2AROC

Crystal structure of the native histone octamer to 2.1 angstrom resolution, crystalised in the presence of s-nitrosoglutathione
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
95
structure length
95
Chain Sequence
b'YRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H2A-IV
publication title The oxidised histone octamer does not form a H3 disulphide bond.
pubmed doi rcsb
molecule tags Structural protein
total genus 31
structure length 95
sequence length 95
chains with identical sequence G
ec nomenclature
pdb deposition date 2005-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 2aroC00
3X1UA 3MVDB 5AV5C 5CPKC 3AZNC 5DNMC 3AZJA 4XUJC 3X1UD 5B2IA 3R45A 4J8VB 5B2ID 3VH6T 3AV2C 5B31D 3B6FD 1P3LD 1F66C 4Z5TB 3AZLB 1P3FC 4G92C 2AROB 3REHB 5E5AA 5B2JC 3B6GC 5B0ZC 5B24B 4J8XD 1P3BD 3W97B 3UTBA 4UUZA 5AV6B 5GXQA 1U35A 1KX4B 2HIOC 3AZKA 4HGAB 4E45A 1HQ3A 5B32B 3X1SB 4KGCD 3AZEB 1HQ3D 5BNVA 5AV9A 3UT9C 5B31C 5JRGB 4EO5C 4QLCA 3B6FC 4J8WB 1P3LC 1P3KA 4H9RB 1P3GB 5DNNB 1N1JA 5BS7C 5GT3B 1M1AB 5F99A 3NQJA 5F99D 4J8XC 3AFAB 4WU9B 2CV5D 1P3BC 3KXBA 3A6NC 3C1CB 5GSUD 3AZNB 3REKD 3KXBD 2NQBB 4H9OA 1KX5D 2L5AA 4X23A 3AZGD 5B33A 3X1VD 2F8NB 3WKJD 4KGCC 1ID3D 4R8PB 4X23D 4ZUXA 5AY8A 3V9RA 3AYWB 4ZUXD 5AY8D 2CWEA 1P3OD 3W98A 5B40D 1P3MA 2CV5C 1M19D 4LD9D 2NZDA 5GSUC 1ZLAB 3REKC 3RELB 1TAFA 3AZFC 3MGSC 1KX5C 4YS3A 1P3IA 3X1VC 3KUYB 3MGPA 3REIC 1ID3C 1P3ID 2RVQD 2JSSA 3KWQD 5B32G 3VH6A 5B1MB 1P3OC 4WV4B 5B40C 2PYOC 1M19C 4LD9C 3WTPA 4M6BA 1P3AB 2FJ7A 1EQZB 3LZ1B 5GT0A 3AN2A 2RVQC 5B0YA 4KUDA 3LELA 3WAAA 3B0BA 4ZBJC 5KDMB 3KWQC 3AN2D 3WAAD 5AV8A 3MGQB 4WU8D 2F8NG 2YFWA 2BYMB 4YM6B 3X1TD 1M18B 4XZQB 4H9SA 1TZYB 3MNNB 3MGRC 1H3OA 3AZIA 1P3PD 5CP6B 3MVDA 3AZMD 3REJD 1AOIC 3AZID 3UTAD 3KSYA 4G91C 4J8VA 3W99B 3REIB 4Z2MH 4JJND 3WA9B 1BFMA 1BH9B 1P34C 4WU8C 4Z5TA 3X1TC 3AZLA 2AROA 3AV1B 3REHA 2AROD 5B24A 3REHD 3W97A 1P3PC 5B1LD 3AZMC 3REJC 5AV6A 3UTAC 1KX4A 4NE3A 5B32A 1KX4D 2IO5B 3X1SA 3AZEA 3X1SD 4JJNC 4J8UB 5JRGA 4J8WA 4H9RA 3C1BC 1P3GA 5DNNA 5GT3A 1M1AA 4DRBA 5DNND 1KX3D 4NE6A 3AFAA 4WU9A 5B1LC 4Z66D 3O62B 5CPIB 5C3IC 3C1CA 3AZNA 1R4VA 3LJAB 3AZJD 2NQBA 1S32B 2NQBD 2F8NA 4R8PA 5CPJB 5BO0B 3AYWA 5BNXB 3B0DB 5AVBB 5E5AD 1KX3C 4KHAB 4Z66C 3X1UC 1ZLAA 3UTBD 3RELA 3AZJC 1U35D 5GXQD 5B2IC 3AZKD 3KUYA 3TU4B 5AV9D 5AVCB 3W96B 4QLCD 3LZ0B 4NFTA 5B1MA 1P3KD 3AZHB 4DRAA 5E5AC 5AV5B 5CPKB 5DNMB 4XUJB 3UTBC 1U35C 5GXQC 1H3OB 3B0CT 3AZKC 1HQ3C 3AV2B 1P3AA 5B33D 3LZ1A 1EQZA 5AV9C 1EQZD 3LZ1D 5KDMA 1F66B 4QLCC 3MGQA 1P3FB 1JFIB 4G92B 2BYMA 1P3KC 5B2JB 4YM6A 3W98D 1M18A 3B6GB 5B0ZB 4XZQA 5F99C 1TZYA 3MNNA 4XZQD 1P3MD 1TZYD 5CP6A 2NZDD 2HIOB 3KXBC 2HUEC 4CSRB 3AZGC 1HTAA 3WKJC 3W99A 4YS3D 3REIA 3UT9B 4H9NB 4X23C 5B31B 5B33C 3MGPD 4EO5B 3B6FB 4ZUXC 3WA9A 5AY8C 1P3LB 1BH9A 3W98C 4J8XB 3AV1A 1P3BB 1Q9CA 3WTPE 1P3MC 3A6NB 3AV1D 3WTPD 2NZDC 4KGCB 4YS3C 1P3IC 3MGPC 2FJ7D 5GT0D 5B0YD 4KUDD 4J8UA 3LELD 4J8UD 5AV8D 2CV5B 5GSUB 3REKB 5CPIA 3WTPC 3O62A 3MVDD 3AZFB 3LJAA 3MGSB 1KX5B 3AZGB 3X1VB 3WKJB 1ID3B 1S32A 4J8VD 2FJ7C 1WWSA 5GT0C 1S32D 3AN2C 5B0YC 5CPJA 4KUDC 5BO0A 2LY8A 3WAAC 3LELC 1P3OB 5AV8C 5B31G 5BNXA 5B40B 2PYOB 5AVBA 3NQUB 4Z5TD 1B67A 3AZLD 2F8NH 5AVBD 1M19B 4AWLC 4H9SC 4LD9B 2YFVB 4KHAA 5B24D 3AZIC 3W97D 3MVDC 5AV6D 4J8VC 5B32D 3TU4A 4ZBJB 3AZED 3KWQB 5AVCA 3VH5W 3W96A 5JRGD 3LZ0A 4J8WD 3AZHA 1P3GD 4Z5TC 3MGRB 5GT3D 3AZLC 1M1AD 2AROC 5G49B 3REHC 5AV5A 5CPKA 5DNMA 4WNNB 5B24C 4H9QB 4XUJA 4WU9D 3AFAD 1AOIB 5CPKD 3W97C 3C1CD 3AZND 4G91B 4XUJD 1KX4C 4HGAC 5B32C 3AV2A 3X1SC 2F8ND 3AZEC 5FUGB 4R8PD 1P34B 4WU8B 3AYWD 1F66A 5JRGC 3X1TB 1P3FA 4J8WC 1JFIA 1BH8B 1A7WA 1P3GC 5B2JA 5DNNC 5GT3C 3B6GA 5B0ZA 1M1AC 1P3PB 3B6GD 3AZMB 3REJB 3AFAC 4WU9C 3UTAB 2HIOA 3C1CC 4CSRA 1ZLAD 2BYKB 3RELD 2HIOD 2NQBC 4JJNB 4H9NA 3UT9A 5B31A 3KUYD 4R8PC 3UT9D 3B6FA 1F1EA 3AYWC 1P3LA 3C1BB 5BS7A 5B1MD 4J8XA 5JA4B 1P3BA 5B1LB 5C3IB 3A6NA 4H9PB 3A6ND 1ZLAC 3RELC 4KGCA 3KUYC 1P3AD 4CAYB 5BT1D 3MGQD 5B1MC 4YM6D 2CV5A 1KX3B 1M18D 4Z66B 3X1UB 5GSUA 3MNND 3REKA 3AZJB 5CP6D 3AZFA 5B2IB 3MGSA 1KX5A 3R45B 3AZGA 3X1VA 3AZFD 3WKJA 3MGSD 1ID3A 3W99D 3REID 1P3AC 4WZSB 1EQZC 3LZ1C 4E44A 3WA9D 3VH5T 1P3OA 5BT1C 3MGQC 5B40A 2PYOA 5E5AB 4YM6C 3NQUA 2PYOD 1M18C 4XZQC 1M19A 4LD9A 2YFVA 2F8NK 1TZYC 3MNNC 3UTBB 4UUZB 5GXQB 1U35B 5CP6C 3AZKB 1HQ3B 3VH6W 5BNVB 3W99C 5AV9B 3KWQA 4QLCB 3WA9C 1P3KB 1N1JB 5F99B 3NQJB 3MGRA 5G49A 3AV1C 3MGRD 3KXBB 2HUEB 1AOIA 4WNNA 4H9QA 5CPID 3O62D 4H9OB 1AOID 3LJAD 4Z2MG 4X23B 5B33B 2IO5C 4ZUXB 5AY8B 3V9RB 5FUGA 1P34A 4WU8A 5CPJD 4J8UC 5CHLB 1P34D 3W98B 3X1TA 1BH8A 1P3MB 1P3PA 2NZDB 3AZMA 3REJA 5CPIC 3UTAA 1TAFB 3O62C 3LJAC 2BYKA 4YS3B 1P3IB 3MGPB 3B0CW 1S32C 4JJNA 3TU4D 5CPJC 5AVCD 3C1BA 3W96D 3LZ0D 3B0DC 3C1BD 5AVBC 3AZHD 5JA4A 3VH5A 3WTPB 1KU5A 1WWIA 5B1LA 5AV5D 5DNMD 4H9PA 5AV6C 2FJ7B 5GT0B 3AN2B 5B0YB 3AV2D 4KUDB 1B6WA 3LELB 3TU4C 3WAAB 4CAYA 1ULYA 5AV8B 5AVCC 2YFWB 3W96C 1F66D 4NE5A 3LZ0C 1P3FD 4AWLB 3AZHC 5B2JD 1KX3A 5B0ZD 4Z66A 3AZIB
