5B0YC

Crystal structure of the nucleosome containing histone h3 with the crotonylated lysine 122
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
105
structure length
105
Chain Sequence
AKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords Histone H3.2
publication title Crystal structure of the nucleosome containing histone H3 with crotonylated lysine 122
pubmed doi rcsb
source organism Homo sapiens
total genus 32
structure length 105
sequence length 105
chains with identical sequence G
ec nomenclature
pdb deposition date 2015-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5b0yC00
3AZJD 5GSUC 3AZGC 3X1VD 1HQ3A 3REIC 4Z5TC 3MVDC 3LJAA 3MGRD 2AROD 1KX5B 3WKJA 5GXQD 5B32G 3AN2B 4R8PB 1ID3C 1AOIA 5B24D 3WTPD 3VH6T 3MGPC 3AZLB 1F66A 5BS7C 4KUDB 4LD9B 4J8WB 1U35B 1TZYB 2BYKB 4H9OB 3RELA 3UTBC 3AV1C 3MGPB 5FUGA 1KX4B 1F1EA 3KUYB 5GSUD 5AY8B 3AZGD 3LZ1C 2YFVB 4Z5TD 3MVDD 3REID 1M18B 3MGRA 3B6GC 2AROA 4KHAB 5GXQA 3AZIC 1KX3C 1WWSA 3W99C 3O62C 4JJNC 3C1CB 5B24A 1ID3D 3WA9B 3WTPA 1P3LC 2F8NK 1S32C 4H9SA 3C1BC 3B6FC 3W98B 3AZKB 3AV1D 1TAFA 4NE3A 3UTBD 4J8XD 5B0ZC 5AV5B 5BNXB 5GSUA 3AZGA 5BNVA 5CPJC 4NFTA 4QLCB 4ZUXC 3REIA 3MVDA 5AV9C 1M1AC 3LZ1D 3B6GD 3AZID 1ID3A 3W99D 3O62D 2FJ7B 1B67A 2BYMB 5AVBB 5CP6B 1S32D 1M19C 5BS7A 4CSRA 3C1BD 3B6FD 1H3OB 4G91B 3AV1A 1P3AD 3KSYA 4J8XA 5CPIC 1N1JB 5B0ZD 5E5AC 4CAYB 3X1SB 4Z2MG 5CPJD 2HIOB 3AZFC 4ZUXD 3KXBC 3B6GA 5AV9D 1BH8B 3AYWB 3AZIA 3B0CT 3O62A 3AFAA 3LELA 4J8VB 1S32A 2F8ND 3C1BA 3B6FA 1M19D 3MNNB 1P3AA 3VH6A 1P3PB 4H9NA 1P3FB 5BT1C 3UTAC 5DNNB 5B0ZA 3LZ0C 5CPID 5E5AD 5CPJA 3KWQD 3REKC 1P3BB 4ZUXA 4J8UB 2NQBC 5B40B 5AV9A 3AZFD 1HQ3C 5AV8D 4M6BA 3W97A 5KDMA 3KXBD 5DNMB 3LJAC 3WAAA 3B0DC 4YM6A 5AVCB 1AOIC 2F8NA 1HQ3B 2L5AA 1M19A 5B2IB 1EQZD 1F66C 4UUZB 3WKJB 4Z66D 1JFIB 5CPIA 4ZBJC 3RELC 3AZEA 3VH5T 5BT1D 3LZ0D 3UTAD 5E5AA 4WU8B 3KWQA 2HUEC 4WZSB 3X1UB 5B1MB 3REKD 3R45B 3REJD 5AV8A 3KXBA 3RELB 2NQBD 3AZJB 5FUGB 1P34D 2AROC 3LJAD 3X1VB 1P3GC 1AOID 1ZLAB 1EQZA 3VH6W 1P3MC 3MGRB 4H9SC 1F66D 4XUJC 4Z66A 5B32D 5GXQB 5B24B 3UTAA 4XZQC 3B0BA 2CWEA 3WTPB 5GT3C 3REKA 1P3OD 3UT9C 3REJA 3A6NA 5GT0D 4WNNA 2NQBA 5B31B 1TAFB 5BO0A 1P34A 5GSUB 3AZGB 1P3KD 3REIB 4Z5TB 5B1LA 3MVDB 1P3GD 4EO5C 5B32A 1P3MD 5B33A 4KGCD 4XUJD 5B2JD 1BH9A 5AV6D 1ID3B 4XZQD 4J8XC 1P3OA 5GT3D 3NQJB 3REHA 5GT0A 4CSRB 3UT9D 5B0YA 3AZMC 3WTPE 3AV1B 3UTBB 5G49A 5C3IC 4J8XB 2IO5C 1P3KA 3AFAC 4H9PA 4WU9A 1P3GA 4YS3C 3LELC 3LZ1B 1P3MA 3B6GB 2CV5C 4KGCA 4XUJA 5B2JA 3AZIB 5AV6A 1KX3B 3O62B 3W99B 4JJNB 1P3AC 4XZQA 2NZDC 5GT3A 1P3LB 1S32B 3C1BB 3UT9A 3B6FB 3W96C 3VH5A 1P3AB 1KX5D 3AZMD 4H9RB 5B0ZB 3W97C 3B0CW 5CPJB 3WAAC 4X23C 2YFWA 3AFAD 4YM6C 4ZUXB 4YS3D 3LELD 5AV9B 1M1AB 5KDMB 2CV5D 1P3IC 2NZDD 2F8NB 3AZEC 1M19B 3KWQC 1KX5A 3AZMA 3W96D 1R4VA 3MGSC 5CPIB 5AV8C 5E5AB 3W97D 4LD9A 3WAAD 4X23D 3X1TC 4YM6D 4YS3A 3AZFB 5CPKC 3KXBB 2CV5A 1EQZC 3NQUA 3TU4C 5AY8A 4Z66C 1P3ID 2NZDA 3VH5W 1M18A 3AZED 1EQZB 3W96A 3C1CA 4Z66B 3REJC 3WA9A 3A6NC 5F99C 3MGSD 4G92C 3UTAB 3LZ0B 1P34C 3REKB 4X23A 3V9RA 3AZKA 3AV2C 4WNNB 3X1TD 2NQBB 5CPKD 5B1LC 2LY8A 3LJAB 5B32C 3B0DB 3X1SD 3TU4D 1P3IA 5B33C 4QLCA 1AOIB 4H9QA 1P3OC 1F66B 3AZNC 3REHC 3MGSA 2FJ7A 5GT0C 2BYMA 2RVQD 1BH9B 5B0YC 5F99D 3A6ND 4ZBJB 4J8VD 4DRBA 3MGQD 1BFMA 1P3OB 2HUEB 1H3OA 1P3KC 3X1TA 5CPKA 5JA4A 3AV2D 4WU9C 1B6WA 3X1SA 5B1LD 3TU4A 4KGCC 2AROB 5B2JC 5AV6C 2HIOA 5B33D 4H9PB 1P3GB 5B40D 1P3MB 4XUJB 3AZHC 3AZND 5F99A 3REHD 4J8VA 4XZQB 5B0YD 3MGQA 5GT3B 3UT9B 2PYOD 5BNVB 3AV2A 4WU9D 1P3BA 4J8UA 5B40A 5DNMA 4EO5B 3AZNA 3AZHD 5AVCA 1KX5C 3AN2C 4R8PC 1A7WA 1ZLAD 5B2IA 3AZLC 2PYOA 4UUZA 5JRGD 3AZMB 1JFIA 4KUDC 4LD9C 4J8WC 1U35C 1TZYC 5C3IB 1ULYA 4WU8A 2IO5B 1KX4C 3X1UA 5B1MA 3R45A 3KUYC 3AFAB 5AY8C 4YS3B 3LELB 5B31D 3AZJA 2CV5B 1M18C 3AZHA 3NQUB 3X1VA 3C1CC 3AN2D 3WA9C 1ZLAA 4H9NB 4R8PD 2NZDB 3AZLD 5JRGA 3W96B 4NE5A 3W98C 4KUDD 4LD9D 4J8WD 1U35D 1TZYD 3AZKC 3W97B 5B31G 3MGPD 5AV5C 1KX4D 3WAAB 4Z2MH 3V9RB 4X23B 4YM6B 3KUYD 5AY8D 4QLCC 4WV4B 5B31A 1M18D 3AN2A 1P3IB 4R8PA 2FJ7C 3C1CD 3WA9D 4Z5TA 5AVBC 3AZEB 3AZLA 4H9QB 5CP6C 3KWQB 1KX3D 4KUDA 4J8WA 3MGSB 1TZYA 2BYKA 1KU5A 4G91C 4H9OA 4JJND 1U35A 3W98D 5AV8B 3AZKD 3MGPA 1P3LD 1KX4A 3NQJA 3KUYA 3X1SC 5AV5D 3UTBA 2HIOC 3X1TB 5CPKB 5JA4B 4QLCD 2YFVA 5CHLB 4KHAA 3AYWC 2F8NH 3TU4B 2RVQC 2FJ7D 4J8VC 4DRAA 3LZ1A 5AVBD 3MGQC 1M1AD 5CP6D 1KX3A 3MNNC 3W99A 4JJNA 3W98A 3REJB 3A6NB 5F99B 1P3PC 4G92B 1P3FC 1P3LA 5DNNC 3MGQB 5BO0B 5AV5A 1P34B 5BNXA 1P3BC 3AV2B 4J8UC 2HIOD 4H9RA 5B40C 5B1LB 5DNMC 3AYWD 5B32B 5B33B 5AVCC 5AVBA 1M1AA 5CP6A 2F8NG 5B2IC 2PYOC 3AZNB 3MNND 3REHB 5GT0B 3WKJC 5B0YB 1P3PD 1N1JA 5G49B 1P3FD 1Q9CA 5DNND 4WU8C 4CAYA 2PYOB 3X1UC 1P3KB 5B1MC 1P3BD 4WU9B 4J8UD 1BH8A 4HGAC 3AYWA 3AZJC 4E45A 2JSSA 5DNMD 4KGCB 5B2JB 5AV6B 3X1VC 3AZFA 5AVCD 1ZLAC 1HQ3D 4HGAB 3MNNA 3MGRC 5B2ID 4NE6A 3AZHB 5JRGC 1P3PA 5GXQC 1P3FA 5B24C 3WKJD 5DNNA 4AWLC 3WTPC 1WWIA 1HTAA 4E44A 4WU8D 5JRGB 3X1UD 5B1MD 2YFWB 3LZ0A 4AWLB 3RELD 5B31C
