2AROC

Crystal structure of the native histone octamer to 2.1 angstrom resolution, crystalised in the presence of s-nitrosoglutathione
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
95
structure length
95
Chain Sequence
YRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein
molecule keywords Histone H2A-IV
publication title The oxidised histone octamer does not form a H3 disulphide bond.
pubmed doi rcsb
total genus 31
structure length 95
sequence length 95
chains with identical sequence G
ec nomenclature
pdb deposition date 2005-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 2aroC00
5GXQD 3AZGA 1M19B 1HQ3C 3AV2A 4UUZA 5AV9C 3X1VC 2NQBC 1BH8A 4R8PB 3AZND 3AV1C 3W97D 4G91B 3MNNC 3AZJC 4JJNA 2CV5A 3AZFA 5G49A 1BFMA 5CPIA 4R8PD 4WU8B 4XZQA 5B40A 3MGRC 4X23B 4WU8D 5GT3B 5JA4A 4G92B 3AN2C 2F8NA 3X1SB 4X23D 3UTBA 1S32B 5GT3D 5CP6C 3RELB 1M1AC 3A6NB 3B6GB 2AROA 3X1SD 5KDMA 2BYMA 1H3OB 1S32D 3RELD 3A6ND 3B6GD 4J8WA 3C1BB 1P3AB 1P3GC 5B33B 3W96C 5GSUC 5B2IB 1F66B 4WU9A 5BS7A 4X23A 4WNNA 3C1BD 5AV6C 3LJAB 1P3AD 4CSRB 5B33D 3WAAB 3AZKA 3C1CC 5B2ID 1F66D 1P3BC 3AZEB 4HGAB 5GT0B 5AVCC 5DNNC 1ZLAC 1S32A 1P3OA 3LJAD 3WAAD 2YFVB 1AOIC 3REHC 1EQZC 3W99A 1KX4B 1U35B 1P3KB 3X1UC 5E5AA 1M19C 5FUGB 3AZED 5B0YC 3B6FA 4YS3C 3MGSB 5GT0D 4ZBJB 3REJC 4R8PC 3KXBA 2LY8A 4G91C 1KX4D 1U35D 1P3KD 5CPJC 3MGSD 4KUDD 1N1JB 1HQ3B 5B1MC 3X1TA 2NQBB 3V9RA 3AV1B 3WKJC 3WA9C 3NQUA 5DNMC 4Z66A 1HQ3D 2JSSA 1WWIA 4G92C 4QLCB 2NQBD 3KSYA 5CPKB 4Z5TB 3AV1D 2PYOA 4J8XA 4KHAB 3MGRB 3A6NC 4QLCD 4EO5C 5CPKD 4KUDA 4Z5TD 1TZYC 1P3LA 2FJ7C 3AN2B 3O62C 3MGRD 4KGCC 1A7WA 5AV8A 3AFAC 2YFWB 3LZ0C 5CP6B 1P3PA 5AV9A 3X1VA 3R45A 1M1AB 3AN2D 1JFIB 4LD9C 4M6BA 3WTPE 5JRGC 3VH5W 4J8VC 4CAYA 3MNNA 3LELC 4H9PB 3AZJA 3KWQA 5CP6D 5AV5B 1TAFB 1M1AD 4WV4B 3AYWA 5B0ZC 3REKB 1P3GB 3W96B 5B1LA 4YM6A 5GSUB 3AZIA 5AV5D 3AZMC 4J8UC 3TU4C 3UTAA 1P3KC 3REIA 5AV6B 3REKD 1P3GD 3MVDC 3W96D 5GSUD 3C1CB 1P3BB 5AVCB 1ZLAB 5DNNB 5AY8B 5AV6D 3KUYA 3W98A 1P34C 1AOIB 1M1AA 3REHB 1EQZB 3LZ1A 1WWSA 5B32G 3X1UB 3C1CD 1P3BD 5B0YB 4YS3B 3VH6W 4H9RA 5B32C 5AVCD 5DNND 5B24A 1ZLAD 5AY8D 3REJB 1AOID 2IO5B 3REHD 1EQZD 4E45A 4NE5A 1M19D 3X1UD 3AZLA 5B0YD 4YS3D 5CPJB 3NQJA 4QLCC 4H9NA 3REJD 5CPKC 4Z5TC 3AZHB 5B2JA 5B1MB 1M18A 5CPJD 3WKJB 3WA9B 4H9SC 5GXQA 3C1CA 3AZHD 4XUJC 5DNMB 5B1MD 1BH9B 3AZNA 3W97A 3WKJD 1EQZA 3WA9D 1M19A 3VH5T 5DNMD 1KX3C 2NZDC 1P3FC 4R8PA 4EO5B 3B0DC 1TZYB 3MGQB 2F8NK 4Z2MH 2FJ7B 1P3IB 3O62B 5AV5C 4KGCB 3AFAB 1HTAA 4WU8A 3LZ0B 3REKC 1TZYD 2FJ7D 4ZUXC 1P3ID 4LD9B 3O62D 5JRGB 4J8VB 4KGCD 3AFAD 3LELB 1ID3C 3LZ0D 5GT3A 4H9OB 4DRAA 3X1SA 4LD9D 5JRGD 5B0ZB 4J8VD 3AZGC 3LELD 5AY8C 3VH6T 3RELA 3A6NA 3B6GA 3AZMB 4J8UB 3TU4B 5F99B 5B0ZD 4E44A 1H3OA 3MVDB 4JJNC 3AZFC 2CV5C 3MGPB 2IO5C 5AVBB 3AZMD 4J8UD 3TU4D 3C1BA 5F99D 4NE6A 5B40C 5B33A 1P3AA 3MVDD 1P34B 5B2IA 1F66A 3MGPD 3AZHC 1R4VA 5AVBD 5B32B 3LJAA 4CSRA 3WAAA 5BNXB 1P34D 3AZEA 1B6WA 5GT0A 5C3IC 5B32D 2HIOB 2F8NH 2YFVA 1KX4A 1U35A 1P3KA 5FUGA 3MGSA 2HIOD 4XUJB 4J8WC 3MGQC 1B67A 1P3IC 4WU9C 4H9QB 2L5AA 1N1JA 1HQ3A 4XUJD 1KX3B 2NZDB 2NQBA 5B31B 1P3FB 3AZKC 3AV1A 3B0DB 1KX5B 1P3OC 1KX3D 2NZDD 4QLCA 5B31D 5BT1D 1P3FD 2BYKB 5CPKA 4Z5TA 3W99C 2HUEC 3B6FC 1KX5D 4KHAA 4ZUXB 3KXBC 3MGRA 1P3MB 4NE3A 5BNVB 5F99C 1ID3B 3UT9B 3AN2A 3MGPC 4ZUXD 5AVBC 3AZGB 2YFWA 1P3MD 3AV2B 1ID3D 4UUZB 5CP6A 3X1TC 1BH8B 4WZSB 3UT9D 1JFIA 2RVQC 3WTPC 4NFTA 3B0CW 3AZGD 4Z66C 4JJNB 4H9PA 3AZFB 2CV5B 5G49B 3AV2D 5CHLB 1TAFA 5AV5A 5CPIB 4XZQB 3REKA 5B40B 1P3GA 2PYOC 4J8XC 1ULYA 3W96A 4JJND 3AZFD 2CV5D 5GSUA 2HIOC 5CPID 4XZQD 5AV6A 5JA4B 5B40D 1P3LC 2F8NB 5AV8C 1P3BA 3UTBB 5AVCA 1ZLAA 5DNNA 5C3IB 5AY8A 1P3PC 1AOIA 2AROB 2F8ND 4Z2MG 3REHA 5KDMB 2BYMB 3X1UA 5B31G 5B0YA 3UTBD 4YS3A 3KWQC 5B31C 5BT1C 3REJA 2CWEA 2AROD 4J8WB 1KX5C 3AYWC 5B1LC 5CPJA 4YM6C 3AZIC 4WU9B 3AZHA 4WNNB 3UTAC 4J8WD 5B1MA 3REIC 3MGQD 3AZKB 3WKJA 3WA9A 1P3MC 4WU9D 5DNMA 1P3OB 3W98C 1BH9A 3KUYC 3UT9C 1F1EA 3AZKD 3LZ1C 3W99B 2HUEB 3B6FB 5E5AB 3AV2C 5B24C 3B0CT 1P3OD 3KXBB 3W99D 1TZYA 3B6FD 5E5AD 3MGQA 3AZLC 2FJ7A 5BO0B 4DRBA 1P3IA 3O62A 5CPIC 3KXBD 4KGCA 3AFAA 4XZQC 5B2JC 3LZ0A 1M18C 3X1TB 4AWLB 3V9RB 4LD9A 3WTPB 5GXQC 5JRGA 4J8VA 3NQUB 2F8NG 4Z66B 3LELA 4H9OA 3X1TD 3AZNC 3W97C 2RVQD 3WTPD 3UTBC 5B0ZA 2PYOB 4J8XB 4Z66D 2AROC 3VH5A 3AZMA 4J8UA 3TU4A 4KUDB 5F99A 1P3LB 2PYOD 3MVDA 4J8XD 1KU5A 5BO0A 3MGPA 5AV8B 5AVBA 4WU8C 1P3PB 5AV9B 3X1VB 3R45B 1P3LD 1P34A 5BS7C 3B0BA 4X23C 5AV8D 3WTPA 4CAYB 3MNNB 3AZJB 5GT3C 5B32A 3KWQB 1P3PD 5AV9D 3X1VD 5BNXA 3X1SC 1Q9CA 3AYWB 3MNND 5B1LB 3AZJD 1S32C 4YM6B 3KWQD 3AZIB 2HIOA 3RELC 3B6GC 3UTAB 3VH6A 5E5AC 3REIB 3AYWD 5B1LD 4YM6D 3AZID 4H9SA 4XUJA 3C1BC 3UTAD 3REID 1P3AC 3W98B 3KUYB 5B33C 5B2IC 3LZ1B 1F66C 4H9QA 4H9RB 5B24B 1KX3A 3LJAC 3W98D 2NZDA 3WAAC 3KUYD 5B31A 4AWLC 1P3FA 3LZ1D 3AZEC 1KX5A 3AZLB 4HGAC 5GT0C 5B24D 3NQJB 4H9NB 2BYKA 5B2JB 1KX4C 1U35C 1M18B 3AZLD 3MGSC 4ZBJC 4ZUXA 5GXQB 4KUDC 1P3MA 5BNVA 5B2JD 1ID3A 1M18D 3AZNB 3UT9A 3W97B
