1N1JA

Crystal structure of the nf-yb/nf-yc histone pair
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
87
structure length
87
Chain Sequence
IYLPIANVARIMKNAIPQTGKIAKDAKECVQECVSEFISFITSEASERCHQEKRKTINGEDILFAMSTLGFDSYVEPLKLYLQKFRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords NF-YB
publication title The NF-YB/NF-YC structure gives insight into DNA binding and transcription regulation by CCAAT factor NF-Y
pubmed doi rcsb
source organism Homo sapiens
total genus 29
structure length 87
sequence length 87
ec nomenclature
pdb deposition date 2002-10-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00808 CBFD_NFYB_HMF Histone-like transcription factor (CBF/NF-Y) and archaeal histone
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1n1jA00
3AZEA 4QLCA 2IO5C 4J8XA 1F66C 3C1BC 3VH5A 3W98D 2AROB 3B0DC 5AVCA 5DNMD 5GXQB 4X23B 3AV1C 3O62D 1P3MD 1TAFA 5CPKB 3MVDC 1HQ3A 1M1AB 1P3LB 1S32D 5BNVB 3REIA 1ID3B 4KUDD 5JRGB 4E44A 4EO5C 1U35A 1KX4A 1KX5A 1P3IA 3REHD 5F99A 2NQBB 3VH5T 5DNMC 3O62C 4NE3A 1P3MC 3MGQB 1ZLAB 4LD9B 3AZGB 4Z2MG 1S32C 5B24D 4KUDC 4G91C 1P3GA 1F1EA 3UT9B 3MNND 3LELB 1P3OA 3AZLD 1N1JB 4YS3A 3REHC 5B40B 3AYWD 3W99C 3X1UD 2NZDB 3TU4A 3W96D 5KDMB 2F8ND 2YFWB 5GSUA 1P3FA 5B1MB 4XZQD 1P3PB 4YM6B 3NQUB 5B24C 1EQZD 3RELD 3MNNC 4R8PB 3AZLC 5AV5D 4KHAA 5B0YA 3LJAB 5AVBA 1BFMA 1Q9CA 4KGCB 3AYWC 3X1UC 1TZYB 4ZUXD 3W96C 1JFIA 3AZKD 5E5AB 3AZEB 5GT3A 4J8WB 4XZQC 3MGPA 2PYOB 3AZMA 1EQZC 3REJB 5CPJB 3WTPB 3RELC 3AZFD 5GT0D 5AV5C 1TAFB 1BH8A 2L5AA 4Z66B 1HQ3B 2CWEA 5CPID 3AZID 3AZKC 1U35B 3B0CW 2HIOA 1KX4B 1KX5B 1P3IB 5CPKD 2AROA 3AZFC 5GXQA 4X23A 5GT0C 1M1AD 5B31G 5B31B 1P3LA 5AV8B 3UTBD 1ID3A 5JRGA 5CPIC 1P3GB 4HGAC 3AZIC 1P3OB 5FUGA 3C1CA 1B67A 5CPKC 1ZLAD 1P34B 2NQBA 4AWLC 4LD9D 1M1AC 3MGQA 3A6NA 4NE6A 3AZGA 5CHLB 3X1VA 2BYMA 5BS7C 3UTBC 2CV5A 3WKJB 3UT9A 3LELA 5AY8B 4NE5A 4DRBA 1AOID 5B40A 1ZLAC 4LD9C 2NZDA 5B1MD 3UTAB 4XUJD 4H9RB 1P3BD 3KWQA 1JFIB 1P3PA 4YM6A 5GT3B 3MGPB 3V9RA 3AZMB 3LJAD 2FJ7D 4R8PA 4KGCD 5B1LD 3MGSA 1TZYD 3VH6A 1M19B 1AOIC 3AZED 4QLCD 4H9SC 1P3KA 4J8XD 4XUJC 4H9NB 5E5AA 3B6GA 1P3BC 4J8WA 3NQJB 2PYOA 5AVCD 2HIOB 3REJA 5B32G 3LJAC 3WTPA 5CPJA 2FJ7C 5B32B 3AFAA 4KGCC 5B1LC 1HQ3D 1TZYC 3REID 4Z66A 3AZEC 3VH6T 1U35D 4QLCC 4J8XC 1KX4D 1P3ID 1KX5D 3VH5W 3X1SA 5F99D 4Z5TA 5FUGB 5AV9B 3C1CB 5AVCC 4G92C 3W98C 4J8VA 1HQ3C 1B6WA 3REIC 5B31A 3AZJB 3A6NB 1P3GD 5AV8A 3X1VB 2BYMB 1U35C 1P3OD 4WU8A 4JJNB 2CV5B 4YS3D 1KX4C 1KX5C 5F99C 3MGRA 3TU4D 1P34A 5GSUD 1P3FD 2LY8A 5B2IA 3REKB 3KXBA 1P3GC 3KWQB 3WKJA 2F8NK 3V9RB 4YS3C 5B0YD 3LZ0B 3W99A 5AVBD 5AY8A 3MGSB 4UUZB 4E45A 3KUYB 5BT1D 3TU4C 5C3IC 3AV2B 1M18A 3W97B 3UTAA 5GSUC 1WWSA 4H9RA 5GT3D 1P3KB 3MGPD 1P3FC 4DRAA 3AZMD 3B6GB 3B6FB 1KU5A 4CAYA 5B0YC 3AFAB 5AVBC 1M19A 3AZHA 5BT1C 4WU9A 3AN2A 2IO5B 1F66B 4H9NA 5GT3C 4ZUXC 3C1BB 2BYKB 2HIOD 3MGPC 3AZMC 5CP6A 3NQJA 2AROD 3B0DB 3X1SB 4Z5TB 3AV1B 5GXQD 4X23D 4ZBJB 5B32A 5DNNA 3MVDB 3R45B 3WA9A 4J8VB 1P3LD 1ID3D 5JRGD 3X1TA 4EO5B 1P3AA 4WU8B 3C1CD 2HIOC 2AROC 4J8UA 2NQBD 5AV9A 5GXQC 4X23C 3O62B 3MGRB 3KSYA 3MGQD 3A6ND 3AZGD 3X1VD 4KUDB 1P3LC 4G91B 1ID3C 2CV5D 5JRGC 5B2IB 3UT9D 3AZJA 3WAAA 3LELD 3KXBB 1H3OA 4JJNA 5BNXA 3C1CC 3AZNA 5B40D 3W99B 5B33A 5B0ZA 2NQBC 2NZDD 5AV6A 3MGQC 1M18B 3A6NC 3KWQD 1P3PD 3AZGC 4YM6D 3X1VC 3REKA 2CV5C 2F8NH 3MNNB 3UT9C 4R8PD 3LELC 3MGSD 2RVQD 3LZ0A 4CAYB 3AYWB 5B40C 3X1UB 4UUZA 2F8NG 3KUYA 1P3KD 3W96B 2NZDC 3AV2A 3W97A 2F8NB 3AZHB 4WU9B 5E5AD 3B6GD 3AN2B 4J8WD 5B1MC 3KWQC 1P3PC 2PYOD 4YM6C 1KX3A 1EQZB 3REJD 3RELB 5CPJD 3WTPD 5B2JA 5CP6B 2YFVB 4R8PC 3AFAD 3B6FA 3MGSC 2RVQC 3VH6W 5DNNB 4H9OA 3WA9B 4Z66D 3LZ1A 1P3KC 3X1TB 3AZKB 4WNNB 5E5AC 1F66A 3B6GC 3X1SD 4J8WC 3C1BA 4Z5TD 2BYKA 2PYOC 1P3AB 3WTPE 4H9PB 3REJC 5CPJC 4H9QB 3WTPC 3AZFB 3AV1A 5GT0B 3AFAC 4J8UB 1R4VA 4J8VD 3MVDA 3R45A 5B31D 5G49B 2HUEB 4Z66C 5AV8D 4WU8D 5CPIB 4HGAB 3WAAB 3AZIB 1H3OB 3X1SC 4Z5TC 1P3IC 3W98A 3MGRD 5BNXB 4ZBJC 4AWLB 3AZNB 1P34D 5DNMA 5B0ZB 4NFTA 5B33B 3O62A 4J8VC 1P3MA 5BO0A 5B2ID 5AV6B 5JA4B 5B31C 3KXBD 1S32A 3UTBB 4KUDA 5AV8C 4Z2MH 3WKJD 4WU8C 1ULYA 3W99D 5AY8D 1P3OC 3REHA 3MGRC 1M18D 1P34C 3UTAD 5B2IC 3KXBC 5B24A 4WZSB 1KX3B 3WKJC 3MNNA 5B2JB 3AZLA 5AY8C 1M19D 1AOIB 3AYWA 3AZHD 4WU9D 3X1UA 1M18C 4H9OB 3AN2D 3LZ1B 3W96A 4XUJB 3UTAC 2F8NA 1P3BB 4XZQA 5CP6D 1EQZA 3RELA 2FJ7B 2YFVA 5B32D 5DNND 5B1LB 3WA9D 5AV5A 1BH9B 4CSRB 1M19C 3X1TD 3AZHC 4WU9C 4QLCB 4ZUXA 3AN2C 