chains in the Genus database with same CATH superfamily
3AZJD 3A1KA 5GSUC 3AZGC 3X1VD 1HQ3A 3REIC 4Z5TC 3MVDC 3LJAA 3MGRD 2AROD 1KX5B 3WKJA 5GXQD 5B32G 3AN2B 4R8PB 1ID3C 1AOIA 2Y2KA 5B24D 3WTPD 3VH6T 3MGPC 3AZLB 1F66A 5BS7C 4KUDB 4LD9B 4J8WB 1U35B 1TZYB 2BYKB 4H9OB 3RELA 3UTBC 3AV1C 3MGPB 2J8PA 1Z2CB 5FUGA 1KX4B 1F1EA 3KUYB 5GSUD 5AY8B 3AZGD 3LZ1C 2YFVB 4Z5TD 3MVDD 3REID 1M18B 3MGRA 2BG1A 3B6GC 2AROA 4KHAB 5GXQA 3AZIC 1KX3C 1WWSA 3W99C 3O62C 4JJNC 3C1CB 5B24A 1ID3D 3WA9B 3WTPA 1P3LC 2F8NK 1S32C 4H9SA 3C1BC 3B6FC 3W98B 3AZKB 3AV1D 1TAFA 4NE3A 3UTBD 4J8XD 5B0ZC 5AV5B 5BNXB 5GSUA 3AZGA 2ZY4A 5BNVA 5CPJC 4NFTA 4QLCB 4ZUXC 3REIA 3MVDA 5AV9C 1M1AC 3LZ1D 3B6GD 3AZID 1ID3A 3W99D 3O62D 2FJ7B 1B67A 2BYMB 5AVBB 5CP6B 1S32D 1M19C 5BS7A 4CSRA 3C1BD 3B6FD 1H3OB 4G91B 3AV1A 1P3AD 3KSYA 4J8XA 5CPIC 1N1JB 2Y2PA 2JCHA 5B0ZD 5E5AC 4CAYB 3X1SB 4Z2MG 5CPJD 2HIOB 3AZFC 4ZUXD 3KXBC 3B6GA 5AV9D 1BH8B 3AYWB 3AZIA 3B0CT 3O62A 3AFAA 3LELA 4J8VB 1S32A 2F8ND 3C1BA 3B6FA 1M19D 3MNNB 1P3AA 3VH6A 1P3PB 4H9NA 1P3FB 5BT1C 3UTAC 5DNNB 5B0ZA 2ZY3A 3LZ0C 5CPID 5E5AD 5CPJA 3KWQD 3REKC 1P3BB 4ZUXA 4J8UB 2NQBC 5B40B 5AV9A 3AZFD 1HQ3C 5AV8D 4M6BA 3W97A 5KDMA 3KXBD 5DNMB 3LJAC 3WAAA 3B0DC 4YM6A 5AVCB 2UWXA 1AOIC 2F8NA 1HQ3B 2L5AA 1M19A 5B2IB 1EQZD 1F66C 4UUZB 3H0RC 3WKJB 4Z66D 1JFIB 5CPIA 4ZBJC 3RELC 3AZEA 3VH5T 5BT1D 3LZ0D 3UTAD 5E5AA 4WU8B 3KWQA 2HUEC 3IP4C 4WZSB 5B1MB 3X1UB 3R45B 3REKD 3REJD 5AV8A 3KXBA 3RELB 2NQBD 2Y2HA 3AL0C 3AZJB 5FUGB 1P34D 2AROC 3LJAD 3X1VB 1P3GC 1AOID 1ZLAB 1EQZA 3VH6W 1P3MC 3MGRB 4H9SC 1F66D 4XUJC 4Z66A 5B32D 5GXQB 3EPJA 5B24B 3UTAA 4XZQC 3B0BA 2CWEA 3WTPB 1PZRA 5GT3C 3REKA 1P3OD 3UT9C 3REJA 3A6NA 5GT0D 4WNNA 2NQBA 2FFFB 5B31B 1TAFB 2ZY5A 5BO0A 1P34A 5GSUB 3AZGB 1P3KD 3REIB 4Z5TB 5B1LA 3MVDB 1P3GD 2DF4C 3H0LC 4EO5C 5B32A 1P3MD 5B33A 2Y2QA 4KGCD 4XUJD 5B2JD 1BH9A 5AV6D 1ID3B 4XZQD 4J8XC 1P3OA 5GT3D 3NQJB 3REHA 5GT0A 4CSRB 3UT9D 5B0YA 3AZMC 3WTPE 3AV1B 3UTBB 5G49A 5C3IC 4J8XB 2IO5C 1P3KA 4DQYB 3AFAC 4H9PA 4WU9A 1P3GA 4YS3C 3LELC 3LZ1B 1P3MA 3B6GB 2CV5C 4KGCA 4XUJA 5B2JA 3AZIB 5AV6A 1KX3B 3O62B 3W99B 4JJNB 1P3AC 4XZQA 2NZDC 5GT3A 1P3LB 1S32B 3C1BB 3UT9A 3B6FB 3W96C 3VH5A 1P3AB 1KX5D 3AZMD 4H9RB 5B0ZB 3W97C 3B0CW 5CPJB 3WAAC 4X23C 1T3UA 2YFWA 4YM6C 3AFAD 4ZUXB 4YS3D 3LELD 5AV9B 1M1AB 5KDMB 2CV5D 1P3IC 2NZDD 2F8NB 3AZEC 2Y2OA 1M19B 3KWQC 2Y2LA 1KX5A 3AZMA 3W96D 1R4VA 3MGSC 1W2EA 5CPIB 5AV8C 5E5AB 3W97D 3FDDA 4LD9A 3WAAD 4X23D 3X1TC 4YM6D 4YS3A 3AZFB 5CPKC 3KXBB 2CV5A 2DQNC 1EQZC 3NQUA 3TU4C 4WJ3C 5AY8A 4Z66C 1P3ID 2NZDA 3VH5W 1M18A 3AZED 1EQZB 3W96A 3C1CA 4Z66B 2ZY2A 3REJC 3A6NC 5F99C 3MGSD 3WA9A 4G92C 3UTAB 3LZ0B 1P34C 3REKB 2XD1A 3V9RA 4X23A 2XD5A 3AZKA 3AV2C 4WNNB 3X1TD 2NQBB 5CPKD 5B1LC 3A1IA 2LY8A 3LJAB 5B32C 3B0DB 3X1SD 3TU4D 1P3IA 5B33C 4QLCA 1AOIB 3P5JB 4H9QA 1P3OC 1F66B 3AZNC 3REHC 3MGSA 2FJ7A 5GT0C 2BYMA 2RVQD 1BH9B 5B0YC 5F99D 3A6ND 4ZBJB 4J8VD 4DRBA 3MGQD 1BFMA 1P3OB 2Y2MA 2HUEB 2VQRA 1H3OA 1P3KC 3X1TA 5CPKA 5JA4A 3AV2D 4WU9C 2RIQA 1B6WA 3X1SA 5B1LD 3TU4A 4KGCC 2AROB 5B2JC 5AV6C 2HIOA 5B33D 4H9PB 1P3GB 2G5HC 5B40D 1P3MB 4XUJB 3AZHC 3AZND 5F99A 3REHD 4J8VA 4XZQB 5B0YD 3MGQA 3EPLA 5GT3B 3UT9B 2PYOD 2JE5A 5BNVB 3AV2A 4WU9D 1P3BA 4J8UA 5B40A 5DNMA 2G5IC 4EO5B 3AZNA 3AZHD 5AVCA 1KX5C 3AN2C 4R8PC 1A7WA 1ZLAD 5B2IA 3AZLC 2PYOA 3KFUG 4UUZA 5JRGD 3AZMB 1JFIA 4KUDC 4LD9C 4J8WC 1U35C 1TZYC 5C3IB 1ULYA 4WU8A 2IO5B 2F2AC 1KX4C 3X1UA 5B1MA 2Y2JA 3R45A 3KUYC 3AFAB 5AY8C 4YS3B 3LELB 5B31D 3AZJA 2CV5B 1M18C 3AZHA 3NQUB 3X1VA 3C1CC 3AN2D 3WA9C 1ZLAA 4H9NB 4R8PD 2NZDB 2Y2NA 3AZLD 5JRGA 3W96B 4NE5A 3W98C 4KUDD 4LD9D 4J8WD 1U35D 1TZYD 3AZKC 3H0MC 3W97B 5B31G 3MGPD 5AV5C 1KX4D 3WAAB 4Z2MH 3V9RB 4X23B 4YM6B 3KUYD 5AY8D 4QLCC 4WV4B 5B31A 2Y2GA 1M18D 3AN2A 1P3IB 4R8PA 2FJ7C 3C1CD 2W8SA 3WA9D 4Z5TA 5AVBC 3AZEB 3AZLA 4H9QB 5CP6C 3EG5B 3KWQB 1KX3D 4KUDA 