2AROC

Crystal structure of the native histone octamer to 2.1 angstrom resolution, crystalised in the presence of s-nitrosoglutathione
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
95
structure length
95
Chain Sequence
YRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H2A-IV
publication title The oxidised histone octamer does not form a H3 disulphide bond.
pubmed doi rcsb
molecule tags Structural protein
total genus 31
structure length 95
sequence length 95
chains with identical sequence G
ec nomenclature
pdb deposition date 2005-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 2aroC00
5B40B 4AWLC 3UTAA 1P3ID 5CP6B 1H3OA 5BNXB 3AYWC 1M19C 1EQZA 5B24B 2L5AA 3TU4C 3MGPC 3AZKA 3C1BD 3NQUA 1U35B 3X1SC 1P3GC 1P3OB 1ZLAD 2AROB 3C1CD 3AFAB 1P3IA 1AOID 5AY8D 5B40D 1M1AC 1KX4C 4YS3C 5CP6D 1P3AD 1ID3B 1ZLAA 3X1VB 5GXQA 3B6GC 3C1CA 3MGQC 1AOIA 5AY8A 4XZQC 1U35D 5B40A 4HGAB 5CPIB 1S32B 3B6FB 2AROD 3AFAD 5BNXA 1P3AA 3MVDB 1HTAA 5JRGC 1ID3D 1U35A 3X1VD 1KX5C 3KXBC 2AROA 3AFAA 1F66B 5CPID 5B0ZD 4ZBJB 1S32D 3B6FD 3MGPB 3WTPB 1ID3A 4UUZB 4ZUXB 1KX4B 5CPIA 5B0ZA 5AV5B 4JJNB 1S32A 3B6FA 3LZ1B 2PYOC 1F66D 5GT3C 5B1MC 3MGPD 3WTPD 2BYKA 4ZUXD 3AV1B 4DRAA 4KHAB 1F66A 3REKC 2HUEC 5AV5D 4JJND 3MNNC 5B2IC 3LZ1D 3MGPA 1KX5B 3WTPA 5FUGB 4UUZA 3VH5A 4ZUXA 4Z66C 5AV5A 4JJNA 3AV1D 3LZ1A 4J8UC 4H9SC 3W97D 1P3MC 3X1TD 4Z5TC 3B0BA 5AVBC 5G49B 3REIB 4QLCB 3AV1A 3AZHC 3WA9D 3W96D 3WAAA 5B1MB 3AZEC 3W97A 3AZJC 4KGCB 5FUGA 5E5AA 3MGRB 3X1TA 2RVQD 3AN2C 3REKB 3WA9A 2IO5C 3W96A 3O62C 4NE6A 2NQBC 3MNNB 3UT9C 4CSRB 4QLCD 4NFTA 4XUJB 3REID 5DNNB 5BT1C 5B32G 4Z66B 4G91C 5B31C 4KGCD 3MGRD 3AZLC 3REIA 4QLCA 1P3PB 3REKD 1BH8B 5AVCB 1P3LC 4XUJD 5AV6C 5DNND 5AVBB 1JFIB 4KUDB 4KGCA 3MGRA 3VH6W 1P3BC 3KUYA 1KX3C 3REJC 4WU8A 2FJ7A 4YM6D 4G92B 4LD9C 4CSRA 1P3PD 4XUJA 1P34C 5DNNA 3AN2B 5AVCD 3O62B 2NZDB 3UT9B 3X1UD 5B0YC 4KUDD 4YM6A 2F8NB 1P3PA 5B2JC 1BH8A 3VH6T 5AVCA 4X23B 5GT0B 5B31B 3AZNC 3WKJB 3AN2D 1JFIA 5C3IC 3X1UA 1HQ3B 4J8WC 4KUDA 2HIOC 3O62D 2NZDD 3UT9D 4DRBA 2F8ND 3AN2A 4X23D 5GT0D 5B31D 3O62A 3AZFC 2NZDA 3WKJD 3B0CW 1HQ3D 1P34B 2YFVA 2F8NA 5GSUC 4X23A 3UTBD 3R45B 5GT0A 5CPKB 5B0YB 5F99C 5KDMB 3WKJA 1HQ3A 3RELB 5CPJC 3C1BA 3UTBA 5B24D 3AZNB 1TZYC 1P34D 3LJAB 3B0CT 1TAFB 4J8XC 4E45A 2HIOB 5DNMB 1P3OD 5CPKD 2BYMB 5CP6A 5B0YD 5B24A 3AZGB 3RELD 4AWLB 3AZND 3AZFB 5CPKA 1P3OA 2F8NH 3AYWB 1M19B 3LJAD 5B0YA 3TU4B 2HIOD 5DNMD 5BNVB 5GSUB 3RELA 1P3GB 3X1SB 4J8VC 2LY8A 3MVDD 3X1VA 3AZIC 3AZNA 5F99B 3AZGD 1M18C 3LJAA 1M1AB 4YS3B 2HIOA 4H9NB 5DNMA 5CPJB 2BYMA 3AYWD 1M19D 1TZYB 3MVDA 5B33C 3B6GB 3TU4D 3MGQB 3AZGA 4XZQB 5B1LC 3AZMC 5GSUD 1P3GD 3X1SD 4Z2MH 2CV5C 4WNNB 5F99D 3AYWA 1M19A 1M1AD 1KX4D 3TU4A 5JRGB 4YS3D 5CPJD 5B32C 4WU9C 5GSUA 1P3GA 3X1SA 4R8PC 1TZYD 3KXBB 3B6GD 3MGQD 4XZQD 3B0DC 3LZ0C 1M1AA 1KX4A 5AV9C 3W99C 4YS3A 4H9NA 1Q9CA 3B6GA 5JRGD 3MGQA 4XZQA 3KWQC 1KX5D 3MGSC 3KXBD 2PYOB 5AV8C 4M6BA 4WNNA 5GT3B 4KHAA 3AZMB 5B1LB 5JRGA 1KX5A 3KXBA 1A7WA 5JA4B 2HUEB 5BS7C 4EO5C 5B2IB 4WU9B 2PYOD 3REHC 2YFWB 5GT3D 1P3FC 5B1MD 4E44A 3AZMD 2JSSA 5AV9B 2PYOA 5G49A 3LELC 1P3KC 4J8UB 5GT3A 5B1MA 3MNND 4WU9D 5B2ID 3A6NC 3AZMA 1P3MB 4NE3A 4Z5TB 3AV2C 4Z66D 3AZHB 5JA4A 3REKA 3AZEB 3MNNA 5B2IA 3AZJB 4J8UD 2YFWA 4Z66A 3AZKC 2IO5B 1P3MD 2NQBB 4Z5TD 1P3IC 4EO5B 5AVBD 3AZHD 1B6WA 4J8UA 4G91B 3AZED 4H9SA 1ZLAC 3AZJD 1P3MA 4WV4B 5GXQC 4Z5TA 3C1CC 5AVBA 1AOIC 3AZLB 5AY8C 5B40C 3AZHA 2NQBD 1P3LB 1WWIA 3AZEA 1P3AC 5AV6B 3AZJA 5BT1D 3AV2B 3V9RB 1P3BB 1KX3B 1U35C 3REJB 2NQBA 2AROC 3AFAC 3UT9A 1BH9B 3AZLD 4LD9B 3VH5W 3AZKB 1P3LD 1ID3C 2F8NG 5B31A 5AV6D 1P3BD 3AZLA 2F8NK 1KX3D 5B2JB 4HGAC 5CPIC 5B0ZC 3REJD 1S32C 1P3LA 4LD9D 5GXQB 5AV6A 3C1CB 5BO0B 5C3IB 4J8WB 3NQJB 1AOIB 3V9RA 3VH5T 1P3BA 1KX3A 3REJA 1P3AB 1F66C 1BH9A 4LD9A 5B2JD 1P34A 4ZBJC 3KSYA 4Z2MG 3WTPC 3R45A 5GXQD 4ZUXC 4J8WD 1N1JB 5KDMA 5B2JA 5AV5C 4JJNC 1B67A 3LZ1C 4WZSB 5BO0A 4J8WA 1TAFA 3NQJA 3WTPE 5B0ZB 3AZFD 3VH6A 3AV1C 3WAAC 4J8XB 3W97C 3AZFA 2BYKB 5E5AC 3X1TC 1N1JA 3WA9C 3W96C 5BNVA 4H9RB 5F99A 4J8XD 2RVQC 1R4VA 4J8VB 5CPJA 3AZIB 3REIC 4QLCC 1TZYA 1M18B 4J8XA 4KGCC 3MGRC 5B33B 3KUYC 3WAAB 4WU8C 4J8VD 2FJ7C 2CV5B 3W97B 3AZID 5E5AB 4XUJC 3X1TB 4H9RA 5DNNC 1M18D 3W98C 3WA9B 3W96B 5B32B 4J8VA 4R8PB 4YM6C 5B33D 3AZIA 1F1EA 1ULYA 1P3PC 3WAAD 3LZ0B 3B0DB 5B1LD 5AVCC 1M18A 3W99B 2CV5D 5E5AD 1KU5A 2CWEA 3X1UC 4KUDC 5B33A 5B32D 5B1LA 3KWQB 4R8PD 4CAYB 3MGSB 4G92C 2CV5A 5AV8B 3LZ0D 3KUYB 5AV9D 3W99D 3UTAC 1BFMA 4WU8B 2NZDC 2FJ7B 5B32A 4WU9A 1EQZC 4R8PA 4H9PB 3W98B 3LZ0A 4X23C 3KWQD 5GT0C 5AV9A 3MGSD 3W99A 5AV8D 3REHB 4YM6B 3WKJC 3KUYD 1P3FB 1HQ3C 4WU8D 2FJ7D 3C1BC 3KWQA 3UTBC 3MGSA 4CAYA 4H9OB 5AV8A 3X1UB 3LELB 1P3KB 3W98D 4H9QB 4NE5A 3A6NB 5CP6C 3REHD 5CHLB 5B24C 1P3FD 4H9PA 3W98A 3UTAB 1P3OC 1H3OB 5CPKC 5BS7A 1EQZB 3LELD 1P3KD 3REHA 2YFVB 1P3FA 3A6ND 3RELC 3NQUB 3X1VC 1P3IB 3AV2D 4H9OA 3LJAC 5B31G 3LELA 1P3KA 3UTAD 1WWSA 4H9QA 5DNMC 3B6FC 3A6NA 3C1BB 1EQZD 3UTBB 1ZLAB 3MVDC 3AV2A 3AZGC 5AY8B 3AZKD
