4EO5B

Yeast asf1 bound to h3/h4g94p mutant
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
76
structure length
76
Chain Sequence
ALIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone chaperone ASF1
publication title The conformational flexibility of the C-terminus of histone H4 promotes histone octamer and nucleosome stability and yeast viability.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Structural protein/chaperone
total genus 25
structure length 76
sequence length 76
ec nomenclature
pdb deposition date 2012-04-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4eo5B00
2F8NA 3AZKC 5CPJC 3W98C 1P3KA 4NE5A 5CPJA 2YFVB 5AVBD 2AROD 3MGSD 5F99B 4Z2MH 5E5AD 3B0CT 1M18B 5F99C 3RELB 3O62D 2YFVA 3RELC 4YS3B 5F99A 3X1TD 4E45A 1M18A 4Z66D 4YS3C 2FJ7B 3RELA 3W97D 2FJ7C 4YS3A 2FJ7A 3AZMD 1B67A 4Z5TD 1P3AB 5AVBB 2AROB 3MGSB 3AZGC 5E5AB 1P3AC 5AVBC 3VH5W 3MGSC 5E5AC 1ULYA 5FUGB 3O62B 1P3AA 5AVBA 2AROA 3MGSA 3X1TB 5E5AA 4Z66B 5CP6D 3X1TC 3W97B 5FUGA 4Z66C 3O62A 5B32G 3X1TA 4Z66A 3W97A 4Z5TB 1BH8B 4Z5TA 1BH8A 3KWQD 3LZ0D 5CP6B 5B2ID 5CP6C 5B32D 4DRBA 5CP6A 3B6FD 4R8PB 4WZSB 4R8PC 3AV2C 3KWQB 2RVQD 4R8PA 3KWQC 1S32D 3AZND 5B2IB 3KWQA 3AZJD 3LZ0A 1P3GD 3B6FB 3R45B 4H9QB 5B2IA 3B6FC 4X23D 3WA9D 3B6FA 3R45A 5AV5D 5AV9B 4H9QA 3B0CW 5AV9C 4J8UD 3MNND 3UTAC 1R4VA 2RVQC 3REKD 5AV9A 3AZNB 4UUZB 1S32B 5GT0B 3AZNC 1S32C 3UT9D 5AY8B 5GT0C 3AZJB 1U35B 3NQJB 1S32A 3AZNA 5AY8C 3AZJC 4UUZA 1U35C 5GT0A 3AZLD 5AY8A 4X23B 3AZJA 3WA9B 4CSRB 1U35A 3NQJA 5AV5B 3WA9C 4J8UB 5AV5C 3REID 4J8UC 1TAFB 4X23A 3AV1D 4CSRA 4J8VD 3REKB 5AV5A 3WA9A 1P3OB 1EQZB 4J8UA 5B24D 3UT9B 2CWEA 1P3OC 1EQZC 1TAFA 3UT9C 3REKA 4WU8D 1EQZA 3AZLB 3UT9A 5B31G 3AZLC 1M1AB 3REIB 2BYKB 4M6BA 1BH9B 3AZLA 1M1AC 3REIC 3AV1B 4J8VB 3AV1C 4J8VC 1M1AA 3REIA 4ZUXB 1BH9A 5BS7A 5BT1C 3AV1A 4ZUXC 4J8VA 5CPJD 3AZKD 4WU8B 3W98D 5B31D 4ZUXA 4WU8A 3V9RA 3C1CB 3C1CC 2HIOB 2IO5B 2HIOC 2IO5C 5B0ZD 3C1CA 3RELD 5B2JD 3WTPD 2HIOA 4YS3D 5KDMB 3AZKB 3W98B 2FJ7D 5BO0B 3VH6T 5B31B 4KUDC 5B31C 5KDMA 5B40C 3AZKA 3W98A 5BO0A 1HQ3B 4Z2MG 3AZGD 5JRGB 1P3AD 5B31A 1F1EA 5AV6B 1HQ3C 5JRGC 3AFAB 5AV6C 5B0ZB 1KX3B 1HQ3A 5B2JB 3WTPB 5B0ZC 5JRGA 3AFAC 1KX3C 3X1UD 5AV6A 4YM6D 5B2JC 5AVCC 3WTPC 3A6ND 5B0ZA 4KGCC 5B2JA 3WTPA 3AZGB 2LY8A 4DRAA 4J8WB 4J8WC 4NE3A 3AZGA 4J8WA 3X1UB 4YM6B 3A6NB 3X1UC 4YM6C 3A6NC 3REJB 3MVDB 3X1UA 4YM6A 3A6NA 3REJC 3MVDC 4KHAB 3REJA 1AOID 3MVDA 4R8PD 5CPID 3AV2D 1KU5A 4KHAA 1KX4C 5G49B 4EO5B 5B1MB 1B6WA 4EO5C 5B1MC 5GSUB 3AZHD 5DNMD 5GSUC 5B1MA 1AOIB 1H3OB 5CPIB 1AOIC 5AV9D 3AV2B 5CPIC 1AOIA 3UTAD 1H3OA 5CPIA 3AV2A 5GT0D 3AZHB 5GT3D 1Q9CA 5DNMB 5AY8D 3KSYA 3LZ1B 3AZHC 1U35D 5DNMC 1P3ID 3LZ1C 2JSSA 4H9NB 3AZHA 5DNMA 3LZ1A 4G92B 3W99D 4G92C 3UTAB 4H9NA 3KUYB 1P3OD 1EQZD 3UTAA 5GT3B 5B1LD 3KUYC 3KXBB 5GT3C 1P3IB 3KXBC 3KUYA 3AZED 1P3IC 5GT3A 3KXBA 1P3LD 1P3IA 4E44A 3W99B 1M1AD 3W99C 4G91B 3W99A 3LJAB 4XUJC 4G91C 5B1LB 5BT1D 4ZUXD 3LJAC 5B1LC 3AYWB 3LJAA 3AZEB 3AYWC 1P3OA 3X1SD 5B1LA 3AZEC 1P3LB 1M19B 3AYWA 3C1CD 1P3LC 1M19C 3AZEA 1P34D 2HIOD 1P3LA 1M19A 2BYKA 3X1SB 4JJNB 4KUDD 5B40D 2F8NH 3X1SC 4JJNC 3WAAB 4CAYB 1P34B 1HQ3D 3X1SA 5JA4B 5JRGD 3WAAC 4JJNA 1P3PD 3WKJC 5AV6D 1P34C 3B6GC 4H9PB 3AFAD 1KX5D 