chains in the Genus database with same CATH superfamily
3X1UA 3MVDB 5AV5C 5CPKC 3AZNC 5DNMC 3AZJA 4XUJC 3X1UD 5B2IA 3R45A 4J8VB 5B2ID 3VH6T 3AV2C 5B31D 3P5JB 3B6FD 1P3LD 1F66C 4Z5TB 3AZLB 1P3FC 4G92C 2AROB 3REHB 5E5AA 5B2JC 3B6GC 5B0ZC 5B24B 4J8XD 1P3BD 3W97B 3UTBA 4UUZA 5AV6B 5GXQA 1U35A 1KX4B 2HIOC 3AZKA 4HGAB 4E45A 1HQ3A 5B32B 3H0RC 3X1SB 4KGCD 3AZEB 1HQ3D 5BNVA 1Z2CB 5AV9A 3UT9C 5B31C 5JRGB 4EO5C 4QLCA 3EPJA 3B6FC 4J8WB 1P3LC 1P3KA 4H9RB 1P3GB 5DNNB 1N1JA 5BS7C 5GT3B 3EPLA 1M1AB 5F99A 4UPKA 3NQJA 5F99D 4J8XC 3AFAB 4WU9B 2CV5D 1P3BC 3KXBA 3A6NC 3C1CB 5GSUD 3AZNB 3REKD 3KXBD 2NQBB 4H9OA 1KX5D 2L5AA 2G5IC 2ZM5A 4X23A 3AZGD 5B33A 3X1VD 2F8NB 3WKJD 4KGCC 1ID3D 4R8PB 4X23D 4ZUXA 5AY8A 3V9RA 3AYWB 4ZUXD 3A1IA 5AY8D 1W2EA 2CWEA 1P3OD 3W98A 5B40D 2DF4C 1P3MA 2CV5C 2XD5A 1M19D 4LD9D 2NZDA 5GSUC 1ZLAB 3REKC 3RELB 1TAFA 3AZFC 2Y2KA 3MGSC 1KX5C 4YS3A 1P3IA 3X1VC 3KUYB 3MGPA 3REIC 1ID3C 1P3ID 2RVQD 2JSSA 4DQYB 3KWQD 5B32G 3VH6A 5B1MB 1P3OC 4WV4B 5B40C 2PYOC 1M19C 4LD9C 3WTPA 4M6BA 1P3AB 2FJ7A 1EQZB 3LZ1B 5GT0A 3AN2A 2RVQC 5B0YA 4KUDA 3LELA 3WAAA 3B0BA 4ZBJC 5KDMB 3KWQC 2DQNC 2Y2NA 3AN2D 3WAAD 5AV8A 3MGQB 4WU8D 2F8NG 2YFWA 2BYMB 4YM6B 3X1TD 1M18B 4XZQB 4H9SA 1TZYB 3MNNB 3MGRC 1H3OA 3AZIA 1P3PD 5CP6B 3MVDA 3AZMD 3REJD 1AOIC 3AZID 3UTAD 3KSYA 4G91C 4J8VA 3W99B 3REIB 4Z2MH 4JJND 3WA9B 1BFMA 1BH9B 1P34C 4WU8C 3EPHA 2Y2HA 4Z5TA 3X1TC 3AZLA 3H0MC 2AROA 3AV1B 3REHA 2ZY3A 2AROD 5B24A 3REHD 3W97A 1P3PC 5B1LD 3AZMC 3REJC 5AV6A 3UTAC 1KX4A 4NE3A 5B32A 1KX4D 2IO5B 3X1SA 3AZEA 3X1SD 4JJNC 4J8UB 5JRGA 4J8WA 4H9RA 3C1BC 1P3GA 5DNNA 5GT3A 1M1AA 4DRBA 5DNND 2Y2JA 1KX3D 4NE6A 3AFAA 4WU9A 5B1LC 4Z66D 3O62B 5CPIB 5C3IC 3C1CA 3AZNA 1R4VA 3LJAB 3AZJD 3H0LC 2NQBA 1S32B 2NQBD 2F8NA 3AL0C 4R8PA 5CPJB 5BO0B 3AYWA 5BNXB 3B0DB 5AVBB 5E5AD 2ZY4A 1KX3C 4KHAB 4Z66C 3X1UC 1ZLAA 3UTBD 3RELA 3AZJC 2XD1A 5GXQD 1U35D 5B2IC 3AZKD 3KUYA 3TU4B 5AV9D 5AVCB 3W96B 4QLCD 3LZ0B 2Y2OA 4NFTA 5B1MA 1P3KD 3AZHB 2Y2MA 4DRAA 5E5AC 5AV5B 5CPKB 5DNMB 4XUJB 3UTBC 1U35C 5GXQC 3B0CT 2J8PA 3AZKC 1HQ3C 3AV2B 1P3AA 5B33D 3LZ1A 1EQZA 5AV9C 1EQZD 3LZ1D 5KDMA 1F66B 4QLCC 3MGQA 1P3FB 1JFIB 4G92B 2BYMA 1P3KC 5B2JB 4YM6A 3W98D 1M18A 3B6GB 5B0ZB 4XZQA 5F99C 1TZYA 3MNNA 4XZQD 1P3MD 5CP6A 1TZYD 2NZDD 2HIOB 3KXBC 2HUEC 4CSRB 2Y2PA 3AZGC 1HTAA 3WKJC 3W99A 4YS3D 3REIA 3UT9B 4H9NB 4X23C 5B31B 2JE5A 5B33C 2F2AC 3MGPD 4EO5B 3B6FB 4ZUXC 3WA9A 5AY8C 1P3LB 1BH9A 3W98C 2VQRA 4J8XB 3AV1A 1P3BB 1Q9CA 3WTPE 1P3MC 1PZRA 3A6NB 3AV1D 3WTPD 2NZDC 4KGCB 4YS3C 2Y2GA 1P3IC 3IP4C 3MGPC 2FJ7D 5GT0D 5B0YD 4KUDD 4J8UA 3LELD 2W8SA 4J8UD 5AV8D 2CV5B 5GSUB 3REKB 5CPIA 3WTPC 3O62A 3MVDD 3AZFB 3LJAA 3MGSB 1KX5B 3AZGB 3X1VB 3WKJB 1ID3B 1S32A 4J8VD 2ZY2A 2FJ7C 1WWSA 5GT0C 1S32D 3AN2C 5B0YC 5CPJA 4KUDC 5BO0A 2LY8A 3WAAC 3LELC 1P3OB 5AV8C 5B31G 1T3UA 5BNXA 5B40B 2PYOB 5AVBA 3NQUB 4Z5TD 1B67A 3AZLD 2F8NH 5AVBD 1M19B 4AWLC 4H9SC 4LD9B 2YFVB 4KHAA 5B24D 3AZIC 3W97D 3MVDC 5AV6D 2JCHA 2Y2IA 4J8VC 5B32D 3TU4A 3KFUG 4ZBJB 3AZED 3KWQB 5AVCA 3VH5W 3W96A 5JRGD 3LZ0A 2BG1A 4J8WD 2ZY5A 3AZHA 1P3GD 4Z5TC 3MGRB 5GT3D 3AZLC 1M1AD 2AROC 5G49B 3REHC 3A1KA 5AV5A 5CPKA 5DNMA 4WNNB 5B24C 4H9QB 4XUJA 4WU9D 3AFAD 1AOIB 5CPKD 3W97C 3C1CD 3AZND 4G91B 4XUJD 1KX4C 4HGAC 5B32C 3AV2A 3X1SC 2F8ND 3AZEC 5FUGB 4R8PD 1P34B 4WU8B 3AYWD 1F66A 5JRGC 3X1TB 1P3FA 4J8WC 1JFIA 1BH8B 1A7WA 1P3GC 5B2JA 5DNNC 5GT3C 3B6GA 5B0ZA 1M1AC 1P3PB 3B6GD 3AZMB 3REJB 3AFAC 4WU9C 3UTAB 2HIOA 3C1CC 4CSRA 1ZLAD 2BYKB 3RELD 2HIOD 2NQBC 4JJNB 4H9NA 3UT9A 5B31A 3KUYD 4R8PC 3UT9D 3B6FA 1F1EA 3AYWC 1P3LA 3C1BB 5BS7A 2Y2LA 5B1MD 2FFFB 4J8XA 5JA4B 1P3BA 5B1LB 5C3IB 3A6NA 4H9PB 3A6ND 1ZLAC 2UWXA 3RELC 4KGCA 3KUYC 1P3AD 4CAYB 3FDDA 5BT1D 3MGQD 5B1MC 4YM6D 2CV5A 1KX3B 1M18D 4Z66B 3X1UB 5GSUA 3MNND 3REKA 3AZJB 5CP6D 3AZFA 5B2IB 3MGSA 1KX5A 3EPKA 3R45B 3AZGA 3X1VA 3AZFD 3WKJA 2G5HC 3MGSD 