chains in the Genus database with same CATH superfamily
5B40B 4AWLC 3UTAA 1P3ID 5CP6B 1H3OA 5BNXB 3AYWC 1M19C 1EQZA 5B24B 2L5AA 3TU4C 3MGPC 3AZKA 3C1BD 3NQUA 1U35B 3X1SC 1P3GC 1P3OB 1ZLAD 2AROB 3C1CD 3AFAB 1P3IA 1AOID 5AY8D 5B40D 3EPKA 1M1AC 1KX4C 4YS3C 5CP6D 1P3AD 3H0RC 1ID3B 1ZLAA 3X1VB 5GXQA 3B6GC 3C1CA 3MGQC 1AOIA 5AY8A 4XZQC 1U35D 5B40A 4HGAB 5CPIB 1S32B 3B6FB 2AROD 3AFAD 5BNXA 1P3AA 2Y2QA 1Z2CB 3MVDB 1HTAA 5JRGC 1ID3D 1U35A 3X1VD 1KX5C 3P5JB 3KXBC 2AROA 3AFAA 1F66B 5CPID 5B0ZD 4ZBJB 1S32D 3B6FD 3MGPB 3WTPB 1ID3A 4UUZB 4ZUXB 1KX4B 5CPIA 5B0ZA 5AV5B 4JJNB 1S32A 3B6FA 3LZ1B 2PYOC 3KFUG 1F66D 5GT3C 5B1MC 3MGPD 3WTPD 2BYKA 4ZUXD 3AV1B 2J8PA 4DRAA 4KHAB 1F66A 3REKC 2VQRA 2HUEC 5AV5D 4JJND 3MNNC 5B2IC 3LZ1D 3MGPA 1KX5B 3WTPA 5FUGB 4UUZA 3VH5A 4ZUXA 4Z66C 5AV5A 4JJNA 3AV1D 3LZ1A 4J8UC 4H9SC 3W97D 3IP4C 1P3MC 3X1TD 4Z5TC 3B0BA 5AVBC 5G49B 3REIB 4QLCB 3AV1A 3AZHC 3WA9D 3W96D 3WAAA 5B1MB 3AZEC 3W97A 3AZJC 4KGCB 5FUGA 5E5AA 3MGRB 3X1TA 2RVQD 3AN2C 3REKB 3WA9A 2IO5C 3W96A 3O62C 4NE6A 2NQBC 3MNNB 3UT9C 4CSRB 4QLCD 4NFTA 4XUJB 3REID 5DNNB 5BT1C 5B32G 4Z66B 2Y2GA 4G91C 2ZY5A 5B31C 4KGCD 3MGRD 3AZLC 3REIA 4QLCA 1P3PB 3REKD 1BH8B 5AVCB 1P3LC 4XUJD 5AV6C 5DNND 5AVBB 1JFIB 4KUDB 4KGCA 3MGRA 2ZM5A 3VH6W 1P3BC 3KUYA 1KX3C 3REJC 4WU8A 2FJ7A 4YM6D 4G92B 4LD9C 4CSRA 1P3PD 4XUJA 1P34C 5DNNA 3AN2B 5AVCD 3O62B 2NZDB 3UT9B 3X1UD 5B0YC 4KUDD 4YM6A 2F8NB 1P3PA 5B2JC 1BH8A 3VH6T 5AVCA 4X23B 5GT0B 5B31B 3AZNC 3WKJB 3AN2D 1JFIA 5C3IC 3X1UA 1HQ3B 3EPLA 4J8WC 4KUDA 2HIOC 3O62D 2NZDD 2Y2PA 3UT9D 4DRBA 2F8ND 3EPHA 3AN2A 4X23D 5GT0D 5B31D 3O62A 3AZFC 2NZDA 3WKJD 3B0CW 1HQ3D 1P34B 2YFVA 2F8NA 5GSUC 4X23A 3UTBD 3R45B 5GT0A 5CPKB 5B0YB 5F99C 5KDMB 3WKJA 1HQ3A 2G5IC 3RELB 5CPJC 2ZY2A 3C1BA 3UTBA 5B24D 3AZNB 1TZYC 1P34D 3LJAB 3B0CT 1TAFB 4J8XC 4E45A 2HIOB 5DNMB 1P3OD 5CPKD 2BYMB 5CP6A 5B0YD 5B24A 3EG5B 3AZGB 3RELD 4AWLB 2JE5A 3AZND 3AZFB 5CPKA 1P3OA 2F8NH 3AYWB 1M19B 3LJAD 3AL0C 5B0YA 3TU4B 2HIOD 5DNMD 5BNVB 5GSUB 3RELA 1P3GB 3X1SB 4J8VC 2LY8A 3MVDD 3X1VA 3AZIC 3AZNA 2Y2OA 5F99B 3AZGD 1M18C 3LJAA 1M1AB 4YS3B 2HIOA 4H9NB 5DNMA 5CPJB 2BYMA 3AYWD 1M19D 1TZYB 3MVDA 5B33C 3B6GB 3TU4D 3MGQB 3AZGA 4XZQB 1PZRA 5B1LC 5GSUD 3AZMC 1P3GD 3X1SD 4Z2MH 2CV5C 4WNNB 5F99D 3AYWA 1M19A 1M1AD 1KX4D 3TU4A 5JRGB 4YS3D 3A1KA 5CPJD 5B32C 4WU9C 5GSUA 1P3GA 3X1SA 4R8PC 1TZYD 3KXBB 3B6GD 3MGQD 3FDDA 4XZQD 3B0DC 3LZ0C 1M1AA 1KX4A 5AV9C 3W99C 4YS3A 4H9NA 1Q9CA 3B6GA 5JRGD 3MGQA 4XZQA 3KWQC 1KX5D 3MGSC 3KXBD 2PYOB 5AV8C 4M6BA 4WNNA 5GT3B 4KHAA 3AZMB 5B1LB 5JRGA 2BG1A 1KX5A 3KXBA 1A7WA 5JA4B 2JCHA 2HUEB 5BS7C 4EO5C 5B2IB 4WU9B 2PYOD 3REHC 2YFWB 5GT3D 1P3FC 5B1MD 3H0LC 4E44A 2JSSA 3AZMD 5AV9B 2PYOA 5G49A 3LELC 1P3KC 4J8UB 5GT3A 5B1MA 3MNND 4WU9D 5B2ID 3A6NC 3AZMA 1P3MB 4NE3A 2RIQA 4Z5TB 3AV2C 4Z66D 3EPJA 3AZHB 5JA4A 3REKA 3AZEB 3MNNA 5B2IA 3AZJB 4J8UD 2YFWA 2Y2LA 3H0MC 4Z66A 3AZKC 2IO5B 1P3MD 2NQBB 4Z5TD 1P3IC 4EO5B 5AVBD 3AZHD 2Y2HA 1B6WA 4J8UA 4G91B 3AZED 4H9SA 1ZLAC 3AZJD 1P3MA 4WV4B 5GXQC 4Z5TA 3C1CC 5AVBA 2ZY4A 2Y2JA 3AZLB 1AOIC 5AY8C 5B40C 3AZHA 2NQBD 1P3LB 2UWXA 1WWIA 3AZEA 1P3AC 5AV6B 3AZJA 5BT1D 3AV2B 3V9RB 1P3BB 1KX3B 1U35C 3REJB 2DQNC 2AROC 2NQBA 3AFAC 3UT9A 1BH9B 3AZLD 4LD9B 3VH5W 2F2AC 3AZKB 1P3LD 1ID3C 2F8NG 5B31A 5AV6D 1P3BD 3AZLA 2F8NK 1KX3D 5B2JB 4HGAC 5CPIC 5B0ZC 3REJD 1S32C 1P3LA 4LD9D 5GXQB 5AV6A 3C1CB 5BO0B 5C3IB 4J8WB 3NQJB 1AOIB 3V9RA 3VH5T 1P3BA 1KX3A 3REJA 1W2EA 1P3AB 1F66C 1BH9A 4LD9A 5B2JD 1P34A 4ZBJC 3KSYA 4Z2MG 3WTPC 3R45A 5GXQD 2FFFB 4ZUXC 4J8WD 1N1JB 5KDMA 5B2JA 5AV5C 4JJNC 1B67A 3LZ1C 4WZSB 5BO0A 4J8WA 1TAFA 3NQJA 3WTPE 5B0ZB 3AZFD 3VH6A 3AV1C 3WAAC 4J8XB 3W97C 2Y2NA 2BYKB 5E5AC 3AZFA 3X1TC 1N1JA 3WA9C 3W96C 4DQYB 3A1IA 5BNVA 4H9RB 3F6TA 5F99A 4J8XD 2RVQC 1R4VA 4J8VB 2Y2MA 5CPJA 3AZIB 3REIC 4QLCC 1TZYA 1M18B 4J8XA 4KGCC 3MGRC 5B33B 3KUYC 3WAAB 2XD1A 4WU8C 