chains in the Genus database with same CATH superfamily
5GXQD 3AZGA 1M19B 1HQ3C 3AV2A 4UUZA 5AV9C 3X1VC 2NQBC 2Y2LA 1BH8A 4R8PB 3AZND 3AV1C 3W97D 4G91B 3MNNC 3AZJC 2UWXA 4JJNA 2CV5A 3AZFA 5G49A 1BFMA 5CPIA 4R8PD 4WU8B 4XZQA 5B40A 3MGRC 4X23B 3A1KA 4WU8D 5GT3B 3EG5B 5JA4A 4G92B 3AN2C 2F8NA 3X1SB 4X23D 3UTBA 1S32B 5GT3D 5CP6C 3RELB 1M1AC 3A6NB 3B6GB 2AROA 3X1SD 5KDMA 2BYMA 1H3OB 1S32D 3RELD 3A6ND 3B6GD 4J8WA 3C1BB 1P3AB 1P3GC 5B33B 3W96C 5GSUC 5B2IB 1F66B 4WU9A 5BS7A 4X23A 4WNNA 3C1BD 5AV6C 3LJAB 1P3AD 4CSRB 5B33D 3WAAB 3AZKA 3C1CC 3P5JB 5B2ID 1P3BC 1F66D 3AZEB 4HGAB 5GT0B 5AVCC 5DNNC 1ZLAC 1S32A 1P3OA 3EPHA 3LJAD 3WAAD 2YFVB 1AOIC 1T3UA 3REHC 1EQZC 3W99A 1KX4B 1U35B 1P3KB 3X1UC 5E5AA 1M19C 5FUGB 3AZED 5B0YC 3B6FA 4YS3C 3MGSB 5GT0D 4ZBJB 3REJC 4R8PC 3KXBA 2LY8A 4G91C 1KX4D 1U35D 1P3KD 5CPJC 3MGSD 3AL0C 2Y2HA 4KUDD 1N1JB 1HQ3B 1Z2CB 5B1MC 3X1TA 2NQBB 3V9RA 3AV1B 3WKJC 3WA9C 3EPKA 3NQUA 5DNMC 4Z66A 1HQ3D 2JSSA 1WWIA 4G92C 4QLCB 2NQBD 3KSYA 2BG1A 5CPKB 4Z5TB 3AV1D 2Y2QA 2PYOA 4J8XA 4KHAB 2Y2OA 3MGRB 3A6NC 4QLCD 4EO5C 5CPKD 4KUDA 4Z5TD 1TZYC 1P3LA 2FJ7C 3AN2B 3O62C 3MGRD 4KGCC 1A7WA 5AV8A 3AFAC 2YFWB 2JCHA 3LZ0C 5CP6B 1P3PA 5AV9A 3X1VA 3R45A 1M1AB 3AN2D 1JFIB 4LD9C 4M6BA 3WTPE 5JRGC 3VH5W 3F6TA 4J8VC 4CAYA 3MNNA 3LELC 4H9PB 3AZJA 3KWQA 5CP6D 5AV5B 1TAFB 1M1AD 4WV4B 3AYWA 5B0ZC 3REKB 1P3GB 3W96B 5B1LA 4YM6A 5GSUB 3AZIA 5AV5D 3AZMC 4J8UC 3TU4C 3UTAA 1P3KC 3REIA 5AV6B 3REKD 1P3GD 3MVDC 3W96D 5GSUD 3C1CB 1P3BB 2XD5A 5AVCB 5DNNB 1ZLAB 5AY8B 5AV6D 3KUYA 3W98A 1P34C 1AOIB 1M1AA 3REHB 1EQZB 3LZ1A 1WWSA 5B32G 3X1UB 3C1CD 1P3BD 5B0YB 4YS3B 3VH6W 4H9RA 5B32C 5AVCD 2DF4C 3A1IA 5DNND 5B24A 5AY8D 3REJB 1ZLAD 1AOID 2IO5B 3REHD 1EQZD 4E45A 4NE5A 1M19D 3X1UD 3AZLA 5B0YD 4YS3D 5CPJB 3NQJA 4QLCC 4H9NA 3REJD 2RIQA 5CPKC 4Z5TC 3AZHB 5B2JA 5B1MB 1M18A 5CPJD 3WKJB 3WA9B 4H9SC 5GXQA 3C1CA 3AZHD 4XUJC 5DNMB 5B1MD 1BH9B 3AZNA 3W97A 3WKJD 1EQZA 3WA9D 1M19A 3VH5T 5DNMD 1KX3C 2NZDC 1P3FC 2ZY2A 4R8PA 4EO5B 3B0DC 1TZYB 3MGQB 2F8NK 4Z2MH 2FJ7B 1P3IB 3FDDA 3H0RC 5AV5C 3O62B 2Y2IA 4KGCB 3AFAB 1HTAA 4WU8A 3LZ0B 3REKC 1TZYD 2FJ7D 4ZUXC 1P3ID 4LD9B 3O62D 5JRGB 4J8VB 4KGCD 3AFAD 2Y2PA 3LELB 1ID3C 3LZ0D 5GT3A 4H9OB 4DRAA 3X1SA 4LD9D 5JRGD 5B0ZB 4J8VD 3AZGC 3LELD 5AY8C 3VH6T 3RELA 3A6NA 3B6GA 3AZMB 4J8UB 3TU4B 2F2AC 5F99B 5B0ZD 2Y2MA 4E44A 1H3OA 3MVDB 4JJNC 3AZFC 2CV5C 3MGPB 2IO5C 5AVBB 3AZMD 4J8UD 3TU4D 3C1BA 5F99D 4NE6A 5B40C 5B33A 1P3AA 3MVDD 1P34B 5B2IA 1F66A 3MGPD 3AZHC 1R4VA 5AVBD 5B32B 3LJAA 4CSRA 3WAAA 5BNXB 1P34D 3AZEA 1B6WA 5GT0A 5C3IC 5B32D 2HIOB 2F8NH 2YFVA 1KX4A 1U35A 1P3KA 4UPKA 5FUGA 3MGSA 2J8PA 2FFFB 2HIOD 4XUJB 4J8WC 3MGQC 1B67A 1P3IC 4WU9C 4H9QB 2L5AA 1N1JA 1HQ3A 4XUJD 1KX3B 2NZDB 2NQBA 5B31B 1P3FB 3AZKC 3AV1A 3B0DB 1KX5B 1P3OC 1KX3D 2ZM5A 4QLCA 2NZDD 5B31D 5BT1D 1P3FD 2BYKB 5CPKA 4Z5TA 3W99C 2HUEC 3B6FC 1KX5D 4KHAA 4ZUXB 3KXBC 3MGRA 1P3MB 4NE3A 5BNVB 5F99C 1ID3B 3UT9B 3AN2A 3MGPC 4ZUXD 5AVBC 3AZGB 2YFWA 1P3MD 3AV2B 1ID3D 4UUZB 5CP6A 3X1TC 2ZY4A 1BH8B 4WZSB 3UT9D 2ZY5A 1JFIA 2RVQC 3WTPC 4NFTA 3B0CW 3AZGD 4Z66C 4JJNB 4H9PA 3AZFB 2CV5B 5G49B 3AV2D 2Y2NA 1TAFA 5CHLB 5AV5A 5CPIB 4XZQB 3REKA 5B40B 1P3GA 2PYOC 4J8XC 1ULYA 3W96A 4JJND 3AZFD 2CV5D 5GSUA 2HIOC 3EPJA 5CPID 4XZQD 5AV6A 5JA4B 5B40D 1P3LC 2F8NB 5AV8C 1P3BA 2JE5A 3UTBB 5AVCA 1ZLAA 5DNNA 5C3IB 5AY8A 3EPLA 1P3PC 1AOIA 2AROB 2F8ND 4Z2MG 3REHA 5KDMB 2BYMB 3X1UA 5B31G 5B0YA 3UTBD 4YS3A 3KWQC 5B31C 5BT1C 3REJA 2CWEA 2AROD 4J8WB 1KX5C 3AYWC 5B1LC 5CPJA 4YM6C 3AZIC 4WU9B 2XD1A 3H0LC 4WNNB 3AZHA 1W2EA 3UTAC 4J8WD 5B1MA 3REIC 3MGQD 3AZKB 3WKJA 3WA9A 1P3MC 4WU9D 5DNMA 1P3OB 3W98C 1BH9A 3KUYC 3H0MC 3UT9C 1F1EA 3AZKD 3LZ1C 3W99B 2HUEB 3B6FB 5E5AB 3AV2C 5B24C 3B0CT 1P3OD 3KXBB 2Y2GA 3W99D 1TZYA 3B6FD 5E5AD 3MGQA 3AZLC 2FJ7A 5BO0B 4DRBA 1P3IA 3O62A 5CPIC 1PZRA 3KXBD 4KGCA 3AFAA 4XZQC 5B2JC 3LZ0A 1M18C 3X1TB 