1ID3A 3W99D 3REID 1P3AC 4WZSB 1EQZC 3LZ1C 4E44A 3WA9D 3VH5T 1P3OA 5BT1C 3MGQC 5B40A 2PYOA 5E5AB 4YM6C 3NQUA 2PYOD 1M18C 4XZQC 1M19A 4LD9A 2YFVA 2F8NK 1TZYC 3MNNC 3UTBB 3F6TA 4UUZB 5GXQB 1U35B 5CP6C 3AZKB 1HQ3B 3VH6W 5BNVB 3W99C 5AV9B 3KWQA 4QLCB 3WA9C 3EG5B 1P3KB 1N1JB 5F99B 3NQJB 3MGRA 5G49A 3AV1C 3MGRD 3KXBB 2HUEB 1AOIA 4WNNA 4H9QA 5CPID 3O62D 4H9OB 1AOID 3LJAD 4Z2MG 4X23B 5B33B 2IO5C 4ZUXB 5AY8B 3V9RB 5FUGA 1P34A 4WU8A 5CPJD 4J8UC 5CHLB 4WJ3C 1P34D 3W98B 3X1TA 1BH8A 1P3MB 1P3PA 2NZDB 2RIQA 3AZMA 3REJA 5CPIC 3UTAA 1TAFB 3O62C 3LJAC 2BYKA 4YS3B 1P3IB 3MGPB 3B0CW 1S32C 4JJNA 3TU4D 5CPJC 5AVCD 3C1BA 3W96D 3LZ0D 3B0DC 3C1BD 5AVBC 3AZHD 5JA4A 3VH5A 3WTPB 1KU5A 1WWIA 5B1LA 5AV5D 5DNMD 4H9PA 5AV6C 2Y2QA 2FJ7B 5GT0B 3AN2B 5B0YB 3AV2D 4KUDB 1B6WA 3LELB 3TU4C 3WAAB 4CAYA 1ULYA 5AV8B 5AVCC 2YFWB 5B0ZD 3W96C 1F66D 4NE5A 3LZ0C 1P3FD 4AWLB 3AZHC 5B2JD 1KX3A 1H3OB 4Z66A 3AZIB
chains in the Genus database with same CATH topology
3X1UA 3MVDB 5AV5C 5CPKC 3AZNC 5DNMC 3AZJA 4XUJC 3X1UD 5B2IA 3R45A 4J8VB 5B2ID 3VH6T 3AV2C 5B31D 3P5JB 3B6FD 1P3LD 1F66C 4Z5TB 3AZLB 1P3FC 4G92C 2AROB 3REHB 5E5AA 5B2JC 3B6GC 5B0ZC 5B24B 4J8XD 1P3BD 3W97B 3UTBA 4UUZA 5AV6B 5GXQA 1U35A 1KX4B 2HIOC 3AZKA 4HGAB 4E45A 1HQ3A 5B32B 3H0RC 3X1SB 4KGCD 3AZEB 1HQ3D 5BNVA 1Z2CB 5AV9A 3UT9C 5B31C 5JRGB 4EO5C 4QLCA 3EPJA 3B6FC 4J8WB 1P3LC 1P3KA 4H9RB 1P3GB 5DNNB 1N1JA 5BS7C 5GT3B 3EPLA 1M1AB 5F99A 4UPKA 3NQJA 5F99D 4J8XC 3AFAB 4WU9B 2CV5D 1P3BC 3KXBA 3A6NC 3C1CB 5GSUD 3AZNB 3REKD 3KXBD 2NQBB 4H9OA 1KX5D 2L5AA 2G5IC 2ZM5A 4X23A 3AZGD 5B33A 3X1VD 2F8NB 3WKJD 4KGCC 1ID3D 4R8PB 4X23D 4ZUXA 5AY8A 3V9RA 3AYWB 4ZUXD 3A1IA 5AY8D 1W2EA 2CWEA 1P3OD 3W98A 5B40D 2DF4C 1P3MA 2CV5C 2XD5A 1M19D 4LD9D 2NZDA 5GSUC 1ZLAB 3REKC 3RELB 1TAFA 3AZFC 2Y2KA 3MGSC 1KX5C 4YS3A 1P3IA 3X1VC 3KUYB 3MGPA 3REIC 1ID3C 1P3ID 2RVQD 2JSSA 4DQYB 3KWQD 5B32G 3VH6A 5B1MB 1P3OC 4WV4B 5B40C 2PYOC 1M19C 4LD9C 3WTPA 4M6BA 1P3AB 2FJ7A 1EQZB 3LZ1B 5GT0A 3AN2A 2RVQC 5B0YA 4KUDA 3LELA 3WAAA 3B0BA 4ZBJC 5KDMB 3KWQC 2DQNC 2Y2NA 3AN2D 3WAAD 5AV8A 3MGQB 4WU8D 2F8NG 2YFWA 2BYMB 4YM6B 3X1TD 1M18B 4XZQB 4H9SA 1TZYB 3MNNB 3MGRC 1H3OA 3AZIA 1P3PD 5CP6B 3MVDA 3AZMD 3REJD 1AOIC 3AZID 3UTAD 3KSYA 4G91C 4J8VA 3W99B 3REIB 4Z2MH 4JJND 3WA9B 1BFMA 1BH9B 1P34C 4WU8C 3EPHA 2Y2HA 4Z5TA 3X1TC 3AZLA 3H0MC 2AROA 3AV1B 3REHA 2ZY3A 2AROD 5B24A 3REHD 3W97A 1P3PC 5B1LD 3AZMC 3REJC 5AV6A 3UTAC 1KX4A 4NE3A 5B32A 1KX4D 2IO5B 3X1SA 3AZEA 3X1SD 4JJNC 4J8UB 5JRGA 4J8WA 4H9RA 3C1BC 1P3GA 5DNNA 5GT3A 1M1AA 4DRBA 5DNND 2Y2JA 1KX3D 4NE6A 3AFAA 4WU9A 5B1LC 4Z66D 3O62B 5CPIB 5C3IC 3C1CA 3AZNA 1R4VA 3LJAB 3AZJD 3H0LC 2NQBA 1S32B 2NQBD 2F8NA 3AL0C 4R8PA 5CPJB 5BO0B 3AYWA 5BNXB 3B0DB 5AVBB 5E5AD 2ZY4A 1KX3C 4KHAB 4Z66C 3X1UC 1ZLAA 3UTBD 3RELA 3AZJC 2XD1A 5GXQD 1U35D 5B2IC 3AZKD 3KUYA 3TU4B 5AV9D 5AVCB 3W96B 4QLCD 3LZ0B 2Y2OA 4NFTA 5B1MA 1P3KD 3AZHB 2Y2MA 4DRAA 5E5AC 5AV5B 5CPKB 5DNMB 4XUJB 3UTBC 1U35C 5GXQC 3B0CT 2J8PA 3AZKC 1HQ3C 3AV2B 1P3AA 5B33D 3LZ1A 1EQZA 5AV9C 1EQZD 3LZ1D 5KDMA 1F66B 4QLCC 3MGQA 1P3FB 1JFIB 4G92B 2BYMA 1P3KC 5B2JB 4YM6A 3W98D 1M18A 3B6GB 5B0ZB 4XZQA 5F99C 1TZYA 3MNNA 4XZQD 1P3MD 5CP6A 1TZYD 2NZDD 2HIOB 3KXBC 2HUEC 4CSRB 2Y2PA 3AZGC 1HTAA 3WKJC 3W99A 4YS3D 3REIA 3UT9B 4H9NB 4X23C 5B31B 2JE5A 5B33C 2F2AC 3MGPD 4EO5B 3B6FB 4ZUXC 3WA9A 5AY8C 1P3LB 1BH9A 3W98C 2VQRA 4J8XB 3AV1A 1P3BB 1Q9CA 3WTPE 1P3MC 1PZRA 3A6NB 3AV1D 3WTPD 2NZDC 4KGCB 4YS3C 2Y2GA 1P3IC 3IP4C 3MGPC 2FJ7D 5GT0D 5B0YD 4KUDD 4J8UA 3LELD 2W8SA 4J8UD 5AV8D 2CV5B 5GSUB 3REKB 5CPIA 3WTPC 3O62A 3MVDD 3AZFB 3LJAA 3MGSB 1KX5B 3AZGB 3X1VB 3WKJB 1ID3B 1S32A 4J8VD 2ZY2A 2FJ7C 1WWSA 5GT0C 1S32D 3AN2C 5B0YC 5CPJA 4KUDC 5BO0A 2LY8A 3WAAC 3LELC 1P3OB 5AV8C 5B31G 1T3UA 5BNXA 5B40B 2PYOB 5AVBA 3NQUB 4Z5TD 1B67A 3AZLD 2F8NH 5AVBD 1M19B 4AWLC 4H9SC 4LD9B 2YFVB 4KHAA 5B24D 3AZIC 3W97D 3MVDC 5AV6D 2JCHA 2Y2IA 4J8VC 5B32D 3TU4A 3KFUG 4ZBJB 3AZED 3KWQB 5AVCA 3VH5W 3W96A 5JRGD 3LZ0A 2BG1A 4J8WD 2ZY5A 3AZHA 1P3GD 4Z5TC 3MGRB 5GT3D 3AZLC 1M1AD 2AROC 5G49B 3REHC 3A1KA 5AV5A 5CPKA 5DNMA 4WNNB 5B24C 4H9QB 4XUJA 4WU9D 3AFAD 1AOIB 5CPKD 3W97C 3C1CD 3AZND 4G91B 4XUJD 1KX4C 4HGAC 5B32C 3AV2A 3X1SC 2F8ND 3AZEC 5FUGB 4R8PD 1P34B 4WU8B 3AYWD 1F66A 5JRGC 3X1TB 1P3FA 4J8WC 1JFIA 1BH8B 1A7WA 1P3GC 5B2JA 5DNNC 5GT3C 3B6GA 5B0ZA 1M1AC 1P3PB 3B6GD 3AZMB 3REJB 3AFAC 4WU9C 3UTAB 2HIOA 3C1CC 4CSRA 1ZLAD 2BYKB 3RELD 2HIOD 2NQBC 4JJNB 4H9NA 3UT9A 5B31A 3KUYD 