4J8WA 3MGSB 1TZYA 2BYKA 1KU5A 4G91C 4H9OA 4JJND 1U35A 3W98D 5AV8B 3AZKD 3MGPA 1P3LD 1KX4A 3NQJA 3KUYA 3X1SC 5AV5D 3UTBA 2HIOC 3X1TB 5CPKB 5JA4B 4QLCD 3EPHA 2YFVA 5CHLB 4KHAA 3AYWC 2F8NH 3TU4B 2RVQC 2FJ7D 4J8VC 4DRAA 3LZ1A 5AVBD 3MGQC 1M1AD 5CP6D 2ZM5A 1KX3A 3F6TA 3MNNC 3W99A 4JJNA 3W98A 3REJB 3A6NB 5F99B 1P3PC 4G92B 1P3FC 1P3LA 5DNNC 3MGQB 5BO0B 2Y2IA 5AV5A 1P34B 5BNXA 1P3BC 3AV2B 4J8UC 2HIOD 4H9RA 5B40C 5B1LB 5DNMC 3AYWD 5B32B 5B33B 5AVCC 5AVBA 3EPKA 1M1AA 5CP6A 4UPKA 2F8NG 5B2IC 2PYOC 3AZNB 3MNND 3REHB 5GT0B 3WKJC 5B0YB 1P3PD 1N1JA 5G49B 1P3FD 1Q9CA 5DNND 4WU8C 4CAYA 2PYOB 3X1UC 1P3KB 5B1MC 1P3BD 4WU9B 4J8UD 1BH8A 4HGAC 3AYWA 3AZJC 4E45A 2JSSA 5DNMD 4KGCB 5B2JB 5AV6B 3X1VC 3AZFA 5AVCD 1ZLAC 1HQ3D 4HGAB 3MNNA 3MGRC 5B2ID 4NE6A 3AZHB 5JRGC 1P3PA 5GXQC 1P3FA 5B24C 3WKJD 5DNNA 4AWLC 3WTPC 1WWIA 1HTAA 4E44A 4WU8D 5JRGB 3X1UD 5B1MD 2YFWB 3LZ0A 4AWLB 3RELD 5B31C
chains in the Genus database with same CATH topology
3AZJD 3A1KA 5GSUC 3AZGC 3X1VD 1HQ3A 3REIC 4Z5TC 3MVDC 3LJAA 3MGRD 2AROD 1KX5B 3WKJA 5GXQD 5B32G 3AN2B 4R8PB 1ID3C 1AOIA 2Y2KA 5B24D 3WTPD 3VH6T 3MGPC 3AZLB 1F66A 5BS7C 4KUDB 4LD9B 4J8WB 1U35B 1TZYB 2BYKB 4H9OB 3RELA 3UTBC 3AV1C 3MGPB 2J8PA 1Z2CB 5FUGA 1KX4B 1F1EA 3KUYB 5GSUD 5AY8B 3AZGD 3LZ1C 2YFVB 4Z5TD 3MVDD 3REID 1M18B 3MGRA 2BG1A 3B6GC 2AROA 4KHAB 5GXQA 3AZIC 1KX3C 1WWSA 3W99C 3O62C 4JJNC 3C1CB 5B24A 1ID3D 3WA9B 3WTPA 1P3LC 2F8NK 1S32C 4H9SA 3C1BC 3B6FC 3W98B 3AZKB 3AV1D 1TAFA 4NE3A 3UTBD 4J8XD 5B0ZC 5AV5B 5BNXB 5GSUA 3AZGA 2ZY4A 5BNVA 5CPJC 4NFTA 4QLCB 4ZUXC 3REIA 3MVDA 5AV9C 1M1AC 3LZ1D 3B6GD 3AZID 1ID3A 3W99D 3O62D 2FJ7B 1B67A 2BYMB 5AVBB 5CP6B 1S32D 1M19C 5BS7A 4CSRA 3C1BD 3B6FD 1H3OB 4G91B 3AV1A 1P3AD 3KSYA 4J8XA 5CPIC 1N1JB 2Y2PA 2JCHA 5B0ZD 5E5AC 4CAYB 3X1SB 4Z2MG 5CPJD 2HIOB 3AZFC 4ZUXD 3KXBC 3B6GA 5AV9D 1BH8B 3AYWB 3AZIA 3B0CT 3O62A 3AFAA 3LELA 4J8VB 1S32A 2F8ND 3C1BA 3B6FA 1M19D 3MNNB 1P3AA 3VH6A 1P3PB 4H9NA 1P3FB 5BT1C 3UTAC 5DNNB 5B0ZA 2ZY3A 3LZ0C 5CPID 5E5AD 5CPJA 3KWQD 3REKC 1P3BB 4ZUXA 4J8UB 2NQBC 5B40B 5AV9A 3AZFD 1HQ3C 5AV8D 4M6BA 3W97A 5KDMA 3KXBD 5DNMB 3LJAC 3WAAA 3B0DC 4YM6A 5AVCB 2UWXA 1AOIC 2F8NA 1HQ3B 2L5AA 1M19A 5B2IB 1EQZD 1F66C 4UUZB 3H0RC 3WKJB 4Z66D 1JFIB 5CPIA 4ZBJC 3RELC 3AZEA 3VH5T 5BT1D 3LZ0D 3UTAD 5E5AA 4WU8B 3KWQA 2HUEC 3IP4C 4WZSB 5B1MB 3X1UB 3R45B 3REKD 3REJD 5AV8A 3KXBA 3RELB 2NQBD 2Y2HA 3AL0C 3AZJB 5FUGB 1P34D 2AROC 3LJAD 3X1VB 1P3GC 1AOID 1ZLAB 1EQZA 3VH6W 1P3MC 3MGRB 4H9SC 1F66D 4XUJC 4Z66A 5B32D 5GXQB 3EPJA 5B24B 3UTAA 4XZQC 3B0BA 2CWEA 3WTPB 1PZRA 5GT3C 3REKA 1P3OD 3UT9C 3REJA 3A6NA 5GT0D 4WNNA 2NQBA 2FFFB 5B31B 1TAFB 2ZY5A 5BO0A 1P34A 5GSUB 3AZGB 1P3KD 3REIB 4Z5TB 5B1LA 3MVDB 1P3GD 2DF4C 3H0LC 4EO5C 5B32A 1P3MD 5B33A 2Y2QA 4KGCD 4XUJD 5B2JD 1BH9A 5AV6D 1ID3B 4XZQD 4J8XC 1P3OA 5GT3D 3NQJB 3REHA 5GT0A 4CSRB 3UT9D 5B0YA 3AZMC 3WTPE 3AV1B 3UTBB 5G49A 5C3IC 4J8XB 2IO5C 1P3KA 4DQYB 3AFAC 4H9PA 4WU9A 1P3GA 4YS3C 3LELC 3LZ1B 1P3MA 3B6GB 2CV5C 4KGCA 4XUJA 5B2JA 3AZIB 5AV6A 1KX3B 3O62B 3W99B 4JJNB 1P3AC 4XZQA 2NZDC 5GT3A 1P3LB 1S32B 3C1BB 3UT9A 3B6FB 3W96C 3VH5A 1P3AB 1KX5D 3AZMD 4H9RB 5B0ZB 3W97C 3B0CW 5CPJB 3WAAC 4X23C 1T3UA 2YFWA 4YM6C 3AFAD 4ZUXB 4YS3D 3LELD 5AV9B 1M1AB 5KDMB 2CV5D 1P3IC 2NZDD 2F8NB 3AZEC 2Y2OA 1M19B 3KWQC 2Y2LA 1KX5A 3AZMA 3W96D 1R4VA 3MGSC 1W2EA 5CPIB 5AV8C 5E5AB 3W97D 3FDDA 4LD9A 3WAAD 4X23D 3X1TC 4YM6D 4YS3A 3AZFB 5CPKC 3KXBB 2CV5A 2DQNC 1EQZC 3NQUA 3TU4C 4WJ3C 5AY8A 4Z66C 1P3ID 2NZDA 3VH5W 1M18A 3AZED 1EQZB 3W96A 3C1CA 4Z66B 2ZY2A 3REJC 3A6NC 5F99C 3MGSD 3WA9A 4G92C 3UTAB 3LZ0B 1P34C 3REKB 2XD1A 3V9RA 4X23A 2XD5A 3AZKA 3AV2C 4WNNB 3X1TD 2NQBB 5CPKD 5B1LC 3A1IA 2LY8A 3LJAB 5B32C 3B0DB 3X1SD 3TU4D 1P3IA 5B33C 4QLCA 1AOIB 3P5JB 4H9QA 1P3OC 1F66B 3AZNC 3REHC 3MGSA 2FJ7A 5GT0C 2BYMA 2RVQD 1BH9B 5B0YC 5F99D 3A6ND 4ZBJB 4J8VD 4DRBA 3MGQD 1BFMA 1P3OB 2Y2MA 2HUEB 2VQRA 1H3OA 1P3KC 3X1TA 5CPKA 5JA4A 3AV2D 4WU9C 2RIQA 1B6WA 3X1SA 5B1LD 3TU4A 4KGCC 2AROB 5B2JC 5AV6C 2HIOA 5B33D 4H9PB 1P3GB 2G5HC 5B40D 1P3MB 4XUJB 3AZHC 3AZND 5F99A 3REHD 4J8VA 4XZQB 5B0YD 3MGQA 3EPLA 5GT3B 3UT9B 2PYOD 2JE5A 5BNVB 3AV2A 4WU9D 1P3BA 4J8UA 5B40A 5DNMA 2G5IC 4EO5B 3AZNA 3AZHD 5AVCA 1KX5C 3AN2C 4R8PC 1A7WA 1ZLAD 5B2IA 3AZLC 2PYOA 3KFUG 4UUZA 5JRGD 3AZMB 1JFIA 4KUDC 4LD9C 4J8WC 1U35C 1TZYC 5C3IB 1ULYA 4WU8A 2IO5B 2F2AC 1KX4C 3X1UA 5B1MA 2Y2JA 3R45A 3KUYC 3AFAB 5AY8C 4YS3B 3LELB 5B31D 3AZJA 2CV5B 1M18C 3AZHA 3NQUB 3X1VA 3C1CC 