4AWLB 3V9RB 4LD9A 3WTPB 5GXQC 5JRGA 4J8VA 3NQUB 2F8NG 4Z66B 3LELA 4H9OA 3X1TD 3AZNC 3W97C 2RVQD 3WTPD 3UTBC 5B0ZA 2PYOB 4J8XB 4Z66D 2AROC 3VH5A 2Y2KA 3AZMA 4J8UA 3TU4A 4KUDB 3KFUG 5F99A 1P3LB 2PYOD 3MVDA 4J8XD 1KU5A 5BO0A 2ZY3A 3MGPA 5AV8B 5AVBA 4WU8C 1P3PB 5AV9B 3X1VB 3R45B 1P3LD 1P34A 3IP4C 5BS7C 3B0BA 4X23C 5AV8D 3WTPA 2Y2JA 4CAYB 3MNNB 3AZJB 5GT3C 5B32A 3KWQB 1P3PD 5AV9D 3X1VD 5BNXA 3X1SC 1Q9CA 3AYWB 3MNND 5B1LB 3AZJD 1S32C 4YM6B 3KWQD 3AZIB 2HIOA 3RELC 3B6GC 2G5HC 3VH6A 5E5AC 3UTAB 3REIB 3AYWD 5B1LD 4WJ3C 4YM6D 4DQYB 3AZID 4H9SA 4XUJA 3C1BC 3UTAD 3REID 1P3AC 3W98B 3KUYB 5B33C 2DQNC 5B2IC 3LZ1B 1F66C 2W8SA 4H9QA 4H9RB 5B24B 2VQRA 1KX3A 3LJAC 3W98D 2NZDA 3WAAC 3KUYD 5B31A 4AWLC 1P3FA 3LZ1D 3AZEC 1KX5A 3AZLB 4HGAC 5GT0C 5B24D 3NQJB 4H9NB 2BYKA 5B2JB 1KX4C 1U35C 1M18B 3AZLD 3MGSC 4ZBJC 4ZUXA 2G5IC 5GXQB 4KUDC 1P3MA 5BNVA 5B2JD 1ID3A 1M18D 3AZNB 3UT9A 3W97B
chains in the Genus database with same CATH topology
5GXQD 3AZGA 1M19B 1HQ3C 3AV2A 4UUZA 5AV9C 3X1VC 2NQBC 2Y2LA 1BH8A 4R8PB 3AZND 3AV1C 3W97D 4G91B 3MNNC 3AZJC 2UWXA 4JJNA 2CV5A 3AZFA 5G49A 1BFMA 5CPIA 4R8PD 4WU8B 4XZQA 5B40A 3MGRC 4X23B 3A1KA 4WU8D 5GT3B 3EG5B 5JA4A 4G92B 3AN2C 2F8NA 3X1SB 4X23D 3UTBA 1S32B 5GT3D 5CP6C 3RELB 1M1AC 3A6NB 3B6GB 2AROA 3X1SD 5KDMA 2BYMA 1H3OB 1S32D 3RELD 3A6ND 3B6GD 4J8WA 3C1BB 1P3AB 1P3GC 5B33B 3W96C 5GSUC 5B2IB 1F66B 4WU9A 5BS7A 4X23A 4WNNA 3C1BD 5AV6C 3LJAB 1P3AD 4CSRB 5B33D 3WAAB 3AZKA 3C1CC 3P5JB 5B2ID 1P3BC 1F66D 3AZEB 4HGAB 5GT0B 5AVCC 5DNNC 1ZLAC 1S32A 1P3OA 3EPHA 3LJAD 3WAAD 2YFVB 1AOIC 1T3UA 3REHC 1EQZC 3W99A 1KX4B 1U35B 1P3KB 3X1UC 5E5AA 1M19C 5FUGB 3AZED 5B0YC 3B6FA 4YS3C 3MGSB 5GT0D 4ZBJB 3REJC 4R8PC 3KXBA 2LY8A 4G91C 1KX4D 1U35D 1P3KD 5CPJC 3MGSD 3AL0C 2Y2HA 4KUDD 1N1JB 1HQ3B 1Z2CB 5B1MC 3X1TA 2NQBB 3V9RA 3AV1B 3WKJC 3WA9C 3EPKA 3NQUA 5DNMC 4Z66A 1HQ3D 2JSSA 1WWIA 4G92C 4QLCB 2NQBD 3KSYA 2BG1A 5CPKB 4Z5TB 3AV1D 2Y2QA 2PYOA 4J8XA 4KHAB 2Y2OA 3MGRB 3A6NC 4QLCD 4EO5C 5CPKD 4KUDA 4Z5TD 1TZYC 1P3LA 2FJ7C 3AN2B 3O62C 3MGRD 4KGCC 1A7WA 5AV8A 3AFAC 2YFWB 2JCHA 3LZ0C 5CP6B 1P3PA 5AV9A 3X1VA 3R45A 1M1AB 3AN2D 1JFIB 4LD9C 4M6BA 3WTPE 5JRGC 3VH5W 3F6TA 4J8VC 4CAYA 3MNNA 3LELC 4H9PB 3AZJA 3KWQA 5CP6D 5AV5B 1TAFB 1M1AD 4WV4B 3AYWA 5B0ZC 3REKB 1P3GB 3W96B 5B1LA 4YM6A 5GSUB 3AZIA 5AV5D 3AZMC 4J8UC 3TU4C 3UTAA 1P3KC 3REIA 5AV6B 3REKD 1P3GD 3MVDC 3W96D 5GSUD 3C1CB 1P3BB 2XD5A 5AVCB 5DNNB 1ZLAB 5AY8B 5AV6D 3KUYA 3W98A 1P34C 1AOIB 1M1AA 3REHB 1EQZB 3LZ1A 1WWSA 5B32G 3X1UB 3C1CD 1P3BD 5B0YB 4YS3B 3VH6W 4H9RA 5B32C 5AVCD 2DF4C 3A1IA 5DNND 5B24A 5AY8D 3REJB 1ZLAD 1AOID 2IO5B 3REHD 1EQZD 4E45A 4NE5A 1M19D 3X1UD 3AZLA 5B0YD 4YS3D 5CPJB 3NQJA 4QLCC 4H9NA 3REJD 2RIQA 5CPKC 4Z5TC 3AZHB 5B2JA 5B1MB 1M18A 5CPJD 3WKJB 3WA9B 4H9SC 5GXQA 3C1CA 3AZHD 4XUJC 5DNMB 5B1MD 1BH9B 3AZNA 3W97A 3WKJD 1EQZA 3WA9D 1M19A 3VH5T 5DNMD 1KX3C 2NZDC 1P3FC 2ZY2A 4R8PA 4EO5B 3B0DC 1TZYB 3MGQB 2F8NK 4Z2MH 2FJ7B 1P3IB 3FDDA 3H0RC 5AV5C 3O62B 2Y2IA 4KGCB 3AFAB 1HTAA 4WU8A 3LZ0B 3REKC 1TZYD 2FJ7D 4ZUXC 1P3ID 4LD9B 3O62D 5JRGB 4J8VB 4KGCD 3AFAD 2Y2PA 3LELB 1ID3C 3LZ0D 5GT3A 4H9OB 4DRAA 3X1SA 4LD9D 5JRGD 5B0ZB 4J8VD 3AZGC 3LELD 5AY8C 3VH6T 3RELA 3A6NA 3B6GA 3AZMB 4J8UB 3TU4B 2F2AC 5F99B 5B0ZD 2Y2MA 4E44A 1H3OA 3MVDB 4JJNC 3AZFC 2CV5C 3MGPB 2IO5C 5AVBB 3AZMD 4J8UD 3TU4D 3C1BA 5F99D 4NE6A 5B40C 5B33A 1P3AA 3MVDD 1P34B 5B2IA 1F66A 3MGPD 3AZHC 1R4VA 5AVBD 5B32B 3LJAA 4CSRA 3WAAA 5BNXB 1P34D 3AZEA 1B6WA 5GT0A 5C3IC 5B32D 2HIOB 2F8NH 2YFVA 1KX4A 1U35A 1P3KA 4UPKA 5FUGA 3MGSA 2J8PA 2FFFB 2HIOD 4XUJB 4J8WC 3MGQC 1B67A 1P3IC 4WU9C 4H9QB 2L5AA 1N1JA 1HQ3A 4XUJD 1KX3B 2NZDB 2NQBA 5B31B 1P3FB 3AZKC 3AV1A 3B0DB 1KX5B 1P3OC 1KX3D 2ZM5A 4QLCA 2NZDD 5B31D 5BT1D 1P3FD 2BYKB 5CPKA 4Z5TA 3W99C 2HUEC 3B6FC 1KX5D 4KHAA 4ZUXB 3KXBC 3MGRA 1P3MB 4NE3A 5BNVB 5F99C 1ID3B 3UT9B 3AN2A 3MGPC 4ZUXD 5AVBC 3AZGB 2YFWA 1P3MD 3AV2B 1ID3D 4UUZB 5CP6A 3X1TC 2ZY4A 1BH8B 4WZSB 3UT9D 2ZY5A 1JFIA 2RVQC 3WTPC 4NFTA 3B0CW 3AZGD 4Z66C 4JJNB 4H9PA 3AZFB 2CV5B 5G49B 3AV2D 2Y2NA 1TAFA 5CHLB 5AV5A 5CPIB 4XZQB 3REKA 5B40B 1P3GA 2PYOC 4J8XC 1ULYA 3W96A 4JJND 3AZFD 2CV5D 5GSUA 2HIOC 3EPJA 5CPID 4XZQD 5AV6A 5JA4B 5B40D 1P3LC 2F8NB 5AV8C 1P3BA 2JE5A 3UTBB 5AVCA 1ZLAA 5DNNA 5C3IB 5AY8A 3EPLA 1P3PC 1AOIA 2AROB 2F8ND 4Z2MG 3REHA 5KDMB 2BYMB 3X1UA 5B31G 5B0YA 3UTBD 4YS3A 3KWQC 5B31C 5BT1C 3REJA 2CWEA 2AROD 4J8WB 1KX5C 3AYWC 5B1LC 5CPJA 4YM6C 3AZIC 4WU9B 2XD1A 3H0LC 