4R8PC 3UT9D 3B6FA 1F1EA 3AYWC 1P3LA 3C1BB 5BS7A 2Y2LA 5B1MD 2FFFB 4J8XA 5JA4B 1P3BA 5B1LB 5C3IB 3A6NA 4H9PB 3A6ND 1ZLAC 2UWXA 3RELC 4KGCA 3KUYC 1P3AD 4CAYB 3FDDA 5BT1D 3MGQD 5B1MC 4YM6D 2CV5A 1KX3B 1M18D 4Z66B 3X1UB 5GSUA 3MNND 3REKA 3AZJB 5CP6D 3AZFA 5B2IB 3MGSA 1KX5A 3EPKA 3R45B 3AZGA 3X1VA 3AZFD 3WKJA 2G5HC 3MGSD 1ID3A 3W99D 3REID 1P3AC 4WZSB 1EQZC 3LZ1C 4E44A 3WA9D 3VH5T 1P3OA 5BT1C 3MGQC 5B40A 2PYOA 5E5AB 4YM6C 3NQUA 2PYOD 1M18C 4XZQC 1M19A 4LD9A 2YFVA 2F8NK 1TZYC 3MNNC 3UTBB 3F6TA 4UUZB 5GXQB 1U35B 5CP6C 3AZKB 1HQ3B 3VH6W 5BNVB 3W99C 5AV9B 3KWQA 4QLCB 3WA9C 3EG5B 1P3KB 1N1JB 5F99B 3NQJB 3MGRA 5G49A 3AV1C 3MGRD 3KXBB 2HUEB 1AOIA 4WNNA 4H9QA 5CPID 3O62D 4H9OB 1AOID 3LJAD 4Z2MG 4X23B 5B33B 2IO5C 4ZUXB 5AY8B 3V9RB 5FUGA 1P34A 4WU8A 5CPJD 4J8UC 5CHLB 4WJ3C 1P34D 3W98B 3X1TA 1BH8A 1P3MB 1P3PA 2NZDB 2RIQA 3AZMA 3REJA 5CPIC 3UTAA 1TAFB 3O62C 3LJAC 2BYKA 4YS3B 1P3IB 3MGPB 3B0CW 1S32C 4JJNA 3TU4D 5CPJC 5AVCD 3C1BA 3W96D 3LZ0D 3B0DC 3C1BD 5AVBC 3AZHD 5JA4A 3VH5A 3WTPB 1KU5A 1WWIA 5B1LA 5AV5D 5DNMD 4H9PA 5AV6C 2Y2QA 2FJ7B 5GT0B 3AN2B 5B0YB 3AV2D 4KUDB 1B6WA 3LELB 3TU4C 3WAAB 4CAYA 1ULYA 5AV8B 5AVCC 2YFWB 5B0ZD 3W96C 1F66D 4NE5A 3LZ0C 1P3FD 4AWLB 3AZHC 5B2JD 1KX3A 1H3OB 4Z66A 3AZIB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3X1U A;  3MVD B;  5AV5 C;  5CPK C;  3AZN C;  5DNM C;  3AZJ A;  4XUJ C;  3X1U D;  5B2I A;  3R45 A;  4J8V B;  5B2I D;  3VH6 T;  3AV2 C;  5B31 D;  3B6F D;  1P3L D;  1F66 C;  4Z5T B;  3AZL B;  1P3F C;  4G92 C;  2ARO B;  3REH B;  5E5A A;  5B2J C;  3B6G C;  5B0Z C;  5B24 B;  4J8X D;  1P3B D;  3W97 B;  3UTB A;  4UUZ A;  5AV6 B;  5GXQ A;  1U35 A;  1KX4 B;  2HIO C;  3AZK A;  4HGA B;  4E45 A;  1HQ3 A;  5B32 B;  3X1S B;  4KGC D;  3AZE B;  1HQ3 D;  5BNV A;  5AV9 A;  3UT9 C;  5B31 C;  5JRG B;  4EO5 C;  4QLC A;  3B6F C;  4J8W B;  1P3L C;  1P3K A;  4H9R B;  1P3G B;  5DNN B;  1N1J A;  5BS7 C;  5GT3 B;  1M1A B;  5F99 A;  3NQJ A;  5F99 D;  4J8X C;  3AFA B;  4WU9 B;  2CV5 D;  1P3B C;  3KXB A;  3A6N C;  3C1C B;  5GSU D;  3AZN B;  3REK D;  3KXB D;  2NQB B;  4H9O A;  1KX5 D;  2L5A A;  4X23 A;  3AZG D;  5B33 A;  3X1V D;  2F8N B;  3WKJ D;  4KGC C;  1ID3 D;  4R8P B;  4X23 D;  4ZUX A;  5AY8 A;  3V9R A;  3AYW B;  4ZUX D;  5AY8 D;  2CWE A;  1P3O D;  3W98 A;  5B40 D;  1P3M A;  2CV5 C;  1M19 D;  4LD9 D;  2NZD A;  5GSU C;  1ZLA B;  3REK C;  3REL B;  1TAF A;  3AZF C;  3MGS C;  1KX5 C;  4YS3 A;  1P3I A;  3X1V C;  3KUY B;  3MGP A;  3REI C;  1ID3 C;  1P3I D;  2RVQ D;  2JSS A;  3KWQ D;  5B32 G;  3VH6 A;  5B1M B;  1P3O C;  4WV4 B;  5B40 C;  2PYO C;  1M19 C;  4LD9 C;  3WTP A;  4M6B A;  1P3A B;  2FJ7 A;  1EQZ B;  3LZ1 B;  5GT0 A;  3AN2 A;  2RVQ C;  5B0Y A;  4KUD A;  3LEL A;  3WAA A;  3B0B A;  4ZBJ C;  5KDM B;  3KWQ C;  3AN2 D;  3WAA D;  5AV8 A;  3MGQ B;  4WU8 D;  2F8N G;  2YFW A;  2BYM B;  4YM6 B;  3X1T D;  1M18 B;  4XZQ B;  4H9S A;  1TZY B;  3MNN B;  3MGR C;  1H3O A;  3AZI A;  1P3P D;  5CP6 B;  3MVD A;  3AZM D;  3REJ D;  1AOI C;  3AZI D;  3UTA D;  3KSY A;  4G91 C;  4J8V A;  3W99 B;  3REI B;  4Z2M H;  4JJN D;  3WA9 B;  1BFM A;  1BH9 B;  1P34 C;  4WU8 C;  4Z5T A;  3X1T C;  3AZL A;  2ARO A;  3AV1 B;  3REH A;  2ARO D;  5B24 A;  3REH D;  3W97 A;  1P3P C;  5B1L D;  3AZM C;  3REJ C;  5AV6 A;  3UTA C;  1KX4 A;  4NE3 A;  5B32 A;  1KX4 D;  2IO5 B;  3X1S A;  3AZE A;  3X1S D;  4JJN C;  4J8U B;  5JRG A;  4J8W A;  4H9R A;  3C1B C;  1P3G A;  5DNN A;  5GT3 A;  1M1A A;  4DRB A;  5DNN D;  1KX3 D;  4NE6 A;  3AFA A;  4WU9 A;  5B1L C;  4Z66 D;  3O62 B;  5CPI B;  5C3I C;  3C1C A;  3AZN A;  1R4V A;  3LJA B;  3AZJ D;  2NQB A;  1S32 B;  2NQB D;  2F8N A;  4R8P A;  5CPJ B;  5BO0 B;  3AYW A;  5BNX B;  3B0D B;  5AVB B;  5E5A D;  1KX3 C;  4KHA B;  4Z66 C;  3X1U C;  1ZLA A;  3UTB D;  3REL A;  3AZJ C;  1U35 D;  5GXQ D;  5B2I C;  3AZK D;  3KUY A;  3TU4 B;  5AV9 D;  5AVC B;  3W96 B;  4QLC D;  3LZ0 B;  4NFT A;  5B1M A;  1P3K D;  3AZH B;  4DRA A;  5E5A C;  5AV5 B;  5CPK B;  5DNM B;  4XUJ B;  3UTB C;  1U35 C;  5GXQ C;  1H3O B;  3B0C T;  3AZK C;  1HQ3 C;  3AV2 B;  1P3A A;  5B33 D;  3LZ1 A;  1EQZ A;  5AV9 C;  1EQZ D;  3LZ1 D;  5KDM A;  1F66 B;  4QLC C;  3MGQ A;  1P3F B;  1JFI B;  4G92 B;  2BYM A;  1P3K C;  5B2J B;  4YM6 A;  3W98 D;  1M18 A;  3B6G B;  5B0Z B;  4XZQ A;  5F99 C;  1TZY A;  3MNN A;  4XZQ D;  1P3M D;  1TZY D;  5CP6 A;  2NZD D;  2HIO B;  3KXB C;  2HUE C;  4CSR B;  3AZG C;  1HTA A;  3WKJ C;  3W99 A;  