3AN2D 3WA9C 1ZLAA 4H9NB 4R8PD 2NZDB 2Y2NA 3AZLD 5JRGA 3W96B 4NE5A 3W98C 4KUDD 4LD9D 4J8WD 1U35D 1TZYD 3AZKC 3H0MC 3W97B 5B31G 3MGPD 5AV5C 1KX4D 3WAAB 4Z2MH 3V9RB 4X23B 4YM6B 3KUYD 5AY8D 4QLCC 4WV4B 5B31A 2Y2GA 1M18D 3AN2A 1P3IB 4R8PA 2FJ7C 3C1CD 2W8SA 3WA9D 4Z5TA 5AVBC 3AZEB 3AZLA 4H9QB 5CP6C 3EG5B 3KWQB 1KX3D 4KUDA 4J8WA 3MGSB 1TZYA 2BYKA 1KU5A 4G91C 4H9OA 4JJND 1U35A 3W98D 5AV8B 3AZKD 3MGPA 1P3LD 1KX4A 3NQJA 3KUYA 3X1SC 5AV5D 3UTBA 2HIOC 3X1TB 5CPKB 5JA4B 4QLCD 3EPHA 2YFVA 5CHLB 4KHAA 3AYWC 2F8NH 3TU4B 2RVQC 2FJ7D 4J8VC 4DRAA 3LZ1A 5AVBD 3MGQC 1M1AD 5CP6D 2ZM5A 1KX3A 3F6TA 3MNNC 3W99A 4JJNA 3W98A 3REJB 3A6NB 5F99B 1P3PC 4G92B 1P3FC 1P3LA 5DNNC 3MGQB 5BO0B 2Y2IA 5AV5A 1P34B 5BNXA 1P3BC 3AV2B 4J8UC 2HIOD 4H9RA 5B40C 5B1LB 5DNMC 3AYWD 5B32B 5B33B 5AVCC 5AVBA 3EPKA 1M1AA 5CP6A 4UPKA 2F8NG 5B2IC 2PYOC 3AZNB 3MNND 3REHB 5GT0B 3WKJC 5B0YB 1P3PD 1N1JA 5G49B 1P3FD 1Q9CA 5DNND 4WU8C 4CAYA 2PYOB 3X1UC 1P3KB 5B1MC 1P3BD 4WU9B 4J8UD 1BH8A 4HGAC 3AYWA 3AZJC 4E45A 2JSSA 5DNMD 4KGCB 5B2JB 5AV6B 3X1VC 3AZFA 5AVCD 1ZLAC 1HQ3D 4HGAB 3MNNA 3MGRC 5B2ID 4NE6A 3AZHB 5JRGC 1P3PA 5GXQC 1P3FA 5B24C 3WKJD 5DNNA 4AWLC 3WTPC 1WWIA 1HTAA 4E44A 4WU8D 5JRGB 3X1UD 5B1MD 2YFWB 3LZ0A 4AWLB 3RELD 5B31C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AZJ D;  5GSU C;  3AZG C;  3X1V D;  1HQ3 A;  3REI C;  4Z5T C;  3MVD C;  3LJA A;  3MGR D;  2ARO D;  1KX5 B;  3WKJ A;  5GXQ D;  5B32 G;  3AN2 B;  4R8P B;  1ID3 C;  1AOI A;  5B24 D;  3WTP D;  3VH6 T;  3MGP C;  3AZL B;  1F66 A;  5BS7 C;  4KUD B;  4LD9 B;  4J8W B;  1U35 B;  1TZY B;  2BYK B;  4H9O B;  3REL A;  3UTB C;  3AV1 C;  3MGP B;  5FUG A;  1KX4 B;  1F1E A;  3KUY B;  5GSU D;  5AY8 B;  3AZG D;  3LZ1 C;  2YFV B;  4Z5T D;  3MVD D;  3REI D;  1M18 B;  3MGR A;  3B6G C;  2ARO A;  4KHA B;  5GXQ A;  3AZI C;  1KX3 C;  1WWS A;  3W99 C;  3O62 C;  4JJN C;  3C1C B;  5B24 A;  1ID3 D;  3WA9 B;  3WTP A;  1P3L C;  2F8N K;  1S32 C;  4H9S A;  3C1B C;  3B6F C;  3W98 B;  3AZK B;  3AV1 D;  1TAF A;  4NE3 A;  3UTB D;  4J8X D;  5B0Z C;  5AV5 B;  5BNX B;  5GSU A;  3AZG A;  5BNV A;  5CPJ C;  4NFT A;  4QLC B;  4ZUX C;  3REI A;  3MVD A;  5AV9 C;  1M1A C;  3LZ1 D;  3B6G D;  3AZI D;  1ID3 A;  3W99 D;  3O62 D;  2FJ7 B;  1B67 A;  2BYM B;  5AVB B;  5CP6 B;  1S32 D;  1M19 C;  5BS7 A;  4CSR A;  3C1B D;  3B6F D;  1H3O B;  4G91 B;  3AV1 A;  1P3A D;  3KSY A;  4J8X A;  5CPI C;  1N1J B;  5B0Z D;  5E5A C;  4CAY B;  3X1S B;  4Z2M G;  5CPJ D;  2HIO B;  3AZF C;  4ZUX D;  3KXB C;  3B6G A;  5AV9 D;  1BH8 B;  3AYW B;  3AZI A;  3B0C T;  3O62 A;  3AFA A;  3LEL A;  4J8V B;  1S32 A;  2F8N D;  3C1B A;  3B6F A;  1M19 D;  3MNN B;  1P3A A;  3VH6 A;  1P3P B;  4H9N A;  1P3F B;  5BT1 C;  3UTA C;  5DNN B;  5B0Z A;  3LZ0 C;  5CPI D;  5E5A D;  5CPJ A;  3KWQ D;  3REK C;  1P3B B;  4ZUX A;  4J8U B;  2NQB C;  5B40 B;  5AV9 A;  3AZF D;  1HQ3 C;  5AV8 D;  4M6B A;  3W97 A;  5KDM A;  3KXB D;  5DNM B;  3LJA C;  3WAA A;  3B0D C;  4YM6 A;  5AVC B;  1AOI C;  2F8N A;  1HQ3 B;  2L5A A;  1M19 A;  5B2I B;  1EQZ D;  1F66 C;  4UUZ B;  3WKJ B;  4Z66 D;  1JFI B;  5CPI A;  4ZBJ C;  3REL C;  3AZE A;  3VH5 T;  5BT1 D;  3LZ0 D;  3UTA D;  5E5A A;  4WU8 B;  3KWQ A;  2HUE C;  4WZS B;  3X1U B;  5B1M B;  3REK D;  3R45 B;  3REJ D;  5AV8 A;  3KXB A;  3REL B;  2NQB D;  3AZJ B;  5FUG B;  1P34 D;  2ARO C;  3LJA D;  3X1V B;  1P3G C;  1AOI D;  1ZLA B;  1EQZ A;  3VH6 W;  1P3M C;  3MGR B;  4H9S C;  1F66 D;  4XUJ C;  4Z66 A;  5B32 D;  5GXQ B;  5B24 B;  3UTA A;  4XZQ C;  3B0B A;  2CWE A;  3WTP B;  5GT3 C;  3REK A;  1P3O D;  3UT9 C;  3REJ A;  3A6N A;  5GT0 D;  4WNN A;  2NQB A;  5B31 B;  1TAF B;  5BO0 A;  1P34 A;  5GSU B;  3AZG B;  1P3K D;  3REI B;  4Z5T B;  5B1L A;  3MVD B;  1P3G D;  4EO5 C;  5B32 A;  1P3M D;  5B33 A;  4KGC D;  4XUJ D;  5B2J D;  1BH9 A;  5AV6 D;  1ID3 B;  4XZQ D;  4J8X C;  1P3O A;  5GT3 D;  3NQJ B;  3REH A;  5GT0 A;  4CSR B;  3UT9 D;  5B0Y A;  3AZM C;  3WTP E;  3AV1 B;  3UTB B;  5G49 A;  5C3I C;  4J8X B;  2IO5 C;  1P3K A;  3AFA C;  4H9P A;  4WU9 A;  1P3G A;  4YS3 C;  3LEL C;  3LZ1 B;  1P3M A;  3B6G B;  2CV5 C;  4KGC A;  4XUJ A;  5B2J A;  3AZI B;  5AV6 A;  1KX3 B;  3O62 B;  3W99 B;  4JJN B;  1P3A C;  4XZQ A;  2NZD C;  5GT3 A;  1P3L B;  1S32 B;  3C1B B;  3UT9 A;  3B6F B;  3W96 C;  3VH5 A;  1P3A B;  1KX5 D;  3AZM D;  4H9R B;  5B0Z B;  3W97 C;  3B0C W;  5CPJ B;  3WAA C;  4X23 C;  2YFW A;  3AFA D;  4YM6 C;  4ZUX B;  4YS3 D;  