4WNNB 3AZHA 1W2EA 3UTAC 4J8WD 5B1MA 3REIC 3MGQD 3AZKB 3WKJA 3WA9A 1P3MC 4WU9D 5DNMA 1P3OB 3W98C 1BH9A 3KUYC 3H0MC 3UT9C 1F1EA 3AZKD 3LZ1C 3W99B 2HUEB 3B6FB 5E5AB 3AV2C 5B24C 3B0CT 1P3OD 3KXBB 2Y2GA 3W99D 1TZYA 3B6FD 5E5AD 3MGQA 3AZLC 2FJ7A 5BO0B 4DRBA 1P3IA 3O62A 5CPIC 1PZRA 3KXBD 4KGCA 3AFAA 4XZQC 5B2JC 3LZ0A 1M18C 3X1TB 4AWLB 3V9RB 4LD9A 3WTPB 5GXQC 5JRGA 4J8VA 3NQUB 2F8NG 4Z66B 3LELA 4H9OA 3X1TD 3AZNC 3W97C 2RVQD 3WTPD 3UTBC 5B0ZA 2PYOB 4J8XB 4Z66D 2AROC 3VH5A 2Y2KA 3AZMA 4J8UA 3TU4A 4KUDB 3KFUG 5F99A 1P3LB 2PYOD 3MVDA 4J8XD 1KU5A 5BO0A 2ZY3A 3MGPA 5AV8B 5AVBA 4WU8C 1P3PB 5AV9B 3X1VB 3R45B 1P3LD 1P34A 3IP4C 5BS7C 3B0BA 4X23C 5AV8D 3WTPA 2Y2JA 4CAYB 3MNNB 3AZJB 5GT3C 5B32A 3KWQB 1P3PD 5AV9D 3X1VD 5BNXA 3X1SC 1Q9CA 3AYWB 3MNND 5B1LB 3AZJD 1S32C 4YM6B 3KWQD 3AZIB 2HIOA 3RELC 3B6GC 2G5HC 3VH6A 5E5AC 3UTAB 3REIB 3AYWD 5B1LD 4WJ3C 4YM6D 4DQYB 3AZID 4H9SA 4XUJA 3C1BC 3UTAD 3REID 1P3AC 3W98B 3KUYB 5B33C 2DQNC 5B2IC 3LZ1B 1F66C 2W8SA 4H9QA 4H9RB 5B24B 2VQRA 1KX3A 3LJAC 3W98D 2NZDA 3WAAC 3KUYD 5B31A 4AWLC 1P3FA 3LZ1D 3AZEC 1KX5A 3AZLB 4HGAC 5GT0C 5B24D 3NQJB 4H9NB 2BYKA 5B2JB 1KX4C 1U35C 1M18B 3AZLD 3MGSC 4ZBJC 4ZUXA 2G5IC 5GXQB 4KUDC 1P3MA 5BNVA 5B2JD 1ID3A 1M18D 3AZNB 3UT9A 3W97B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GXQ D;  3AZG A;  1M19 B;  1HQ3 C;  3AV2 A;  4UUZ A;  5AV9 C;  3X1V C;  2NQB C;  1BH8 A;  4R8P B;  3AZN D;  3AV1 C;  3W97 D;  4G91 B;  3MNN C;  3AZJ C;  4JJN A;  2CV5 A;  3AZF A;  5G49 A;  1BFM A;  5CPI A;  4R8P D;  4WU8 B;  4XZQ A;  5B40 A;  3MGR C;  4X23 B;  4WU8 D;  5GT3 B;  5JA4 A;  4G92 B;  3AN2 C;  2F8N A;  3X1S B;  4X23 D;  3UTB A;  1S32 B;  5GT3 D;  5CP6 C;  3REL B;  1M1A C;  3A6N B;  3B6G B;  2ARO A;  3X1S D;  5KDM A;  2BYM A;  1H3O B;  1S32 D;  3REL D;  3A6N D;  3B6G D;  4J8W A;  3C1B B;  1P3A B;  1P3G C;  5B33 B;  3W96 C;  5GSU C;  5B2I B;  1F66 B;  4WU9 A;  5BS7 A;  4X23 A;  4WNN A;  3C1B D;  5AV6 C;  3LJA B;  1P3A D;  4CSR B;  5B33 D;  3WAA B;  3AZK A;  3C1C C;  5B2I D;  1F66 D;  1P3B C;  3AZE B;  4HGA B;  5GT0 B;  5AVC C;  5DNN C;  1ZLA C;  1S32 A;  1P3O A;  3LJA D;  3WAA D;  2YFV B;  1AOI C;  3REH C;  1EQZ C;  3W99 A;  1KX4 B;  1U35 B;  1P3K B;  3X1U C;  5E5A A;  1M19 C;  5FUG B;  3AZE D;  5B0Y C;  3B6F A;  4YS3 C;  3MGS B;  5GT0 D;  4ZBJ B;  3REJ C;  4R8P C;  3KXB A;  2LY8 A;  4G91 C;  1KX4 D;  1U35 D;  1P3K D;  5CPJ C;  3MGS D;  4KUD D;  1N1J B;  1HQ3 B;  5B1M C;  3X1T A;  2NQB B;  3V9R A;  3AV1 B;  3WKJ C;  3WA9 C;  3NQU A;  5DNM C;  4Z66 A;  1HQ3 D;  2JSS A;  1WWI A;  4G92 C;  4QLC B;  2NQB D;  3KSY A;  5CPK B;  4Z5T B;  3AV1 D;  2PYO A;  4J8X A;  4KHA B;  3MGR B;  3A6N C;  4QLC D;  4EO5 C;  5CPK D;  4KUD A;  4Z5T D;  1TZY C;  1P3L A;  2FJ7 C;  3AN2 B;  3O62 C;  3MGR D;  4KGC C;  1A7W A;  5AV8 A;  3AFA C;  2YFW B;  3LZ0 C;  5CP6 B;  1P3P A;  5AV9 A;  3X1V A;  3R45 A;  1M1A B;  3AN2 D;  1JFI B;  4LD9 C;  4M6B A;  3WTP E;  5JRG C;  3VH5 W;  4J8V C;  4CAY A;  3MNN A;  3LEL C;  4H9P B;  3AZJ A;  3KWQ A;  5CP6 D;  5AV5 B;  1TAF B;  1M1A D;  4WV4 B;  3AYW A;  5B0Z C;  3REK B;  1P3G B;  3W96 B;  5B1L A;  4YM6 A;  5GSU B;  3AZI A;  5AV5 D;  3AZM C;  4J8U C;  3TU4 C;  3UTA A;  1P3K C;  3REI A;  5AV6 B;  3REK D;  1P3G D;  3MVD C;  3W96 D;  5GSU D;  3C1C B;  1P3B B;  5AVC B;  1ZLA B;  5DNN B;  5AY8 B;  5AV6 D;  3KUY A;  3W98 A;  1P34 C;  1AOI B;  1M1A A;  3REH B;  1EQZ B;  3LZ1 A;  1WWS A;  5B32 G;  3X1U B;  3C1C D;  1P3B D;  5B0Y B;  4YS3 B;  3VH6 W;  4H9R A;  5B32 C;  5AVC D;  5DNN D;  5B24 A;  1ZLA D;  5AY8 D;  3REJ B;  1AOI D;  2IO5 B;  3REH D;  1EQZ D;  4E45 A;  4NE5 A;  1M19 D;  3X1U D;  3AZL A;  5B0Y D;  4YS3 D;  5CPJ B;  3NQJ A;  4QLC C;  4H9N A;  3REJ D;  5CPK C;  4Z5T C;  3AZH B;  5B2J A;  5B1M B;  1M18 A;  5CPJ D;  3WKJ B;  3WA9 B;  4H9S C;  5GXQ A;  3C1C A;  3AZH D;  4XUJ C;  5DNM B;  5B1M D;  1BH9 B;  3AZN A;  3W97 A;  3WKJ D;  1EQZ A;  3WA9 D;  1M19 A;  3VH5 T;  5DNM D;  1KX3 C;  2NZD C;  1P3F C;  4R8P A;  4EO5 B;  3B0D C;  1TZY B;  3MGQ B;  2F8N K;  4Z2M H;  2FJ7 B;  1P3I B;  3O62 B;  5AV5 C;  4KGC B;  3AFA B;  1HTA A;  4WU8 A;  3LZ0 B;  3REK C;  1TZY D;  2FJ7 D;  4ZUX C;  1P3I D;  4LD9 B;  3O62 D;  5JRG B;  4J8V B;  4KGC D;  3AFA D;  3LEL B;  1ID3 C;  3LZ0 D;  5GT3 A;  4H9O B;  4DRA A;  3X1S A;  4LD9 D;  5JRG D;  5B0Z B;  4J8V D;  3AZG C;  3LEL D;  5AY8 C;  3VH6 T;  3REL A;  3A6N A;  3B6G A;  3AZM B;  4J8U B;  