3WAAA 1KX3D 4CAYA 3REHC 1P34A 2NZDB 5JA4A 5AVCD 4WNNB 3C1BB 2NZDC 4KGCD 4H9PA 3C1BC 2NZDA 4KUDB 5B40B 4WNNA 3C1BA 2PYOB 5CPKB 2PYOC 5CPKC 1P3PB 4KUDA 4J8WD 5B40A 2YFWB 1P3PC 3B0BA 1P3FD 5CPKA 1KX5B 5CHLB 1KX5C 5AVCB 1P3PA 3WTPE 4KGCB 2YFWA 4H9OB 3AFAA 1KX5A 5GXQD 1KX3A 3REJD 5AVCA 3MVDD 4KGCA 4H9OA 4ZBJB 1P3KC 4ZBJC 5BNVB 5B0YB 1P3FB 5B0YC 1KX4D 1P3FC 1TZYB 3W96B 5BNVA 5B0YA 1TZYC 3W96C 5DNND 3AN2B 1ZLAB 2CV5D 1P3FA 3UTBD 3AN2C 5GXQB 1ZLAC 5B1MD 2NQBD 1TZYA 3W96A 2HUEB 3VH6A 1M18C 5C3IB 5GXQC 5GSUD 1ZLAA 2HUEC 3AN2A 5C3IC 1P3BD 3MGPB 5GXQA 4NE6A 3MGPC 3MGPA 1KX4B 5DNNB 4LD9D 2CV5B 5DNNC 3UTBB 2NQBB 2CV5C 2AROC 1KX4A 3UTBC 2NQBC 1HTAA 5DNNA 2CV5A 3O62C 5G49A 3LZ1D 4XZQD 1P3BB 3UTBA 2NQBA 1WWSA 1P3BC 5GSUA 3W97C 1P3BA 5AV8D 3AZMB 4LD9B 3AZMC 4AWLB 4Z5TC 4LD9C 4AWLC 3B0DB 4WV4B 3NQUB 3AZMA 1JFIB 3KUYD 3B0DC 4LD9A 4XZQB 3VH6W 4H9SC 3KXBD 5BNXB 1JFIA 3NQUA 4XZQC 2F8NK 4H9SA 4XZQA 5AV8B 3TU4D 3X1VD 1F66D 5BNXA 1ID3D 5AV8C 3LELD 4H9RB 4XUJD 5AV8A 1P3MD 3LJAD 3LZ0B 4H9RA 1WWIA 3AYWD 3LZ0C 5B2IC 5B32B 3TU4B 3X1VB 1M19D 1F66B 1A7WA 5B32C 1ID3B 3TU4C 3X1VC 1F66C 3MGQD 3LELB 1ID3C 5B32A 4XUJB 3LELC 3TU4A 4QLCD 3X1VA 4WU9D 1P3MB 1F66A 1ID3A 1P3MC 3LELA 4XUJA 1P3MA 4JJND 1P3GB 3WAAD 3WKJD 1P3GC 3MGQB 3B6GD 3MGQC 4QLCB 3REHD 4WU9B 1P3GA 4X23C 4QLCC 2NZDD 3MGQA 4J8XD 4WU9C 3VH5T 3AZFD 3MNNB 3C1BD 4QLCA 3MNNC 4WU9A 2F8NG 3REKC 3MNNA 2PYOD 1BFMA 5CPKD 3WKJB 3MGRD 3B6GB 3AZID 3REHB 5B33D 3WKJA 4HGAB 4J8XB 3B6GA 3AZFB 4HGAC 4J8XC 3AZFC 3REHA 2F8ND 5BS7C 4J8XA 5B24B 3AZFA 1P3KD 5B24C 3MGRB 3V9RB 1N1JB 3AZIB 5B0YD 5B24A 3MGRC 4WU8C 3AZIC 2PYOA 5B33B 2L5AA 1TZYD 3MGRA 3W96D 1N1JA 3VH5A 2BYMB 5B33C 3AZIA 1ZLAD 3AN2D 5F99D 1M18D 5B33A 2F8NB 2BYMA 1P3KB 4NFTA 3MGPD 5CPJB
chains in the Genus database with same CATH superfamily
2F8NA 3KFUG 2Y2LA 3AZKC 5CPJC 3W98C 4WJ3C 1P3KA 4NE5A 5CPJA 2YFVB 5AVBD 2AROD 3MGSD 5F99B 4Z2MH 5E5AD 3B0CT 1M18B 5F99C 3RELB 3O62D 2YFVA 3RELC 4YS3B 5F99A 3X1TD 4E45A 1M18A 4Z66D 4YS3C 2FJ7B 3RELA 3W97D 2FJ7C 4YS3A 2FJ7A 3AZMD 1B67A 4Z5TD 1P3AB 5AVBB 2AROB 3MGSB 3AZGC 5E5AB 1P3AC 5AVBC 3VH5W 3MGSC 5E5AC 1ULYA 5FUGB 3O62B 1P3AA 5AVBA 2AROA 3MGSA 3X1TB 5E5AA 4Z66B 5CP6D 3X1TC 3W97B 5FUGA 4Z66C 3O62A 2XD5A 5B32G 3X1TA 4Z66A 3W97A 4Z5TB 1BH8B 4Z5TA 1BH8A 3KWQD 3LZ0D 5CP6B 5B2ID 5CP6C 5B32D 4DRBA 5CP6A 3B6FD 2ZY5A 4R8PB 2Y2PA 4WZSB 4R8PC 2JCHA 3AV2C 3KWQB 2RVQD 4R8PA 3KWQC 1S32D 3AZND 5B2IB 3AL0C 3KWQA 3AZJD 3LZ0A 1P3GD 3B6FB 3R45B 4H9QB 5B2IA 3B6FC 4X23D 3WA9D 3B6FA 3R45A 5AV5D 5AV9B 4H9QA 3B0CW 5AV9C 4J8UD 3MNND 3UTAC 1R4VA 2RVQC 3H0MC 5AV9A 3REKD 4UUZB 3AZNB 1S32B 5GT0B 3AZNC 1S32C 3UT9D 5AY8B 5GT0C 3AZJB 1U35B 3NQJB 1S32A 3AZNA 5AY8C 3AZJC 4UUZA 1U35C 5GT0A 3AZLD 5AY8A 4X23B 3AZJA 3WA9B 4CSRB 1U35A 3NQJA 5AV5B 3WA9C 4J8UB 5AV5C 3EPLA 3REID 4J8UC 1TAFB 4X23A 3EPJA 4CSRA 2Y2GA 4J8VD 5AV5A 3REKB 3AV1D 3WA9A 1P3OB 1EQZB 4J8UA 5B24D 2UWXA 2CWEA 3UT9B 1P3OC 1EQZC 1TAFA 3UT9C 3REKA 4WU8D 1EQZA 3AZLB 3UT9A 5B31G 3AZLC 1M1AB 3REIB 2BYKB 4M6BA 1BH9B 3AZLA 1M1AC 3REIC 3AV1B 4J8VB 3AV1C 4J8VC 1M1AA 3REIA 4ZUXB 1BH9A 5BS7A 5BT1C 3AV1A 4ZUXC 4J8VA 5CPJD 3AZKD 4WU8B 3W98D 5B31D 4ZUXA 4WU8A 3V9RA 3C1CB 3C1CC 2HIOB 2IO5B 2HIOC 2IO5C 5B0ZD 3C1CA 3RELD 5B2JD 3WTPD 