4J8VD 2FJ7C 2CV5B 3W97B 3AZID 5E5AB 4XUJC 3X1TB 4H9RA 5DNNC 1M18D 2XD5A 3W98C 3WA9B 3W96B 5B32B 4J8VA 4R8PB 4YM6C 5B33D 3AZIA 1F1EA 1ULYA 1P3PC 3WAAD 3LZ0B 3B0DB 5B1LD 5AVCC 1M18A 4WJ3C 3W99B 2CV5D 5E5AD 1KU5A 2CWEA 3X1UC 4KUDC 5B33A 2Y2IA 4UPKA 5B32D 5B1LA 3KWQB 4R8PD 4CAYB 3MGSB 4G92C 2CV5A 5AV8B 3LZ0D 3KUYB 5AV9D 3W99D 3UTAC 1BFMA 4WU8B 2NZDC 2FJ7B 5B32A 4WU9A 1EQZC 4R8PA 4H9PB 3W98B 3LZ0A 4X23C 3KWQD 5GT0C 5AV9A 3MGSD 3W99A 5AV8D 3REHB 4YM6B 3WKJC 3KUYD 1P3FB 1HQ3C 2DF4C 2G5HC 4WU8D 2FJ7D 3C1BC 3KWQA 3UTBC 3MGSA 4CAYA 4H9OB 5AV8A 3X1UB 3LELB 1P3KB 2ZY3A 3W98D 4H9QB 2W8SA 4NE5A 3A6NB 5CP6C 3REHD 5CHLB 5B24C 1P3FD 4H9PA 2Y2KA 3W98A 3UTAB 1P3OC 1H3OB 5CPKC 5BS7A 1EQZB 3LELD 1P3KD 3REHA 2YFVB 1P3FA 3A6ND 3RELC 3NQUB 3X1VC 1P3IB 3AV2D 4H9OA 3LJAC 5B31G 3LELA 1P3KA 3UTAD 1T3UA 1WWSA 4H9QA 5DNMC 3B6FC 3A6NA 3C1BB 1EQZD 3UTBB 1ZLAB 3MVDC 3AV2A 3AZGC 5AY8B 3AZKD
chains in the Genus database with same CATH topology
5B40B 4AWLC 3UTAA 1P3ID 5CP6B 1H3OA 5BNXB 3AYWC 1M19C 1EQZA 5B24B 2L5AA 3TU4C 3MGPC 3AZKA 3C1BD 3NQUA 1U35B 3X1SC 1P3GC 1P3OB 1ZLAD 2AROB 3C1CD 3AFAB 1P3IA 1AOID 5AY8D 5B40D 3EPKA 1M1AC 1KX4C 4YS3C 5CP6D 1P3AD 3H0RC 1ID3B 1ZLAA 3X1VB 5GXQA 3B6GC 3C1CA 3MGQC 1AOIA 5AY8A 4XZQC 1U35D 5B40A 4HGAB 5CPIB 1S32B 3B6FB 2AROD 3AFAD 5BNXA 1P3AA 2Y2QA 1Z2CB 3MVDB 1HTAA 5JRGC 1ID3D 1U35A 3X1VD 1KX5C 3P5JB 3KXBC 2AROA 3AFAA 1F66B 5CPID 5B0ZD 4ZBJB 1S32D 3B6FD 3MGPB 3WTPB 1ID3A 4UUZB 4ZUXB 1KX4B 5CPIA 5B0ZA 5AV5B 4JJNB 1S32A 3B6FA 3LZ1B 2PYOC 3KFUG 1F66D 5GT3C 5B1MC 3MGPD 3WTPD 2BYKA 4ZUXD 3AV1B 2J8PA 4DRAA 4KHAB 1F66A 3REKC 2VQRA 2HUEC 5AV5D 4JJND 3MNNC 5B2IC 3LZ1D 3MGPA 1KX5B 3WTPA 5FUGB 4UUZA 3VH5A 4ZUXA 4Z66C 5AV5A 4JJNA 3AV1D 3LZ1A 4J8UC 4H9SC 3W97D 3IP4C 1P3MC 3X1TD 4Z5TC 3B0BA 5AVBC 5G49B 3REIB 4QLCB 3AV1A 3AZHC 3WA9D 3W96D 3WAAA 5B1MB 3AZEC 3W97A 3AZJC 4KGCB 5FUGA 5E5AA 3MGRB 3X1TA 2RVQD 3AN2C 3REKB 3WA9A 2IO5C 3W96A 3O62C 4NE6A 2NQBC 3MNNB 3UT9C 4CSRB 4QLCD 4NFTA 4XUJB 3REID 5DNNB 5BT1C 5B32G 4Z66B 2Y2GA 4G91C 2ZY5A 5B31C 4KGCD 3MGRD 3AZLC 3REIA 4QLCA 1P3PB 3REKD 1BH8B 5AVCB 1P3LC 4XUJD 5AV6C 5DNND 5AVBB 1JFIB 4KUDB 4KGCA 3MGRA 2ZM5A 3VH6W 1P3BC 3KUYA 1KX3C 3REJC 4WU8A 2FJ7A 4YM6D 4G92B 4LD9C 4CSRA 1P3PD 4XUJA 1P34C 5DNNA 3AN2B 5AVCD 3O62B 2NZDB 3UT9B 3X1UD 5B0YC 4KUDD 4YM6A 2F8NB 1P3PA 5B2JC 1BH8A 3VH6T 5AVCA 4X23B 5GT0B 5B31B 3AZNC 3WKJB 3AN2D 1JFIA 5C3IC 3X1UA 1HQ3B 3EPLA 4J8WC 4KUDA 2HIOC 3O62D 2NZDD 2Y2PA 3UT9D 4DRBA 2F8ND 3EPHA 3AN2A 4X23D 5GT0D 5B31D 3O62A 3AZFC 2NZDA 3WKJD 3B0CW 1HQ3D 1P34B 2YFVA 2F8NA 5GSUC 4X23A 3UTBD 3R45B 5GT0A 5CPKB 5B0YB 5F99C 5KDMB 3WKJA 1HQ3A 2G5IC 3RELB 5CPJC 2ZY2A 3C1BA 3UTBA 5B24D 3AZNB 1TZYC 1P34D 3LJAB 3B0CT 1TAFB 4J8XC 4E45A 2HIOB 5DNMB 1P3OD 5CPKD 2BYMB 5CP6A 5B0YD 5B24A 3EG5B 3AZGB 3RELD 4AWLB 2JE5A 3AZND 3AZFB 5CPKA 1P3OA 2F8NH 3AYWB 1M19B 3LJAD 3AL0C 5B0YA 3TU4B 2HIOD 5DNMD 5BNVB 5GSUB 3RELA 1P3GB 3X1SB 4J8VC 2LY8A 3MVDD 3X1VA 3AZIC 3AZNA 2Y2OA 5F99B 3AZGD 1M18C 3LJAA 1M1AB 4YS3B 2HIOA 4H9NB 5DNMA 5CPJB 2BYMA 3AYWD 1M19D 1TZYB 3MVDA 5B33C 3B6GB 3TU4D 3MGQB 3AZGA 4XZQB 1PZRA 5B1LC 5GSUD 3AZMC 1P3GD 3X1SD 4Z2MH 2CV5C 4WNNB 5F99D 3AYWA 1M19A 1M1AD 1KX4D 3TU4A 5JRGB 4YS3D 3A1KA 5CPJD 5B32C 4WU9C 5GSUA 1P3GA 3X1SA 4R8PC 1TZYD 3KXBB 3B6GD 3MGQD 3FDDA 4XZQD 3B0DC 3LZ0C 1M1AA 1KX4A 5AV9C 3W99C 4YS3A 4H9NA 1Q9CA 3B6GA 5JRGD 3MGQA 4XZQA 3KWQC 1KX5D 3MGSC 3KXBD 2PYOB 5AV8C 4M6BA 4WNNA 5GT3B 4KHAA 3AZMB 5B1LB 5JRGA 2BG1A 1KX5A 3KXBA 1A7WA 5JA4B 2JCHA 2HUEB 5BS7C 4EO5C 5B2IB 4WU9B 2PYOD 3REHC 2YFWB 5GT3D 1P3FC 5B1MD 3H0LC 4E44A 2JSSA 3AZMD 5AV9B 2PYOA 5G49A 3LELC 1P3KC 4J8UB 5GT3A 5B1MA 3MNND 4WU9D 5B2ID 3A6NC 3AZMA 1P3MB 4NE3A 2RIQA 4Z5TB 3AV2C 4Z66D 3EPJA 3AZHB 5JA4A 3REKA 3AZEB 3MNNA 5B2IA 3AZJB 4J8UD 2YFWA 2Y2LA 3H0MC 4Z66A 3AZKC 2IO5B 1P3MD 2NQBB 4Z5TD 1P3IC 4EO5B 5AVBD 3AZHD 2Y2HA 1B6WA 4J8UA 4G91B 3AZED 4H9SA 1ZLAC 3AZJD 1P3MA 4WV4B 5GXQC 4Z5TA 3C1CC 5AVBA 2ZY4A 2Y2JA 3AZLB 1AOIC 5AY8C 5B40C 3AZHA 2NQBD 1P3LB 2UWXA 1WWIA 3AZEA 1P3AC 5AV6B 3AZJA 5BT1D 3AV2B 3V9RB 1P3BB 1KX3B 1U35C 3REJB 2DQNC 2AROC 2NQBA 3AFAC 3UT9A 1BH9B 3AZLD 4LD9B 3VH5W 2F2AC 3AZKB 1P3LD 1ID3C 2F8NG 5B31A 5AV6D 1P3BD 3AZLA 2F8NK 1KX3D 5B2JB 4HGAC 5CPIC 5B0ZC 3REJD 1S32C 1P3LA 4LD9D 5GXQB 5AV6A 3C1CB 5BO0B 5C3IB 4J8WB 3NQJB 1AOIB 3V9RA 3VH5T 1P3BA 1KX3A 3REJA 1W2EA 1P3AB 1F66C 1BH9A 4LD9A 5B2JD 1P34A 4ZBJC 3KSYA 4Z2MG 3WTPC 3R45A 5GXQD 2FFFB 4ZUXC 