3LEL D;  5AV9 B;  1M1A B;  5KDM B;  2CV5 D;  1P3I C;  2NZD D;  2F8N B;  3AZE C;  1M19 B;  3KWQ C;  1KX5 A;  3AZM A;  3W96 D;  1R4V A;  3MGS C;  5CPI B;  5AV8 C;  5E5A B;  3W97 D;  4LD9 A;  3WAA D;  4X23 D;  3X1T C;  4YM6 D;  4YS3 A;  3AZF B;  5CPK C;  3KXB B;  2CV5 A;  1EQZ C;  3NQU A;  3TU4 C;  5AY8 A;  4Z66 C;  1P3I D;  2NZD A;  3VH5 W;  1M18 A;  3AZE D;  1EQZ B;  3W96 A;  3C1C A;  4Z66 B;  3REJ C;  3WA9 A;  3A6N C;  5F99 C;  3MGS D;  4G92 C;  3UTA B;  3LZ0 B;  1P34 C;  3REK B;  4X23 A;  3V9R A;  3AZK A;  3AV2 C;  4WNN B;  3X1T D;  2NQB B;  5CPK D;  5B1L C;  2LY8 A;  3LJA B;  5B32 C;  3B0D B;  3X1S D;  3TU4 D;  1P3I A;  5B33 C;  4QLC A;  1AOI B;  4H9Q A;  1P3O C;  1F66 B;  3AZN C;  3REH C;  3MGS A;  2FJ7 A;  5GT0 C;  2BYM A;  2RVQ D;  1BH9 B;  5B0Y C;  5F99 D;  3A6N D;  4ZBJ B;  4J8V D;  4DRB A;  3MGQ D;  1BFM A;  1P3O B;  2HUE B;  1H3O A;  1P3K C;  3X1T A;  5CPK A;  5JA4 A;  3AV2 D;  4WU9 C;  1B6W A;  3X1S A;  5B1L D;  3TU4 A;  4KGC C;  2ARO B;  5B2J C;  5AV6 C;  2HIO A;  5B33 D;  4H9P B;  1P3G B;  5B40 D;  1P3M B;  4XUJ B;  3AZH C;  3AZN D;  5F99 A;  3REH D;  4J8V A;  4XZQ B;  5B0Y D;  3MGQ A;  5GT3 B;  3UT9 B;  2PYO D;  5BNV B;  3AV2 A;  4WU9 D;  1P3B A;  4J8U A;  5B40 A;  5DNM A;  4EO5 B;  3AZN A;  3AZH D;  5AVC A;  1KX5 C;  3AN2 C;  4R8P C;  1A7W A;  1ZLA D;  5B2I A;  3AZL C;  2PYO A;  4UUZ A;  5JRG D;  3AZM B;  1JFI A;  4KUD C;  4LD9 C;  4J8W C;  1U35 C;  1TZY C;  5C3I B;  1ULY A;  4WU8 A;  2IO5 B;  1KX4 C;  3X1U A;  5B1M A;  3R45 A;  3KUY C;  3AFA B;  5AY8 C;  4YS3 B;  3LEL B;  5B31 D;  3AZJ A;  2CV5 B;  1M18 C;  3AZH A;  3NQU B;  3X1V A;  3C1C C;  3AN2 D;  3WA9 C;  1ZLA A;  4H9N B;  4R8P D;  2NZD B;  3AZL D;  5JRG A;  3W96 B;  4NE5 A;  3W98 C;  4KUD D;  4LD9 D;  4J8W D;  1U35 D;  1TZY D;  3AZK C;  3W97 B;  5B31 G;  3MGP D;  5AV5 C;  1KX4 D;  3WAA B;  4Z2M H;  3V9R B;  4X23 B;  4YM6 B;  3KUY D;  5AY8 D;  4QLC C;  4WV4 B;  5B31 A;  1M18 D;  3AN2 A;  1P3I B;  4R8P A;  2FJ7 C;  3C1C D;  3WA9 D;  4Z5T A;  5AVB C;  3AZE B;  3AZL A;  4H9Q B;  5CP6 C;  3KWQ B;  1KX3 D;  4KUD A;  4J8W A;  3MGS B;  1TZY A;  2BYK A;  1KU5 A;  4G91 C;  4H9O A;  4JJN D;  1U35 A;  3W98 D;  5AV8 B;  3AZK D;  3MGP A;  1P3L D;  1KX4 A;  3NQJ A;  3KUY A;  3X1S C;  5AV5 D;  3UTB A;  2HIO C;  3X1T B;  5CPK B;  5JA4 B;  4QLC D;  2YFV A;  5CHL B;  4KHA A;  3AYW C;  2F8N H;  3TU4 B;  2RVQ C;  2FJ7 D;  4J8V C;  4DRA A;  3LZ1 A;  5AVB D;  3MGQ C;  1M1A D;  5CP6 D;  1KX3 A;  3MNN C;  3W99 A;  4JJN A;  3W98 A;  3REJ B;  3A6N B;  5F99 B;  1P3P C;  4G92 B;  1P3F C;  1P3L A;  5DNN C;  3MGQ B;  5BO0 B;  5AV5 A;  1P34 B;  5BNX A;  1P3B C;  3AV2 B;  4J8U C;  2HIO D;  4H9R A;  5B40 C;  5B1L B;  5DNM C;  3AYW D;  5B32 B;  5B33 B;  5AVC C;  5AVB A;  1M1A A;  5CP6 A;  2F8N G;  5B2I C;  2PYO C;  3AZN B;  3MNN D;  3REH B;  5GT0 B;  3WKJ C;  5B0Y B;  1P3P D;  1N1J A;  5G49 B;  1P3F D;  1Q9C A;  5DNN D;  4WU8 C;  4CAY A;  2PYO B;  3X1U C;  1P3K B;  5B1M C;  1P3B D;  4WU9 B;  4J8U D;  1BH8 A;  4HGA C;  3AYW A;  3AZJ C;  4E45 A;  2JSS A;  5DNM D;  4KGC B;  5B2J B;  5AV6 B;  3X1V C;  3AZF A;  5AVC D;  1ZLA C;  1HQ3 D;  4HGA B;  3MNN A;  3MGR C;  5B2I D;  4NE6 A;  3AZH B;  5JRG C;  1P3P A;  5GXQ C;  1P3F A;  5B24 C;  3WKJ D;  5DNN A;  4AWL C;  3WTP C;  1WWI A;  1HTA A;  4E44 A;  4WU8 D;  5JRG B;  3X1U D;  5B1M D;  2YFW B;  3LZ0 A;  4AWL B;  3REL D;  5B31 C; 
#chains in the Genus database with same CATH topology
 3AZJ D;  3A1K A;  5GSU C;  3AZG C;  3X1V D;  1HQ3 A;  3REI C;  4Z5T C;  3MVD C;  3LJA A;  3MGR D;  2ARO D;  1KX5 B;  3WKJ A;  5GXQ D;  5B32 G;  3AN2 B;  4R8P B;  1ID3 C;  1AOI A;  2Y2K A;  5B24 D;  3WTP D;  3VH6 T;  3MGP C;  3AZL B;  1F66 A;  5BS7 C;  4KUD B;  4LD9 B;  4J8W B;  1U35 B;  1TZY B;  2BYK B;  4H9O B;  3REL A;  3UTB C;  3AV1 C;  3MGP B;  2J8P A;  1Z2C B;  5FUG A;  1KX4 B;  1F1E A;  3KUY B;  5GSU D;  5AY8 B;  3AZG D;  3LZ1 C;  2YFV B;  4Z5T D;  3MVD D;  3REI D;  1M18 B;  3MGR A;  2BG1 A;  3B6G C;  2ARO A;  4KHA B;  5GXQ A;  3AZI C;  1KX3 C;  1WWS A;  3W99 C;  3O62 C;  4JJN C;  3C1C B;  5B24 A;  1ID3 D;  3WA9 B;  3WTP A;  1P3L C;  2F8N K;  1S32 C;  4H9S A;  3C1B C;  3B6F C;  3W98 B;  3AZK B;  3AV1 D;  1TAF A;  4NE3 A;  3UTB D;  4J8X D;  5B0Z C;  5AV5 B;  5BNX B;  5GSU A;  3AZG A;  2ZY4 A;  5BNV A;  5CPJ C;  4NFT A;  4QLC B;  4ZUX C;  3REI A;  3MVD A;  5AV9 C;  1M1A C;  3LZ1 D;  3B6G D;  3AZI