4YS3 D;  3REI A;  3UT9 B;  4H9N B;  4X23 C;  5B31 B;  5B33 C;  3MGP D;  4EO5 B;  3B6F B;  4ZUX C;  3WA9 A;  5AY8 C;  1P3L B;  1BH9 A;  3W98 C;  4J8X B;  3AV1 A;  1P3B B;  1Q9C A;  3WTP E;  1P3M C;  3A6N B;  3AV1 D;  3WTP D;  2NZD C;  4KGC B;  4YS3 C;  1P3I C;  3MGP C;  2FJ7 D;  5GT0 D;  5B0Y D;  4KUD D;  4J8U A;  3LEL D;  4J8U D;  5AV8 D;  2CV5 B;  5GSU B;  3REK B;  5CPI A;  3WTP C;  3O62 A;  3MVD D;  3AZF B;  3LJA A;  3MGS B;  1KX5 B;  3AZG B;  3X1V B;  3WKJ B;  1ID3 B;  1S32 A;  4J8V D;  2FJ7 C;  1WWS A;  5GT0 C;  1S32 D;  3AN2 C;  5B0Y C;  5CPJ A;  4KUD C;  5BO0 A;  2LY8 A;  3WAA C;  3LEL C;  1P3O B;  5AV8 C;  5B31 G;  5BNX A;  5B40 B;  2PYO B;  5AVB A;  3NQU B;  4Z5T D;  1B67 A;  3AZL D;  2F8N H;  5AVB D;  1M19 B;  4AWL C;  4H9S C;  4LD9 B;  2YFV B;  4KHA A;  5B24 D;  3AZI C;  3W97 D;  3MVD C;  5AV6 D;  4J8V C;  5B32 D;  3TU4 A;  4ZBJ B;  3AZE D;  3KWQ B;  5AVC A;  3VH5 W;  3W96 A;  5JRG D;  3LZ0 A;  4J8W D;  3AZH A;  1P3G D;  4Z5T C;  3MGR B;  5GT3 D;  3AZL C;  1M1A D;  2ARO C;  5G49 B;  3REH C;  5AV5 A;  5CPK A;  5DNM A;  4WNN B;  5B24 C;  4H9Q B;  4XUJ A;  4WU9 D;  3AFA D;  1AOI B;  5CPK D;  3W97 C;  3C1C D;  3AZN D;  4G91 B;  4XUJ D;  1KX4 C;  4HGA C;  5B32 C;  3AV2 A;  3X1S C;  2F8N D;  3AZE C;  5FUG B;  4R8P D;  1P34 B;  4WU8 B;  3AYW D;  1F66 A;  5JRG C;  3X1T B;  1P3F A;  4J8W C;  1JFI A;  1BH8 B;  1A7W A;  1P3G C;  5B2J A;  5DNN C;  5GT3 C;  3B6G A;  5B0Z A;  1M1A C;  1P3P B;  3B6G D;  3AZM B;  3REJ B;  3AFA C;  4WU9 C;  3UTA B;  2HIO A;  3C1C C;  4CSR A;  1ZLA D;  2BYK B;  3REL D;  2HIO D;  2NQB C;  4JJN B;  4H9N A;  3UT9 A;  5B31 A;  3KUY D;  4R8P C;  3UT9 D;  3B6F A;  1F1E A;  3AYW C;  1P3L A;  3C1B B;  5BS7 A;  5B1M D;  4J8X A;  5JA4 B;  1P3B A;  5B1L B;  5C3I B;  3A6N A;  4H9P B;  3A6N D;  1ZLA C;  3REL C;  4KGC A;  3KUY C;  1P3A D;  4CAY B;  5BT1 D;  3MGQ D;  5B1M C;  4YM6 D;  2CV5 A;  1KX3 B;  1M18 D;  4Z66 B;  3X1U B;  5GSU A;  3MNN D;  3REK A;  3AZJ B;  5CP6 D;  3AZF A;  5B2I B;  3MGS A;  1KX5 A;  3R45 B;  3AZG A;  3X1V A;  3AZF D;  3WKJ A;  3MGS D;  1ID3 A;  3W99 D;  3REI D;  1P3A C;  4WZS B;  1EQZ C;  3LZ1 C;  4E44 A;  3WA9 D;  3VH5 T;  1P3O A;  5BT1 C;  3MGQ C;  5B40 A;  2PYO A;  5E5A B;  4YM6 C;  3NQU A;  2PYO D;  1M18 C;  4XZQ C;  1M19 A;  4LD9 A;  2YFV A;  2F8N K;  1TZY C;  3MNN C;  3UTB B;  4UUZ B;  5GXQ B;  1U35 B;  5CP6 C;  3AZK B;  1HQ3 B;  3VH6 W;  5BNV B;  3W99 C;  5AV9 B;  3KWQ A;  4QLC B;  3WA9 C;  1P3K B;  1N1J B;  5F99 B;  3NQJ B;  3MGR A;  5G49 A;  3AV1 C;  3MGR D;  3KXB B;  2HUE B;  1AOI A;  4WNN A;  4H9Q A;  5CPI D;  3O62 D;  4H9O B;  1AOI D;  3LJA D;  4Z2M G;  4X23 B;  5B33 B;  2IO5 C;  4ZUX B;  5AY8 B;  3V9R B;  5FUG A;  1P34 A;  4WU8 A;  5CPJ D;  4J8U C;  5CHL B;  1P34 D;  3W98 B;  3X1T A;  1BH8 A;  1P3M B;  1P3P A;  2NZD B;  3AZM A;  3REJ A;  5CPI C;  3UTA A;  1TAF B;  3O62 C;  3LJA C;  2BYK A;  4YS3 B;  1P3I B;  3MGP B;  3B0C W;  1S32 C;  4JJN A;  3TU4 D;  5CPJ C;  5AVC D;  3C1B A;  3W96 D;  3LZ0 D;  3B0D C;  3C1B D;  5AVB C;  3AZH D;  5JA4 A;  3VH5 A;  3WTP B;  1KU5 A;  1WWI A;  5B1L A;  5AV5 D;  5DNM D;  4H9P A;  5AV6 C;  2FJ7 B;  5GT0 B;  3AN2 B;  5B0Y B;  3AV2 D;  4KUD B;  1B6W A;  3LEL B;  3TU4 C;  3WAA B;  4CAY A;  1ULY A;  5AV8 B;  5AVC C;  2YFW B;  3W96 C;  1F66 D;  4NE5 A;  3LZ0 C;  1P3F D;  4AWL B;  3AZH C;  5B2J D;  1KX3 A;  5B0Z D;  4Z66 A;  3AZI B; 
#chains in the Genus database with same CATH topology
 3X1U A;  3MVD B;  5AV5 C;  5CPK C;  3AZN C;  5DNM C;  3AZJ A;  4XUJ C;  3X1U D;  5B2I A;  3R45 A;  4J8V B;  5B2I D;  3VH6 T;  3AV2 C;  5B31 D;  3P5J B;  3B6F D;  1P3L D;  1F66 C;  4Z5T B;  3AZL B;  1P3F C;  4G92 C;  2ARO B;  3REH B;  5E5A A;  5B2J C;  3B6G C;  5B0Z C;  5B24 B;  4J8X D;  1P3B D;  3W97 B;  3UTB A;  4UUZ A;  5AV6 B;  5GXQ A;  1U35 A;  1KX4 B;  2HIO C;  3AZK A;  4HGA B;  4E45 A;  1HQ3 A;  5B32 B;  3H0R C;  3X1S B;  4KGC D;  3AZE B;  1HQ3 D;  5BNV A;  1Z2C B;  5AV9 A;  3UT9 C;  5B31 C;  5JRG B;  4EO5 C;  4QLC A;  3EPJ A;  3B6F C;  4J8W B;  1P3L C;  1P3K A;  4H9R B;  1P3G B;  5DNN B;  1N1J A;  5BS7 C;  5GT3 B;  3EPL A;  1M1A B;  5F99 A;  4UPK A;  3NQJ A;  5F99 D;  4J8X C;  3AFA B;  4WU9 B;  2CV5 D;  1P3B C;  3KXB A;  3A6N C;  3C1C B;  5GSU D;  3AZN B;  3REK D;  3KXB D;  2NQB B;  4H9O A;  1KX5 D;  2L5A A;  2G5I C;  2ZM5 A;  4X23 A;  3AZG D;  5B33 A;  3X1V D;  2F8N B;  3WKJ D;  4KGC C;  