3TU4 B;  5F99 B;  5B0Z D;  4E44 A;  1H3O A;  3MVD B;  4JJN C;  3AZF C;  2CV5 C;  3MGP B;  2IO5 C;  5AVB B;  3AZM D;  4J8U D;  3TU4 D;  3C1B A;  5F99 D;  4NE6 A;  5B40 C;  5B33 A;  1P3A A;  3MVD D;  1P34 B;  5B2I A;  1F66 A;  3MGP D;  3AZH C;  1R4V A;  5AVB D;  5B32 B;  3LJA A;  4CSR A;  3WAA A;  5BNX B;  1P34 D;  3AZE A;  1B6W A;  5GT0 A;  5C3I C;  5B32 D;  2HIO B;  2F8N H;  2YFV A;  1KX4 A;  1U35 A;  1P3K A;  5FUG A;  3MGS A;  2HIO D;  4XUJ B;  4J8W C;  3MGQ C;  1B67 A;  1P3I C;  4WU9 C;  4H9Q B;  2L5A A;  1N1J A;  1HQ3 A;  4XUJ D;  1KX3 B;  2NZD B;  2NQB A;  5B31 B;  1P3F B;  3AZK C;  3AV1 A;  3B0D B;  1KX5 B;  1P3O C;  1KX3 D;  2NZD D;  4QLC A;  5B31 D;  5BT1 D;  1P3F D;  2BYK B;  5CPK A;  4Z5T A;  3W99 C;  2HUE C;  3B6F C;  1KX5 D;  4KHA A;  4ZUX B;  3KXB C;  3MGR A;  1P3M B;  4NE3 A;  5BNV B;  5F99 C;  1ID3 B;  3UT9 B;  3AN2 A;  3MGP C;  4ZUX D;  5AVB C;  3AZG B;  2YFW A;  1P3M D;  3AV2 B;  1ID3 D;  4UUZ B;  5CP6 A;  3X1T C;  1BH8 B;  4WZS B;  3UT9 D;  1JFI A;  2RVQ C;  3WTP C;  4NFT A;  3B0C W;  3AZG D;  4Z66 C;  4JJN B;  4H9P A;  3AZF B;  2CV5 B;  5G49 B;  3AV2 D;  5CHL B;  1TAF A;  5AV5 A;  5CPI B;  4XZQ B;  3REK A;  5B40 B;  1P3G A;  2PYO C;  4J8X C;  1ULY A;  3W96 A;  4JJN D;  3AZF D;  2CV5 D;  5GSU A;  2HIO C;  5CPI D;  4XZQ D;  5AV6 A;  5JA4 B;  5B40 D;  1P3L C;  2F8N B;  5AV8 C;  1P3B A;  3UTB B;  5AVC A;  1ZLA A;  5DNN A;  5C3I B;  5AY8 A;  1P3P C;  1AOI A;  2ARO B;  2F8N D;  4Z2M G;  3REH A;  5KDM B;  2BYM B;  3X1U A;  5B31 G;  5B0Y A;  3UTB D;  4YS3 A;  3KWQ C;  5B31 C;  5BT1 C;  3REJ A;  2CWE A;  2ARO D;  4J8W B;  1KX5 C;  3AYW C;  5B1L C;  5CPJ A;  4YM6 C;  3AZI C;  4WU9 B;  3AZH A;  4WNN B;  3UTA C;  4J8W D;  5B1M A;  3REI C;  3MGQ D;  3AZK B;  3WKJ A;  3WA9 A;  1P3M C;  4WU9 D;  5DNM A;  1P3O B;  3W98 C;  1BH9 A;  3KUY C;  3UT9 C;  1F1E A;  3AZK D;  3LZ1 C;  3W99 B;  2HUE B;  3B6F B;  5E5A B;  3AV2 C;  5B24 C;  3B0C T;  1P3O D;  3KXB B;  3W99 D;  1TZY A;  3B6F D;  5E5A D;  3MGQ A;  3AZL C;  2FJ7 A;  5BO0 B;  4DRB A;  1P3I A;  3O62 A;  5CPI C;  3KXB D;  4KGC A;  3AFA A;  4XZQ C;  5B2J C;  3LZ0 A;  1M18 C;  3X1T B;  4AWL B;  3V9R B;  4LD9 A;  3WTP B;  5GXQ C;  5JRG A;  4J8V A;  3NQU B;  2F8N G;  4Z66 B;  3LEL A;  4H9O A;  3X1T D;  3AZN C;  3W97 C;  2RVQ D;  3WTP D;  3UTB C;  5B0Z A;  2PYO B;  4J8X B;  4Z66 D;  2ARO C;  3VH5 A;  3AZM A;  4J8U A;  3TU4 A;  4KUD B;  5F99 A;  1P3L B;  2PYO D;  3MVD A;  4J8X D;  1KU5 A;  5BO0 A;  3MGP A;  5AV8 B;  5AVB A;  4WU8 C;  1P3P B;  5AV9 B;  3X1V B;  3R45 B;  1P3L D;  1P34 A;  5BS7 C;  3B0B A;  4X23 C;  5AV8 D;  3WTP A;  4CAY B;  3MNN B;  3AZJ B;  5GT3 C;  5B32 A;  3KWQ B;  1P3P D;  5AV9 D;  3X1V D;  5BNX A;  3X1S C;  1Q9C A;  3AYW B;  3MNN D;  5B1L B;  3AZJ D;  1S32 C;  4YM6 B;  3KWQ D;  3AZI B;  2HIO A;  3REL C;  3B6G C;  3UTA B;  3VH6 A;  5E5A C;  3REI B;  3AYW D;  5B1L D;  4YM6 D;  3AZI D;  4H9S A;  4XUJ A;  3C1B C;  3UTA D;  3REI D;  1P3A C;  3W98 B;  3KUY B;  5B33 C;  5B2I C;  3LZ1 B;  1F66 C;  4H9Q A;  4H9R B;  5B24 B;  1KX3 A;  3LJA C;  3W98 D;  2NZD A;  3WAA C;  3KUY D;  5B31 A;  4AWL C;  1P3F A;  3LZ1 D;  3AZE C;  1KX5 A;  3AZL B;  4HGA C;  5GT0 C;  5B24 D;  3NQJ B;  4H9N B;  2BYK A;  5B2J B;  1KX4 C;  1U35 C;  1M18 B;  3AZL D;  3MGS C;  4ZBJ C;  4ZUX A;  5GXQ B;  4KUD C;  1P3M A;  5BNV A;  5B2J D;  1ID3 A;  1M18 D;  3AZN B;  3UT9 A;  3W97 B; 
#chains in the Genus database with same CATH topology
 5GXQ D;  3AZG A;  1M19 B;  1HQ3 C;  3AV2 A;  4UUZ A;  5AV9 C;  3X1V C;  2NQB C;  2Y2L A;  1BH8 A;  4R8P B;  3AZN D;  3AV1 C;  3W97 D;  4G91 B;  3MNN C;  3AZJ C;  2UWX A;  4JJN A;  2CV5 A;  3AZF A;  5G49 A;  1BFM A;  5CPI A;  4R8P D;  4WU8 B;  4XZQ A;  5B40 A;  3MGR C;  4X23 B;  3A1K A;  4WU8 D;  5GT3 B;  3EG5 B;  5JA4 A;  4G92 B;  3AN2 C;  2F8N A;  3X1S B;  4X23 D;  3UTB A;  1S32 B;  5GT3 D;  5CP6 C;  3REL B;  1M1A C;  3A6N B;  3B6G B;  2ARO A;  3X1S D;  5KDM A;  2BYM A;  1H3O B;  1S32 D;  3REL D;  3A6N D;  3B6G D;  4J8W A;  3C1B B;  1P3A B;  1P3G C;  5B33 B;  3W96 C;  5GSU C;  5B2I B;  1F66 B;  4WU9 A;  5BS7 A;  4X23 A;  4WNN A;  3C1B D;  5AV6 C;  3LJA B;  1P3A D;  4CSR B;  5B33 D;  3WAA B;  3AZK A;  3C1C C;  3P5J B;  5B2I D;  1P3B C;  1F66 D;  3AZE B;  4HGA B;  5GT0 B;  5AVC C;  5DNN C;  1ZLA C;  1S32 A;  1P3O A;  3EPH A;  3LJA D;  3WAA D;  2YFV B;  1AOI C;  1T3U A;  3REH C;  1EQZ C;  3W99 A;  