D;  1ID3 A;  3W99 D;  3O62 D;  2FJ7 B;  1B67 A;  2BYM B;  5AVB B;  5CP6 B;  1S32 D;  1M19 C;  5BS7 A;  4CSR A;  3C1B D;  3B6F D;  1H3O B;  4G91 B;  3AV1 A;  1P3A D;  3KSY A;  4J8X A;  5CPI C;  1N1J B;  2Y2P A;  2JCH A;  5B0Z D;  5E5A C;  4CAY B;  3X1S B;  4Z2M G;  5CPJ D;  2HIO B;  3AZF C;  4ZUX D;  3KXB C;  3B6G A;  5AV9 D;  1BH8 B;  3AYW B;  3AZI A;  3B0C T;  3O62 A;  3AFA A;  3LEL A;  4J8V B;  1S32 A;  2F8N D;  3C1B A;  3B6F A;  1M19 D;  3MNN B;  1P3A A;  3VH6 A;  1P3P B;  4H9N A;  1P3F B;  5BT1 C;  3UTA C;  5DNN B;  5B0Z A;  2ZY3 A;  3LZ0 C;  5CPI D;  5E5A D;  5CPJ A;  3KWQ D;  3REK C;  1P3B B;  4ZUX A;  4J8U B;  2NQB C;  5B40 B;  5AV9 A;  3AZF D;  1HQ3 C;  5AV8 D;  4M6B A;  3W97 A;  5KDM A;  3KXB D;  5DNM B;  3LJA C;  3WAA A;  3B0D C;  4YM6 A;  5AVC B;  2UWX A;  1AOI C;  2F8N A;  1HQ3 B;  2L5A A;  1M19 A;  5B2I B;  1EQZ D;  1F66 C;  4UUZ B;  3H0R C;  3WKJ B;  4Z66 D;  1JFI B;  5CPI A;  4ZBJ C;  3REL C;  3AZE A;  3VH5 T;  5BT1 D;  3LZ0 D;  3UTA D;  5E5A A;  4WU8 B;  3KWQ A;  2HUE C;  3IP4 C;  4WZS B;  5B1M B;  3X1U B;  3R45 B;  3REK D;  3REJ D;  5AV8 A;  3KXB A;  3REL B;  2NQB D;  2Y2H A;  3AL0 C;  3AZJ B;  5FUG B;  1P34 D;  2ARO C;  3LJA D;  3X1V B;  1P3G C;  1AOI D;  1ZLA B;  1EQZ A;  3VH6 W;  1P3M C;  3MGR B;  4H9S C;  1F66 D;  4XUJ C;  4Z66 A;  5B32 D;  5GXQ B;  3EPJ A;  5B24 B;  3UTA A;  4XZQ C;  3B0B A;  2CWE A;  3WTP B;  1PZR A;  5GT3 C;  3REK A;  1P3O D;  3UT9 C;  3REJ A;  3A6N A;  5GT0 D;  4WNN A;  2NQB A;  2FFF B;  5B31 B;  1TAF B;  2ZY5 A;  5BO0 A;  1P34 A;  5GSU B;  3AZG B;  1P3K D;  3REI B;  4Z5T B;  5B1L A;  3MVD B;  1P3G D;  2DF4 C;  3H0L C;  4EO5 C;  5B32 A;  1P3M D;  5B33 A;  2Y2Q A;  4KGC D;  4XUJ D;  5B2J D;  1BH9 A;  5AV6 D;  1ID3 B;  4XZQ D;  4J8X C;  1P3O A;  5GT3 D;  3NQJ B;  3REH A;  5GT0 A;  4CSR B;  3UT9 D;  5B0Y A;  3AZM C;  3WTP E;  3AV1 B;  3UTB B;  5G49 A;  5C3I C;  4J8X B;  2IO5 C;  1P3K A;  4DQY B;  3AFA C;  4H9P A;  4WU9 A;  1P3G A;  4YS3 C;  3LEL C;  3LZ1 B;  1P3M A;  3B6G B;  2CV5 C;  4KGC A;  4XUJ A;  5B2J A;  3AZI B;  5AV6 A;  1KX3 B;  3O62 B;  3W99 B;  4JJN B;  1P3A C;  4XZQ A;  2NZD C;  5GT3 A;  1P3L B;  1S32 B;  3C1B B;  3UT9 A;  3B6F B;  3W96 C;  3VH5 A;  1P3A B;  1KX5 D;  3AZM D;  4H9R B;  5B0Z B;  3W97 C;  3B0C W;  5CPJ B;  3WAA C;  4X23 C;  1T3U A;  2YFW A;  4YM6 C;  3AFA D;  4ZUX B;  4YS3 D;  3LEL D;  5AV9 B;  1M1A B;  5KDM B;  2CV5 D;  1P3I C;  2NZD D;  2F8N B;  3AZE C;  2Y2O A;  1M19 B;  3KWQ C;  2Y2L A;  1KX5 A;  3AZM A;  3W96 D;  1R4V A;  3MGS C;  1W2E A;  5CPI B;  5AV8 C;  5E5A B;  3W97 D;  3FDD A;  4LD9 A;  3WAA D;  4X23 D;  3X1T C;  4YM6 D;  4YS3 A;  3AZF B;  5CPK C;  3KXB B;  2CV5 A;  2DQN C;  1EQZ C;  3NQU A;  3TU4 C;  4WJ3 C;  5AY8 A;  4Z66 C;  1P3I D;  2NZD A;  3VH5 W;  1M18 A;  3AZE D;  1EQZ B;  3W96 A;  3C1C A;  4Z66 B;  2ZY2 A;  3REJ C;  3A6N C;  5F99 C;  3MGS D;  3WA9 A;  4G92 C;  3UTA B;  3LZ0 B;  1P34 C;  3REK B;  2XD1 A;  3V9R A;  4X23 A;  2XD5 A;  3AZK A;  3AV2 C;  4WNN B;  3X1T D;  2NQB B;  5CPK D;  5B1L C;  3A1I A;  2LY8 A;  3LJA B;  5B32 C;  3B0D B;  3X1S D;  3TU4 D;  1P3I A;  5B33 C;  4QLC A;  1AOI B;  3P5J B;  4H9Q A;  1P3O C;  1F66 B;  3AZN C;  3REH C;  3MGS A;  2FJ7 A;  5GT0 C;  2BYM A;  2RVQ D;  1BH9 B;  5B0Y C;  5F99 D;  3A6N D;  4ZBJ B;  4J8V D;  4DRB A;  3MGQ D;  1BFM A;  1P3O B;  2Y2M A;  2HUE B;  2VQR A;  1H3O A;  1P3K C;  3X1T A;  5CPK A;  5JA4 A;  3AV2 D;  4WU9 C;  2RIQ A;  1B6W A;  3X1S A;  5B1L D;  3TU4 A;  4KGC C;  2ARO B;  5B2J C;  5AV6 C;  2HIO A;  5B33 D;  4H9P B;  1P3G B;  2G5H C;  5B40 D;  1P3M B;  4XUJ B;  3AZH C;  3AZN D;  5F99 A;  3REH D;  4J8V A;  4XZQ B;  5B0Y D;  3MGQ A;  3EPL A;  5GT3 B;  3UT9 B;  2PYO D;  2JE5 A;  5BNV B;  3AV2 A;  4WU9 D;  1P3B A;  4J8U A;  5B40 A;  5DNM A;  2G5I C;  4EO5 B;  3AZN A;  3AZH D;  5AVC A;  1KX5 C;  3AN2 C;  4R8P C;  1A7W A;  1ZLA D;  5B2I A;  3AZL C;  2PYO A;  3KFU G;  4UUZ A;  5JRG D;  3AZM B;  1JFI A;  4KUD C;  4LD9 C;  4J8W C;  1U35 C;  1TZY C;  5C3I B;  1ULY A;  4WU8 A;  2IO5 B;  2F2A C;  1KX4 C;  3X1U A;  5B1M A;  2Y2J A;  3R45 A;  3KUY C;  3AFA B;  5AY8 C;  4YS3 B;  3LEL B;  5B31 D;  3AZJ A;  2CV5 B;  1M18 C;  3AZH A;  3NQU B;  3X1V A;  3C1C C;  3AN2 D;  3WA9 C;  1ZLA A;  4H9N B;  4R8P D;  2NZD B;  2Y2N A;  3AZL D;  5JRG A;  3W96 B;  4NE5 A;  3W98 C;  4KUD D;  4LD9 D;  4J8W D;  1U35 D;  1TZY D;  3AZK C;  3H0M C;  3W97 