1ID3 D;  4R8P B;  4X23 D;  4ZUX A;  5AY8 A;  3V9R A;  3AYW B;  4ZUX D;  3A1I A;  5AY8 D;  1W2E A;  2CWE A;  1P3O D;  3W98 A;  5B40 D;  2DF4 C;  1P3M A;  2CV5 C;  2XD5 A;  1M19 D;  4LD9 D;  2NZD A;  5GSU C;  1ZLA B;  3REK C;  3REL B;  1TAF A;  3AZF C;  2Y2K A;  3MGS C;  1KX5 C;  4YS3 A;  1P3I A;  3X1V C;  3KUY B;  3MGP A;  3REI C;  1ID3 C;  1P3I D;  2RVQ D;  2JSS A;  4DQY B;  3KWQ D;  5B32 G;  3VH6 A;  5B1M B;  1P3O C;  4WV4 B;  5B40 C;  2PYO C;  1M19 C;  4LD9 C;  3WTP A;  4M6B A;  1P3A B;  2FJ7 A;  1EQZ B;  3LZ1 B;  5GT0 A;  3AN2 A;  2RVQ C;  5B0Y A;  4KUD A;  3LEL A;  3WAA A;  3B0B A;  4ZBJ C;  5KDM B;  3KWQ C;  2DQN C;  2Y2N A;  3AN2 D;  3WAA D;  5AV8 A;  3MGQ B;  4WU8 D;  2F8N G;  2YFW A;  2BYM B;  4YM6 B;  3X1T D;  1M18 B;  4XZQ B;  4H9S A;  1TZY B;  3MNN B;  3MGR C;  1H3O A;  3AZI A;  1P3P D;  5CP6 B;  3MVD A;  3AZM D;  3REJ D;  1AOI C;  3AZI D;  3UTA D;  3KSY A;  4G91 C;  4J8V A;  3W99 B;  3REI B;  4Z2M H;  4JJN D;  3WA9 B;  1BFM A;  1BH9 B;  1P34 C;  4WU8 C;  3EPH A;  2Y2H A;  4Z5T A;  3X1T C;  3AZL A;  3H0M C;  2ARO A;  3AV1 B;  3REH A;  2ZY3 A;  2ARO D;  5B24 A;  3REH D;  3W97 A;  1P3P C;  5B1L D;  3AZM C;  3REJ C;  5AV6 A;  3UTA C;  1KX4 A;  4NE3 A;  5B32 A;  1KX4 D;  2IO5 B;  3X1S A;  3AZE A;  3X1S D;  4JJN C;  4J8U B;  5JRG A;  4J8W A;  4H9R A;  3C1B C;  1P3G A;  5DNN A;  5GT3 A;  1M1A A;  4DRB A;  5DNN D;  2Y2J A;  1KX3 D;  4NE6 A;  3AFA A;  4WU9 A;  5B1L C;  4Z66 D;  3O62 B;  5CPI B;  5C3I C;  3C1C A;  3AZN A;  1R4V A;  3LJA B;  3AZJ D;  3H0L C;  2NQB A;  1S32 B;  2NQB D;  2F8N A;  3AL0 C;  4R8P A;  5CPJ B;  5BO0 B;  3AYW A;  5BNX B;  3B0D B;  5AVB B;  5E5A D;  2ZY4 A;  1KX3 C;  4KHA B;  4Z66 C;  3X1U C;  1ZLA A;  3UTB D;  3REL A;  3AZJ C;  2XD1 A;  5GXQ D;  1U35 D;  5B2I C;  3AZK D;  3KUY A;  3TU4 B;  5AV9 D;  5AVC B;  3W96 B;  4QLC D;  3LZ0 B;  2Y2O A;  4NFT A;  5B1M A;  1P3K D;  3AZH B;  2Y2M A;  4DRA A;  5E5A C;  5AV5 B;  5CPK B;  5DNM B;  4XUJ B;  3UTB C;  1U35 C;  5GXQ C;  3B0C T;  2J8P A;  3AZK C;  1HQ3 C;  3AV2 B;  1P3A A;  5B33 D;  3LZ1 A;  1EQZ A;  5AV9 C;  1EQZ D;  3LZ1 D;  5KDM A;  1F66 B;  4QLC C;  3MGQ A;  1P3F B;  1JFI B;  4G92 B;  2BYM A;  1P3K C;  5B2J B;  4YM6 A;  3W98 D;  1M18 A;  3B6G B;  5B0Z B;  4XZQ A;  5F99 C;  1TZY A;  3MNN A;  4XZQ D;  1P3M D;  5CP6 A;  1TZY D;  2NZD D;  2HIO B;  3KXB C;  2HUE C;  4CSR B;  2Y2P A;  3AZG C;  1HTA A;  3WKJ C;  3W99 A;  4YS3 D;  3REI A;  3UT9 B;  4H9N B;  4X23 C;  5B31 B;  2JE5 A;  5B33 C;  2F2A C;  3MGP D;  4EO5 B;  3B6F B;  4ZUX C;  3WA9 A;  5AY8 C;  1P3L B;  1BH9 A;  3W98 C;  2VQR A;  4J8X B;  3AV1 A;  1P3B B;  1Q9C A;  3WTP E;  1P3M C;  1PZR A;  3A6N B;  3AV1 D;  3WTP D;  2NZD C;  4KGC B;  4YS3 C;  2Y2G A;  1P3I C;  3IP4 C;  3MGP C;  2FJ7 D;  5GT0 D;  5B0Y D;  4KUD D;  4J8U A;  3LEL D;  2W8S A;  4J8U D;  5AV8 D;  2CV5 B;  5GSU B;  3REK B;  5CPI A;  3WTP C;  3O62 A;  3MVD D;  3AZF B;  3LJA A;  3MGS B;  1KX5 B;  3AZG B;  3X1V B;  3WKJ B;  1ID3 B;  1S32 A;  4J8V D;  2ZY2 A;  2FJ7 C;  1WWS A;  5GT0 C;  1S32 D;  3AN2 C;  5B0Y C;  5CPJ A;  4KUD C;  5BO0 A;  2LY8 A;  3WAA C;  3LEL C;  1P3O B;  5AV8 C;  5B31 G;  1T3U A;  5BNX A;  5B40 B;  2PYO B;  5AVB A;  3NQU B;  4Z5T D;  1B67 A;  3AZL D;  2F8N H;  5AVB D;  1M19 B;  4AWL C;  4H9S C;  4LD9 B;  2YFV B;  4KHA A;  5B24 D;  3AZI C;  3W97 D;  3MVD C;  5AV6 D;  2JCH A;  2Y2I A;  4J8V C;  5B32 D;  3TU4 A;  3KFU G;  4ZBJ B;  3AZE D;  3KWQ B;  5AVC A;  3VH5 W;  3W96 A;  5JRG D;  3LZ0 A;  2BG1 A;  4J8W D;  2ZY5 A;  3AZH A;  1P3G D;  4Z5T C;  3MGR B;  5GT3 D;  3AZL C;  1M1A D;  2ARO C;  5G49 B;  3REH C;  3A1K A;  5AV5 A;  5CPK A;  5DNM A;  4WNN B;  5B24 C;  4H9Q B;  4XUJ A;  4WU9 D;  3AFA D;  1AOI B;  5CPK D;  3W97 C;  3C1C D;  3AZN D;  4G91 B;  4XUJ D;  1KX4 C;  4HGA C;  5B32 C;  3AV2 A;  3X1S C;  2F8N D;  3AZE C;  5FUG B;  4R8P D;  1P34 B;  4WU8 B;  3AYW D;  1F66 A;  5JRG C;  3X1T B;  1P3F A;  4J8W C;  1JFI A;  1BH8 B;  1A7W A;  1P3G C;  5B2J A;  5DNN C;  5GT3 C;  3B6G A;  5B0Z A;  1M1A C;  1P3P B;  3B6G D;  3AZM B;  3REJ B;  3AFA C;  4WU9 C;  3UTA B;  2HIO A;  3C1C C;  4CSR A;  1ZLA D;  2BYK B;  3REL D;  2HIO D;  2NQB C;  4JJN B;  4H9N A;  3UT9 A;  5B31 A;  3KUY D;  4R8P C;  3UT9 D;  3B6F A;  1F1E A;  3AYW C;  1P3L A;  3C1B B;  5BS7 A;  2Y2L A;  5B1M D;  2FFF B;  4J8X A;  5JA4 B;  1P3B A;  5B1L B;  5C3I B;  3A6N A;  4H9P B;  3A6N D;  1ZLA C;  2UWX