1KX4 B;  1U35 B;  1P3K B;  3X1U C;  5E5A A;  1M19 C;  5FUG B;  3AZE D;  5B0Y C;  3B6F A;  4YS3 C;  3MGS B;  5GT0 D;  4ZBJ B;  3REJ C;  4R8P C;  3KXB A;  2LY8 A;  4G91 C;  1KX4 D;  1U35 D;  1P3K D;  5CPJ C;  3MGS D;  3AL0 C;  2Y2H A;  4KUD D;  1N1J B;  1HQ3 B;  1Z2C B;  5B1M C;  3X1T A;  2NQB B;  3V9R A;  3AV1 B;  3WKJ C;  3WA9 C;  3EPK A;  3NQU A;  5DNM C;  4Z66 A;  1HQ3 D;  2JSS A;  1WWI A;  4G92 C;  4QLC B;  2NQB D;  3KSY A;  2BG1 A;  5CPK B;  4Z5T B;  3AV1 D;  2Y2Q A;  2PYO A;  4J8X A;  4KHA B;  2Y2O A;  3MGR B;  3A6N C;  4QLC D;  4EO5 C;  5CPK D;  4KUD A;  4Z5T D;  1TZY C;  1P3L A;  2FJ7 C;  3AN2 B;  3O62 C;  3MGR D;  4KGC C;  1A7W A;  5AV8 A;  3AFA C;  2YFW B;  2JCH A;  3LZ0 C;  5CP6 B;  1P3P A;  5AV9 A;  3X1V A;  3R45 A;  1M1A B;  3AN2 D;  1JFI B;  4LD9 C;  4M6B A;  3WTP E;  5JRG C;  3VH5 W;  3F6T A;  4J8V C;  4CAY A;  3MNN A;  3LEL C;  4H9P B;  3AZJ A;  3KWQ A;  5CP6 D;  5AV5 B;  1TAF B;  1M1A D;  4WV4 B;  3AYW A;  5B0Z C;  3REK B;  1P3G B;  3W96 B;  5B1L A;  4YM6 A;  5GSU B;  3AZI A;  5AV5 D;  3AZM C;  4J8U C;  3TU4 C;  3UTA A;  1P3K C;  3REI A;  5AV6 B;  3REK D;  1P3G D;  3MVD C;  3W96 D;  5GSU D;  3C1C B;  1P3B B;  2XD5 A;  5AVC B;  5DNN B;  1ZLA B;  5AY8 B;  5AV6 D;  3KUY A;  3W98 A;  1P34 C;  1AOI B;  1M1A A;  3REH B;  1EQZ B;  3LZ1 A;  1WWS A;  5B32 G;  3X1U B;  3C1C D;  1P3B D;  5B0Y B;  4YS3 B;  3VH6 W;  4H9R A;  5B32 C;  5AVC D;  2DF4 C;  3A1I A;  5DNN D;  5B24 A;  5AY8 D;  3REJ B;  1ZLA D;  1AOI D;  2IO5 B;  3REH D;  1EQZ D;  4E45 A;  4NE5 A;  1M19 D;  3X1U D;  3AZL A;  5B0Y D;  4YS3 D;  5CPJ B;  3NQJ A;  4QLC C;  4H9N A;  3REJ D;  2RIQ A;  5CPK C;  4Z5T C;  3AZH B;  5B2J A;  5B1M B;  1M18 A;  5CPJ D;  3WKJ B;  3WA9 B;  4H9S C;  5GXQ A;  3C1C A;  3AZH D;  4XUJ C;  5DNM B;  5B1M D;  1BH9 B;  3AZN A;  3W97 A;  3WKJ D;  1EQZ A;  3WA9 D;  1M19 A;  3VH5 T;  5DNM D;  1KX3 C;  2NZD C;  1P3F C;  2ZY2 A;  4R8P A;  4EO5 B;  3B0D C;  1TZY B;  3MGQ B;  2F8N K;  4Z2M H;  2FJ7 B;  1P3I B;  3FDD A;  3H0R C;  5AV5 C;  3O62 B;  2Y2I A;  4KGC B;  3AFA B;  1HTA A;  4WU8 A;  3LZ0 B;  3REK C;  1TZY D;  2FJ7 D;  4ZUX C;  1P3I D;  4LD9 B;  3O62 D;  5JRG B;  4J8V B;  4KGC D;  3AFA D;  2Y2P A;  3LEL B;  1ID3 C;  3LZ0 D;  5GT3 A;  4H9O B;  4DRA A;  3X1S A;  4LD9 D;  5JRG D;  5B0Z B;  4J8V D;  3AZG C;  3LEL D;  5AY8 C;  3VH6 T;  3REL A;  3A6N A;  3B6G A;  3AZM B;  4J8U B;  3TU4 B;  2F2A C;  5F99 B;  5B0Z D;  2Y2M A;  4E44 A;  1H3O A;  3MVD B;  4JJN C;  3AZF C;  2CV5 C;  3MGP B;  2IO5 C;  5AVB B;  3AZM D;  4J8U D;  3TU4 D;  3C1B A;  5F99 D;  4NE6 A;  5B40 C;  5B33 A;  1P3A A;  3MVD D;  1P34 B;  5B2I A;  1F66 A;  3MGP D;  3AZH C;  1R4V A;  5AVB D;  5B32 B;  3LJA A;  4CSR A;  3WAA A;  5BNX B;  1P34 D;  3AZE A;  1B6W A;  5GT0 A;  5C3I C;  5B32 D;  2HIO B;  2F8N H;  2YFV A;  1KX4 A;  1U35 A;  1P3K A;  4UPK A;  5FUG A;  3MGS A;  2J8P A;  2FFF B;  2HIO D;  4XUJ B;  4J8W C;  3MGQ C;  1B67 A;  1P3I C;  4WU9 C;  4H9Q B;  2L5A A;  1N1J A;  1HQ3 A;  4XUJ D;  1KX3 B;  2NZD B;  2NQB A;  5B31 B;  1P3F B;  3AZK C;  3AV1 A;  3B0D B;  1KX5 B;  1P3O C;  1KX3 D;  2ZM5 A;  4QLC A;  2NZD D;  5B31 D;  5BT1 D;  1P3F D;  2BYK B;  5CPK A;  4Z5T A;  3W99 C;  2HUE C;  3B6F C;  1KX5 D;  4KHA A;  4ZUX B;  3KXB C;  3MGR A;  1P3M B;  4NE3 A;  5BNV B;  5F99 C;  1ID3 B;  3UT9 B;  3AN2 A;  3MGP C;  4ZUX D;  5AVB C;  3AZG B;  2YFW A;  1P3M D;  3AV2 B;  1ID3 D;  4UUZ B;  5CP6 A;  3X1T C;  2ZY4 A;  1BH8 B;  4WZS B;  3UT9 D;  2ZY5 A;  1JFI A;  2RVQ C;  3WTP C;  4NFT A;  3B0C W;  3AZG D;  4Z66 C;  4JJN B;  4H9P A;  3AZF B;  2CV5 B;  5G49 B;  3AV2 D;  2Y2N A;  1TAF A;  5CHL B;  5AV5 A;  5CPI B;  4XZQ B;  3REK A;  5B40 B;  1P3G A;  2PYO C;  4J8X C;  1ULY A;  3W96 A;  4JJN D;  3AZF D;  2CV5 D;  5GSU A;  2HIO C;  3EPJ A;  5CPI D;  4XZQ D;  5AV6 A;  5JA4 B;  5B40 D;  1P3L C;  2F8N B;  5AV8 C;  1P3B A;  2JE5 A;  3UTB B;  5AVC A;  1ZLA A;  5DNN A;  5C3I B;  5AY8 A;  3EPL A;  1P3P C;  1AOI A;  2ARO B;  2F8N D;  4Z2M G;  3REH A;  5KDM B;  2BYM B;  3X1U A;  5B31 G;  5B0Y A;  3UTB D;  4YS3 A;  3KWQ C;  5B31 C;  5BT1 C;  3REJ A;  2CWE A;  2ARO D;  4J8W B;  1KX5 C;  3AYW C;  5B1L C;  5CPJ A;  4YM6 C;  3AZI C;  4WU9 B;  2XD1 A;  3H0L C;  4WNN B;  3AZH A;  1W2E A;  3UTA C;  4J8W D;  5B1M A;  3REI C;  3MGQ D;  3AZK B;  3WKJ A;  3WA9 A;  1P3M C;  4WU9 D;  5DNM A;  1P3O B;  3W98 C;  1BH9 A;  3KUY C;  3H0M C;  3UT9 C;  1F1E