X1T D;  3MGP D;  3A1K A;  5GSU B;  5BS7 C;  2CV5 C;  3X1S C;  1P3F D;  1KX5 D;  2L5A A;  3KUY C;  2BYK B;  4H9P A;  5B33 C;  2CV5 B;  1F66 B;  3KUY B;  5B40 C;  1P3O C;  1KX4 C;  4WU8 C;  1TZY D;  3AZG C;  1P3O B;  1KX4 B;  4WU8 B;  3MGR D;  3AZG B;  1B6W A;  1M18 D;  4DRB A;  3AZJ D;  5CPJ C;  3AZE D;  5B2J A;  4JJN D;  5KDM B;  4Z5T A;  4KGC A;  4G91 C;  3AFA D;  3W99 D;  2Y2L A;  2ZY5 A;  4WU9 D;  4G91 B;  4E44 A;  3WAA A;  1TAF A;  3C1B C;  3C1C C;  3REL D;  5AVC C;  3X1U D;  3AV2 D;  3UTA A;  1ID3 C;  3C1B B;  3C1C B;  5AVC B;  1U35 A;  1ID3 B;  3VH5 W;  1M19 C;  4H9S A;  3O62 D;  1M19 B;  5B24 D;  1EQZ C;  3MGS A;  2F8N B;  1EQZ B;  4WV4 B;  5AV9 D;  3EG5 B;  1N1J A;  4QLC B;  5JA4 A;  5CPI D;  1HQ3 A;  5DNM D;  4YM6 C;  1P3B C;  3W96 A;  1P3B B;  3AZF A;  3AZH C;  2RIQ A;  1P3K C;  3AZH B;  4EO5 C;  1P3K B;  1KX3 D;  4EO5 B;  4ZBJ C;  3AZM C;  3VH6 W;  5B1M A;  3AYW D;  2FJ7 C;  3AZM B;  4J8U C;  5E5A B;  3MVD C;  2FJ7 B;  1P3M C;  2ARO D;  4J8U B;  3V9R B;  3H0M C;  3MVD B;  1BH9 B;  1P3P D;  1P3M B;  2Y2J A;  4XUJ A;  4CSR B;  5GSU D;  3WTP A;  2CV5 D;  1F66 D;  3KUY D;  1P3O D;  4NFT A;  4J8W A;  4WU8 D;  1KX4 D;  4HGA C;  5B32 A;  1ZLA A;  5FUG A;  4X23 C;  4HGA B;  1JFI A;  5B31 A;  4X23 B;  4UUZ B;  2J8P A;  4KUD A;  4WNN B;  3VH5 T;  3X1S A;  1A7W A;  5B33 A;  5B40 A;  5JRG A;  4H9P B;  1P34 A;  3B0B A;  3FDD A;  2Y2O A;  3LZ0 C;  4LD9 C;  3KWQ A;  2ZY2 A;  3C1B D;  3C1C D;  4ZUX A;  5AVC D;  5CPJ A;  4LD9 B;  2YFW A;  1ID3 D;  3W98 A;  4M6B A;  3LEL C;  3B6F A;  5B2J C;  1M19 D;  3H0L C;  4Z5T C;  3VH6 T;  4KGC C;  5B2J B;  2F8N D;  1EQZ D;  4Z5T B;  4KGC B;  4QLC D;  3WAA C;  3WAA B;  3UTA C;  1TAF B;  3UT9 A;  1P3B D;  1M1A A;  3UTA B;  1U35 C;  5AV8 A;  3A6N A;  3W97 D;  1U35 B;  3AZH D;  2VQR A;  3MGS C;  3AZM D;  3MGS B;  5E5A D;  5CPK A;  2FJ7 D;  3MGQ A;  4J8U D;  3TU4 A;  1N1J B;  1HQ3 C;  4YM6 A;  3MVD D;  1P3M D;  5JA4 B;  1HQ3 B;  3W96 C;  3AZF C;  5BNX A;  5GXQ C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...