A;  3REL C;  4KGC A;  3KUY C;  1P3A D;  4CAY B;  3FDD A;  5BT1 D;  3MGQ D;  5B1M C;  4YM6 D;  2CV5 A;  1KX3 B;  1M18 D;  4Z66 B;  3X1U B;  5GSU A;  3MNN D;  3REK A;  3AZJ B;  5CP6 D;  3AZF A;  5B2I B;  3MGS A;  1KX5 A;  3EPK A;  3R45 B;  3AZG A;  3X1V A;  3AZF D;  3WKJ A;  2G5H C;  3MGS D;  1ID3 A;  3W99 D;  3REI D;  1P3A C;  4WZS B;  1EQZ C;  3LZ1 C;  4E44 A;  3WA9 D;  3VH5 T;  1P3O A;  5BT1 C;  3MGQ C;  5B40 A;  2PYO A;  5E5A B;  4YM6 C;  3NQU A;  2PYO D;  1M18 C;  4XZQ C;  1M19 A;  4LD9 A;  2YFV A;  2F8N K;  1TZY C;  3MNN C;  3UTB B;  3F6T A;  4UUZ B;  5GXQ B;  1U35 B;  5CP6 C;  3AZK B;  1HQ3 B;  3VH6 W;  5BNV B;  3W99 C;  5AV9 B;  3KWQ A;  4QLC B;  3WA9 C;  3EG5 B;  1P3K B;  1N1J B;  5F99 B;  3NQJ B;  3MGR A;  5G49 A;  3AV1 C;  3MGR D;  3KXB B;  2HUE B;  1AOI A;  4WNN A;  4H9Q A;  5CPI D;  3O62 D;  4H9O B;  1AOI D;  3LJA D;  4Z2M G;  4X23 B;  5B33 B;  2IO5 C;  4ZUX B;  5AY8 B;  3V9R B;  5FUG A;  1P34 A;  4WU8 A;  5CPJ D;  4J8U C;  5CHL B;  4WJ3 C;  1P34 D;  3W98 B;  3X1T A;  1BH8 A;  1P3M B;  1P3P A;  2NZD B;  2RIQ A;  3AZM A;  3REJ A;  5CPI C;  3UTA A;  1TAF B;  3O62 C;  3LJA C;  2BYK A;  4YS3 B;  1P3I B;  3MGP B;  3B0C W;  1S32 C;  4JJN A;  3TU4 D;  5CPJ C;  5AVC D;  3C1B A;  3W96 D;  3LZ0 D;  3B0D C;  3C1B D;  5AVB C;  3AZH D;  5JA4 A;  3VH5 A;  3WTP B;  1KU5 A;  1WWI A;  5B1L A;  5AV5 D;  5DNM D;  4H9P A;  5AV6 C;  2Y2Q A;  2FJ7 B;  5GT0 B;  3AN2 B;  5B0Y B;  3AV2 D;  4KUD B;  1B6W A;  3LEL B;  3TU4 C;  3WAA B;  4CAY A;  1ULY A;  5AV8 B;  5AVC C;  2YFW B;  5B0Z D;  3W96 C;  1F66 D;  4NE5 A;  3LZ0 C;  1P3F D;  4AWL B;  3AZH C;  5B2J D;  1KX3 A;  1H3O B;  4Z66 A;  3AZI B; 
#chains in the Genus database with same CATH homology
 3X1U A;  3MVD B;  5AV5 C;  5CPK C;  3AZN C;  5DNM C;  3AZJ A;  4XUJ C;  3X1U D;  5B2I A;  3R45 A;  4J8V B;  5B2I D;  3VH6 T;  3AV2 C;  5B31 D;  3P5J B;  3B6F D;  1P3L D;  1F66 C;  4Z5T B;  3AZL B;  1P3F C;  4G92 C;  2ARO B;  3REH B;  5E5A A;  5B2J C;  3B6G C;  5B0Z C;  5B24 B;  4J8X D;  1P3B D;  3W97 B;  3UTB A;  4UUZ A;  5AV6 B;  5GXQ A;  1U35 A;  1KX4 B;  2HIO C;  3AZK A;  4HGA B;  4E45 A;  1HQ3 A;  5B32 B;  3H0R C;  3X1S B;  4KGC D;  3AZE B;  1HQ3 D;  5BNV A;  1Z2C B;  5AV9 A;  3UT9 C;  5B31 C;  5JRG B;  4EO5 C;  4QLC A;  3EPJ A;  3B6F C;  4J8W B;  1P3L C;  1P3K A;  4H9R B;  1P3G B;  5DNN B;  1N1J A;  5BS7 C;  5GT3 B;  3EPL A;  1M1A B;  5F99 A;  4UPK A;  3NQJ A;  5F99 D;  4J8X C;  3AFA B;  4WU9 B;  2CV5 D;  1P3B C;  3KXB A;  3A6N C;  3C1C B;  5GSU D;  3AZN B;  3REK D;  3KXB D;  2NQB B;  4H9O A;  1KX5 D;  2L5A A;  2G5I C;  2ZM5 A;  4X23 A;  3AZG D;  5B33 A;  3X1V D;  2F8N B;  3WKJ D;  4KGC C;  1ID3 D;  4R8P B;  4X23 D;  4ZUX A;  5AY8 A;  3V9R A;  3AYW B;  4ZUX D;  3A1I A;  5AY8 D;  1W2E A;  2CWE A;  1P3O D;  3W98 A;  5B40 D;  2DF4 C;  1P3M A;  2CV5 C;  2XD5 A;  1M19 D;  4LD9 D;  2NZD A;  5GSU C;  1ZLA B;  3REK C;  3REL B;  1TAF A;  3AZF C;  2Y2K A;  3MGS C;  1KX5 C;  4YS3 A;  1P3I A;  3X1V C;  3KUY B;  3MGP A;  3REI C;  1ID3 C;  1P3I D;  2RVQ D;  2JSS A;  4DQY B;  3KWQ D;  5B32 G;  3VH6 A;  5B1M B;  1P3O C;  4WV4 B;  5B40 C;  2PYO C;  1M19 C;  4LD9 C;  3WTP A;  4M6B A;  1P3A B;  2FJ7 A;  1EQZ B;  3LZ1 B;  5GT0 A;  3AN2 A;  2RVQ C;  5B0Y A;  4KUD A;  3LEL A;  3WAA A;  3B0B A;  4ZBJ C;  5KDM B;  3KWQ C;  2DQN C;  2Y2N A;  3AN2 D;  3WAA D;  5AV8 A;  3MGQ B;  4WU8 D;  2F8N G;  2YFW A;  2BYM B;  4YM6 B;  3X1T D;  1M18 B;  4XZQ B;  4H9S A;  1TZY B;  3MNN B;  3MGR C;  1H3O A;  3AZI A;  1P3P D;  5CP6 B;  3MVD A;  3AZM D;  3REJ D;  1AOI C;  3AZI D;  3UTA D;  3KSY A;  4G91 C;  4J8V A;  3W99 B;  3REI B;  4Z2M H;  4JJN D;  3WA9 B;  1BFM A;  1BH9 B;  1P34 C;  4WU8 C;  3EPH A;  2Y2H A;  4Z5T A;  3X1T C;  3AZL A;  3H0M C;  2ARO A;  3AV1 B;  3REH A;  2ZY3 A;  2ARO D;  5B24 A;  3REH D;  3W97 A;  1P3P C;  5B1L D;  3AZM C;  3REJ C;  5AV6 A;  3UTA C;  1KX4 A;  4NE3 A;  5B32 A;  1KX4 D;  2IO5 B;  3X1S A;  3AZE A;  3X1S D;  4JJN C;  4J8U B;  5JRG A;  4J8W A;  4H9R A;  3C1B C;  1P3G A;  5DNN A;  5GT3 A;  1M1A A;  4DRB A;  5DNN D;  2Y2J A;  1KX3 D;  4NE6 A;  3AFA A;  4WU9 A;  5B1L C;  4Z66 D;  3O62 B;  5CPI B;  5C3I C;  3C1C A;  3AZN A;  1R4V A;  3LJA B;  3AZJ D;  3H0L C;  2NQB A;  1S32 B;  2NQB D;  2F8N A;  3AL0 C;  4R8P A;  5CPJ B;  5BO0 B;  3AYW A;  5BNX B;  3B0D B;  5AVB B;  5E5A D;  2ZY4 A;  1KX3 C;  4KHA B;  4Z66 C;  3X1U C;  1ZLA A;  3UTB