2JSSA 4J8XB 1P3AD 3AZKA 4WNNA 5CP6C 4J8UD 1A7WA 5AVCB 5AV9D 4H9PA 4G92B 3W98B 4H9QA 4WV4B 3AZFA 5GT0A 5DNNC 5B32C 5DNMB 3WA9C 1P3MB 3REIB 5BO0B 5G49A 3AZJD 3X1TC 3WAAD 1S32B 5CPIA 4JJND 1P3AC 3AZIA 3AZND 5F99B 5B33D 5B0ZD 4J8UC 5AV9C 5CPKA 3REHB 3B0CT 5AV6D 1M1AA 2HUEC 5BNVA 5JA4A 3REKD 5BS7A 3WAAC 3UTBA 3AZJC 5B24B 4YS3B 4JJNC 3LZ0D 3AZNC 3AZLB 5B0ZC 5B33C 3TU4B 3KUYD 5C3IB 1ZLAA 4LD9A 3AV2D 3W97D 5GSUB 5AV6C 1P3FB 1KX3D 3REKC 4XZQB 5B2JD 1N1JA 3B6FD 4KHAB 5B0YB 5AVBB 3LZ0C 3LZ1D 5AV5B 5KDMA 1AOIA 2YFWA 3KUYC 3AV2C 3W97C 4H9SA 5B1MA 1WWIA 3B0BA 4XUJA 1F66D 3NQUA 4ZUXB 3C1BD 1P3BA 1KX3C 5B2JC 3AV1D 3B6FC 3LJAA 2FJ7A 4M6BA 3MVDD 4KGCA 5B1LA 1HTAA 1BH8B 1TZYA 3LZ1C 1BH9A 4CSRA
chains in the Genus database with same CATH superfamily
3AZEA 4QLCA 2IO5C 4J8XA 1F66C 3C1BC 3VH5A 3W98D 2AROB 3B0DC 5AVCA 5DNMD 5GXQB 4X23B 3AV1C 3O62D 1P3MD 1TAFA 5CPKB 3MVDC 1HQ3A 1M1AB 1P3LB 1S32D 5BNVB 3REIA 1ID3B 4KUDD 5JRGB 4E44A 4EO5C 1U35A 1KX4A 1KX5A 1P3IA 3REHD 5F99A 2NQBB 3VH5T 5DNMC 3O62C 4NE3A 1P3MC 3MGQB 1ZLAB 4LD9B 3AZGB 2ZY3A 4Z2MG 1S32C 5B24D 4KUDC 4G91C 1P3GA 1F1EA 3UT9B 3MNND 3LELB 1P3OA 3AZLD 1N1JB 4YS3A 3REHC 5B40B 3AYWD 3W99C 3X1UD 2NZDB 3TU4A 3W96D 5KDMB 2F8ND 2YFWB 5GSUA 1P3FA 5B1MB 4XZQD 2XD1A 1P3PB 4YM6B 3KFUG 3NQUB 5B24C 1EQZD 3RELD 3MNNC 4R8PB 2Y2JA 3AZLC 5AV5D 4KHAA 5B0YA 3LJAB 5AVBA 1BFMA 1Q9CA 4KGCB 3AYWC 3X1UC 1TZYB 4ZUXD 3W96C 2UWXA 1JFIA 3H0MC 5E5AB 3AZEB 3AZKD 5GT3A 4J8WB 4XZQC 3MGPA 2PYOB 3AZMA 1EQZC 3REJB 5CPJB 3WTPB 3RELC 3AZFD 3A1IA 5GT0D 5AV5C 1TAFB 1BH8A 2L5AA 4Z66B 1HQ3B 4DQYB 2CWEA 5CPID 3AZID 3AZKC 1U35B 3B0CW 2Y2HA 2HIOA 1KX4B 1KX5B 1P3IB 5CPKD 2AROA 3AZFC 5GXQA 4X23A 5GT0C 1M1AD 2DF4C 5B31G 3EPHA 5B31B 1P3LA 5AV8B 3UTBD 1ID3A 5JRGA 2DQNC 5CPIC 1P3GB 4HGAC 3AZIC 1P3OB 5FUGA 3C1CA 1B67A 2Y2LA 5CPKC 1P34B 1ZLAD 4AWLC 2NQBA 4LD9D 1M1AC 3MGQA 3A6NA 4NE6A 3AZGA 5CHLB 3X1VA 2BYMA 5BS7C 3UTBC 2CV5A 3WKJB 3UT9A 3LELA 5AY8B 4NE5A 4DRBA 1AOID 5B40A 1ZLAC 4LD9C 2NZDA 5B1MD 3UTAB 4XUJD 4H9RB 1P3BD 3KWQA 1JFIB 1P3PA 4YM6A 5GT3B 3MGPB 3V9RA 3AZMB 3LJAD 2FJ7D 4R8PA 4KGCD 5B1LD 3MGSA 1TZYD 3VH6A 1Z2CB 1M19B 1AOIC 3AZED 4QLCD 4H9SC 1T3UA 1P3KA 4J8XD 4XUJC 4H9NB 5E5AA 3B6GA 1P3BC 4J8WA 3NQJB 2PYOA 5AVCD 2HIOB 2JCHA 3REJA 5B32G 3LJAC 3WTPA 5CPJA 2FJ7C 5B32B 3AFAA 3EPLA 4KGCC 2Y2KA 5B1LC 1HQ3D 1TZYC 3REID 4Z66A 3AZEC 3VH6T 1U35D 4QLCC 4J8XC 1KX4D 1P3ID 1KX5D 3VH5W 3X1SA 5F99D 4Z5TA 5FUGB 5AV9B 3C1CB 5AVCC 4G92C 3W98C 4J8VA 1HQ3C 1B6WA 3REIC 5B31A 3AZJB 3A6NB 1P3GD 5AV8A 3X1VB 2BYMB 1U35C 1P3OD 4WU8A 4JJNB 2CV5B 4YS3D 1KX4C 1KX5C 2Y2GA 5F99C 2Y2IA 3MGRA 3TU4D 1P34A 5GSUD 1P3FD 2LY8A 5B2IA 3REKB 3KXBA 1P3GC 3KWQB 3WKJA 2F8NK 3V9RB 4YS3C 5B0YD 3LZ0B 3W99A 5AVBD 5AY8A 3MGSB 4UUZB 4E45A 3KUYB 5BT1D 3TU4C 5C3IC 3AV2B 1M18A 3W97B 3UTAA 5GSUC 1WWSA 4H9RA 5GT3D 1P3KB 3MGPD 1P3FC 4DRAA 3AZMD 3B6GB 3B6FB 1KU5A 4CAYA 5B0YC 3AFAB 5AVBC 1M19A 3AZHA 5BT1C 4WU9A 3AN2A 2IO5B 1F66B 4H9NA 5GT3C 4ZUXC 3C1BB 2BYKB 2HIOD 3MGPC 3AZMC 5CP6A 3NQJA 3B0DB 2AROD 3X1SB 4Z5TB 3AV1B 5GXQD 4X23D 2Y2PA 4ZBJB 5B32A 5DNNA 3MVDB 3R45B 3WA9A 4WJ3C 4J8VB 1P3LD 1ID3D 5JRGD 3X1TA 4EO5B 1P3AA 4WU8B 3C1CD 2HIOC 2AROC 4J8UA 2NQBD 5AV9A 3H0LC 5GXQC 4X23C 3O62B 3MGRB 3KSYA 3MGQD 3A6ND 2JE5A 3AZGD 2Y2NA 3X1VD 4KUDB 1P3LC 4G91B 1ID3C 2CV5D 5JRGC 3A1KA 5B2IB 3UT9D 3AZJA 3WAAA 3LELD 3KXBB 1H3OA 4JJNA 2G5IC 5BNXA 3C1CC 3AZNA 5B40D 3W99B 5B33A 5B0ZA 2NQBC 2NZDD 5AV6A 3MGQC 1M18B 3A6NC 3KWQD 1P3PD 3AZGC 4YM6D 3X1VC 3REKA 2CV5C 2F8NH 3MNNB 3UT9C 4R8PD 3LELC 3MGSD 2RVQD 3LZ0A 4CAYB 3AYWB 5B40C 3X1UB 4UUZA 2F8NG 3KUYA 1P3KD 3W96B 2NZDC 3AV2A 3W97A 2F8NB 3AZHB 4WU9B 5E5AD 3B6GD 3AN2B 4J8WD 5B1MC 3KWQC 1P3PC 2PYOD 4YM6C 1KX3A 3EPKA 1EQZB 3REJD 3RELB 5CPJD 5B2JA 5CP6B 3WTPD 2YFVB 4R8PC 3AFAD 3B6FA 3MGSC 2RVQC 3VH6W 5DNNB 4H9OA 3WA9B 4Z66D 3LZ1A 1P3KC 3X1TB 3AZKB 4WNNB 2RIQA 5E5AC 1F66A 3X1SD 4J8WC 3C1BA 3B6GC 4Z5TD 2BYKA 2PYOC 1P3AB 3WTPE 4H9PB 3REJC 2G5HC 5CPJC 4H9QB 3WTPC 3AZFB 3AV1A 5GT0B 3AFAC 4J8UB 1R4VA 4J8VD 3MVDA 3R45A 5B31D 5G49B 2HUEB 4Z66C 5AV8D 4WU8D 5CPIB 4HGAB 3WAAB 3AZIB 1H3OB 3X1SC 4Z5TC 1P3IC 3W98A 3MGRD 5BNXB 4ZBJC 4AWLB 3AZNB 1P34D 5DNMA 5B33B 4NFTA 5B0ZB 3O62A 4J8VC 1P3MA 5BO0A 5B2ID 5AV6B 5JA4B 5B31C 3KXBD 1S32A 3UTBB 4KUDA 5AV8C 4Z2MH 3WKJD 4WU8C 1ULYA 3W99D 5AY8D 1P3OC 3REHA 3MGRC 1M18D 1P34C 3UTAD 2ZY4A 2ZY2A 1W2EA 5B2IC 3H0RC 3KXBC 5B24A 4WZSB 3EPJA 1KX3B 3MNNA 3WKJC 5B2JB 3AZLA 5AY8C 1M19D 1AOIB 3AYWA 3AZHD 