A;  3AZK D;  3LZ1 C;  3W99 B;  2HUE B;  3B6F B;  5E5A B;  3AV2 C;  5B24 C;  3B0C T;  1P3O D;  3KXB B;  2Y2G A;  3W99 D;  1TZY A;  3B6F D;  5E5A D;  3MGQ A;  3AZL C;  2FJ7 A;  5BO0 B;  4DRB A;  1P3I A;  3O62 A;  5CPI C;  1PZR A;  3KXB D;  4KGC A;  3AFA A;  4XZQ C;  5B2J C;  3LZ0 A;  1M18 C;  3X1T B;  4AWL B;  3V9R B;  4LD9 A;  3WTP B;  5GXQ C;  5JRG A;  4J8V A;  3NQU B;  2F8N G;  4Z66 B;  3LEL A;  4H9O A;  3X1T D;  3AZN C;  3W97 C;  2RVQ D;  3WTP D;  3UTB C;  5B0Z A;  2PYO B;  4J8X B;  4Z66 D;  2ARO C;  3VH5 A;  2Y2K A;  3AZM A;  4J8U A;  3TU4 A;  4KUD B;  3KFU G;  5F99 A;  1P3L B;  2PYO D;  3MVD A;  4J8X D;  1KU5 A;  5BO0 A;  2ZY3 A;  3MGP A;  5AV8 B;  5AVB A;  4WU8 C;  1P3P B;  5AV9 B;  3X1V B;  3R45 B;  1P3L D;  1P34 A;  3IP4 C;  5BS7 C;  3B0B A;  4X23 C;  5AV8 D;  3WTP A;  2Y2J A;  4CAY B;  3MNN B;  3AZJ B;  5GT3 C;  5B32 A;  3KWQ B;  1P3P D;  5AV9 D;  3X1V D;  5BNX A;  3X1S C;  1Q9C A;  3AYW B;  3MNN D;  5B1L B;  3AZJ D;  1S32 C;  4YM6 B;  3KWQ D;  3AZI B;  2HIO A;  3REL C;  3B6G C;  2G5H C;  3VH6 A;  5E5A C;  3UTA B;  3REI B;  3AYW D;  5B1L D;  4WJ3 C;  4YM6 D;  4DQY B;  3AZI D;  4H9S A;  4XUJ A;  3C1B C;  3UTA D;  3REI D;  1P3A C;  3W98 B;  3KUY B;  5B33 C;  2DQN C;  5B2I C;  3LZ1 B;  1F66 C;  2W8S A;  4H9Q A;  4H9R B;  5B24 B;  2VQR A;  1KX3 A;  3LJA C;  3W98 D;  2NZD A;  3WAA C;  3KUY D;  5B31 A;  4AWL C;  1P3F A;  3LZ1 D;  3AZE C;  1KX5 A;  3AZL B;  4HGA C;  5GT0 C;  5B24 D;  3NQJ B;  4H9N B;  2BYK A;  5B2J B;  1KX4 C;  1U35 C;  1M18 B;  3AZL D;  3MGS C;  4ZBJ C;  4ZUX A;  2G5I C;  5GXQ B;  4KUD C;  1P3M A;  5BNV A;  5B2J D;  1ID3 A;  1M18 D;  3AZN B;  3UT9 A;  3W97 B; 
#chains in the Genus database with same CATH homology
 5GXQ D;  3AZG A;  1M19 B;  1HQ3 C;  3AV2 A;  4UUZ A;  5AV9 C;  3X1V C;  2NQB C;  2Y2L A;  1BH8 A;  4R8P B;  3AZN D;  3AV1 C;  3W97 D;  4G91 B;  3MNN C;  3AZJ C;  2UWX A;  4JJN A;  2CV5 A;  3AZF A;  5G49 A;  1BFM A;  5CPI A;  4R8P D;  4WU8 B;  4XZQ A;  5B40 A;  3MGR C;  4X23 B;  3A1K A;  4WU8 D;  5GT3 B;  3EG5 B;  5JA4 A;  4G92 B;  3AN2 C;  2F8N A;  3X1S B;  4X23 D;  3UTB A;  1S32 B;  5GT3 D;  5CP6 C;  3REL B;  1M1A C;  3A6N B;  3B6G B;  2ARO A;  3X1S D;  5KDM A;  2BYM A;  1H3O B;  1S32 D;  3REL D;  3A6N D;  3B6G D;  4J8W A;  3C1B B;  1P3A B;  1P3G C;  5B33 B;  3W96 C;  5GSU C;  5B2I B;  1F66 B;  4WU9 A;  5BS7 A;  4X23 A;  4WNN A;  3C1B D;  5AV6 C;  3LJA B;  1P3A D;  4CSR B;  5B33 D;  3WAA B;  3AZK A;  3C1C C;  3P5J B;  5B2I D;  1P3B C;  1F66 D;  3AZE B;  4HGA B;  5GT0 B;  5AVC C;  5DNN C;  1ZLA C;  1S32 A;  1P3O A;  3EPH A;  3LJA D;  3WAA D;  2YFV B;  1AOI C;  1T3U A;  3REH C;  1EQZ C;  3W99 A;  1KX4 B;  1U35 B;  1P3K B;  3X1U C;  5E5A A;  1M19 C;  5FUG B;  3AZE D;  5B0Y C;  3B6F A;  4YS3 C;  3MGS B;  5GT0 D;  4ZBJ B;  3REJ C;  4R8P C;  3KXB A;  2LY8 A;  4G91 C;  1KX4 D;  1U35 D;  1P3K D;  5CPJ C;  3MGS D;  3AL0 C;  2Y2H A;  4KUD D;  1N1J B;  1HQ3 B;  1Z2C B;  5B1M C;  3X1T A;  2NQB B;  3V9R A;  3AV1 B;  3WKJ C;  3WA9 C;  3EPK A;  3NQU A;  5DNM C;  4Z66 A;  1HQ3 D;  2JSS A;  1WWI A;  4G92 C;  4QLC B;  2NQB D;  3KSY A;  2BG1 A;  5CPK B;  4Z5T B;  3AV1 D;  2Y2Q A;  2PYO A;  4J8X A;  4KHA B;  2Y2O A;  3MGR B;  3A6N C;  4QLC D;  4EO5 C;  5CPK D;  4KUD A;  4Z5T D;  1TZY C;  1P3L A;  2FJ7 C;  3AN2 B;  3O62 C;  3MGR D;  4KGC C;  1A7W A;  5AV8 A;  3AFA C;  2YFW B;  2JCH A;  3LZ0 C;  5CP6 B;  1P3P A;  5AV9 A;  3X1V A;  3R45 A;  1M1A B;  3AN2 D;  1JFI B;  4LD9 C;  4M6B A;  3WTP E;  5JRG C;  3VH5 W;  3F6T A;  4J8V C;  4CAY A;  3MNN A;  3LEL C;  4H9P B;  3AZJ A;  3KWQ A;  5CP6 D;  5AV5 B;  1TAF B;  1M1A D;  4WV4 B;  3AYW A;  5B0Z C;  3REK B;  1P3G B;  3W96 B;  5B1L A;  4YM6 A;  5GSU B;  3AZI A;  5AV5 D;  3AZM C;  4J8U C;  3TU4 C;  3UTA A;  1P3K C;  3REI A;  5AV6 B;  3REK D;  1P3G D;  3MVD C;  3W96 D;  5GSU D;  3C1C B;  1P3B B;  2XD5 A;  5AVC B;  5DNN B;  1ZLA B;  5AY8 B;  5AV6 D;  3KUY A;  3W98 A;  1P34 C;  1AOI B;  1M1A A;  3REH B;  1EQZ B;  3LZ1 A;  1WWS A;  5B32 G;  3X1U B;  3C1C D;  1P3B D;  5B0Y B;  4YS3 B;  3VH6 W;  4H9R A;  5B32 C;  5AVC D;  2DF4 C;  3A1I A;  5DNN D;  5B24 A;  5AY8 D;  3REJ B;  1ZLA D;  1AOI D;  2IO5 B;  3REH D;  1EQZ D;  4E45 A;  4NE5 A;  1M19 D;  3X1U D;  3AZL A;  5B0Y D;  4YS3 D;  5CPJ B;  3NQJ A;  4QLC C;  4H9N A;  3REJ D;  2RIQ A;  5CPK C;  4Z5T C;  3AZH B;  5B2J A;  5B1M B;  1M18 A;  5CPJ D;  3WKJ B;  3WA9 