2HIOA 4YS3D 5KDMB 3AZKB 3W98B 2FJ7D 5BO0B 3VH6T 5B31B 4DQYB 4KUDC 5B31C 5KDMA 5B40C 3AZKA 3W98A 5BO0A 1HQ3B 4Z2MG 3AZGD 5JRGB 1P3AD 5B31A 1F1EA 5AV6B 1HQ3C 5JRGC 3AFAB 5AV6C 5B0ZB 1KX3B 1PZRA 1HQ3A 5B2JB 3WTPB 5B0ZC 5JRGA 3AFAC 1KX3C 3X1UD 5AV6A 4YM6D 5B2JC 5AVCC 3WTPC 3A6ND 5B0ZA 4KGCC 5B2JA 3WTPA 1T3UA 3AZGB 2LY8A 4DRAA 1Z2CB 4J8WB 4J8WC 4NE3A 2Y2NA 3AZGA 4J8WA 3X1UB 4YM6B 3A6NB 3H0RC 3X1UC 4YM6C 3A6NC 3REJB 3MVDB 3X1UA 4YM6A 3A6NA 3REJC 3MVDC 2VQRA 4KHAB 3REJA 1AOID 3MVDA 4R8PD 5CPID 4UPKA 3AV2D 1KU5A 4KHAA 1KX4C 5G49B 4EO5B 5B1MB 1B6WA 2FFFB 4EO5C 5B1MC 5GSUB 3AZHD 5DNMD 3A1KA 5GSUC 5B1MA 1AOIB 1H3OB 5CPIB 1AOIC 5AV9D 3AV2B 5CPIC 2Y2IA 1AOIA 3UTAD 1H3OA 5CPIA 3AV2A 5GT0D 3AZHB 5GT3D 1Q9CA 5DNMB 5AY8D 3KSYA 3LZ1B 3AZHC 1U35D 3EPHA 5DNMC 1P3ID 3LZ1C 1W2EA 2JSSA 4H9NB 3AZHA 5DNMA 3LZ1A 4G92B 3W99D 4G92C 3UTAB 4H9NA 2Y2KA 3KUYB 3EPKA 1P3OD 1EQZD 3UTAA 5GT3B 5B1LD 3EG5B 3KUYC 3KXBB 5GT3C 1P3IB 2G5HC 3KXBC 3KUYA 3AZED 1P3IC 5GT3A 3KXBA 2ZY4A 1P3LD 1P3IA 4E44A 3W99B 1M1AD 3W99C 4G91B 3W99A 3LJAB 4XUJC 4G91C 5B1LB 5BT1D 4ZUXD 3LJAC 5B1LC 3AYWB 3LJAA 3AZEB 3AYWC 1P3OA 3X1SD 5B1LA 3AZEC 1P3LB 1M19B 3AYWA 3C1CD 1P3LC 1M19C 3AZEA 1P34D 2HIOD 1P3LA 1M19A 2BYKA 3P5JB 3X1SB 4JJNB 4KUDD 3IP4C 5B40D 2F8NH 3X1SC 4JJNC 3WAAB 4CAYB 1P34B 1HQ3D 3X1SA 5JA4B 5JRGD 3WAAC 4JJNA 1P3PD 3WKJC 5AV6D 1P34C 3B6GC 4H9PB 3AFAD 1KX5D 2DQNC 3WAAA 1KX3D 4CAYA 3REHC 1P34A 2NZDB 5JA4A 5AVCD 4WNNB 3C1BB 2NZDC 2Y2QA 4KGCD 4H9PA 3C1BC 2F2AC 2W8SA 2NZDA 4KUDB 2ZM5A 5B40B 4WNNA 3C1BA 2PYOB 5CPKB 2PYOC 5CPKC 1P3PB 4KUDA 4J8WD 5B40A 2YFWB 1P3PC 3B0BA 1P3FD 5CPKA 1KX5B 5CHLB 1KX5C 5AVCB 1P3PA 3WTPE 4KGCB 2YFWA 4H9OB 3AFAA 1KX5A 5GXQD 1KX3A 3REJD 5AVCA 3MVDD 4KGCA 2XD1A 4H9OA 4ZBJB 1P3KC 4ZBJC 5BNVB 5B0YB 2ZY2A 1P3FB 5B0YC 1KX4D 1P3FC 1TZYB 3W96B 2DF4C 5BNVA 5B0YA 1TZYC 3W96C 5DNND 3AN2B 1ZLAB 2CV5D 1P3FA 3UTBD 3AN2C 5GXQB 1ZLAC 5B1MD 2NQBD 1TZYA 3W96A 2HUEB 3VH6A 1M18C 5C3IB 5GXQC 5GSUD 1ZLAA 2HUEC 3AN2A 5C3IC 1P3BD 3MGPB 5GXQA 4NE6A 3MGPC 2ZY3A 3MGPA 1KX4B 5DNNB 4LD9D 2CV5B 5DNNC 3H0LC 3UTBB 2NQBB 2CV5C 2AROC 1KX4A 3UTBC 2NQBC 1HTAA 5DNNA 2CV5A 3O62C 5G49A 3LZ1D 4XZQD 1P3BB 3UTBA 2JE5A 2NQBA 1WWSA 1P3BC 5GSUA 3W97C 1P3BA 5AV8D 3AZMB 4LD9B 3AZMC 4AWLB 4Z5TC 4LD9C 4AWLC 3B0DB 4WV4B 3NQUB 3AZMA 1JFIB 3KUYD 2Y2HA 3B0DC 4LD9A 4XZQB 3VH6W 4H9SC 3KXBD 5BNXB 1JFIA 3NQUA 4XZQC 2F8NK 4H9SA 4XZQA 5AV8B 3TU4D 3X1VD 1F66D 5BNXA 1ID3D 5AV8C 3LELD 4H9RB 4XUJD 5AV8A 2Y2JA 1P3MD 3LJAD 3LZ0B 1WWIA 4H9RA 3AYWD 3LZ0C 5B2IC 5B32B 3TU4B 2Y2MA 3X1VB 1M19D 1F66B 1A7WA 5B32C 1ID3B 3TU4C 3X1VC 1F66C 3MGQD 3FDDA 3LELB 1ID3C 5B32A 4XUJB 3LELC 3TU4A 4QLCD 3X1VA 4WU9D 1P3MB 1F66A 1ID3A 1P3MC 3LELA 4XUJA 1P3MA 2J8PA 4JJND 1P3GB 2Y2OA 3WAAD 3WKJD 1P3GC 3MGQB 3B6GD 3MGQC 4QLCB 3A1IA 3REHD 4WU9B 1P3GA 3F6TA 4X23C 4QLCC 2NZDD 3MGQA 4J8XD 4WU9C 3VH5T 3AZFD 3MNNB 3C1BD 4QLCA 3MNNC 4WU9A 2F8NG 3REKC 3MNNA 2PYOD 1BFMA 5CPKD 3WKJB 3MGRD 3B6GB 3AZID 3REHB 5B33D 3WKJA 4HGAB 4J8XB 3B6GA 3AZFB 4HGAC 4J8XC 2BG1A 2G5IC 3REHA 3AZFC 2F8ND 5BS7C 4J8XA 5B24B 3AZFA 1P3KD 5B24C 3MGRB 3V9RB 1N1JB 3AZIB 5B0YD 5B24A 3MGRC 4WU8C 3AZIC 2PYOA 5B33B 2L5AA 1TZYD 3MGRA 3W96D 1N1JA 3VH5A 2BYMB 5B33C 3AZIA 1ZLAD 3AN2D 2RIQA 5F99D 1M18D 5B33A 2F8NB 2BYMA 1P3KB 4NFTA 3MGPD 5CPJB