4WU9D 3X1UA 1M18C 4H9OB 3AN2D 3LZ1B 3W96A 4XUJB 3UTAC 2F8NA 1P3BB 4XZQA 1PZRA 5CP6D 1EQZA 3RELA 2FJ7B 2YFVA 5B32D 5DNND 5B1LB 3WA9D 5AV5A 1BH9B 4CSRB 1M19C 3X1TD 3AZHC 4WU9C 4QLCB 4ZUXA 2Y2OA 2JSSA 3AN2C 4J8XB 2ZM5A 1P3AD 3AZKA 2W8SA 3F6TA 4WNNA 5CP6C 2BG1A 4J8UD 1A7WA 5AVCB 5AV9D 4H9PA 4G92B 3W98B 4H9QA 4WV4B 3AZFA 5GT0A 5DNNC 5B32C 5DNMB 3WA9C 1P3MB 3REIB 5BO0B 5G49A 3AZJD 3X1TC 3WAAD 1S32B 5CPIA 4JJND 1P3AC 3AZIA 3AZND 5F99B 2VQRA 5B33D 5B0ZD 4J8UC 5AV9C 5CPKA 3REHB 3B0CT 5AV6D 1M1AA 2HUEC 5BNVA 2XD5A 2J8PA 5JA4A 3REKD 5BS7A 3WAAC 3UTBA 3AZJC 5B24B 4YS3B 4JJNC 3LZ0D 3AZNC 3AZLB 2Y2QA 5B0ZC 5B33C 3TU4B 3KUYD 5C3IB 1ZLAA 4LD9A 3AV2D 3W97D 5GSUB 5AV6C 1P3FB 2F2AC 1KX3D 3IP4C 3EG5B 3REKC 4XZQB 5B2JD 1N1JA 3B6FD 3FDDA 4KHAB 5B0YB 5AVBB 3LZ0C 2ZY5A 3LZ1D 5AV5B 5KDMA 1AOIA 2YFWA 3KUYC 3AV2C 3W97C 4H9SA 5B1MA 1WWIA 3B0BA 4UPKA 4XUJA 3NQUA 4ZUXB 1F66D 3C1BD 1P3BA 1KX3C 2Y2MA 2FFFB 5B2JC 3AV1D 3B6FC 3LJAA 2FJ7A 3P5JB 4M6BA 3AL0C 3MVDD 4KGCA 5B1LA 1HTAA 1BH8B 1TZYA 3LZ1C 1BH9A 4CSRA
chains in the Genus database with same CATH topology
3AZEA 4QLCA 2IO5C 4J8XA 1F66C 3C1BC 3VH5A 3W98D 2AROB 3B0DC 5AVCA 5DNMD 5GXQB 4X23B 3AV1C 3O62D 1P3MD 1TAFA 5CPKB 3MVDC 1HQ3A 1M1AB 1P3LB 1S32D 5BNVB 3REIA 1ID3B 4KUDD 5JRGB 4E44A 4EO5C 1U35A 1KX4A 1KX5A 1P3IA 3REHD 5F99A 2NQBB 3VH5T 5DNMC 3O62C 4NE3A 1P3MC 3MGQB 1ZLAB 4LD9B 3AZGB 2ZY3A 4Z2MG 1S32C 5B24D 4KUDC 4G91C 1P3GA 1F1EA 3UT9B 3MNND 3LELB 1P3OA 3AZLD 1N1JB 4YS3A 3REHC 5B40B 3AYWD 3W99C 3X1UD 2NZDB 3TU4A 3W96D 5KDMB 2F8ND 2YFWB 5GSUA 1P3FA 5B1MB 4XZQD 2XD1A 1P3PB 4YM6B 3KFUG 3NQUB 5B24C 1EQZD 3RELD 3MNNC 4R8PB 2Y2JA 3AZLC 5AV5D 4KHAA 5B0YA 3LJAB 5AVBA 1BFMA 1Q9CA 4KGCB 3AYWC 3X1UC 1TZYB 4ZUXD 3W96C 2UWXA 1JFIA 3H0MC 5E5AB 3AZEB 3AZKD 5GT3A 4J8WB 4XZQC 3MGPA 2PYOB 3AZMA 1EQZC 3REJB 5CPJB 3WTPB 3RELC 3AZFD 3A1IA 5GT0D 5AV5C 1TAFB 1BH8A 2L5AA 4Z66B 1HQ3B 4DQYB 2CWEA 5CPID 3AZID 3AZKC 1U35B 3B0CW 2Y2HA 2HIOA 1KX4B 1KX5B 1P3IB 5CPKD 2AROA 3AZFC 5GXQA 4X23A 5GT0C 1M1AD 2DF4C 5B31G 3EPHA 5B31B 1P3LA 5AV8B 3UTBD 1ID3A 5JRGA 2DQNC 5CPIC 1P3GB 4HGAC 3AZIC 1P3OB 5FUGA 3C1CA 1B67A 2Y2LA 5CPKC 1P34B 1ZLAD 4AWLC 2NQBA 4LD9D 1M1AC 3MGQA 3A6NA 4NE6A 3AZGA 5CHLB 3X1VA 2BYMA 5BS7C 3UTBC 2CV5A 3WKJB 3UT9A 3LELA 5AY8B 4NE5A 4DRBA 1AOID 5B40A 1ZLAC 4LD9C 2NZDA 5B1MD 3UTAB 4XUJD 4H9RB 1P3BD 3KWQA 1JFIB 1P3PA 4YM6A 5GT3B 3MGPB 3V9RA 3AZMB 3LJAD 2FJ7D 4R8PA 4KGCD 5B1LD 3MGSA 1TZYD 3VH6A 1Z2CB 1M19B 1AOIC 3AZED 4QLCD 4H9SC 1T3UA 1P3KA 4J8XD 4XUJC 4H9NB 5E5AA 3B6GA 1P3BC 4J8WA 3NQJB 2PYOA 5AVCD 2HIOB 2JCHA 3REJA 5B32G 3LJAC 3WTPA 5CPJA 2FJ7C 5B32B 3AFAA 3EPLA 4KGCC 2Y2KA 5B1LC 1HQ3D 1TZYC 3REID 4Z66A 3AZEC 3VH6T 1U35D 4QLCC 4J8XC 1KX4D 1P3ID 1KX5D 3VH5W 3X1SA 5F99D 4Z5TA 5FUGB 5AV9B 3C1CB 5AVCC 4G92C 3W98C 4J8VA 1HQ3C 1B6WA 3REIC 5B31A 3AZJB 3A6NB 1P3GD 5AV8A 3X1VB 2BYMB 1U35C 1P3OD 4WU8A 4JJNB 2CV5B 4YS3D 1KX4C 1KX5C 2Y2GA 5F99C 2Y2IA 3MGRA 3TU4D 1P34A 5GSUD 1P3FD 2LY8A 5B2IA 3REKB 3KXBA 1P3GC 3KWQB 3WKJA 2F8NK 3V9RB 4YS3C 5B0YD 3LZ0B 3W99A 5AVBD 5AY8A 3MGSB 4UUZB 4E45A 3KUYB 5BT1D 3TU4C 5C3IC 3AV2B 1M18A 3W97B 3UTAA 5GSUC 1WWSA 4H9RA 5GT3D 1P3KB 3MGPD 1P3FC 4DRAA 3AZMD 3B6GB 3B6FB 1KU5A 4CAYA 5B0YC 3AFAB 5AVBC 1M19A 3AZHA 5BT1C 4WU9A 3AN2A 2IO5B 1F66B 4H9NA 5GT3C 4ZUXC 3C1BB 2BYKB 2HIOD 3MGPC 3AZMC 5CP6A 3NQJA 3B0DB 2AROD 3X1SB 4Z5TB 3AV1B 5GXQD 4X23D 2Y2PA 4ZBJB 5B32A 5DNNA 3MVDB 3R45B 3WA9A 4WJ3C 4J8VB 1P3LD 1ID3D 5JRGD 3X1TA 4EO5B 1P3AA 4WU8B 3C1CD 2HIOC 2AROC 4J8UA 2NQBD 5AV9A 3H0LC 5GXQC 4X23C 3O62B 3MGRB 3KSYA 3MGQD 3A6ND 2JE5A 3AZGD 2Y2NA 3X1VD 4KUDB 1P3LC 4G91B 1ID3C 2CV5D 5JRGC 3A1KA 5B2IB 3UT9D 3AZJA 3WAAA 3LELD 3KXBB 1H3OA 4JJNA 2G5IC 5BNXA 3C1CC 3AZNA 5B40D 3W99B 5B33A 5B0ZA 2NQBC 2NZDD 5AV6A 3MGQC 1M18B 3A6NC 3KWQD 1P3PD 3AZGC 4YM6D 3X1VC 3REKA 2CV5C 2F8NH 3MNNB 3UT9C 4R8PD 3LELC 3MGSD 2RVQD 3LZ0A 4CAYB 3AYWB 5B40C 3X1UB 4UUZA 2F8NG 3KUYA 1P3KD 3W96B 2NZDC 3AV2A 3W97A 2F8NB 3AZHB 4WU9B 5E5AD 3B6GD 3AN2B 4J8WD 5B1MC 3KWQC 1P3PC 2PYOD 4YM6C 1KX3A 3EPKA 1EQZB 3REJD 3RELB 5CPJD 5B2JA 5CP6B 3WTPD 2YFVB 4R8PC 3AFAD 3B6FA 3MGSC 2RVQC 3VH6W 5DNNB 4H9OA 3WA9B 4Z66D 3LZ1A 1P3KC 3X1TB 3AZKB 4WNNB 2RIQA 5E5AC 1F66A 3X1SD 4J8WC 3C1BA 3B6GC 4Z5TD 2BYKA 2PYOC 1P3AB 3WTPE 4H9PB 3REJC 2G5HC 5CPJC 4H9QB 3WTPC 3AZFB 3AV1A 5GT0B 3AFAC 4J8UB 1R4VA 4J8VD 3MVDA 3R45A 5B31D 5G49B 2HUEB 4Z66C 5AV8D 4WU8D 5CPIB 4HGAB 3WAAB 3AZIB 1H3OB 3X1SC 4Z5TC 1P3IC 3W98A 3MGRD 5BNXB 4ZBJC 4AWLB 