4J8WD 1N1JB 5KDMA 5B2JA 5AV5C 4JJNC 1B67A 3LZ1C 4WZSB 5BO0A 4J8WA 1TAFA 3NQJA 3WTPE 5B0ZB 3AZFD 3VH6A 3AV1C 3WAAC 4J8XB 3W97C 2Y2NA 2BYKB 5E5AC 3AZFA 3X1TC 1N1JA 3WA9C 3W96C 4DQYB 3A1IA 5BNVA 4H9RB 3F6TA 5F99A 4J8XD 2RVQC 1R4VA 4J8VB 2Y2MA 5CPJA 3AZIB 3REIC 4QLCC 1TZYA 1M18B 4J8XA 4KGCC 3MGRC 5B33B 3KUYC 3WAAB 2XD1A 4WU8C 4J8VD 2FJ7C 2CV5B 3W97B 3AZID 5E5AB 4XUJC 3X1TB 4H9RA 5DNNC 1M18D 2XD5A 3W98C 3WA9B 3W96B 5B32B 4J8VA 4R8PB 4YM6C 5B33D 3AZIA 1F1EA 1ULYA 1P3PC 3WAAD 3LZ0B 3B0DB 5B1LD 5AVCC 1M18A 4WJ3C 3W99B 2CV5D 5E5AD 1KU5A 2CWEA 3X1UC 4KUDC 5B33A 2Y2IA 4UPKA 5B32D 5B1LA 3KWQB 4R8PD 4CAYB 3MGSB 4G92C 2CV5A 5AV8B 3LZ0D 3KUYB 5AV9D 3W99D 3UTAC 1BFMA 4WU8B 2NZDC 2FJ7B 5B32A 4WU9A 1EQZC 4R8PA 4H9PB 3W98B 3LZ0A 4X23C 3KWQD 5GT0C 5AV9A 3MGSD 3W99A 5AV8D 3REHB 4YM6B 3WKJC 3KUYD 1P3FB 1HQ3C 2DF4C 2G5HC 4WU8D 2FJ7D 3C1BC 3KWQA 3UTBC 3MGSA 4CAYA 4H9OB 5AV8A 3X1UB 3LELB 1P3KB 2ZY3A 3W98D 4H9QB 2W8SA 4NE5A 3A6NB 5CP6C 3REHD 5CHLB 5B24C 1P3FD 4H9PA 2Y2KA 3W98A 3UTAB 1P3OC 1H3OB 5CPKC 5BS7A 1EQZB 3LELD 1P3KD 3REHA 2YFVB 1P3FA 3A6ND 3RELC 3NQUB 3X1VC 1P3IB 3AV2D 4H9OA 3LJAC 5B31G 3LELA 1P3KA 3UTAD 1T3UA 1WWSA 4H9QA 5DNMC 3B6FC 3A6NA 3C1BB 1EQZD 3UTBB 1ZLAB 3MVDC 3AV2A 3AZGC 5AY8B 3AZKD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5B40 B;  4AWL C;  3UTA A;  1P3I D;  5CP6 B;  1H3O A;  5BNX B;  3AYW C;  1M19 C;  1EQZ A;  5B24 B;  2L5A A;  3TU4 C;  3MGP C;  3AZK A;  3C1B D;  3NQU A;  1U35 B;  3X1S C;  1P3G C;  1P3O B;  1ZLA D;  2ARO B;  3C1C D;  3AFA B;  1P3I A;  1AOI D;  5AY8 D;  5B40 D;  1M1A C;  1KX4 C;  4YS3 C;  5CP6 D;  1P3A D;  1ID3 B;  1ZLA A;  3X1V B;  5GXQ A;  3B6G C;  3C1C A;  3MGQ C;  1AOI A;  5AY8 A;  4XZQ C;  1U35 D;  5B40 A;  4HGA B;  5CPI B;  1S32 B;  3B6F B;  2ARO D;  3AFA D;  5BNX A;  1P3A A;  3MVD B;  1HTA A;  5JRG C;  1ID3 D;  1U35 A;  3X1V D;  1KX5 C;  3KXB C;  2ARO A;  3AFA A;  1F66 B;  5CPI D;  5B0Z D;  4ZBJ B;  1S32 D;  3B6F D;  3MGP B;  3WTP B;  1ID3 A;  4UUZ B;  4ZUX B;  1KX4 B;  5CPI A;  5B0Z A;  5AV5 B;  4JJN B;  1S32 A;  3B6F A;  3LZ1 B;  2PYO C;  1F66 D;  5GT3 C;  5B1M C;  3MGP D;  3WTP D;  2BYK A;  4ZUX D;  3AV1 B;  4DRA A;  4KHA B;  1F66 A;  3REK C;  2HUE C;  5AV5 D;  4JJN D;  3MNN C;  5B2I C;  3LZ1 D;  3MGP A;  1KX5 B;  3WTP A;  5FUG B;  4UUZ A;  3VH5 A;  4ZUX A;  4Z66 C;  5AV5 A;  4JJN A;  3AV1 D;  3LZ1 A;  4J8U C;  4H9S C;  3W97 D;  1P3M C;  3X1T D;  4Z5T C;  3B0B A;  5AVB C;  5G49 B;  3REI B;  4QLC B;  3AV1 A;  3AZH C;  3WA9 D;  3W96 D;  3WAA A;  5B1M B;  3AZE C;  3W97 A;  3AZJ C;  4KGC B;  5FUG A;  5E5A A;  3MGR B;  3X1T A;  2RVQ D;  3AN2 C;  3REK B;  3WA9 A;  2IO5 C;  3W96 A;  3O62 C;  4NE6 A;  2NQB C;  3MNN B;  3UT9 C;  4CSR B;  4QLC D;  4NFT A;  4XUJ B;  3REI D;  5DNN B;  5BT1 C;  5B32 G;  4Z66 B;  4G91 C;  5B31 C;  4KGC D;  3MGR D;  3AZL C;  3REI A;  4QLC A;  1P3P B;  3REK D;  1BH8 B;  5AVC B;  1P3L C;  4XUJ D;  5AV6 C;  5DNN D;  5AVB B;  1JFI B;  4KUD B;  4KGC A;  3MGR A;  3VH6 W;  1P3B C;  3KUY A;  1KX3 C;  3REJ C;  4WU8 A;  2FJ7 A;  4YM6 D;  4G92 B;  4LD9 C;  4CSR A;  1P3P D;  4XUJ A;  1P34 C;  5DNN A;  3AN2 B;  5AVC D;  3O62 B;  2NZD B;  3UT9 B;  3X1U D;  5B0Y C;  4KUD D;  4YM6 A;  2F8N B;  1P3P A;  5B2J C;  1BH8 A;  3VH6 T;  5AVC A;  4X23 B;  5GT0 B;  5B31 B;  3AZN C;  3WKJ B;  3AN2 D;  1JFI A;  5C3I C;  3X1U A;  1HQ3 B;  4J8W C;  4KUD A;  2HIO C;  3O62 D;  2NZD D;  3UT9 D;  4DRB A;  2F8N D;  3AN2 A;  4X23 D;  5GT0 D;  5B31 D;  3O62 A;  3AZF C;  2NZD A;  3WKJ D;  3B0C W;  1HQ3 D;  1P34 B;  2YFV A;  2F8N A;  5GSU C;  4X23 A;  3UTB D;  3R45 B;  5GT0 A;  5CPK B;  5B0Y B;  5F99 C;  5KDM B;  3WKJ A;  1HQ3 A;  3REL B;  5CPJ C;  3C1B A;  3UTB A;  5B24 D;  3AZN B;  1TZY C;  1P34 D;  3LJA B;  3B0C T;  1TAF B;  4J8X C;  4E45 A;  2HIO B;  5DNM B;  1P3O D;  5CPK D;  2BYM B;  5CP6 A;  5B0Y D;  5B24 A;  3AZG B;  3REL D;  4AWL B;  3AZN D;  3AZF B;  5CPK A;  1P3O A;  2F8N H;  3AYW B;  1M19 B;  3LJA D;  5B0Y A;  3TU4 B;  2HIO D;  5DNM D;  5BNV B;  5GSU B;  3REL A;  1P3G B;  3X1S B;  4J8V C;  2LY8 A;  3MVD D;  3X1V A;  3AZI C;  3AZN A;  5F99 B;  3AZG D;  1M18 C;  3LJA A;  1M1A B;  4YS3 B;  2HIO A;  4H9N B;  5DNM A;  5CPJ B;  2BYM A;  3AYW D;  1M19 D;  1TZY B;  3MVD A;  5B33 C;  3B6G B;  3TU4 D;  3MGQ B;  3AZG A;  4XZQ B;  5B1L C;  3AZM C;  5GSU D;  1P3G D;  3X1S D;  4Z2M H;  2CV5 C;  4WNN B;  5F99 D;  3AYW A;  1M19 A;  1M1A D;  1KX4 D;  