chains in the Genus database with same CATH topology
2F8NA 3KFUG 2Y2LA 3AZKC 5CPJC 3W98C 4WJ3C 1P3KA 4NE5A 5CPJA 2YFVB 5AVBD 2AROD 3MGSD 5F99B 4Z2MH 5E5AD 3B0CT 1M18B 5F99C 3RELB 3O62D 2YFVA 3RELC 4YS3B 5F99A 3X1TD 4E45A 1M18A 4Z66D 4YS3C 2FJ7B 3RELA 3W97D 2FJ7C 4YS3A 2FJ7A 3AZMD 1B67A 4Z5TD 1P3AB 5AVBB 2AROB 3MGSB 3AZGC 5E5AB 1P3AC 5AVBC 3VH5W 3MGSC 5E5AC 1ULYA 5FUGB 3O62B 1P3AA 5AVBA 2AROA 3MGSA 3X1TB 5E5AA 4Z66B 5CP6D 3X1TC 3W97B 5FUGA 4Z66C 3O62A 2XD5A 5B32G 3X1TA 4Z66A 3W97A 4Z5TB 1BH8B 4Z5TA 1BH8A 3KWQD 3LZ0D 5CP6B 5B2ID 5CP6C 5B32D 4DRBA 5CP6A 3B6FD 2ZY5A 4R8PB 2Y2PA 4WZSB 4R8PC 2JCHA 3AV2C 3KWQB 2RVQD 4R8PA 3KWQC 1S32D 3AZND 5B2IB 3AL0C 3KWQA 3AZJD 3LZ0A 1P3GD 3B6FB 3R45B 4H9QB 5B2IA 3B6FC 4X23D 3WA9D 3B6FA 3R45A 5AV5D 5AV9B 4H9QA 3B0CW 5AV9C 4J8UD 3MNND 3UTAC 1R4VA 2RVQC 3H0MC 5AV9A 3REKD 4UUZB 3AZNB 1S32B 5GT0B 3AZNC 1S32C 3UT9D 5AY8B 5GT0C 3AZJB 1U35B 3NQJB 1S32A 3AZNA 5AY8C 3AZJC 4UUZA 1U35C 5GT0A 3AZLD 5AY8A 4X23B 3AZJA 3WA9B 4CSRB 1U35A 3NQJA 5AV5B 3WA9C 4J8UB 5AV5C 3EPLA 3REID 4J8UC 1TAFB 4X23A 3EPJA 4CSRA 2Y2GA 4J8VD 5AV5A 3REKB 3AV1D 3WA9A 1P3OB 1EQZB 4J8UA 5B24D 2UWXA 2CWEA 3UT9B 1P3OC 1EQZC 1TAFA 3UT9C 3REKA 4WU8D 1EQZA 3AZLB 3UT9A 5B31G 3AZLC 1M1AB 3REIB 2BYKB 4M6BA 1BH9B 3AZLA 1M1AC 3REIC 3AV1B 4J8VB 3AV1C 4J8VC 1M1AA 3REIA 4ZUXB 1BH9A 5BS7A 5BT1C 3AV1A 4ZUXC 4J8VA 5CPJD 3AZKD 4WU8B 3W98D 5B31D 4ZUXA 4WU8A 3V9RA 3C1CB 3C1CC 2HIOB 2IO5B 2HIOC 2IO5C 5B0ZD 3C1CA 3RELD 5B2JD 3WTPD 2HIOA 4YS3D 5KDMB 3AZKB 3W98B 2FJ7D 5BO0B 3VH6T 5B31B 4DQYB 4KUDC 5B31C 5KDMA 5B40C 3AZKA 3W98A 5BO0A 1HQ3B 4Z2MG 3AZGD 5JRGB 1P3AD 5B31A 1F1EA 5AV6B 1HQ3C 5JRGC 3AFAB 5AV6C 5B0ZB 1KX3B 1PZRA 1HQ3A 5B2JB 3WTPB 5B0ZC 5JRGA 3AFAC 1KX3C 3X1UD 5AV6A 4YM6D 5B2JC 5AVCC 3WTPC 3A6ND 5B0ZA 4KGCC 5B2JA 3WTPA 1T3UA 3AZGB 2LY8A 4DRAA 1Z2CB 4J8WB 4J8WC 4NE3A 2Y2NA 3AZGA 4J8WA 3X1UB 4YM6B 3A6NB 3H0RC 3X1UC 4YM6C 3A6NC 3REJB 3MVDB 3X1UA 4YM6A 3A6NA 3REJC 3MVDC 2VQRA 4KHAB 3REJA 1AOID 3MVDA 4R8PD 5CPID 4UPKA 3AV2D 1KU5A 4KHAA 1KX4C 5G49B 4EO5B 5B1MB 1B6WA 2FFFB 4EO5C 5B1MC 5GSUB 3AZHD 5DNMD 3A1KA 5GSUC 5B1MA 1AOIB 1H3OB 5CPIB 1AOIC 5AV9D 3AV2B 5CPIC 2Y2IA 1AOIA 3UTAD 1H3OA 5CPIA 3AV2A 5GT0D 3AZHB 5GT3D 1Q9CA 5DNMB 5AY8D 3KSYA 3LZ1B 3AZHC 1U35D 3EPHA 5DNMC 1P3ID 3LZ1C 1W2EA 2JSSA 4H9NB 3AZHA 5DNMA 3LZ1A 4G92B 3W99D 4G92C 3UTAB 4H9NA 2Y2KA 3KUYB 3EPKA 1P3OD 1EQZD 3UTAA 5GT3B 5B1LD 3EG5B 3KUYC 3KXBB 5GT3C 1P3IB 2G5HC 3KXBC 3KUYA 3AZED 1P3IC 5GT3A 3KXBA 2ZY4A 1P3LD 1P3IA 4E44A 3W99B 1M1AD 3W99C 4G91B 3W99A 3LJAB 4XUJC 4G91C 5B1LB 5BT1D 4ZUXD 3LJAC 5B1LC 3AYWB 3LJAA 3AZEB 3AYWC 1P3OA 3X1SD 5B1LA 3AZEC 1P3LB 1M19B 3AYWA 3C1CD 1P3LC 1M19C 3AZEA 1P34D 2HIOD 1P3LA 1M19A 2BYKA 3P5JB 3X1SB 4JJNB 4KUDD 3IP4C 5B40D 2F8NH 3X1SC 4JJNC 3WAAB 4CAYB 1P34B 1HQ3D 3X1SA 5JA4B 5JRGD 3WAAC 4JJNA 1P3PD 3WKJC 5AV6D 1P34C 3B6GC 4H9PB 3AFAD 1KX5D 2DQNC 3WAAA 1KX3D 4CAYA 3REHC 1P34A 2NZDB 5JA4A 5AVCD 4WNNB 3C1BB 2NZDC 2Y2QA 4KGCD 4H9PA 3C1BC 2F2AC 2W8SA 2NZDA 4KUDB 2ZM5A 5B40B 4WNNA 3C1BA 2PYOB 5CPKB 2PYOC 5CPKC 1P3PB 4KUDA 4J8WD 5B40A 2YFWB 1P3PC 3B0BA 1P3FD 5CPKA 1KX5B 5CHLB 1KX5C 5AVCB 1P3PA 3WTPE 4KGCB 2YFWA 4H9OB 3AFAA 1KX5A 5GXQD 1KX3A 3REJD 5AVCA 