3AZNB 1P34D 5DNMA 5B33B 4NFTA 5B0ZB 3O62A 4J8VC 1P3MA 5BO0A 5B2ID 5AV6B 5JA4B 5B31C 3KXBD 1S32A 3UTBB 4KUDA 5AV8C 4Z2MH 3WKJD 4WU8C 1ULYA 3W99D 5AY8D 1P3OC 3REHA 3MGRC 1M18D 1P34C 3UTAD 2ZY4A 2ZY2A 1W2EA 5B2IC 3H0RC 3KXBC 5B24A 4WZSB 3EPJA 1KX3B 3MNNA 3WKJC 5B2JB 3AZLA 5AY8C 1M19D 1AOIB 3AYWA 3AZHD 4WU9D 3X1UA 1M18C 4H9OB 3AN2D 3LZ1B 3W96A 4XUJB 3UTAC 2F8NA 1P3BB 4XZQA 1PZRA 5CP6D 1EQZA 3RELA 2FJ7B 2YFVA 5B32D 5DNND 5B1LB 3WA9D 5AV5A 1BH9B 4CSRB 1M19C 3X1TD 3AZHC 4WU9C 4QLCB 4ZUXA 2Y2OA 2JSSA 3AN2C 4J8XB 2ZM5A 1P3AD 3AZKA 2W8SA 3F6TA 4WNNA 5CP6C 2BG1A 4J8UD 1A7WA 5AVCB 5AV9D 4H9PA 4G92B 3W98B 4H9QA 4WV4B 3AZFA 5GT0A 5DNNC 5B32C 5DNMB 3WA9C 1P3MB 3REIB 5BO0B 5G49A 3AZJD 3X1TC 3WAAD 1S32B 5CPIA 4JJND 1P3AC 3AZIA 3AZND 5F99B 2VQRA 5B33D 5B0ZD 4J8UC 5AV9C 5CPKA 3REHB 3B0CT 5AV6D 1M1AA 2HUEC 5BNVA 2XD5A 2J8PA 5JA4A 3REKD 5BS7A 3WAAC 3UTBA 3AZJC 5B24B 4YS3B 4JJNC 3LZ0D 3AZNC 3AZLB 2Y2QA 5B0ZC 5B33C 3TU4B 3KUYD 5C3IB 1ZLAA 4LD9A 3AV2D 3W97D 5GSUB 5AV6C 1P3FB 2F2AC 1KX3D 3IP4C 3EG5B 3REKC 4XZQB 5B2JD 1N1JA 3B6FD 3FDDA 4KHAB 5B0YB 5AVBB 3LZ0C 2ZY5A 3LZ1D 5AV5B 5KDMA 1AOIA 2YFWA 3KUYC 3AV2C 3W97C 4H9SA 5B1MA 1WWIA 3B0BA 4UPKA 4XUJA 3NQUA 4ZUXB 1F66D 3C1BD 1P3BA 1KX3C 2Y2MA 2FFFB 5B2JC 3AV1D 3B6FC 3LJAA 2FJ7A 3P5JB 4M6BA 3AL0C 3MVDD 4KGCA 5B1LA 1HTAA 1BH8B 1TZYA 3LZ1C 1BH9A 4CSRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AZE A;  4QLC A;  2IO5 C;  4J8X A;  1F66 C;  3C1B C;  3VH5 A;  3W98 D;  2ARO B;  3B0D C;  5AVC A;  5DNM D;  5GXQ B;  4X23 B;  3AV1 C;  3O62 D;  1P3M D;  1TAF A;  5CPK B;  3MVD C;  1HQ3 A;  1M1A B;  1P3L B;  1S32 D;  5BNV B;  3REI A;  1ID3 B;  4KUD D;  5JRG B;  4E44 A;  4EO5 C;  1U35 A;  1KX4 A;  1KX5 A;  1P3I A;  3REH D;  5F99 A;  2NQB B;  3VH5 T;  5DNM C;  3O62 C;  4NE3 A;  1P3M C;  3MGQ B;  1ZLA B;  4LD9 B;  3AZG B;  4Z2M G;  1S32 C;  5B24 D;  4KUD C;  4G91 C;  1P3G A;  1F1E A;  3UT9 B;  3MNN D;  3LEL B;  1P3O A;  3AZL D;  1N1J B;  4YS3 A;  3REH C;  5B40 B;  3AYW D;  3W99 C;  3X1U D;  2NZD B;  3TU4 A;  3W96 D;  5KDM B;  2F8N D;  2YFW B;  5GSU A;  1P3F A;  5B1M B;  4XZQ D;  1P3P B;  4YM6 B;  3NQU B;  5B24 C;  1EQZ D;  3REL D;  3MNN C;  4R8P B;  3AZL C;  5AV5 D;  4KHA A;  5B0Y A;  3LJA B;  5AVB A;  1BFM A;  1Q9C A;  4KGC B;  3AYW C;  3X1U C;  1TZY B;  4ZUX D;  3W96 C;  1JFI A;  3AZK D;  5E5A B;  3AZE B;  5GT3 A;  4J8W B;  4XZQ C;  3MGP A;  2PYO B;  3AZM A;  1EQZ C;  3REJ B;  5CPJ B;  3WTP B;  3REL C;  3AZF D;  5GT0 D;  5AV5 C;  1TAF B;  1BH8 A;  2L5A A;  4Z66 B;  1HQ3 B;  2CWE A;  5CPI D;  3AZI D;  3AZK C;  1U35 B;  3B0C W;  2HIO A;  1KX4 B;  1KX5 B;  1P3I B;  5CPK D;  2ARO A;  3AZF C;  5GXQ A;  4X23 A;  5GT0 C;  1M1A D;  5B31 G;  5B31 B;  1P3L A;  5AV8 B;  3UTB D;  1ID3 A;  5JRG A;  5CPI C;  1P3G B;  4HGA C;  3AZI C;  1P3O B;  5FUG A;  3C1C A;  1B67 A;  5CPK C;  1ZLA D;  1P34 B;  2NQB A;  4AWL C;  4LD9 D;  1M1A C;  3MGQ A;  3A6N A;  4NE6 A;  3AZG A;  5CHL B;  3X1V A;  2BYM A;  5BS7 C;  3UTB C;  2CV5 A;  3WKJ B;  3UT9 A;  3LEL A;  5AY8 B;  4NE5 A;  4DRB A;  1AOI D;  5B40 A;  1ZLA C;  4LD9 C;  2NZD A;  5B1M D;  3UTA B;  4XUJ D;  4H9R B;  1P3B D;  3KWQ A;  1JFI B;  1P3P A;  4YM6 A;  5GT3 B;  3MGP B;  3V9R A;  3AZM B;  3LJA D;  2FJ7 D;  4R8P A;  4KGC D;  5B1L D;  3MGS A;  1TZY D;  3VH6 A;  1M19 B;  1AOI C;  3AZE D;  4QLC D;  4H9S C;  1P3K A;  4J8X D;  4XUJ C;  4H9N B;  5E5A A;  3B6G A;  1P3B C;  4J8W A;  3NQJ B;  2PYO A;  5AVC D;  2HIO B;  3REJ A;  5B32 G;  3LJA C;  3WTP A;  5CPJ A;  2FJ7 C;  5B32 B;  3AFA A;  4KGC C;  5B1L C;  1HQ3 D;  1TZY C;  3REI D;  4Z66 A;  3AZE C;  3VH6 T;  1U35 D;  4QLC C;  4J8X C;  1KX4 D;  1P3I D;  1KX5 D;  3VH5 W;  3X1S A;  5F99 D;  4Z5T A;  5FUG B;  5AV9 B;  3C1C B;  5AVC C;  4G92 C;  3W98 C;  4J8V A;  1HQ3 C;  1B6W A;  3REI C;  5B31 A;  3AZJ B;  3A6N B;  1P3G D;  5AV8 A;  3X1V B;  2BYM B;  1U35 C;  1P3O D;  4WU8 A;  4JJN B;  2CV5 B;  4YS3 D;  1KX4 C;  1KX5 C;  5F99 C;  3MGR A;  3TU4 D;  1P34 A;  5GSU D;  1P3F D;  2LY8 A;  5B2I A;  3REK B;  3KXB A;  1P3G C;  3KWQ B;  3WKJ A;  2F8N K;  3V9R B;  4YS3 C;  5B0Y D;  3LZ0 B;  3W99 A;  5AVB D;  5AY8 A;  3MGS B;  4UUZ B;  4E45 A;  3KUY B;  5BT1 D;  3TU4 C;  5C3I C;  3AV2 B;  1M18 A;  3W97 B;  3UTA A;  5GSU C;  1WWS A;  4H9R A;  5GT3 D;  1P3K B;  3MGP D;  1P3F C;  4DRA A;  3AZM D;  3B6G B;  3B6F B;  1KU5 A;  4CAY A;  5B0Y C;  3AFA B;  5AVB C;  1M19 A;  3AZH A;  5BT1 C;  4WU9 A;  3AN2 A;  2IO5 