3TU4 A;  5JRG B;  4YS3 D;  5CPJ D;  5B32 C;  4WU9 C;  5GSU A;  1P3G A;  3X1S A;  4R8P C;  1TZY D;  3KXB B;  3B6G D;  3MGQ D;  4XZQ D;  3B0D C;  3LZ0 C;  1M1A A;  1KX4 A;  5AV9 C;  3W99 C;  4YS3 A;  4H9N A;  1Q9C A;  3B6G A;  5JRG D;  3MGQ A;  4XZQ A;  3KWQ C;  1KX5 D;  3MGS C;  3KXB D;  2PYO B;  5AV8 C;  4M6B A;  4WNN A;  5GT3 B;  4KHA A;  3AZM B;  5B1L B;  5JRG A;  1KX5 A;  3KXB A;  1A7W A;  5JA4 B;  2HUE B;  5BS7 C;  4EO5 C;  5B2I B;  4WU9 B;  2PYO D;  3REH C;  2YFW B;  5GT3 D;  1P3F C;  5B1M D;  4E44 A;  3AZM D;  2JSS A;  5AV9 B;  2PYO A;  5G49 A;  3LEL C;  1P3K C;  4J8U B;  5GT3 A;  5B1M A;  3MNN D;  4WU9 D;  5B2I D;  3A6N C;  3AZM A;  1P3M B;  4NE3 A;  4Z5T B;  3AV2 C;  4Z66 D;  3AZH B;  5JA4 A;  3REK A;  3AZE B;  3MNN A;  5B2I A;  3AZJ B;  4J8U D;  2YFW A;  4Z66 A;  3AZK C;  2IO5 B;  1P3M D;  2NQB B;  4Z5T D;  1P3I C;  4EO5 B;  5AVB D;  3AZH D;  1B6W A;  4J8U A;  4G91 B;  3AZE D;  4H9S A;  1ZLA C;  3AZJ D;  1P3M A;  4WV4 B;  5GXQ C;  4Z5T A;  3C1C C;  5AVB A;  1AOI C;  3AZL B;  5AY8 C;  5B40 C;  3AZH A;  2NQB D;  1P3L B;  1WWI A;  3AZE A;  1P3A C;  5AV6 B;  3AZJ A;  5BT1 D;  3AV2 B;  3V9R B;  1P3B B;  1KX3 B;  1U35 C;  3REJ B;  2NQB A;  2ARO C;  3AFA C;  3UT9 A;  1BH9 B;  3AZL D;  4LD9 B;  3VH5 W;  3AZK B;  1P3L D;  1ID3 C;  2F8N G;  5B31 A;  5AV6 D;  1P3B D;  3AZL A;  2F8N K;  1KX3 D;  5B2J B;  4HGA C;  5CPI C;  5B0Z C;  3REJ D;  1S32 C;  1P3L A;  4LD9 D;  5GXQ B;  5AV6 A;  3C1C B;  5BO0 B;  5C3I B;  4J8W B;  3NQJ B;  1AOI B;  3V9R A;  3VH5 T;  1P3B A;  1KX3 A;  3REJ A;  1P3A B;  1F66 C;  1BH9 A;  4LD9 A;  5B2J D;  1P34 A;  4ZBJ C;  3KSY A;  4Z2M G;  3WTP C;  3R45 A;  5GXQ D;  4ZUX C;  4J8W D;  1N1J B;  5KDM A;  5B2J A;  5AV5 C;  4JJN C;  1B67 A;  3LZ1 C;  4WZS B;  5BO0 A;  4J8W A;  1TAF A;  3NQJ A;  3WTP E;  5B0Z B;  3AZF D;  3VH6 A;  3AV1 C;  3WAA C;  4J8X B;  3W97 C;  3AZF A;  2BYK B;  5E5A C;  3X1T C;  1N1J A;  3WA9 C;  3W96 C;  5BNV A;  4H9R B;  5F99 A;  4J8X D;  2RVQ C;  1R4V A;  4J8V B;  5CPJ A;  3AZI B;  3REI C;  4QLC C;  1TZY A;  1M18 B;  4J8X A;  4KGC C;  3MGR C;  5B33 B;  3KUY C;  3WAA B;  4WU8 C;  4J8V D;  2FJ7 C;  2CV5 B;  3W97 B;  3AZI D;  5E5A B;  4XUJ C;  3X1T B;  4H9R A;  5DNN C;  1M18 D;  3W98 C;  3WA9 B;  3W96 B;  5B32 B;  4J8V A;  4R8P B;  4YM6 C;  5B33 D;  3AZI A;  1F1E A;  1ULY A;  1P3P C;  3WAA D;  3LZ0 B;  3B0D B;  5B1L D;  5AVC C;  1M18 A;  3W99 B;  2CV5 D;  5E5A D;  1KU5 A;  2CWE A;  3X1U C;  4KUD C;  5B33 A;  5B32 D;  5B1L A;  3KWQ B;  4R8P D;  4CAY B;  3MGS B;  4G92 C;  2CV5 A;  5AV8 B;  3LZ0 D;  3KUY B;  5AV9 D;  3W99 D;  3UTA C;  1BFM A;  4WU8 B;  2NZD C;  2FJ7 B;  5B32 A;  4WU9 A;  1EQZ C;  4R8P A;  4H9P B;  3W98 B;  3LZ0 A;  4X23 C;  3KWQ D;  5GT0 C;  5AV9 A;  3MGS D;  3W99 A;  5AV8 D;  3REH B;  4YM6 B;  3WKJ C;  3KUY D;  1P3F B;  1HQ3 C;  4WU8 D;  2FJ7 D;  3C1B C;  3KWQ A;  3UTB C;  3MGS A;  4CAY A;  4H9O B;  5AV8 A;  3X1U B;  3LEL B;  1P3K B;  3W98 D;  4H9Q B;  4NE5 A;  3A6N B;  5CP6 C;  3REH D;  5CHL B;  5B24 C;  1P3F D;  4H9P A;  3W98 A;  3UTA B;  1P3O C;  1H3O B;  5CPK C;  5BS7 A;  1EQZ B;  3LEL D;  1P3K D;  3REH A;  2YFV B;  1P3F A;  3A6N D;  3REL C;  3NQU B;  3X1V C;  1P3I B;  3AV2 D;  4H9O A;  3LJA C;  5B31 G;  3LEL A;  1P3K A;  3UTA D;  1WWS A;  4H9Q A;  5DNM C;  3B6F C;  3A6N A;  3C1B B;  1EQZ D;  3UTB B;  1ZLA B;  3MVD C;  3AV2 A;  3AZG C;  5AY8 B;  3AZK D; 
#chains in the Genus database with same CATH topology
 5B40 B;  4AWL C;  3UTA A;  1P3I D;  5CP6 B;  1H3O A;  5BNX B;  3AYW C;  1M19 C;  1EQZ A;  5B24 B;  2L5A A;  3TU4 C;  3MGP C;  3AZK A;  3C1B D;  3NQU A;  1U35 B;  3X1S C;  1P3G C;  1P3O B;  1ZLA D;  2ARO B;  3C1C D;  3AFA B;  1P3I A;  1AOI D;  5AY8 D;  5B40 D;  3EPK A;  1M1A C;  1KX4 C;  4YS3 C;  5CP6 D;  1P3A D;  3H0R C;  1ID3 B;  1ZLA A;  3X1V B;  5GXQ A;  3B6G C;  3C1C A;  3MGQ C;  1AOI A;  5AY8 A;  4XZQ C;  1U35 D;  5B40 A;  4HGA B;  5CPI B;  1S32 B;  3B6F B;  2ARO D;  3AFA D;  5BNX A;  1P3A A;  2Y2Q A;  1Z2C B;  3MVD B;  1HTA A;  5JRG C;  1ID3 D;  1U35 A;  3X1V D;  1KX5 C;  3P5J B;  3KXB C;  2ARO A;  3AFA A;  1F66 B;  5CPI D;  5B0Z D;  4ZBJ B;  1S32 D;  3B6F D;  3MGP B;  3WTP B;  1ID3 A;  4UUZ B;  4ZUX B;  1KX4 B;  5CPI A;  5B0Z A;  5AV5 B;  4JJN B;  1S32 A;  3B6F A;  3LZ1 B;  2PYO C;  3KFU G;  1F66 D;  5GT3 C;  5B1M C;  3MGP D;  3WTP D;  2BYK A;  4ZUX D;  3AV1 B;  2J8P A;  4DRA A;  4KHA B;  