3MVDD 4KGCA 2XD1A 4H9OA 4ZBJB 1P3KC 4ZBJC 5BNVB 5B0YB 2ZY2A 1P3FB 5B0YC 1KX4D 1P3FC 1TZYB 3W96B 2DF4C 5BNVA 5B0YA 1TZYC 3W96C 5DNND 3AN2B 1ZLAB 2CV5D 1P3FA 3UTBD 3AN2C 5GXQB 1ZLAC 5B1MD 2NQBD 1TZYA 3W96A 2HUEB 3VH6A 1M18C 5C3IB 5GXQC 5GSUD 1ZLAA 2HUEC 3AN2A 5C3IC 1P3BD 3MGPB 5GXQA 4NE6A 3MGPC 2ZY3A 3MGPA 1KX4B 5DNNB 4LD9D 2CV5B 5DNNC 3H0LC 3UTBB 2NQBB 2CV5C 2AROC 1KX4A 3UTBC 2NQBC 1HTAA 5DNNA 2CV5A 3O62C 5G49A 3LZ1D 4XZQD 1P3BB 3UTBA 2JE5A 2NQBA 1WWSA 1P3BC 5GSUA 3W97C 1P3BA 5AV8D 3AZMB 4LD9B 3AZMC 4AWLB 4Z5TC 4LD9C 4AWLC 3B0DB 4WV4B 3NQUB 3AZMA 1JFIB 3KUYD 2Y2HA 3B0DC 4LD9A 4XZQB 3VH6W 4H9SC 3KXBD 5BNXB 1JFIA 3NQUA 4XZQC 2F8NK 4H9SA 4XZQA 5AV8B 3TU4D 3X1VD 1F66D 5BNXA 1ID3D 5AV8C 3LELD 4H9RB 4XUJD 5AV8A 2Y2JA 1P3MD 3LJAD 3LZ0B 1WWIA 4H9RA 3AYWD 3LZ0C 5B2IC 5B32B 3TU4B 2Y2MA 3X1VB 1M19D 1F66B 1A7WA 5B32C 1ID3B 3TU4C 3X1VC 1F66C 3MGQD 3FDDA 3LELB 1ID3C 5B32A 4XUJB 3LELC 3TU4A 4QLCD 3X1VA 4WU9D 1P3MB 1F66A 1ID3A 1P3MC 3LELA 4XUJA 1P3MA 2J8PA 4JJND 1P3GB 2Y2OA 3WAAD 3WKJD 1P3GC 3MGQB 3B6GD 3MGQC 4QLCB 3A1IA 3REHD 4WU9B 1P3GA 3F6TA 4X23C 4QLCC 2NZDD 3MGQA 4J8XD 4WU9C 3VH5T 3AZFD 3MNNB 3C1BD 4QLCA 3MNNC 4WU9A 2F8NG 3REKC 3MNNA 2PYOD 1BFMA 5CPKD 3WKJB 3MGRD 3B6GB 3AZID 3REHB 5B33D 3WKJA 4HGAB 4J8XB 3B6GA 3AZFB 4HGAC 4J8XC 2BG1A 2G5IC 3REHA 3AZFC 2F8ND 5BS7C 4J8XA 5B24B 3AZFA 1P3KD 5B24C 3MGRB 3V9RB 1N1JB 3AZIB 5B0YD 5B24A 3MGRC 4WU8C 3AZIC 2PYOA 5B33B 2L5AA 1TZYD 3MGRA 3W96D 1N1JA 3VH5A 2BYMB 5B33C 3AZIA 1ZLAD 3AN2D 2RIQA 5F99D 1M18D 5B33A 2F8NB 2BYMA 1P3KB 4NFTA 3MGPD 5CPJB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F8N A;  3AZK C;  5CPJ C;  3W98 C;  1P3K A;  4NE5 A;  5CPJ A;  2YFV B;  5AVB D;  2ARO D;  3MGS D;  5F99 B;  4Z2M H;  5E5A D;  3B0C T;  1M18 B;  5F99 C;  3REL B;  3O62 D;  2YFV A;  3REL C;  4YS3 B;  5F99 A;  3X1T D;  4E45 A;  1M18 A;  4Z66 D;  4YS3 C;  2FJ7 B;  3REL A;  3W97 D;  2FJ7 C;  4YS3 A;  2FJ7 A;  3AZM D;  1B67 A;  4Z5T D;  1P3A B;  5AVB B;  2ARO B;  3MGS B;  3AZG C;  5E5A B;  1P3A C;  5AVB C;  3VH5 W;  3MGS C;  5E5A C;  1ULY A;  5FUG B;  3O62 B;  1P3A A;  5AVB A;  2ARO A;  3MGS A;  3X1T B;  5E5A A;  4Z66 B;  5CP6 D;  3X1T C;  3W97 B;  5FUG A;  4Z66 C;  3O62 A;  5B32 G;  3X1T A;  4Z66 A;  3W97 A;  4Z5T B;  1BH8 B;  4Z5T A;  1BH8 A;  3KWQ D;  3LZ0 D;  5CP6 B;  5B2I D;  5CP6 C;  5B32 D;  4DRB A;  5CP6 A;  3B6F D;  4R8P B;  4WZS B;  4R8P C;  3AV2 C;  3KWQ B;  2RVQ D;  4R8P A;  3KWQ C;  1S32 D;  3AZN D;  5B2I B;  3KWQ A;  3AZJ D;  3LZ0 A;  1P3G D;  3B6F B;  3R45 B;  4H9Q B;  5B2I A;  3B6F C;  4X23 D;  3WA9 D;  3B6F A;  3R45 A;  5AV5 D;  5AV9 B;  4H9Q A;  3B0C W;  5AV9 C;  4J8U D;  3MNN D;  3UTA C;  1R4V A;  2RVQ C;  3REK D;  5AV9 A;  3AZN B;  4UUZ B;  1S32 B;  5GT0 B;  3AZN C;  1S32 C;  3UT9 D;  5AY8 B;  5GT0 C;  3AZJ B;  1U35 B;  3NQJ B;  1S32 A;  3AZN A;  5AY8 C;  3AZJ C;  4UUZ A;  1U35 C;  5GT0 A;  3AZL D;  5AY8 A;  4X23 B;  3AZJ A;  3WA9 B;  4CSR B;  1U35 A;  3NQJ A;  5AV5 B;  3WA9 C;  4J8U B;  5AV5 C;  3REI D;  4J8U C;  1TAF B;  4X23 A;  3AV1 D;  4CSR A;  4J8V D;  3REK B;  5AV5 A;  3WA9 A;  1P3O B;  1EQZ B;  4J8U A;  5B24 D;  3UT9 B;  2CWE A;  1P3O C;  1EQZ C;  1TAF A;  3UT9 C;  3REK A;  4WU8 D;  1EQZ A;  3AZL B;  3UT9 