D;  3REL A;  3AZJ C;  2XD1 A;  5GXQ D;  1U35 D;  5B2I C;  3AZK D;  3KUY A;  3TU4 B;  5AV9 D;  5AVC B;  3W96 B;  4QLC D;  3LZ0 B;  2Y2O A;  4NFT A;  5B1M A;  1P3K D;  3AZH B;  2Y2M A;  4DRA A;  5E5A C;  5AV5 B;  5CPK B;  5DNM B;  4XUJ B;  3UTB C;  1U35 C;  5GXQ C;  3B0C T;  2J8P A;  3AZK C;  1HQ3 C;  3AV2 B;  1P3A A;  5B33 D;  3LZ1 A;  1EQZ A;  5AV9 C;  1EQZ D;  3LZ1 D;  5KDM A;  1F66 B;  4QLC C;  3MGQ A;  1P3F B;  1JFI B;  4G92 B;  2BYM A;  1P3K C;  5B2J B;  4YM6 A;  3W98 D;  1M18 A;  3B6G B;  5B0Z B;  4XZQ A;  5F99 C;  1TZY A;  3MNN A;  4XZQ D;  1P3M D;  5CP6 A;  1TZY D;  2NZD D;  2HIO B;  3KXB C;  2HUE C;  4CSR B;  2Y2P A;  3AZG C;  1HTA A;  3WKJ C;  3W99 A;  4YS3 D;  3REI A;  3UT9 B;  4H9N B;  4X23 C;  5B31 B;  2JE5 A;  5B33 C;  2F2A C;  3MGP D;  4EO5 B;  3B6F B;  4ZUX C;  3WA9 A;  5AY8 C;  1P3L B;  1BH9 A;  3W98 C;  2VQR A;  4J8X B;  3AV1 A;  1P3B B;  1Q9C A;  3WTP E;  1P3M C;  1PZR A;  3A6N B;  3AV1 D;  3WTP D;  2NZD C;  4KGC B;  4YS3 C;  2Y2G A;  1P3I C;  3IP4 C;  3MGP C;  2FJ7 D;  5GT0 D;  5B0Y D;  4KUD D;  4J8U A;  3LEL D;  2W8S A;  4J8U D;  5AV8 D;  2CV5 B;  5GSU B;  3REK B;  5CPI A;  3WTP C;  3O62 A;  3MVD D;  3AZF B;  3LJA A;  3MGS B;  1KX5 B;  3AZG B;  3X1V B;  3WKJ B;  1ID3 B;  1S32 A;  4J8V D;  2ZY2 A;  2FJ7 C;  1WWS A;  5GT0 C;  1S32 D;  3AN2 C;  5B0Y C;  5CPJ A;  4KUD C;  5BO0 A;  2LY8 A;  3WAA C;  3LEL C;  1P3O B;  5AV8 C;  5B31 G;  1T3U A;  5BNX A;  5B40 B;  2PYO B;  5AVB A;  3NQU B;  4Z5T D;  1B67 A;  3AZL D;  2F8N H;  5AVB D;  1M19 B;  4AWL C;  4H9S C;  4LD9 B;  2YFV B;  4KHA A;  5B24 D;  3AZI C;  3W97 D;  3MVD C;  5AV6 D;  2JCH A;  2Y2I A;  4J8V C;  5B32 D;  3TU4 A;  3KFU G;  4ZBJ B;  3AZE D;  3KWQ B;  5AVC A;  3VH5 W;  3W96 A;  5JRG D;  3LZ0 A;  2BG1 A;  4J8W D;  2ZY5 A;  3AZH A;  1P3G D;  4Z5T C;  3MGR B;  5GT3 D;  3AZL C;  1M1A D;  2ARO C;  5G49 B;  3REH C;  3A1K A;  5AV5 A;  5CPK A;  5DNM A;  4WNN B;  5B24 C;  4H9Q B;  4XUJ A;  4WU9 D;  3AFA D;  1AOI B;  5CPK D;  3W97 C;  3C1C D;  3AZN D;  4G91 B;  4XUJ D;  1KX4 C;  4HGA C;  5B32 C;  3AV2 A;  3X1S C;  2F8N D;  3AZE C;  5FUG B;  4R8P D;  1P34 B;  4WU8 B;  3AYW D;  1F66 A;  5JRG C;  3X1T B;  1P3F A;  4J8W C;  1JFI A;  1BH8 B;  1A7W A;  1P3G C;  5B2J A;  5DNN C;  5GT3 C;  3B6G A;  5B0Z A;  1M1A C;  1P3P B;  3B6G D;  3AZM B;  3REJ B;  3AFA C;  4WU9 C;  3UTA B;  2HIO A;  3C1C C;  4CSR A;  1ZLA D;  2BYK B;  3REL D;  2HIO D;  2NQB C;  4JJN B;  4H9N A;  3UT9 A;  5B31 A;  3KUY D;  4R8P C;  3UT9 D;  3B6F A;  1F1E A;  3AYW C;  1P3L A;  3C1B B;  5BS7 A;  2Y2L A;  5B1M D;  2FFF B;  4J8X A;  5JA4 B;  1P3B A;  5B1L B;  5C3I B;  3A6N A;  4H9P B;  3A6N D;  1ZLA C;  2UWX A;  3REL C;  4KGC A;  3KUY C;  1P3A D;  4CAY B;  3FDD A;  5BT1 D;  3MGQ D;  5B1M C;  4YM6 D;  2CV5 A;  1KX3 B;  1M18 D;  4Z66 B;  3X1U B;  5GSU A;  3MNN D;  3REK A;  3AZJ B;  5CP6 D;  3AZF A;  5B2I B;  3MGS A;  1KX5 A;  3EPK A;  3R45 B;  3AZG A;  3X1V A;  3AZF D;  3WKJ A;  2G5H C;  3MGS D;  1ID3 A;  3W99 D;  3REI D;  1P3A C;  4WZS B;  1EQZ C;  3LZ1 C;  4E44 A;  3WA9 D;  3VH5 T;  1P3O A;  5BT1 C;  3MGQ C;  5B40 A;  2PYO A;  5E5A B;  4YM6 C;  3NQU A;  2PYO D;  1M18 C;  4XZQ C;  1M19 A;  4LD9 A;  2YFV A;  2F8N K;  1TZY C;  3MNN C;  3UTB B;  3F6T A;  4UUZ B;  5GXQ B;  1U35 B;  5CP6 C;  3AZK B;  1HQ3 B;  3VH6 W;  5BNV B;  3W99 C;  5AV9 B;  3KWQ A;  4QLC B;  3WA9 C;  3EG5 B;  1P3K B;  1N1J B;  5F99 B;  3NQJ B;  3MGR A;  5G49 A;  3AV1 C;  3MGR D;  3KXB B;  2HUE B;  1AOI A;  4WNN A;  4H9Q A;  5CPI D;  3O62 D;  4H9O B;  1AOI D;  3LJA D;  4Z2M G;  4X23 B;  5B33 B;  2IO5 C;  4ZUX B;  5AY8 B;  3V9R B;  5FUG A;  1P34 A;  4WU8 A;  5CPJ D;  4J8U C;  5CHL B;  4WJ3 C;  1P34 D;  3W98 B;  3X1T A;  1BH8 A;  1P3M B;  1P3P A;  2NZD B;  2RIQ A;  3AZM A;  3REJ A;  5CPI C;  3UTA A;  1TAF B;  3O62 C;  3LJA C;  2BYK A;  4YS3 B;  1P3I B;  3MGP B;  3B0C W;  1S32 C;  4JJN A;  3TU4 D;  5CPJ C;  5AVC D;  3C1B A;  3W96 D;  3LZ0 D;  3B0D C;  3C1B D;  5AVB C;  3AZH D;  5JA4 A;  3VH5 A;  3WTP B;  1KU5 A;  1WWI A;  5B1L A;  5AV5 D;  5DNM D;  4H9P A;  5AV6 C;  2Y2Q A;  2FJ7 B;  5GT0 B;  3AN2 B;  5B0Y B;  3AV2 D;  4KUD B;  1B6W A;  3LEL B;  3TU4 C;  3WAA B;  4CAY A;  1ULY A;  5AV8 B;  5AVC C;  2YFW B;  5B0Z D;  3W96 C;  1F66 D;  4NE5 A;  3LZ0 C;  1P3F D;  4AWL B;  3AZH C;  5B2J D;  1KX3 A;  1H3O B;  4Z66 A;  3AZI B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...