1F66 A;  3REK C;  2VQR A;  2HUE C;  5AV5 D;  4JJN D;  3MNN C;  5B2I C;  3LZ1 D;  3MGP A;  1KX5 B;  3WTP A;  5FUG B;  4UUZ A;  3VH5 A;  4ZUX A;  4Z66 C;  5AV5 A;  4JJN A;  3AV1 D;  3LZ1 A;  4J8U C;  4H9S C;  3W97 D;  3IP4 C;  1P3M C;  3X1T D;  4Z5T C;  3B0B A;  5AVB C;  5G49 B;  3REI B;  4QLC B;  3AV1 A;  3AZH C;  3WA9 D;  3W96 D;  3WAA A;  5B1M B;  3AZE C;  3W97 A;  3AZJ C;  4KGC B;  5FUG A;  5E5A A;  3MGR B;  3X1T A;  2RVQ D;  3AN2 C;  3REK B;  3WA9 A;  2IO5 C;  3W96 A;  3O62 C;  4NE6 A;  2NQB C;  3MNN B;  3UT9 C;  4CSR B;  4QLC D;  4NFT A;  4XUJ B;  3REI D;  5DNN B;  5BT1 C;  5B32 G;  4Z66 B;  2Y2G A;  4G91 C;  2ZY5 A;  5B31 C;  4KGC D;  3MGR D;  3AZL C;  3REI A;  4QLC A;  1P3P B;  3REK D;  1BH8 B;  5AVC B;  1P3L C;  4XUJ D;  5AV6 C;  5DNN D;  5AVB B;  1JFI B;  4KUD B;  4KGC A;  3MGR A;  2ZM5 A;  3VH6 W;  1P3B C;  3KUY A;  1KX3 C;  3REJ C;  4WU8 A;  2FJ7 A;  4YM6 D;  4G92 B;  4LD9 C;  4CSR A;  1P3P D;  4XUJ A;  1P34 C;  5DNN A;  3AN2 B;  5AVC D;  3O62 B;  2NZD B;  3UT9 B;  3X1U D;  5B0Y C;  4KUD D;  4YM6 A;  2F8N B;  1P3P A;  5B2J C;  1BH8 A;  3VH6 T;  5AVC A;  4X23 B;  5GT0 B;  5B31 B;  3AZN C;  3WKJ B;  3AN2 D;  1JFI A;  5C3I C;  3X1U A;  1HQ3 B;  3EPL A;  4J8W C;  4KUD A;  2HIO C;  3O62 D;  2NZD D;  2Y2P A;  3UT9 D;  4DRB A;  2F8N D;  3EPH A;  3AN2 A;  4X23 D;  5GT0 D;  5B31 D;  3O62 A;  3AZF C;  2NZD A;  3WKJ D;  3B0C W;  1HQ3 D;  1P34 B;  2YFV A;  2F8N A;  5GSU C;  4X23 A;  3UTB D;  3R45 B;  5GT0 A;  5CPK B;  5B0Y B;  5F99 C;  5KDM B;  3WKJ A;  1HQ3 A;  2G5I C;  3REL B;  5CPJ C;  2ZY2 A;  3C1B A;  3UTB A;  5B24 D;  3AZN B;  1TZY C;  1P34 D;  3LJA B;  3B0C T;  1TAF B;  4J8X C;  4E45 A;  2HIO B;  5DNM B;  1P3O D;  5CPK D;  2BYM B;  5CP6 A;  5B0Y D;  5B24 A;  3EG5 B;  3AZG B;  3REL D;  4AWL B;  2JE5 A;  3AZN D;  3AZF B;  5CPK A;  1P3O A;  2F8N H;  3AYW B;  1M19 B;  3LJA D;  3AL0 C;  5B0Y A;  3TU4 B;  2HIO D;  5DNM D;  5BNV B;  5GSU B;  3REL A;  1P3G B;  3X1S B;  4J8V C;  2LY8 A;  3MVD D;  3X1V A;  3AZI C;  3AZN A;  2Y2O A;  5F99 B;  3AZG D;  1M18 C;  3LJA A;  1M1A B;  4YS3 B;  2HIO A;  4H9N B;  5DNM A;  5CPJ B;  2BYM A;  3AYW D;  1M19 D;  1TZY B;  3MVD A;  5B33 C;  3B6G B;  3TU4 D;  3MGQ B;  3AZG A;  4XZQ B;  1PZR A;  5B1L C;  5GSU D;  3AZM C;  1P3G D;  3X1S D;  4Z2M H;  2CV5 C;  4WNN B;  5F99 D;  3AYW A;  1M19 A;  1M1A D;  1KX4 D;  3TU4 A;  5JRG B;  4YS3 D;  3A1K A;  5CPJ D;  5B32 C;  4WU9 C;  5GSU A;  1P3G A;  3X1S A;  4R8P C;  1TZY D;  3KXB B;  3B6G D;  3MGQ D;  3FDD A;  4XZQ D;  3B0D C;  3LZ0 C;  1M1A A;  1KX4 A;  5AV9 C;  3W99 C;  4YS3 A;  4H9N A;  1Q9C A;  3B6G A;  5JRG D;  3MGQ A;  4XZQ A;  3KWQ C;  1KX5 D;  3MGS C;  3KXB D;  2PYO B;  5AV8 C;  4M6B A;  4WNN A;  5GT3 B;  4KHA A;  3AZM B;  5B1L B;  5JRG A;  2BG1 A;  1KX5 A;  3KXB A;  1A7W A;  5JA4 B;  2JCH A;  2HUE B;  5BS7 C;  4EO5 C;  5B2I B;  4WU9 B;  2PYO D;  3REH C;  2YFW B;  5GT3 D;  1P3F C;  5B1M D;  3H0L C;  4E44 A;  2JSS A;  3AZM D;  5AV9 B;  2PYO A;  5G49 A;  3LEL C;  1P3K C;  4J8U B;  5GT3 A;  5B1M A;  3MNN D;  4WU9 D;  5B2I D;  3A6N C;  3AZM A;  1P3M B;  4NE3 A;  2RIQ A;  4Z5T B;  3AV2 C;  4Z66 D;  3EPJ A;  3AZH B;  5JA4 A;  3REK A;  3AZE B;  3MNN A;  5B2I A;  3AZJ B;  4J8U D;  2YFW A;  2Y2L A;  3H0M C;  4Z66 A;  3AZK C;  2IO5 B;  1P3M D;  2NQB B;  4Z5T D;  1P3I C;  4EO5 B;  5AVB D;  3AZH D;  2Y2H A;  1B6W A;  4J8U A;  4G91 B;  3AZE D;  4H9S A;  1ZLA C;  3AZJ D;  1P3M A;  4WV4 B;  5GXQ C;  4Z5T A;  3C1C C;  5AVB A;  2ZY4 A;  2Y2J A;  3AZL B;  1AOI C;  5AY8 C;  5B40 C;  3AZH A;  2NQB D;  1P3L B;  2UWX A;  1WWI A;  3AZE A;  1P3A C;  5AV6 B;  3AZJ A;  5BT1 D;  3AV2 B;  3V9R B;  1P3B B;  1KX3 B;  1U35 C;  3REJ B;  2DQN C;  2ARO C;  2NQB A;  3AFA C;  3UT9 A;  1BH9 B;  3AZL D;  4LD9 B;  3VH5 W;  2F2A C;  3AZK B;  1P3L D;  1ID3 C;  2F8N G;  5B31 A;  5AV6 D;  1P3B D;  3AZL A;  2F8N K;  1KX3 D;  5B2J B;  4HGA C;  5CPI C;  5B0Z C;  3REJ D;  1S32 C;  1P3L A;  4LD9 D;  5GXQ B;  5AV6 A;  3C1C B;  5BO0 B;  5C3I B;  4J8W B;  3NQJ B;  1AOI B;  3V9R A;  3VH5 T;  1P3B A;  1KX3 A;  3REJ A;  1W2E A;  1P3A B;  1F66 C;  1BH9 A;  4LD9 A;  5B2J D;  1P34 A;  4ZBJ C;  3KSY A;  4Z2M G;  3WTP C;  3R45 A;  5GXQ D;  2FFF B;  4ZUX C;  4J8W D;  1N1J B;  5KDM A;  5B2J A;  5AV5 C;  4JJN C;  1B67 A;  3LZ1 C;  4WZS B;  5BO0 A;  4J8W A;  1TAF A;  3NQJ A;  3WTP E;  5B0Z B;  3AZF D;  3VH6 A;  3AV1 C;  3WAA C;  4J8X B;  3W97 