B;  1F66 B;  4H9N A;  5GT3 C;  4ZUX C;  3C1B B;  2BYK B;  2HIO D;  3MGP C;  3AZM C;  5CP6 A;  3NQJ A;  2ARO D;  3B0D B;  3X1S B;  4Z5T B;  3AV1 B;  5GXQ D;  4X23 D;  4ZBJ B;  5B32 A;  5DNN A;  3MVD B;  3R45 B;  3WA9 A;  4J8V B;  1P3L D;  1ID3 D;  5JRG D;  3X1T A;  4EO5 B;  1P3A A;  4WU8 B;  3C1C D;  2HIO C;  2ARO C;  4J8U A;  2NQB D;  5AV9 A;  5GXQ C;  4X23 C;  3O62 B;  3MGR B;  3KSY A;  3MGQ D;  3A6N D;  3AZG D;  3X1V D;  4KUD B;  1P3L C;  4G91 B;  1ID3 C;  2CV5 D;  5JRG C;  5B2I B;  3UT9 D;  3AZJ A;  3WAA A;  3LEL D;  3KXB B;  1H3O A;  4JJN A;  5BNX A;  3C1C C;  3AZN A;  5B40 D;  3W99 B;  5B33 A;  5B0Z A;  2NQB C;  2NZD D;  5AV6 A;  3MGQ C;  1M18 B;  3A6N C;  3KWQ D;  1P3P D;  3AZG C;  4YM6 D;  3X1V C;  3REK A;  2CV5 C;  2F8N H;  3MNN B;  3UT9 C;  4R8P D;  3LEL C;  3MGS D;  2RVQ D;  3LZ0 A;  4CAY B;  3AYW B;  5B40 C;  3X1U B;  4UUZ A;  2F8N G;  3KUY A;  1P3K D;  3W96 B;  2NZD C;  3AV2 A;  3W97 A;  2F8N B;  3AZH B;  4WU9 B;  5E5A D;  3B6G D;  3AN2 B;  4J8W D;  5B1M C;  3KWQ C;  1P3P C;  2PYO D;  4YM6 C;  1KX3 A;  1EQZ B;  3REJ D;  3REL B;  5CPJ D;  3WTP D;  5B2J A;  5CP6 B;  2YFV B;  4R8P C;  3AFA D;  3B6F A;  3MGS C;  2RVQ C;  3VH6 W;  5DNN B;  4H9O A;  3WA9 B;  4Z66 D;  3LZ1 A;  1P3K C;  3X1T B;  3AZK B;  4WNN B;  5E5A C;  1F66 A;  3B6G C;  3X1S D;  4J8W C;  3C1B A;  4Z5T D;  2BYK A;  2PYO C;  1P3A B;  3WTP E;  4H9P B;  3REJ C;  5CPJ C;  4H9Q B;  3WTP C;  3AZF B;  3AV1 A;  5GT0 B;  3AFA C;  4J8U B;  1R4V A;  4J8V D;  3MVD A;  3R45 A;  5B31 D;  5G49 B;  2HUE B;  4Z66 C;  5AV8 D;  4WU8 D;  5CPI B;  4HGA B;  3WAA B;  3AZI B;  1H3O B;  3X1S C;  4Z5T C;  1P3I C;  3W98 A;  3MGR D;  5BNX B;  4ZBJ C;  4AWL B;  3AZN B;  1P34 D;  5DNM A;  5B0Z B;  4NFT A;  5B33 B;  3O62 A;  4J8V C;  1P3M A;  5BO0 A;  5B2I D;  5AV6 B;  5JA4 B;  5B31 C;  3KXB D;  1S32 A;  3UTB B;  4KUD A;  5AV8 C;  4Z2M H;  3WKJ D;  4WU8 C;  1ULY A;  3W99 D;  5AY8 D;  1P3O C;  3REH A;  3MGR C;  1M18 D;  1P34 C;  3UTA D;  5B2I C;  3KXB C;  5B24 A;  4WZS B;  1KX3 B;  3WKJ C;  3MNN A;  5B2J B;  3AZL A;  5AY8 C;  1M19 D;  1AOI B;  3AYW A;  3AZH D;  4WU9 D;  3X1U A;  1M18 C;  4H9O B;  3AN2 D;  3LZ1 B;  3W96 A;  4XUJ B;  3UTA C;  2F8N A;  1P3B B;  4XZQ A;  5CP6 D;  1EQZ A;  3REL A;  2FJ7 B;  2YFV A;  5B32 D;  5DNN D;  5B1L B;  3WA9 D;  5AV5 A;  1BH9 B;  4CSR B;  1M19 C;  3X1T D;  3AZH C;  4WU9 C;  4QLC B;  4ZUX A;  3AN2 C;  2JSS A;  4J8X B;  1P3A D;  3AZK A;  4WNN A;  5CP6 C;  4J8U D;  1A7W A;  5AVC B;  5AV9 D;  4H9P A;  4G92 B;  3W98 B;  4H9Q A;  4WV4 B;  3AZF A;  5GT0 A;  5DNN C;  5B32 C;  5DNM B;  3WA9 C;  1P3M B;  3REI B;  5BO0 B;  5G49 A;  3AZJ D;  3X1T C;  3WAA D;  1S32 B;  5CPI A;  4JJN D;  1P3A C;  3AZI A;  3AZN D;  5F99 B;  5B33 D;  5B0Z D;  4J8U C;  5AV9 C;  5CPK A;  3REH B;  3B0C T;  5AV6 D;  1M1A A;  2HUE C;  5BNV A;  5JA4 A;  3REK D;  5BS7 A;  3WAA C;  3UTB A;  3AZJ C;  5B24 B;  4YS3 B;  4JJN C;  3LZ0 D;  3AZN C;  3AZL B;  5B0Z C;  5B33 C;  3TU4 B;  3KUY D;  5C3I B;  1ZLA A;  4LD9 A;  3AV2 D;  3W97 D;  5GSU B;  5AV6 C;  1P3F B;  1KX3 D;  3REK C;  4XZQ B;  5B2J D;  1N1J A;  3B6F D;  4KHA B;  5B0Y B;  5AVB B;  3LZ0 C;  3LZ1 D;  5AV5 B;  5KDM A;  1AOI A;  2YFW A;  3KUY C;  3AV2 C;  3W97 C;  4H9S A;  5B1M A;  1WWI A;  3B0B A;  4XUJ A;  1F66 D;  3NQU A;  4ZUX B;  3C1B D;  1P3B A;  1KX3 C;  5B2J C;  3AV1 D;  3B6F C;  3LJA A;  2FJ7 A;  4M6B A;  3MVD D;  4KGC A;  5B1L A;  1HTA A;  1BH8 B;  1TZY A;  3LZ1 C;  1BH9 A;  4CSR A; 
#chains in the Genus database with same CATH topology
 3AZE A;  4QLC A;  2IO5 C;  4J8X A;  1F66 C;  3C1B C;  3VH5 A;  3W98 D;  2ARO B;  3B0D C;  5AVC A;  5DNM D;  5GXQ B;  4X23 B;  3AV1 C;  3O62 D;  1P3M D;  1TAF A;  5CPK B;  3MVD C;  1HQ3 A;  1M1A B;  1P3L B;  1S32 D;  5BNV B;  3REI A;  1ID3 B;  4KUD D;  5JRG B;  4E44 A;  4EO5 C;  1U35 A;  1KX4 A;  1KX5 A;  1P3I A;  3REH D;  5F99 A;  2NQB B;  3VH5 T;  5DNM C;  3O62 C;  4NE3 A;  1P3M C;  3MGQ B;  1ZLA B;  4LD9 B;  3AZG B;  2ZY3 A;  4Z2M G;  1S32 C;  5B24 D;  4KUD C;  4G91 C;  1P3G A;  1F1E A;  3UT9 B;  3MNN D;  3LEL B;  1P3O A;  3AZL D;  1N1J B;  4YS3 A;  3REH C;  5B40 B;  3AYW D;  3W99 C;  3X1U D;  2NZD B;  3TU4 A;  3W96 D;  5KDM B;  2F8N D;  2YFW B;  5GSU A;  1P3F A;  5B1M B;  4XZQ D;  2XD1 A;  1P3P B;  4YM6 B;  3KFU G;  3NQU B;  5B24 C;  1EQZ D;  3REL D;  3MNN C;  4R8P B;  2Y2J A;  3AZL C;  5AV5 D;  4KHA A;  5B0Y A;  3LJA B;  5AVB A;  1BFM