A;  5B31 G;  3AZL C;  1M1A B;  3REI B;  2BYK B;  4M6B A;  1BH9 B;  3AZL A;  1M1A C;  3REI C;  3AV1 B;  4J8V B;  3AV1 C;  4J8V C;  1M1A A;  3REI A;  4ZUX B;  1BH9 A;  5BS7 A;  5BT1 C;  3AV1 A;  4ZUX C;  4J8V A;  5CPJ D;  3AZK D;  4WU8 B;  3W98 D;  5B31 D;  4ZUX A;  4WU8 A;  3V9R A;  3C1C B;  3C1C C;  2HIO B;  2IO5 B;  2HIO C;  2IO5 C;  5B0Z D;  3C1C A;  3REL D;  5B2J D;  3WTP D;  2HIO A;  4YS3 D;  5KDM B;  3AZK B;  3W98 B;  2FJ7 D;  5BO0 B;  3VH6 T;  5B31 B;  4KUD C;  5B31 C;  5KDM A;  5B40 C;  3AZK A;  3W98 A;  5BO0 A;  1HQ3 B;  4Z2M G;  3AZG D;  5JRG B;  1P3A D;  5B31 A;  1F1E A;  5AV6 B;  1HQ3 C;  5JRG C;  3AFA B;  5AV6 C;  5B0Z B;  1KX3 B;  1HQ3 A;  5B2J B;  3WTP B;  5B0Z C;  5JRG A;  3AFA C;  1KX3 C;  3X1U D;  5AV6 A;  4YM6 D;  5B2J C;  5AVC C;  3WTP C;  3A6N D;  5B0Z A;  4KGC C;  5B2J A;  3WTP A;  3AZG B;  2LY8 A;  4DRA A;  4J8W B;  4J8W C;  4NE3 A;  3AZG A;  4J8W A;  3X1U B;  4YM6 B;  3A6N B;  3X1U C;  4YM6 C;  3A6N C;  3REJ B;  3MVD B;  3X1U A;  4YM6 A;  3A6N A;  3REJ C;  3MVD C;  4KHA B;  3REJ A;  1AOI D;  3MVD A;  4R8P D;  5CPI D;  3AV2 D;  1KU5 A;  4KHA A;  1KX4 C;  5G49 B;  4EO5 B;  5B1M B;  1B6W A;  4EO5 C;  5B1M C;  5GSU B;  3AZH D;  5DNM D;  5GSU C;  5B1M A;  1AOI B;  1H3O B;  5CPI B;  1AOI C;  5AV9 D;  3AV2 B;  5CPI C;  1AOI A;  3UTA D;  1H3O A;  5CPI A;  3AV2 A;  5GT0 D;  3AZH B;  5GT3 D;  1Q9C A;  5DNM B;  5AY8 D;  3KSY A;  3LZ1 B;  3AZH C;  1U35 D;  5DNM C;  1P3I D;  3LZ1 C;  2JSS A;  4H9N B;  3AZH A;  5DNM A;  3LZ1 A;  4G92 B;  3W99 D;  4G92 C;  3UTA B;  4H9N A;  3KUY B;  1P3O D;  1EQZ D;  3UTA A;  5GT3 B;  5B1L D;  3KUY C;  3KXB B;  5GT3 C;  1P3I B;  3KXB C;  3KUY A;  3AZE D;  1P3I C;  5GT3 A;  3KXB A;  1P3L D;  1P3I A;  4E44 A;  3W99 B;  1M1A D;  3W99 C;  4G91 B;  3W99 A;  3LJA B;  4XUJ C;  4G91 C;  5B1L B;  5BT1 D;  4ZUX D;  3LJA C;  5B1L C;  3AYW B;  3LJA A;  3AZE B;  3AYW C;  1P3O A;  3X1S D;  5B1L A;  3AZE C;  1P3L B;  1M19 B;  3AYW A;  3C1C D;  1P3L C;  1M19 C;  3AZE A;  1P34 D;  2HIO D;  1P3L A;  1M19 A;  2BYK A;  3X1S B;  4JJN B;  4KUD D;  5B40 D;  2F8N H;  3X1S C;  4JJN C;  3WAA B;  4CAY B;  1P34 B;  1HQ3 D;  3X1S A;  5JA4 B;  5JRG D;  3WAA C;  4JJN A;  1P3P D;  3WKJ C;  5AV6 D;  1P34 C;  3B6G C;  4H9P B;  3AFA D;  1KX5 D;  3WAA A;  1KX3 D;  4CAY A;  3REH C;  1P34 A;  2NZD B;  5JA4 A;  5AVC D;  4WNN B;  3C1B B;  2NZD C;  4KGC D;  4H9P A;  3C1B C;  2NZD A;  4KUD B;  5B40 B;  4WNN A;  3C1B A;  2PYO B;  5CPK B;  2PYO C;  5CPK C;  1P3P B;  4KUD A;  4J8W D;  5B40 A;  2YFW B;  1P3P C;  3B0B A;  1P3F D;  5CPK A;  1KX5 B;  5CHL B;  1KX5 C;  5AVC B;  1P3P A;  3WTP E;  4KGC B;  2YFW A;  4H9O B;  3AFA A;  1KX5 A;  5GXQ D;  1KX3 A;  3REJ D;  5AVC A;  3MVD D;  4KGC A;  4H9O A;  4ZBJ B;  1P3K C;  4ZBJ C;  5BNV B;  5B0Y B;  1P3F B;  5B0Y C;  1KX4 D;  1P3F C;  1TZY B;  3W96 B;  5BNV A;  5B0Y A;  1TZY C;  3W96 C;  5DNN D;  3AN2 B;  1ZLA B;  2CV5 D;  1P3F A;  3UTB D;  3AN2 C;  5GXQ B;  1ZLA C;  5B1M D;  2NQB D;  1TZY A;  3W96 A;  2HUE B;  3VH6 A;  1M18 C;  5C3I B;  5GXQ C;  5GSU D;  1ZLA A;  2HUE C;  3AN2 A;  5C3I C;  1P3B D;  3MGP B;  5GXQ A;  4NE6 A;  3MGP C;  3MGP A;  1KX4 B;  5DNN B;  4LD9 D;  2CV5 B;  5DNN C;  3UTB B;  2NQB B;  