C;  2Y2N A;  2BYK B;  5E5A C;  3AZF A;  3X1T C;  1N1J A;  3WA9 C;  3W96 C;  4DQY B;  3A1I A;  5BNV A;  4H9R B;  3F6T A;  5F99 A;  4J8X D;  2RVQ C;  1R4V A;  4J8V B;  2Y2M A;  5CPJ A;  3AZI B;  3REI C;  4QLC C;  1TZY A;  1M18 B;  4J8X A;  4KGC C;  3MGR C;  5B33 B;  3KUY C;  3WAA B;  2XD1 A;  4WU8 C;  4J8V D;  2FJ7 C;  2CV5 B;  3W97 B;  3AZI D;  5E5A B;  4XUJ C;  3X1T B;  4H9R A;  5DNN C;  1M18 D;  2XD5 A;  3W98 C;  3WA9 B;  3W96 B;  5B32 B;  4J8V A;  4R8P B;  4YM6 C;  5B33 D;  3AZI A;  1F1E A;  1ULY A;  1P3P C;  3WAA D;  3LZ0 B;  3B0D B;  5B1L D;  5AVC C;  1M18 A;  4WJ3 C;  3W99 B;  2CV5 D;  5E5A D;  1KU5 A;  2CWE A;  3X1U C;  4KUD C;  5B33 A;  2Y2I A;  4UPK A;  5B32 D;  5B1L A;  3KWQ B;  4R8P D;  4CAY B;  3MGS B;  4G92 C;  2CV5 A;  5AV8 B;  3LZ0 D;  3KUY B;  5AV9 D;  3W99 D;  3UTA C;  1BFM A;  4WU8 B;  2NZD C;  2FJ7 B;  5B32 A;  4WU9 A;  1EQZ C;  4R8P A;  4H9P B;  3W98 B;  3LZ0 A;  4X23 C;  3KWQ D;  5GT0 C;  5AV9 A;  3MGS D;  3W99 A;  5AV8 D;  3REH B;  4YM6 B;  3WKJ C;  3KUY D;  1P3F B;  1HQ3 C;  2DF4 C;  2G5H C;  4WU8 D;  2FJ7 D;  3C1B C;  3KWQ A;  3UTB C;  3MGS A;  4CAY A;  4H9O B;  5AV8 A;  3X1U B;  3LEL B;  1P3K B;  2ZY3 A;  3W98 D;  4H9Q B;  2W8S A;  4NE5 A;  3A6N B;  5CP6 C;  3REH D;  5CHL B;  5B24 C;  1P3F D;  4H9P A;  2Y2K A;  3W98 A;  3UTA B;  1P3O C;  1H3O B;  5CPK C;  5BS7 A;  1EQZ B;  3LEL D;  1P3K D;  3REH A;  2YFV B;  1P3F A;  3A6N D;  3REL C;  3NQU B;  3X1V C;  1P3I B;  3AV2 D;  4H9O A;  3LJA C;  5B31 G;  3LEL A;  1P3K A;  3UTA D;  1T3U A;  1WWS A;  4H9Q A;  5DNM C;  3B6F C;  3A6N A;  3C1B B;  1EQZ D;  3UTB B;  1ZLA B;  3MVD C;  3AV2 A;  3AZG C;  5AY8 B;  3AZK D; 
#chains in the Genus database with same CATH homology
 5B40 B;  4AWL C;  3UTA A;  1P3I D;  5CP6 B;  1H3O A;  5BNX B;  3AYW C;  1M19 C;  1EQZ A;  5B24 B;  2L5A A;  3TU4 C;  3MGP C;  3AZK A;  3C1B D;  3NQU A;  1U35 B;  3X1S C;  1P3G C;  1P3O B;  1ZLA D;  2ARO B;  3C1C D;  3AFA B;  1P3I A;  1AOI D;  5AY8 D;  5B40 D;  3EPK A;  1M1A C;  1KX4 C;  4YS3 C;  5CP6 D;  1P3A D;  3H0R C;  1ID3 B;  1ZLA A;  3X1V B;  5GXQ A;  3B6G C;  3C1C A;  3MGQ C;  1AOI A;  5AY8 A;  4XZQ C;  1U35 D;  5B40 A;  4HGA B;  5CPI B;  1S32 B;  3B6F B;  2ARO D;  3AFA D;  5BNX A;  1P3A A;  2Y2Q A;  1Z2C B;  3MVD B;  1HTA A;  5JRG C;  1ID3 D;  1U35 A;  3X1V D;  1KX5 C;  3P5J B;  3KXB C;  2ARO A;  3AFA A;  1F66 B;  5CPI D;  5B0Z D;  4ZBJ B;  1S32 D;  3B6F D;  3MGP B;  3WTP B;  1ID3 A;  4UUZ B;  4ZUX B;  1KX4 B;  5CPI A;  5B0Z A;  5AV5 B;  4JJN B;  1S32 A;  3B6F A;  3LZ1 B;  2PYO C;  3KFU G;  1F66 D;  5GT3 C;  5B1M C;  3MGP D;  3WTP D;  2BYK A;  4ZUX D;  3AV1 B;  2J8P A;  4DRA A;  4KHA B;  1F66 A;  3REK C;  2VQR A;  2HUE C;  5AV5 D;  4JJN D;  3MNN C;  5B2I C;  3LZ1 D;  3MGP A;  1KX5 B;  3WTP A;  5FUG B;  4UUZ A;  3VH5 A;  4ZUX A;  4Z66 C;  5AV5 A;  4JJN A;  3AV1 D;  3LZ1 A;  4J8U C;  4H9S C;  3W97 D;  3IP4 C;  1P3M C;  3X1T D;  4Z5T C;  3B0B A;  5AVB C;  5G49 B;  3REI B;  4QLC B;  3AV1 A;  3AZH C;  3WA9 D;  3W96 D;  3WAA A;  5B1M B;  3AZE C;  3W97 A;  3AZJ C;  4KGC B;  5FUG A;  5E5A A;  3MGR B;  3X1T A;  2RVQ D;  3AN2 C;  3REK B;  3WA9 A;  2IO5 C;  3W96 A;  3O62 C;  4NE6 A;  2NQB C;  3MNN B;  3UT9 C;  4CSR B;  4QLC D;  4NFT A;  4XUJ B;  3REI D;  5DNN B;  5BT1 C;  5B32 G;  4Z66 B;  2Y2G A;  4G91 C;  2ZY5 A;  5B31 C;  4KGC D;  3MGR D;  3AZL C;  3REI A;  4QLC A;  1P3P B;  3REK D;  1BH8 B;  5AVC B;  1P3L C;  4XUJ D;  5AV6 C;  5DNN D;  5AVB B;  1JFI B;  4KUD B;  4KGC A;  3MGR A;  2ZM5 A;  3VH6 W;  1P3B C;  3KUY A;  1KX3 C;  3REJ C;  4WU8 A;  2FJ7 A;  4YM6 D;  4G92 B;  4LD9 C;  4CSR A;  1P3P D;  4XUJ A;  1P34 C;  5DNN A;  3AN2 B;  5AVC D;  3O62 B;  2NZD B;  3UT9 B;  3X1U D;  5B0Y C;  4KUD D;  4YM6 A;  2F8N B;  1P3P A;  5B2J C;  1BH8 A;  3VH6 T;  5AVC A;  4X23 B;  5GT0 B;  5B31 B;  3AZN C;  3WKJ B;  3AN2 D;  1JFI A;  5C3I C;  3X1U A;  1HQ3 B;  3EPL A;  4J8W C;  4KUD A;  2HIO C;  3O62 D;  2NZD D;  2Y2P A;  3UT9 D;  4DRB A;  2F8N D;  3EPH A;  3AN2 A;  4X23 D;  5GT0 D;  5B31 D;  3O62 A;  3AZF C;  2NZD A;  3WKJ D;  3B0C W;  1HQ3 D;  1P34 B;  2YFV A;  2F8N A;  5GSU C;  4X23 A;  3UTB D;  3R45 B;  5GT0 A;  5CPK B;  5B0Y B;  5F99 C;  5KDM B;  3WKJ A;  1HQ3 A;  2G5I C;  3REL B;  5CPJ C;  2ZY2 A;  3C1B A;  3UTB A;  5B24 D;  3AZN B;  1TZY C;  1P34 D;  3LJA B;  3B0C T;  1TAF B;  4J8X C;  4E45 A;  2HIO B;  5DNM B;  1P3O D;  5CPK D;  2BYM