A;  1Q9C A;  4KGC B;  3AYW C;  3X1U C;  1TZY B;  4ZUX D;  3W96 C;  2UWX A;  1JFI A;  3H0M C;  5E5A B;  3AZE B;  3AZK D;  5GT3 A;  4J8W B;  4XZQ C;  3MGP A;  2PYO B;  3AZM A;  1EQZ C;  3REJ B;  5CPJ B;  3WTP B;  3REL C;  3AZF D;  3A1I A;  5GT0 D;  5AV5 C;  1TAF B;  1BH8 A;  2L5A A;  4Z66 B;  1HQ3 B;  4DQY B;  2CWE A;  5CPI D;  3AZI D;  3AZK C;  1U35 B;  3B0C W;  2Y2H A;  2HIO A;  1KX4 B;  1KX5 B;  1P3I B;  5CPK D;  2ARO A;  3AZF C;  5GXQ A;  4X23 A;  5GT0 C;  1M1A D;  2DF4 C;  5B31 G;  3EPH A;  5B31 B;  1P3L A;  5AV8 B;  3UTB D;  1ID3 A;  5JRG A;  2DQN C;  5CPI C;  1P3G B;  4HGA C;  3AZI C;  1P3O B;  5FUG A;  3C1C A;  1B67 A;  2Y2L A;  5CPK C;  1P34 B;  1ZLA D;  4AWL C;  2NQB A;  4LD9 D;  1M1A C;  3MGQ A;  3A6N A;  4NE6 A;  3AZG A;  5CHL B;  3X1V A;  2BYM A;  5BS7 C;  3UTB C;  2CV5 A;  3WKJ B;  3UT9 A;  3LEL A;  5AY8 B;  4NE5 A;  4DRB A;  1AOI D;  5B40 A;  1ZLA C;  4LD9 C;  2NZD A;  5B1M D;  3UTA B;  4XUJ D;  4H9R B;  1P3B D;  3KWQ A;  1JFI B;  1P3P A;  4YM6 A;  5GT3 B;  3MGP B;  3V9R A;  3AZM B;  3LJA D;  2FJ7 D;  4R8P A;  4KGC D;  5B1L D;  3MGS A;  1TZY D;  3VH6 A;  1Z2C B;  1M19 B;  1AOI C;  3AZE D;  4QLC D;  4H9S C;  1T3U A;  1P3K A;  4J8X D;  4XUJ C;  4H9N B;  5E5A A;  3B6G A;  1P3B C;  4J8W A;  3NQJ B;  2PYO A;  5AVC D;  2HIO B;  2JCH A;  3REJ A;  5B32 G;  3LJA C;  3WTP A;  5CPJ A;  2FJ7 C;  5B32 B;  3AFA A;  3EPL A;  4KGC C;  2Y2K A;  5B1L C;  1HQ3 D;  1TZY C;  3REI D;  4Z66 A;  3AZE C;  3VH6 T;  1U35 D;  4QLC C;  4J8X C;  1KX4 D;  1P3I D;  1KX5 D;  3VH5 W;  3X1S A;  5F99 D;  4Z5T A;  5FUG B;  5AV9 B;  3C1C B;  5AVC C;  4G92 C;  3W98 C;  4J8V A;  1HQ3 C;  1B6W A;  3REI C;  5B31 A;  3AZJ B;  3A6N B;  1P3G D;  5AV8 A;  3X1V B;  2BYM B;  1U35 C;  1P3O D;  4WU8 A;  4JJN B;  2CV5 B;  4YS3 D;  1KX4 C;  1KX5 C;  2Y2G A;  5F99 C;  2Y2I A;  3MGR A;  3TU4 D;  1P34 A;  5GSU D;  1P3F D;  2LY8 A;  5B2I A;  3REK B;  3KXB A;  1P3G C;  3KWQ B;  3WKJ A;  2F8N K;  3V9R B;  4YS3 C;  5B0Y D;  3LZ0 B;  3W99 A;  5AVB D;  5AY8 A;  3MGS B;  4UUZ B;  4E45 A;  3KUY B;  5BT1 D;  3TU4 C;  5C3I C;  3AV2 B;  1M18 A;  3W97 B;  3UTA A;  5GSU C;  1WWS A;  4H9R A;  5GT3 D;  1P3K B;  3MGP D;  1P3F C;  4DRA A;  3AZM D;  3B6G B;  3B6F B;  1KU5 A;  4CAY A;  5B0Y C;  3AFA B;  5AVB C;  1M19 A;  3AZH A;  5BT1 C;  4WU9 A;  3AN2 A;  2IO5 B;  1F66 B;  4H9N A;  5GT3 C;  4ZUX C;  3C1B B;  2BYK B;  2HIO D;  3MGP C;  3AZM C;  5CP6 A;  3NQJ A;  3B0D B;  2ARO D;  3X1S B;  4Z5T B;  3AV1 B;  5GXQ D;  4X23 D;  2Y2P A;  4ZBJ B;  5B32 A;  5DNN A;  3MVD B;  3R45 B;  3WA9 A;  4WJ3 C;  4J8V B;  1P3L D;  1ID3 D;  5JRG D;  3X1T A;  4EO5 B;  1P3A A;  4WU8 B;  3C1C D;  2HIO C;  2ARO C;  4J8U A;  2NQB D;  5AV9 A;  3H0L C;  5GXQ C;  4X23 C;  3O62 B;  3MGR B;  3KSY A;  3MGQ D;  3A6N D;  2JE5 A;  3AZG D;  2Y2N A;  3X1V D;  4KUD B;  1P3L C;  4G91 B;  1ID3 C;  2CV5 D;  5JRG C;  3A1K A;  5B2I B;  3UT9 D;  3AZJ A;  3WAA A;  3LEL D;  3KXB B;  1H3O A;  4JJN A;  2G5I C;  5BNX A;  3C1C C;  3AZN A;  5B40 D;  3W99 B;  5B33 A;  5B0Z A;  2NQB C;  2NZD D;  5AV6 A;  3MGQ C;  1M18 B;  3A6N C;  3KWQ D;  1P3P D;  3AZG C;  4YM6 D;  3X1V C;  3REK A;  2CV5 C;  2F8N H;  3MNN B;  3UT9 C;  4R8P D;  3LEL C;  3MGS D;  2RVQ D;  3LZ0 A;  4CAY B;  3AYW B;  5B40 C;  3X1U B;  4UUZ A;  2F8N G;  3KUY A;  1P3K D;  3W96 B;  2NZD C;  3AV2 A;  3W97 A;  2F8N B;  3AZH B;  4WU9 B;  5E5A D;  3B6G D;  3AN2 B;  4J8W D;  5B1M C;  3KWQ C;  1P3P C;  2PYO D;  4YM6 C;  1KX3 A;  3EPK A;  1EQZ B;  3REJ D;  3REL B;  5CPJ D;  5B2J A;  5CP6 B;  3WTP D;  2YFV B;  4R8P C;  3AFA D;  3B6F A;  3MGS C;  2RVQ C;  3VH6 W;  5DNN B;  4H9O A;  3WA9 B;  4Z66 D;  3LZ1 A;  1P3K C;  3X1T B;  3AZK B;  4WNN B;  2RIQ A;  5E5A C;  1F66 A;  3X1S D;  4J8W C;  3C1B A;  3B6G C;  4Z5T D;  2BYK A;  2PYO C;  1P3A B;  3WTP E;  4H9P B;  3REJ C;  2G5H C;  5CPJ C;  4H9Q B;  3WTP C;  3AZF B;  3AV1 A;  5GT0 B;  3AFA C;  4J8U B;  1R4V A;  4J8V D;  3MVD A;  3R45 A;  5B31 D;  5G49 B;  2HUE B;  4Z66 C;  5AV8 D;  4WU8 D;  5CPI B;  4HGA B;  3WAA B;  3AZI B;  1H3O B;  3X1S C;  4Z5T C;  1P3I C;  3W98 A;  3MGR D;  5BNX B;  4ZBJ C;  4AWL B;  3AZN B;  1P34 D;  5DNM A;  5B33 B;  4NFT A;  5B0Z B;  3O62 A;  4J8V C;  1P3M A;  5BO0 A;  5B2I D;  5AV6 B;  5JA4 B;  5B31 C;  3KXB D;  1S32 A;  3UTB B;  4KUD A;  5AV8 C;  4Z2M H;  3WKJ D;  4WU8 C;  1ULY A;  3W99 D;  5AY8 D;  1P3O C;  3REH A;  3MGR C;  1M18 D;  1P34 C;  3UTA D;  2ZY4 A;  