2CV5 C;  2ARO C;  1KX4 A;  3UTB C;  2NQB C;  1HTA A;  5DNN A;  2CV5 A;  3O62 C;  5G49 A;  3LZ1 D;  4XZQ D;  1P3B B;  3UTB A;  2NQB A;  1WWS A;  1P3B C;  5GSU A;  3W97 C;  1P3B A;  5AV8 D;  3AZM B;  4LD9 B;  3AZM C;  4AWL B;  4Z5T C;  4LD9 C;  4AWL C;  3B0D B;  4WV4 B;  3NQU B;  3AZM A;  1JFI B;  3KUY D;  3B0D C;  4LD9 A;  4XZQ B;  3VH6 W;  4H9S C;  3KXB D;  5BNX B;  1JFI A;  3NQU A;  4XZQ C;  2F8N K;  4H9S A;  4XZQ A;  5AV8 B;  3TU4 D;  3X1V D;  1F66 D;  5BNX A;  1ID3 D;  5AV8 C;  3LEL D;  4H9R B;  4XUJ D;  5AV8 A;  1P3M D;  3LJA D;  3LZ0 B;  4H9R A;  1WWI A;  3AYW D;  3LZ0 C;  5B2I C;  5B32 B;  3TU4 B;  3X1V B;  1M19 D;  1F66 B;  1A7W A;  5B32 C;  1ID3 B;  3TU4 C;  3X1V C;  1F66 C;  3MGQ D;  3LEL B;  1ID3 C;  5B32 A;  4XUJ B;  3LEL C;  3TU4 A;  4QLC D;  3X1V A;  4WU9 D;  1P3M B;  1F66 A;  1ID3 A;  1P3M C;  3LEL A;  4XUJ A;  1P3M A;  4JJN D;  1P3G B;  3WAA D;  3WKJ D;  1P3G C;  3MGQ B;  3B6G D;  3MGQ C;  4QLC B;  3REH D;  4WU9 B;  1P3G A;  4X23 C;  4QLC C;  2NZD D;  3MGQ A;  4J8X D;  4WU9 C;  3VH5 T;  3AZF D;  3MNN B;  3C1B D;  4QLC A;  3MNN C;  4WU9 A;  2F8N G;  3REK C;  3MNN A;  2PYO D;  1BFM A;  5CPK D;  3WKJ B;  3MGR D;  3B6G B;  3AZI D;  3REH B;  5B33 D;  3WKJ A;  4HGA B;  4J8X B;  3B6G A;  3AZF B;  4HGA C;  4J8X C;  3AZF C;  3REH A;  2F8N D;  5BS7 C;  4J8X A;  5B24 B;  3AZF A;  1P3K D;  5B24 C;  3MGR B;  3V9R B;  1N1J B;  3AZI B;  5B0Y D;  5B24 A;  3MGR C;  4WU8 C;  3AZI C;  2PYO A;  5B33 B;  2L5A A;  1TZY D;  3MGR A;  3W96 D;  1N1J A;  3VH5 A;  2BYM B;  5B33 C;  3AZI A;  1ZLA D;  3AN2 D;  5F99 D;  1M18 D;  5B33 A;  2F8N B;  2BYM A;  1P3K B;  4NFT A;  3MGP D;  5CPJ B; 
#chains in the Genus database with same CATH topology
 2F8N A;  3KFU G;  2Y2L A;  3AZK C;  5CPJ C;  3W98 C;  4WJ3 C;  1P3K A;  4NE5 A;  5CPJ A;  2YFV B;  5AVB D;  2ARO D;  3MGS D;  5F99 B;  4Z2M H;  5E5A D;  3B0C T;  1M18 B;  5F99 C;  3REL B;  3O62 D;  2YFV A;  3REL C;  4YS3 B;  5F99 A;  3X1T D;  4E45 A;  1M18 A;  4Z66 D;  4YS3 C;  2FJ7 B;  3REL A;  3W97 D;  2FJ7 C;  4YS3 A;  2FJ7 A;  3AZM D;  1B67 A;  4Z5T D;  1P3A B;  5AVB B;  2ARO B;  3MGS B;  3AZG C;  5E5A B;  1P3A C;  5AVB C;  3VH5 W;  3MGS C;  5E5A C;  1ULY A;  5FUG B;  3O62 B;  1P3A A;  5AVB A;  2ARO A;  3MGS A;  3X1T B;  5E5A A;  4Z66 B;  5CP6 D;  3X1T C;  3W97 B;  5FUG A;  4Z66 C;  3O62 A;  2XD5 A;  5B32 G;  3X1T A;  4Z66 A;  3W97 A;  4Z5T B;  1BH8 B;  4Z5T A;  1BH8 A;  3KWQ D;  3LZ0 D;  5CP6 B;  5B2I D;  5CP6 C;  5B32 D;  4DRB A;  5CP6 A;  3B6F D;  2ZY5 A;  4R8P B;  2Y2P A;  4WZS B;  4R8P C;  2JCH A;  3AV2 C;  3KWQ B;  2RVQ D;  4R8P A;  3KWQ C;  1S32 D;  3AZN D;  5B2I B;  3AL0 C;  3KWQ A;  3AZJ D;  3LZ0 A;  1P3G D;  3B6F B;  3R45 B;  4H9Q B;  5B2I A;  3B6F C;  4X23 D;  3WA9 D;  3B6F A;  3R45 A;  5AV5 D;  5AV9 B;  4H9Q A;  3B0C W;  5AV9 C;  4J8U D;  3MNN D;  3UTA C;  1R4V A;  2RVQ C;  3H0M C;  5AV9 A;  3REK D;  4UUZ B;  3AZN B;  1S32 B;  5GT0 B;  3AZN C;  1S32 C;  3UT9 D;  5AY8 B;  5GT0 C;  3AZJ B;  1U35 B;  3NQJ B;  1S32 A;  3AZN A;  5AY8 C;  3AZJ C;  4UUZ A;  1U35 C;  5GT0 A;  3AZL D;  5AY8 A;  4X23 B;  3AZJ A;  3WA9 B;  4CSR B;  1U35 A;  3NQJ A;  5AV5 B;  3WA9 C;  4J8U B;  5AV5 C;  3EPL A;  3REI D;  4J8U C;  