B;  5CP6 A;  5B0Y D;  5B24 A;  3EG5 B;  3AZG B;  3REL D;  4AWL B;  2JE5 A;  3AZN D;  3AZF B;  5CPK A;  1P3O A;  2F8N H;  3AYW B;  1M19 B;  3LJA D;  3AL0 C;  5B0Y A;  3TU4 B;  2HIO D;  5DNM D;  5BNV B;  5GSU B;  3REL A;  1P3G B;  3X1S B;  4J8V C;  2LY8 A;  3MVD D;  3X1V A;  3AZI C;  3AZN A;  2Y2O A;  5F99 B;  3AZG D;  1M18 C;  3LJA A;  1M1A B;  4YS3 B;  2HIO A;  4H9N B;  5DNM A;  5CPJ B;  2BYM A;  3AYW D;  1M19 D;  1TZY B;  3MVD A;  5B33 C;  3B6G B;  3TU4 D;  3MGQ B;  3AZG A;  4XZQ B;  1PZR A;  5B1L C;  5GSU D;  3AZM C;  1P3G D;  3X1S D;  4Z2M H;  2CV5 C;  4WNN B;  5F99 D;  3AYW A;  1M19 A;  1M1A D;  1KX4 D;  3TU4 A;  5JRG B;  4YS3 D;  3A1K A;  5CPJ D;  5B32 C;  4WU9 C;  5GSU A;  1P3G A;  3X1S A;  4R8P C;  1TZY D;  3KXB B;  3B6G D;  3MGQ D;  3FDD A;  4XZQ D;  3B0D C;  3LZ0 C;  1M1A A;  1KX4 A;  5AV9 C;  3W99 C;  4YS3 A;  4H9N A;  1Q9C A;  3B6G A;  5JRG D;  3MGQ A;  4XZQ A;  3KWQ C;  1KX5 D;  3MGS C;  3KXB D;  2PYO B;  5AV8 C;  4M6B A;  4WNN A;  5GT3 B;  4KHA A;  3AZM B;  5B1L B;  5JRG A;  2BG1 A;  1KX5 A;  3KXB A;  1A7W A;  5JA4 B;  2JCH A;  2HUE B;  5BS7 C;  4EO5 C;  5B2I B;  4WU9 B;  2PYO D;  3REH C;  2YFW B;  5GT3 D;  1P3F C;  5B1M D;  3H0L C;  4E44 A;  2JSS A;  3AZM D;  5AV9 B;  2PYO A;  5G49 A;  3LEL C;  1P3K C;  4J8U B;  5GT3 A;  5B1M A;  3MNN D;  4WU9 D;  5B2I D;  3A6N C;  3AZM A;  1P3M B;  4NE3 A;  2RIQ A;  4Z5T B;  3AV2 C;  4Z66 D;  3EPJ A;  3AZH B;  5JA4 A;  3REK A;  3AZE B;  3MNN A;  5B2I A;  3AZJ B;  4J8U D;  2YFW A;  2Y2L A;  3H0M C;  4Z66 A;  3AZK C;  2IO5 B;  1P3M D;  2NQB B;  4Z5T D;  1P3I C;  4EO5 B;  5AVB D;  3AZH D;  2Y2H A;  1B6W A;  4J8U A;  4G91 B;  3AZE D;  4H9S A;  1ZLA C;  3AZJ D;  1P3M A;  4WV4 B;  5GXQ C;  4Z5T A;  3C1C C;  5AVB A;  2ZY4 A;  2Y2J A;  3AZL B;  1AOI C;  5AY8 C;  5B40 C;  3AZH A;  2NQB D;  1P3L B;  2UWX A;  1WWI A;  3AZE A;  1P3A C;  5AV6 B;  3AZJ A;  5BT1 D;  3AV2 B;  3V9R B;  1P3B B;  1KX3 B;  1U35 C;  3REJ B;  2DQN C;  2ARO C;  2NQB A;  3AFA C;  3UT9 A;  1BH9 B;  3AZL D;  4LD9 B;  3VH5 W;  2F2A C;  3AZK B;  1P3L D;  1ID3 C;  2F8N G;  5B31 A;  5AV6 D;  1P3B D;  3AZL A;  2F8N K;  1KX3 D;  5B2J B;  4HGA C;  5CPI C;  5B0Z C;  3REJ D;  1S32 C;  1P3L A;  4LD9 D;  5GXQ B;  5AV6 A;  3C1C B;  5BO0 B;  5C3I B;  4J8W B;  3NQJ B;  1AOI B;  3V9R A;  3VH5 T;  1P3B A;  1KX3 A;  3REJ A;  1W2E A;  1P3A B;  1F66 C;  1BH9 A;  4LD9 A;  5B2J D;  1P34 A;  4ZBJ C;  3KSY A;  4Z2M G;  3WTP C;  3R45 A;  5GXQ D;  2FFF B;  4ZUX C;  4J8W D;  1N1J B;  5KDM A;  5B2J A;  5AV5 C;  4JJN C;  1B67 A;  3LZ1 C;  4WZS B;  5BO0 A;  4J8W A;  1TAF A;  3NQJ A;  3WTP E;  5B0Z B;  3AZF D;  3VH6 A;  3AV1 C;  3WAA C;  4J8X B;  3W97 C;  2Y2N A;  2BYK B;  5E5A C;  3AZF A;  3X1T C;  1N1J A;  3WA9 C;  3W96 C;  4DQY B;  3A1I A;  5BNV A;  4H9R B;  3F6T A;  5F99 A;  4J8X D;  2RVQ C;  1R4V A;  4J8V B;  2Y2M A;  5CPJ A;  3AZI B;  3REI C;  4QLC C;  1TZY A;  1M18 B;  4J8X A;  4KGC C;  3MGR C;  5B33 B;  3KUY C;  3WAA B;  2XD1 A;  4WU8 C;  4J8V D;  2FJ7 C;  2CV5 B;  3W97 B;  3AZI D;  5E5A B;  4XUJ C;  3X1T B;  4H9R A;  5DNN C;  1M18 D;  2XD5 A;  3W98 C;  3WA9 B;  3W96 B;  5B32 B;  4J8V A;  4R8P B;  4YM6 C;  5B33 D;  3AZI A;  1F1E A;  1ULY A;  1P3P C;  3WAA D;  3LZ0 B;  3B0D B;  5B1L D;  5AVC C;  1M18 A;  4WJ3 C;  3W99 B;  2CV5 D;  5E5A D;  1KU5 A;  2CWE A;  3X1U C;  4KUD C;  5B33 A;  2Y2I A;  4UPK A;  5B32 D;  5B1L A;  3KWQ B;  4R8P D;  4CAY B;  3MGS B;  4G92 C;  2CV5 A;  5AV8 B;  3LZ0 D;  3KUY B;  5AV9 D;  3W99 D;  3UTA C;  1BFM A;  4WU8 B;  2NZD C;  2FJ7 B;  5B32 A;  4WU9 A;  1EQZ C;  4R8P A;  4H9P B;  3W98 B;  3LZ0 A;  4X23 C;  3KWQ D;  5GT0 C;  5AV9 A;  3MGS D;  3W99 A;  5AV8 D;  3REH B;  4YM6 B;  3WKJ C;  3KUY D;  1P3F B;  1HQ3 C;  2DF4 C;  2G5H C;  4WU8 D;  2FJ7 D;  3C1B C;  3KWQ A;  3UTB C;  3MGS A;  4CAY A;  4H9O B;  5AV8 A;  3X1U B;  3LEL B;  1P3K B;  2ZY3 A;  3W98 D;  4H9Q B;  2W8S A;  4NE5 A;  3A6N B;  5CP6 C;  3REH D;  5CHL B;  5B24 C;  1P3F D;  4H9P A;  2Y2K A;  3W98 A;  3UTA B;  1P3O C;  1H3O B;  5CPK C;  5BS7 A;  1EQZ B;  3LEL D;  1P3K D;  3REH A;  2YFV B;  1P3F A;  3A6N D;  3REL C;  3NQU B;  3X1V C;  1P3I B;  3AV2 D;  4H9O A;  3LJA C;  5B31 G;  3LEL A;  1P3K A;  3UTA D;  1T3U A;  1WWS A;  4H9Q A;  5DNM C;  3B6F C;  3A6N A;  3C1B B;  1EQZ D;  3UTB B;  1ZLA B;  3MVD C;  3AV2 A;  3AZG C;  5AY8 B;  3AZK D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...