2ZY2 A;  1W2E A;  5B2I C;  3H0R C;  3KXB C;  5B24 A;  4WZS B;  3EPJ A;  1KX3 B;  3MNN A;  3WKJ C;  5B2J B;  3AZL A;  5AY8 C;  1M19 D;  1AOI B;  3AYW A;  3AZH D;  4WU9 D;  3X1U A;  1M18 C;  4H9O B;  3AN2 D;  3LZ1 B;  3W96 A;  4XUJ B;  3UTA C;  2F8N A;  1P3B B;  4XZQ A;  1PZR A;  5CP6 D;  1EQZ A;  3REL A;  2FJ7 B;  2YFV A;  5B32 D;  5DNN D;  5B1L B;  3WA9 D;  5AV5 A;  1BH9 B;  4CSR B;  1M19 C;  3X1T D;  3AZH C;  4WU9 C;  4QLC B;  4ZUX A;  2Y2O A;  2JSS A;  3AN2 C;  4J8X B;  2ZM5 A;  1P3A D;  3AZK A;  2W8S A;  3F6T A;  4WNN A;  5CP6 C;  2BG1 A;  4J8U D;  1A7W A;  5AVC B;  5AV9 D;  4H9P A;  4G92 B;  3W98 B;  4H9Q A;  4WV4 B;  3AZF A;  5GT0 A;  5DNN C;  5B32 C;  5DNM B;  3WA9 C;  1P3M B;  3REI B;  5BO0 B;  5G49 A;  3AZJ D;  3X1T C;  3WAA D;  1S32 B;  5CPI A;  4JJN D;  1P3A C;  3AZI A;  3AZN D;  5F99 B;  2VQR A;  5B33 D;  5B0Z D;  4J8U C;  5AV9 C;  5CPK A;  3REH B;  3B0C T;  5AV6 D;  1M1A A;  2HUE C;  5BNV A;  2XD5 A;  2J8P A;  5JA4 A;  3REK D;  5BS7 A;  3WAA C;  3UTB A;  3AZJ C;  5B24 B;  4YS3 B;  4JJN C;  3LZ0 D;  3AZN C;  3AZL B;  2Y2Q A;  5B0Z C;  5B33 C;  3TU4 B;  3KUY D;  5C3I B;  1ZLA A;  4LD9 A;  3AV2 D;  3W97 D;  5GSU B;  5AV6 C;  1P3F B;  2F2A C;  1KX3 D;  3IP4 C;  3EG5 B;  3REK C;  4XZQ B;  5B2J D;  1N1J A;  3B6F D;  3FDD A;  4KHA B;  5B0Y B;  5AVB B;  3LZ0 C;  2ZY5 A;  3LZ1 D;  5AV5 B;  5KDM A;  1AOI A;  2YFW A;  3KUY C;  3AV2 C;  3W97 C;  4H9S A;  5B1M A;  1WWI A;  3B0B A;  4UPK A;  4XUJ A;  3NQU A;  4ZUX B;  1F66 D;  3C1B D;  1P3B A;  1KX3 C;  2Y2M A;  2FFF B;  5B2J C;  3AV1 D;  3B6F C;  3LJA A;  2FJ7 A;  3P5J B;  4M6B A;  3AL0 C;  3MVD D;  4KGC A;  5B1L A;  1HTA A;  1BH8 B;  1TZY A;  3LZ1 C;  1BH9 A;  4CSR A; 
#chains in the Genus database with same CATH homology
 3AZE A;  4QLC A;  2IO5 C;  4J8X A;  1F66 C;  3C1B C;  3VH5 A;  3W98 D;  2ARO B;  3B0D C;  5AVC A;  5DNM D;  5GXQ B;  4X23 B;  3AV1 C;  3O62 D;  1P3M D;  1TAF A;  5CPK B;  3MVD C;  1HQ3 A;  1M1A B;  1P3L B;  1S32 D;  5BNV B;  3REI A;  1ID3 B;  4KUD D;  5JRG B;  4E44 A;  4EO5 C;  1U35 A;  1KX4 A;  1KX5 A;  1P3I A;  3REH D;  5F99 A;  2NQB B;  3VH5 T;  5DNM C;  3O62 C;  4NE3 A;  1P3M C;  3MGQ B;  1ZLA B;  4LD9 B;  3AZG B;  2ZY3 A;  4Z2M G;  1S32 C;  5B24 D;  4KUD C;  4G91 C;  1P3G A;  1F1E A;  3UT9 B;  3MNN D;  3LEL B;  1P3O A;  3AZL D;  1N1J B;  4YS3 A;  3REH C;  5B40 B;  3AYW D;  3W99 C;  3X1U D;  2NZD B;  3TU4 A;  3W96 D;  5KDM B;  2F8N D;  2YFW B;  5GSU A;  1P3F A;  5B1M B;  4XZQ D;  2XD1 A;  1P3P B;  4YM6 B;  3KFU G;  3NQU B;  5B24 C;  1EQZ D;  3REL D;  3MNN C;  4R8P B;  2Y2J A;  3AZL C;  5AV5 D;  4KHA A;  5B0Y A;  3LJA B;  5AVB A;  1BFM A;  1Q9C A;  4KGC B;  3AYW C;  3X1U C;  1TZY B;  4ZUX D;  3W96 C;  2UWX A;  1JFI A;  3H0M C;  5E5A B;  3AZE B;  3AZK D;  5GT3 A;  4J8W B;  4XZQ C;  3MGP A;  2PYO B;  3AZM A;  1EQZ C;  3REJ B;  5CPJ B;  3WTP B;  3REL C;  3AZF D;  3A1I A;  5GT0 D;  5AV5 C;  1TAF B;  1BH8 A;  2L5A A;  4Z66 B;  1HQ3 B;  4DQY B;  2CWE A;  5CPI D;  3AZI D;  3AZK C;  1U35 B;  3B0C W;  2Y2H A;  2HIO A;  1KX4 B;  1KX5 B;  1P3I B;  5CPK D;  2ARO A;  3AZF C;  5GXQ A;  4X23 A;  5GT0 C;  1M1A D;  2DF4 C;  5B31 G;  3EPH A;  5B31 B;  1P3L A;  5AV8 B;  3UTB D;  1ID3 A;  5JRG A;  2DQN C;  5CPI C;  1P3G B;  4HGA C;  3AZI C;  1P3O B;  5FUG A;  3C1C A;  1B67 A;  2Y2L A;  5CPK C;  1P34 B;  1ZLA D;  4AWL C;  2NQB A;  4LD9 D;  1M1A C;  3MGQ A;  3A6N A;  4NE6 A;  3AZG A;  5CHL B;  3X1V A;  2BYM A;  5BS7 C;  3UTB C;  2CV5 A;  3WKJ B;  3UT9 A;  3LEL A;  5AY8 B;  4NE5 A;  4DRB A;  1AOI D;  5B40 A;  1ZLA C;  4LD9 C;  2NZD A;  5B1M D;  3UTA B;  4XUJ D;  4H9R B;  1P3B D;  3KWQ A;  1JFI B;  1P3P A;  4YM6 A;  5GT3 B;  3MGP B;  3V9R A;  3AZM B;  3LJA D;  2FJ7 D;  4R8P A;  4KGC D;  5B1L D;  3MGS A;  1TZY D;  3VH6 A;  1Z2C B;  1M19 B;  1AOI C;  3AZE D;  4QLC D;  4H9S C;  1T3U A;  1P3K A;  4J8X D;  4XUJ C;  4H9N B;  5E5A A;  3B6G A;  1P3B C;  4J8W A;  3NQJ B;  2PYO A;  5AVC D;  2HIO B;  2JCH A;  3REJ A;  5B32 G;  3LJA C;  3WTP A;  5CPJ A;  2FJ7 C;  5B32 B;  3AFA A;  3EPL A;  4KGC C;  2Y2K A;  5B1L C;  1HQ3 D;  1TZY C;  3REI D;  4Z66 A;  3AZE C;  3VH6 T;  1U35 D;  4QLC C;  4J8X C;  1KX4 D;  1P3I D;  1KX5 D;  3VH5 W;  3X1S A;  5F99 D;  4Z5T A;  5FUG B;  5AV9 B;  3C1C B;  5AVC C;  4G92 C;  3W98 C;  4J8V A;  1HQ3 C;  1B6W A;  3REI C;  5B31 A;  3AZJ B;  3A6N B;  1P3G D;  5AV8 A;  3X1V B;  2BYM B;  1U35 C;  1P3O D;  4WU8 A;  