B;  5B31 G;  3MGP D;  5AV5 C;  1KX4 D;  3WAA B;  4Z2M H;  3V9R B;  4X23 B;  4YM6 B;  3KUY D;  5AY8 D;  4QLC C;  4WV4 B;  5B31 A;  2Y2G A;  1M18 D;  3AN2 A;  1P3I B;  4R8P A;  2FJ7 C;  3C1C D;  2W8S A;  3WA9 D;  4Z5T A;  5AVB C;  3AZE B;  3AZL A;  4H9Q B;  5CP6 C;  3EG5 B;  3KWQ B;  1KX3 D;  4KUD A;  4J8W A;  3MGS B;  1TZY A;  2BYK A;  1KU5 A;  4G91 C;  4H9O A;  4JJN D;  1U35 A;  3W98 D;  5AV8 B;  3AZK D;  3MGP A;  1P3L D;  1KX4 A;  3NQJ A;  3KUY A;  3X1S C;  5AV5 D;  3UTB A;  2HIO C;  3X1T B;  5CPK B;  5JA4 B;  4QLC D;  3EPH A;  2YFV A;  5CHL B;  4KHA A;  3AYW C;  2F8N H;  3TU4 B;  2RVQ C;  2FJ7 D;  4J8V C;  4DRA A;  3LZ1 A;  5AVB D;  3MGQ C;  1M1A D;  5CP6 D;  2ZM5 A;  1KX3 A;  3F6T A;  3MNN C;  3W99 A;  4JJN A;  3W98 A;  3REJ B;  3A6N B;  5F99 B;  1P3P C;  4G92 B;  1P3F C;  1P3L A;  5DNN C;  3MGQ B;  5BO0 B;  2Y2I A;  5AV5 A;  1P34 B;  5BNX A;  1P3B C;  3AV2 B;  4J8U C;  2HIO D;  4H9R A;  5B40 C;  5B1L B;  5DNM C;  3AYW D;  5B32 B;  5B33 B;  5AVC C;  5AVB A;  3EPK A;  1M1A A;  5CP6 A;  4UPK A;  2F8N G;  5B2I C;  2PYO C;  3AZN B;  3MNN D;  3REH B;  5GT0 B;  3WKJ C;  5B0Y B;  1P3P D;  1N1J A;  5G49 B;  1P3F D;  1Q9C A;  5DNN D;  4WU8 C;  4CAY A;  2PYO B;  3X1U C;  1P3K B;  5B1M C;  1P3B D;  4WU9 B;  4J8U D;  1BH8 A;  4HGA C;  3AYW A;  3AZJ C;  4E45 A;  2JSS A;  5DNM D;  4KGC B;  5B2J B;  5AV6 B;  3X1V C;  3AZF A;  5AVC D;  1ZLA C;  1HQ3 D;  4HGA B;  3MNN A;  3MGR C;  5B2I D;  4NE6 A;  3AZH B;  5JRG C;  1P3P A;  5GXQ C;  1P3F A;  5B24 C;  3WKJ D;  5DNN A;  4AWL C;  3WTP C;  1WWI A;  1HTA A;  4E44 A;  4WU8 D;  5JRG B;  3X1U D;  5B1M D;  2YFW B;  3LZ0 A;  4AWL B;  3REL D;  5B31 C; 
#chains in the Genus database with same CATH homology
 3AZJ D;  3A1K A;  5GSU C;  3AZG C;  3X1V D;  1HQ3 A;  3REI C;  4Z5T C;  3MVD C;  3LJA A;  3MGR D;  2ARO D;  1KX5 B;  3WKJ A;  5GXQ D;  5B32 G;  3AN2 B;  4R8P B;  1ID3 C;  1AOI A;  2Y2K A;  5B24 D;  3WTP D;  3VH6 T;  3MGP C;  3AZL B;  1F66 A;  5BS7 C;  4KUD B;  4LD9 B;  4J8W B;  1U35 B;  1TZY B;  2BYK B;  4H9O B;  3REL A;  3UTB C;  3AV1 C;  3MGP B;  2J8P A;  1Z2C B;  5FUG A;  1KX4 B;  1F1E A;  3KUY B;  5GSU D;  5AY8 B;  3AZG D;  3LZ1 C;  2YFV B;  4Z5T D;  3MVD D;  3REI D;  1M18 B;  3MGR A;  2BG1 A;  3B6G C;  2ARO A;  4KHA B;  5GXQ A;  3AZI C;  1KX3 C;  1WWS A;  3W99 C;  3O62 C;  4JJN C;  3C1C B;  5B24 A;  1ID3 D;  3WA9 B;  3WTP A;  1P3L C;  2F8N K;  1S32 C;  4H9S A;  3C1B C;  3B6F C;  3W98 B;  3AZK B;  3AV1 D;  1TAF A;  4NE3 A;  3UTB D;  4J8X D;  5B0Z C;  5AV5 B;  5BNX B;  5GSU A;  3AZG A;  2ZY4 A;  5BNV A;  5CPJ C;  4NFT A;  4QLC B;  4ZUX C;  3REI A;  3MVD A;  5AV9 C;  1M1A C;  3LZ1 D;  3B6G D;  3AZI D;  1ID3 A;  3W99 D;  3O62 D;  2FJ7 B;  1B67 A;  2BYM B;  5AVB B;  5CP6 B;  1S32 D;  1M19 C;  5BS7 A;  4CSR A;  3C1B D;  3B6F D;  1H3O B;  4G91 B;  3AV1 A;  1P3A D;  3KSY A;  4J8X A;  5CPI C;  1N1J B;  2Y2P A;  2JCH A;  5B0Z D;  5E5A C;  4CAY B;  3X1S B;  4Z2M G;  5CPJ D;  2HIO B;  3AZF C;  4ZUX D;  3KXB C;  3B6G A;  5AV9 D;  1BH8 B;  3AYW B;  3AZI A;  3B0C T;  3O62 A;  3AFA A;  3LEL A;  4J8V B;  1S32 A;  2F8N D;  3C1B A;  3B6F A;  1M19 D;  3MNN B;  1P3A A;  3VH6 A;  1P3P B;  4H9N A;  1P3F B;  5BT1 C;  3UTA C;  5DNN B;  5B0Z A;  2ZY3 A;  3LZ0 C;  5CPI D;  5E5A D;  5CPJ A;  3KWQ D;  3REK C;  1P3B B;  4ZUX A;  4J8U B;  2NQB C;  5B40 B;  5AV9 A;  3AZF D;  1HQ3 C;  5AV8 D;  4M6B A;  3W97 A;  5KDM A;  3KXB D;  5DNM B;  3LJA C;  3WAA A;  3B0D C;  4YM6 A;  5AVC B;  2UWX A;  1AOI C;  2F8N A;  1HQ3 B;  2L5A A;  1M19 A;  5B2I B;  1EQZ D;  1F66 C;  4UUZ B;  3H0R C;  3WKJ B;  4Z66 D;  1JFI B;  5CPI A;  4ZBJ C;  3REL C;  3AZE A;  3VH5 T;  5BT1 D;  3LZ0 D;  3UTA D;  5E5A A;  4WU8 B;  3KWQ A;  2HUE C;  3IP4 C;  4WZS B;  5B1M B;  3X1U B;  3R45 B;  3REK D;  3REJ D;  5AV8 A;  3KXB A;  3REL B;  2NQB D;  2Y2H A;  3AL0 C;  3AZJ B;  5FUG B;  1P34 D;  2ARO C;  3LJA D;  3X1V B;  1P3G C;  1AOI D;  1ZLA B;  1EQZ A;  3VH6 W;  1P3M C;  3MGR B;  4H9S C;  1F66 D;  4XUJ C;  4Z66 A;  5B32 D;  5GXQ B;  3EPJ A;  5B24 B;  3UTA A;  4XZQ C;  3B0B A;  2CWE A;  3WTP B;  1PZR A;  5GT3 C;  3REK A;  1P3O D;  3UT9 C;  3REJ A;  3A6N A;  5GT0 D;  4WNN A;  2NQB A;  2FFF B;  5B31 B;  1TAF B;  2ZY5 A;  5BO0 A;  1P34 A;  5GSU B;  3AZG B;  1P3K D;  3REI B;  4Z5T B;  5B1L A;  3MVD B;  1P3G D;  2DF4 C;  3H0L C;  4EO5 C;  5B32 A;  1P3M D;  5B33 A;  2Y2Q A;  4KGC D;  4XUJ D;  5B2J