B;  4H9S C;  5GXQ A;  3C1C A;  3AZH D;  4XUJ C;  5DNM B;  5B1M D;  1BH9 B;  3AZN A;  3W97 A;  3WKJ D;  1EQZ A;  3WA9 D;  1M19 A;  3VH5 T;  5DNM D;  1KX3 C;  2NZD C;  1P3F C;  2ZY2 A;  4R8P A;  4EO5 B;  3B0D C;  1TZY B;  3MGQ B;  2F8N K;  4Z2M H;  2FJ7 B;  1P3I B;  3FDD A;  3H0R C;  5AV5 C;  3O62 B;  2Y2I A;  4KGC B;  3AFA B;  1HTA A;  4WU8 A;  3LZ0 B;  3REK C;  1TZY D;  2FJ7 D;  4ZUX C;  1P3I D;  4LD9 B;  3O62 D;  5JRG B;  4J8V B;  4KGC D;  3AFA D;  2Y2P A;  3LEL B;  1ID3 C;  3LZ0 D;  5GT3 A;  4H9O B;  4DRA A;  3X1S A;  4LD9 D;  5JRG D;  5B0Z B;  4J8V D;  3AZG C;  3LEL D;  5AY8 C;  3VH6 T;  3REL A;  3A6N A;  3B6G A;  3AZM B;  4J8U B;  3TU4 B;  2F2A C;  5F99 B;  5B0Z D;  2Y2M A;  4E44 A;  1H3O A;  3MVD B;  4JJN C;  3AZF C;  2CV5 C;  3MGP B;  2IO5 C;  5AVB B;  3AZM D;  4J8U D;  3TU4 D;  3C1B A;  5F99 D;  4NE6 A;  5B40 C;  5B33 A;  1P3A A;  3MVD D;  1P34 B;  5B2I A;  1F66 A;  3MGP D;  3AZH C;  1R4V A;  5AVB D;  5B32 B;  3LJA A;  4CSR A;  3WAA A;  5BNX B;  1P34 D;  3AZE A;  1B6W A;  5GT0 A;  5C3I C;  5B32 D;  2HIO B;  2F8N H;  2YFV A;  1KX4 A;  1U35 A;  1P3K A;  4UPK A;  5FUG A;  3MGS A;  2J8P A;  2FFF B;  2HIO D;  4XUJ B;  4J8W C;  3MGQ C;  1B67 A;  1P3I C;  4WU9 C;  4H9Q B;  2L5A A;  1N1J A;  1HQ3 A;  4XUJ D;  1KX3 B;  2NZD B;  2NQB A;  5B31 B;  1P3F B;  3AZK C;  3AV1 A;  3B0D B;  1KX5 B;  1P3O C;  1KX3 D;  2ZM5 A;  4QLC A;  2NZD D;  5B31 D;  5BT1 D;  1P3F D;  2BYK B;  5CPK A;  4Z5T A;  3W99 C;  2HUE C;  3B6F C;  1KX5 D;  4KHA A;  4ZUX B;  3KXB C;  3MGR A;  1P3M B;  4NE3 A;  5BNV B;  5F99 C;  1ID3 B;  3UT9 B;  3AN2 A;  3MGP C;  4ZUX D;  5AVB C;  3AZG B;  2YFW A;  1P3M D;  3AV2 B;  1ID3 D;  4UUZ B;  5CP6 A;  3X1T C;  2ZY4 A;  1BH8 B;  4WZS B;  3UT9 D;  2ZY5 A;  1JFI A;  2RVQ C;  3WTP C;  4NFT A;  3B0C W;  3AZG D;  4Z66 C;  4JJN B;  4H9P A;  3AZF B;  2CV5 B;  5G49 B;  3AV2 D;  2Y2N A;  1TAF A;  5CHL B;  5AV5 A;  5CPI B;  4XZQ B;  3REK A;  5B40 B;  1P3G A;  2PYO C;  4J8X C;  1ULY A;  3W96 A;  4JJN D;  3AZF D;  2CV5 D;  5GSU A;  2HIO C;  3EPJ A;  5CPI D;  4XZQ D;  5AV6 A;  5JA4 B;  5B40 D;  1P3L C;  2F8N B;  5AV8 C;  1P3B A;  2JE5 A;  3UTB B;  5AVC A;  1ZLA A;  5DNN A;  5C3I B;  5AY8 A;  3EPL A;  1P3P C;  1AOI A;  2ARO B;  2F8N D;  4Z2M G;  3REH A;  5KDM B;  2BYM B;  3X1U A;  5B31 G;  5B0Y A;  3UTB D;  4YS3 A;  3KWQ C;  5B31 C;  5BT1 C;  3REJ A;  2CWE A;  2ARO D;  4J8W B;  1KX5 C;  3AYW C;  5B1L C;  5CPJ A;  4YM6 C;  3AZI C;  4WU9 B;  2XD1 A;  3H0L C;  4WNN B;  3AZH A;  1W2E A;  3UTA C;  4J8W D;  5B1M A;  3REI C;  3MGQ D;  3AZK B;  3WKJ A;  3WA9 A;  1P3M C;  4WU9 D;  5DNM A;  1P3O B;  3W98 C;  1BH9 A;  3KUY C;  3H0M C;  3UT9 C;  1F1E A;  3AZK D;  3LZ1 C;  3W99 B;  2HUE B;  3B6F B;  5E5A B;  3AV2 C;  5B24 C;  3B0C T;  1P3O D;  3KXB B;  2Y2G A;  3W99 D;  1TZY A;  3B6F D;  5E5A D;  3MGQ A;  3AZL C;  2FJ7 A;  5BO0 B;  4DRB A;  1P3I A;  3O62 A;  5CPI C;  1PZR A;  3KXB D;  4KGC A;  3AFA A;  4XZQ C;  5B2J C;  3LZ0 A;  1M18 C;  3X1T B;  4AWL B;  3V9R B;  4LD9 A;  3WTP B;  5GXQ C;  5JRG A;  4J8V A;  3NQU B;  2F8N G;  4Z66 B;  3LEL A;  4H9O A;  3X1T D;  3AZN C;  3W97 C;  2RVQ D;  3WTP D;  3UTB C;  5B0Z A;  2PYO B;  4J8X B;  4Z66 D;  2ARO C;  3VH5 A;  2Y2K A;  3AZM A;  4J8U A;  3TU4 A;  4KUD B;  3KFU G;  5F99 A;  1P3L B;  2PYO D;  3MVD A;  4J8X D;  1KU5 A;  5BO0 A;  2ZY3 A;  3MGP A;  5AV8 B;  5AVB A;  4WU8 C;  1P3P B;  5AV9 B;  3X1V B;  3R45 B;  1P3L D;  1P34 A;  3IP4 C;  5BS7 C;  3B0B A;  4X23 C;  5AV8 D;  3WTP A;  2Y2J A;  4CAY B;  3MNN B;  3AZJ B;  5GT3 C;  5B32 A;  3KWQ B;  1P3P D;  5AV9 D;  3X1V D;  5BNX A;  3X1S C;  1Q9C A;  3AYW B;  3MNN D;  5B1L B;  3AZJ D;  1S32 C;  4YM6 B;  3KWQ D;  3AZI B;  2HIO A;  3REL C;  3B6G C;  2G5H C;  3VH6 A;  5E5A C;  3UTA B;  3REI B;  3AYW D;  5B1L D;  4WJ3 C;  4YM6 D;  4DQY B;  3AZI D;  4H9S A;  4XUJ A;  3C1B C;  3UTA D;  3REI D;  1P3A C;  3W98 B;  3KUY B;  5B33 C;  2DQN C;  5B2I C;  3LZ1 B;  1F66 C;  2W8S A;  4H9Q A;  4H9R B;  5B24 B;  2VQR A;  1KX3 A;  3LJA C;  3W98 D;  2NZD A;  3WAA C;  3KUY D;  5B31 A;  4AWL C;  1P3F A;  3LZ1 D;  3AZE C;  1KX5 A;  3AZL B;  4HGA C;  5GT0 C;  5B24 D;  3NQJ B;  4H9N B;  2BYK A;  5B2J B;  1KX4 C;  1U35 C;  1M18 B;  3AZL D;  3MGS C;  4ZBJ C;  4ZUX A;  2G5I C;  5GXQ B;  4KUD C;  1P3M A;  5BNV A;  5B2J D;  1ID3 A;  1M18 D;  3AZN B;  3UT9 A;  3W97 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...