4JJN B;  2CV5 B;  4YS3 D;  1KX4 C;  1KX5 C;  2Y2G A;  5F99 C;  2Y2I A;  3MGR A;  3TU4 D;  1P34 A;  5GSU D;  1P3F D;  2LY8 A;  5B2I A;  3REK B;  3KXB A;  1P3G C;  3KWQ B;  3WKJ A;  2F8N K;  3V9R B;  4YS3 C;  5B0Y D;  3LZ0 B;  3W99 A;  5AVB D;  5AY8 A;  3MGS B;  4UUZ B;  4E45 A;  3KUY B;  5BT1 D;  3TU4 C;  5C3I C;  3AV2 B;  1M18 A;  3W97 B;  3UTA A;  5GSU C;  1WWS A;  4H9R A;  5GT3 D;  1P3K B;  3MGP D;  1P3F C;  4DRA A;  3AZM D;  3B6G B;  3B6F B;  1KU5 A;  4CAY A;  5B0Y C;  3AFA B;  5AVB C;  1M19 A;  3AZH A;  5BT1 C;  4WU9 A;  3AN2 A;  2IO5 B;  1F66 B;  4H9N A;  5GT3 C;  4ZUX C;  3C1B B;  2BYK B;  2HIO D;  3MGP C;  3AZM C;  5CP6 A;  3NQJ A;  3B0D B;  2ARO D;  3X1S B;  4Z5T B;  3AV1 B;  5GXQ D;  4X23 D;  2Y2P A;  4ZBJ B;  5B32 A;  5DNN A;  3MVD B;  3R45 B;  3WA9 A;  4WJ3 C;  4J8V B;  1P3L D;  1ID3 D;  5JRG D;  3X1T A;  4EO5 B;  1P3A A;  4WU8 B;  3C1C D;  2HIO C;  2ARO C;  4J8U A;  2NQB D;  5AV9 A;  3H0L C;  5GXQ C;  4X23 C;  3O62 B;  3MGR B;  3KSY A;  3MGQ D;  3A6N D;  2JE5 A;  3AZG D;  2Y2N A;  3X1V D;  4KUD B;  1P3L C;  4G91 B;  1ID3 C;  2CV5 D;  5JRG C;  3A1K A;  5B2I B;  3UT9 D;  3AZJ A;  3WAA A;  3LEL D;  3KXB B;  1H3O A;  4JJN A;  2G5I C;  5BNX A;  3C1C C;  3AZN A;  5B40 D;  3W99 B;  5B33 A;  5B0Z A;  2NQB C;  2NZD D;  5AV6 A;  3MGQ C;  1M18 B;  3A6N C;  3KWQ D;  1P3P D;  3AZG C;  4YM6 D;  3X1V C;  3REK A;  2CV5 C;  2F8N H;  3MNN B;  3UT9 C;  4R8P D;  3LEL C;  3MGS D;  2RVQ D;  3LZ0 A;  4CAY B;  3AYW B;  5B40 C;  3X1U B;  4UUZ A;  2F8N G;  3KUY A;  1P3K D;  3W96 B;  2NZD C;  3AV2 A;  3W97 A;  2F8N B;  3AZH B;  4WU9 B;  5E5A D;  3B6G D;  3AN2 B;  4J8W D;  5B1M C;  3KWQ C;  1P3P C;  2PYO D;  4YM6 C;  1KX3 A;  3EPK A;  1EQZ B;  3REJ D;  3REL B;  5CPJ D;  5B2J A;  5CP6 B;  3WTP D;  2YFV B;  4R8P C;  3AFA D;  3B6F A;  3MGS C;  2RVQ C;  3VH6 W;  5DNN B;  4H9O A;  3WA9 B;  4Z66 D;  3LZ1 A;  1P3K C;  3X1T B;  3AZK B;  4WNN B;  2RIQ A;  5E5A C;  1F66 A;  3X1S D;  4J8W C;  3C1B A;  3B6G C;  4Z5T D;  2BYK A;  2PYO C;  1P3A B;  3WTP E;  4H9P B;  3REJ C;  2G5H C;  5CPJ C;  4H9Q B;  3WTP C;  3AZF B;  3AV1 A;  5GT0 B;  3AFA C;  4J8U B;  1R4V A;  4J8V D;  3MVD A;  3R45 A;  5B31 D;  5G49 B;  2HUE B;  4Z66 C;  5AV8 D;  4WU8 D;  5CPI B;  4HGA B;  3WAA B;  3AZI B;  1H3O B;  3X1S C;  4Z5T C;  1P3I C;  3W98 A;  3MGR D;  5BNX B;  4ZBJ C;  4AWL B;  3AZN B;  1P34 D;  5DNM A;  5B33 B;  4NFT A;  5B0Z B;  3O62 A;  4J8V C;  1P3M A;  5BO0 A;  5B2I D;  5AV6 B;  5JA4 B;  5B31 C;  3KXB D;  1S32 A;  3UTB B;  4KUD A;  5AV8 C;  4Z2M H;  3WKJ D;  4WU8 C;  1ULY A;  3W99 D;  5AY8 D;  1P3O C;  3REH A;  3MGR C;  1M18 D;  1P34 C;  3UTA D;  2ZY4 A;  2ZY2 A;  1W2E A;  5B2I C;  3H0R C;  3KXB C;  5B24 A;  4WZS B;  3EPJ A;  1KX3 B;  3MNN A;  3WKJ C;  5B2J B;  3AZL A;  5AY8 C;  1M19 D;  1AOI B;  3AYW A;  3AZH D;  4WU9 D;  3X1U A;  1M18 C;  4H9O B;  3AN2 D;  3LZ1 B;  3W96 A;  4XUJ B;  3UTA C;  2F8N A;  1P3B B;  4XZQ A;  1PZR A;  5CP6 D;  1EQZ A;  3REL A;  2FJ7 B;  2YFV A;  5B32 D;  5DNN D;  5B1L B;  3WA9 D;  5AV5 A;  1BH9 B;  4CSR B;  1M19 C;  3X1T D;  3AZH C;  4WU9 C;  4QLC B;  4ZUX A;  2Y2O A;  2JSS A;  3AN2 C;  4J8X B;  2ZM5 A;  1P3A D;  3AZK A;  2W8S A;  3F6T A;  4WNN A;  5CP6 C;  2BG1 A;  4J8U D;  1A7W A;  5AVC B;  5AV9 D;  4H9P A;  4G92 B;  3W98 B;  4H9Q A;  4WV4 B;  3AZF A;  5GT0 A;  5DNN C;  5B32 C;  5DNM B;  3WA9 C;  1P3M B;  3REI B;  5BO0 B;  5G49 A;  3AZJ D;  3X1T C;  3WAA D;  1S32 B;  5CPI A;  4JJN D;  1P3A C;  3AZI A;  3AZN D;  5F99 B;  2VQR A;  5B33 D;  5B0Z D;  4J8U C;  5AV9 C;  5CPK A;  3REH B;  3B0C T;  5AV6 D;  1M1A A;  2HUE C;  5BNV A;  2XD5 A;  2J8P A;  5JA4 A;  3REK D;  5BS7 A;  3WAA C;  3UTB A;  3AZJ C;  5B24 B;  4YS3 B;  4JJN C;  3LZ0 D;  3AZN C;  3AZL B;  2Y2Q A;  5B0Z C;  5B33 C;  3TU4 B;  3KUY D;  5C3I B;  1ZLA A;  4LD9 A;  3AV2 D;  3W97 D;  5GSU B;  5AV6 C;  1P3F B;  2F2A C;  1KX3 D;  3IP4 C;  3EG5 B;  3REK C;  4XZQ B;  5B2J D;  1N1J A;  3B6F D;  3FDD A;  4KHA B;  5B0Y B;  5AVB B;  3LZ0 C;  2ZY5 A;  3LZ1 D;  5AV5 B;  5KDM A;  1AOI A;  2YFW A;  3KUY C;  3AV2 C;  3W97 C;  4H9S A;  5B1M A;  1WWI A;  3B0B A;  4UPK A;  4XUJ A;  3NQU A;  4ZUX B;  1F66 D;  3C1B D;  1P3B A;  1KX3 C;  2Y2M A;  2FFF B;  5B2J C;  3AV1 D;  3B6F C;  3LJA A;  2FJ7 A;  3P5J B;  4M6B A;  3AL0 C;  3MVD D;  4KGC A;  5B1L A;  1HTA A;  1BH8 B;  1TZY A;  3LZ1 C;  1BH9 A;  4CSR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...