D;  1BH9 A;  5AV6 D;  1ID3 B;  4XZQ D;  4J8X C;  1P3O A;  5GT3 D;  3NQJ B;  3REH A;  5GT0 A;  4CSR B;  3UT9 D;  5B0Y A;  3AZM C;  3WTP E;  3AV1 B;  3UTB B;  5G49 A;  5C3I C;  4J8X B;  2IO5 C;  1P3K A;  4DQY B;  3AFA C;  4H9P A;  4WU9 A;  1P3G A;  4YS3 C;  3LEL C;  3LZ1 B;  1P3M A;  3B6G B;  2CV5 C;  4KGC A;  4XUJ A;  5B2J A;  3AZI B;  5AV6 A;  1KX3 B;  3O62 B;  3W99 B;  4JJN B;  1P3A C;  4XZQ A;  2NZD C;  5GT3 A;  1P3L B;  1S32 B;  3C1B B;  3UT9 A;  3B6F B;  3W96 C;  3VH5 A;  1P3A B;  1KX5 D;  3AZM D;  4H9R B;  5B0Z B;  3W97 C;  3B0C W;  5CPJ B;  3WAA C;  4X23 C;  1T3U A;  2YFW A;  4YM6 C;  3AFA D;  4ZUX B;  4YS3 D;  3LEL D;  5AV9 B;  1M1A B;  5KDM B;  2CV5 D;  1P3I C;  2NZD D;  2F8N B;  3AZE C;  2Y2O A;  1M19 B;  3KWQ C;  2Y2L A;  1KX5 A;  3AZM A;  3W96 D;  1R4V A;  3MGS C;  1W2E A;  5CPI B;  5AV8 C;  5E5A B;  3W97 D;  3FDD A;  4LD9 A;  3WAA D;  4X23 D;  3X1T C;  4YM6 D;  4YS3 A;  3AZF B;  5CPK C;  3KXB B;  2CV5 A;  2DQN C;  1EQZ C;  3NQU A;  3TU4 C;  4WJ3 C;  5AY8 A;  4Z66 C;  1P3I D;  2NZD A;  3VH5 W;  1M18 A;  3AZE D;  1EQZ B;  3W96 A;  3C1C A;  4Z66 B;  2ZY2 A;  3REJ C;  3A6N C;  5F99 C;  3MGS D;  3WA9 A;  4G92 C;  3UTA B;  3LZ0 B;  1P34 C;  3REK B;  2XD1 A;  3V9R A;  4X23 A;  2XD5 A;  3AZK A;  3AV2 C;  4WNN B;  3X1T D;  2NQB B;  5CPK D;  5B1L C;  3A1I A;  2LY8 A;  3LJA B;  5B32 C;  3B0D B;  3X1S D;  3TU4 D;  1P3I A;  5B33 C;  4QLC A;  1AOI B;  3P5J B;  4H9Q A;  1P3O C;  1F66 B;  3AZN C;  3REH C;  3MGS A;  2FJ7 A;  5GT0 C;  2BYM A;  2RVQ D;  1BH9 B;  5B0Y C;  5F99 D;  3A6N D;  4ZBJ B;  4J8V D;  4DRB A;  3MGQ D;  1BFM A;  1P3O B;  2Y2M A;  2HUE B;  2VQR A;  1H3O A;  1P3K C;  3X1T A;  5CPK A;  5JA4 A;  3AV2 D;  4WU9 C;  2RIQ A;  1B6W A;  3X1S A;  5B1L D;  3TU4 A;  4KGC C;  2ARO B;  5B2J C;  5AV6 C;  2HIO A;  5B33 D;  4H9P B;  1P3G B;  2G5H C;  5B40 D;  1P3M B;  4XUJ B;  3AZH C;  3AZN D;  5F99 A;  3REH D;  4J8V A;  4XZQ B;  5B0Y D;  3MGQ A;  3EPL A;  5GT3 B;  3UT9 B;  2PYO D;  2JE5 A;  5BNV B;  3AV2 A;  4WU9 D;  1P3B A;  4J8U A;  5B40 A;  5DNM A;  2G5I C;  4EO5 B;  3AZN A;  3AZH D;  5AVC A;  1KX5 C;  3AN2 C;  4R8P C;  1A7W A;  1ZLA D;  5B2I A;  3AZL C;  2PYO A;  3KFU G;  4UUZ A;  5JRG D;  3AZM B;  1JFI A;  4KUD C;  4LD9 C;  4J8W C;  1U35 C;  1TZY C;  5C3I B;  1ULY A;  4WU8 A;  2IO5 B;  2F2A C;  1KX4 C;  3X1U A;  5B1M A;  2Y2J A;  3R45 A;  3KUY C;  3AFA B;  5AY8 C;  4YS3 B;  3LEL B;  5B31 D;  3AZJ A;  2CV5 B;  1M18 C;  3AZH A;  3NQU B;  3X1V A;  3C1C C;  3AN2 D;  3WA9 C;  1ZLA A;  4H9N B;  4R8P D;  2NZD B;  2Y2N A;  3AZL D;  5JRG A;  3W96 B;  4NE5 A;  3W98 C;  4KUD D;  4LD9 D;  4J8W D;  1U35 D;  1TZY D;  3AZK C;  3H0M C;  3W97 B;  5B31 G;  3MGP D;  5AV5 C;  1KX4 D;  3WAA B;  4Z2M H;  3V9R B;  4X23 B;  4YM6 B;  3KUY D;  5AY8 D;  4QLC C;  4WV4 B;  5B31 A;  2Y2G A;  1M18 D;  3AN2 A;  1P3I B;  4R8P A;  2FJ7 C;  3C1C D;  2W8S A;  3WA9 D;  4Z5T A;  5AVB C;  3AZE B;  3AZL A;  4H9Q B;  5CP6 C;  3EG5 B;  3KWQ B;  1KX3 D;  4KUD A;  4J8W A;  3MGS B;  1TZY A;  2BYK A;  1KU5 A;  4G91 C;  4H9O A;  4JJN D;  1U35 A;  3W98 D;  5AV8 B;  3AZK D;  3MGP A;  1P3L D;  1KX4 A;  3NQJ A;  3KUY A;  3X1S C;  5AV5 D;  3UTB A;  2HIO C;  3X1T B;  5CPK B;  5JA4 B;  4QLC D;  3EPH A;  2YFV A;  5CHL B;  4KHA A;  3AYW C;  2F8N H;  3TU4 B;  2RVQ C;  2FJ7 D;  4J8V C;  4DRA A;  3LZ1 A;  5AVB D;  3MGQ C;  1M1A D;  5CP6 D;  2ZM5 A;  1KX3 A;  3F6T A;  3MNN C;  3W99 A;  4JJN A;  3W98 A;  3REJ B;  3A6N B;  5F99 B;  1P3P C;  4G92 B;  1P3F C;  1P3L A;  5DNN C;  3MGQ B;  5BO0 B;  2Y2I A;  5AV5 A;  1P34 B;  5BNX A;  1P3B C;  3AV2 B;  4J8U C;  2HIO D;  4H9R A;  5B40 C;  5B1L B;  5DNM C;  3AYW D;  5B32 B;  5B33 B;  5AVC C;  5AVB A;  3EPK A;  1M1A A;  5CP6 A;  4UPK A;  2F8N G;  5B2I C;  2PYO C;  3AZN B;  3MNN D;  3REH B;  5GT0 B;  3WKJ C;  5B0Y B;  1P3P D;  1N1J A;  5G49 B;  1P3F D;  1Q9C A;  5DNN D;  4WU8 C;  4CAY A;  2PYO B;  3X1U C;  1P3K B;  5B1M C;  1P3B D;  4WU9 B;  4J8U D;  1BH8 A;  4HGA C;  3AYW A;  3AZJ C;  4E45 A;  2JSS A;  5DNM D;  4KGC B;  5B2J B;  5AV6 B;  3X1V C;  3AZF A;  5AVC D;  1ZLA C;  1HQ3 D;  4HGA B;  3MNN A;  3MGR C;  5B2I D;  4NE6 A;  3AZH B;  5JRG C;  1P3P A;  5GXQ C;  1P3F A;  5B24 C;  3WKJ D;  5DNN A;  4AWL C;  3WTP C;  1WWI A;  1HTA A;  4E44 A;  4WU8 D;  5JRG B;  3X1U D;  5B1M D;  2YFW B;  3LZ0 A;  4AWL B;  3REL D;  5B31 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...