1TAF B;  4X23 A;  3EPJ A;  4CSR A;  2Y2G A;  4J8V D;  5AV5 A;  3REK B;  3AV1 D;  3WA9 A;  1P3O B;  1EQZ B;  4J8U A;  5B24 D;  2UWX A;  2CWE A;  3UT9 B;  1P3O C;  1EQZ C;  1TAF A;  3UT9 C;  3REK A;  4WU8 D;  1EQZ A;  3AZL B;  3UT9 A;  5B31 G;  3AZL C;  1M1A B;  3REI B;  2BYK B;  4M6B A;  1BH9 B;  3AZL A;  1M1A C;  3REI C;  3AV1 B;  4J8V B;  3AV1 C;  4J8V C;  1M1A A;  3REI A;  4ZUX B;  1BH9 A;  5BS7 A;  5BT1 C;  3AV1 A;  4ZUX C;  4J8V A;  5CPJ D;  3AZK D;  4WU8 B;  3W98 D;  5B31 D;  4ZUX A;  4WU8 A;  3V9R A;  3C1C B;  3C1C C;  2HIO B;  2IO5 B;  2HIO C;  2IO5 C;  5B0Z D;  3C1C A;  3REL D;  5B2J D;  3WTP D;  2HIO A;  4YS3 D;  5KDM B;  3AZK B;  3W98 B;  2FJ7 D;  5BO0 B;  3VH6 T;  5B31 B;  4DQY B;  4KUD C;  5B31 C;  5KDM A;  5B40 C;  3AZK A;  3W98 A;  5BO0 A;  1HQ3 B;  4Z2M G;  3AZG D;  5JRG B;  1P3A D;  5B31 A;  1F1E A;  5AV6 B;  1HQ3 C;  5JRG C;  3AFA B;  5AV6 C;  5B0Z B;  1KX3 B;  1PZR A;  1HQ3 A;  5B2J B;  3WTP B;  5B0Z C;  5JRG A;  3AFA C;  1KX3 C;  3X1U D;  5AV6 A;  4YM6 D;  5B2J C;  5AVC C;  3WTP C;  3A6N D;  5B0Z A;  4KGC C;  5B2J A;  3WTP A;  1T3U A;  3AZG B;  2LY8 A;  4DRA A;  1Z2C B;  4J8W B;  4J8W C;  4NE3 A;  2Y2N A;  3AZG A;  4J8W A;  3X1U B;  4YM6 B;  3A6N B;  3H0R C;  3X1U C;  4YM6 C;  3A6N C;  3REJ B;  3MVD B;  3X1U A;  4YM6 A;  3A6N A;  3REJ C;  3MVD C;  2VQR A;  4KHA B;  3REJ A;  1AOI D;  3MVD A;  4R8P D;  5CPI D;  4UPK A;  3AV2 D;  1KU5 A;  4KHA A;  1KX4 C;  5G49 B;  4EO5 B;  5B1M B;  1B6W A;  2FFF B;  4EO5 C;  5B1M C;  5GSU B;  3AZH D;  5DNM D;  3A1K A;  5GSU C;  5B1M A;  1AOI B;  1H3O B;  5CPI B;  1AOI C;  5AV9 D;  3AV2 B;  5CPI C;  2Y2I A;  1AOI A;  3UTA D;  1H3O A;  5CPI A;  3AV2 A;  5GT0 D;  3AZH B;  5GT3 D;  1Q9C A;  5DNM B;  5AY8 D;  3KSY A;  3LZ1 B;  3AZH C;  1U35 D;  3EPH A;  5DNM C;  1P3I D;  3LZ1 C;  1W2E A;  2JSS A;  4H9N B;  3AZH A;  5DNM A;  3LZ1 A;  4G92 B;  3W99 D;  4G92 C;  3UTA B;  4H9N A;  2Y2K A;  3KUY B;  3EPK A;  1P3O D;  1EQZ D;  3UTA A;  5GT3 B;  5B1L D;  3EG5 B;  3KUY C;  3KXB B;  5GT3 C;  1P3I B;  2G5H C;  3KXB C;  3KUY A;  3AZE D;  1P3I C;  5GT3 A;  3KXB A;  2ZY4 A;  1P3L D;  1P3I A;  4E44 A;  3W99 B;  1M1A D;  3W99 C;  4G91 B;  3W99 A;  3LJA B;  4XUJ C;  4G91 C;  5B1L B;  5BT1 D;  4ZUX D;  3LJA C;  5B1L C;  3AYW B;  3LJA A;  3AZE B;  3AYW C;  1P3O A;  3X1S D;  5B1L A;  3AZE C;  1P3L B;  1M19 B;  3AYW A;  3C1C D;  1P3L C;  1M19 C;  3AZE A;  1P34 D;  2HIO D;  1P3L A;  1M19 A;  2BYK A;  3P5J B;  3X1S B;  4JJN B;  4KUD D;  3IP4 C;  5B40 D;  2F8N H;  3X1S C;  4JJN C;  3WAA B;  4CAY B;  1P34 B;  1HQ3 D;  3X1S A;  5JA4 B;  5JRG D;  3WAA C;  4JJN A;  1P3P D;  3WKJ C;  5AV6 D;  1P34 C;  3B6G C;  4H9P B;  3AFA D;  1KX5 D;  2DQN C;  3WAA A;  1KX3 D;  4CAY A;  3REH C;  1P34 A;  2NZD B;  5JA4 A;  5AVC D;  4WNN B;  3C1B B;  2NZD C;  2Y2Q A;  4KGC D;  4H9P A;  3C1B C;  2F2A C;  2W8S A;  2NZD A;  4KUD B;  2ZM5 A;  5B40 B;  4WNN A;  3C1B A;  2PYO B;  5CPK B;  2PYO C;  5CPK C;  1P3P B;  4KUD A;  4J8W D;  5B40 A;  2YFW B;  1P3P C;  3B0B A;  1P3F D;  5CPK A;  1KX5 B;  5CHL B;  1KX5 C;  5AVC B;  1P3P A;  3WTP E;  4KGC B;  2YFW A;  4H9O B;  3AFA A;  1KX5 A;  5GXQ D;  1KX3 A;  3REJ D;  5AVC A;  3MVD D;  4KGC A;  2XD1 A;  4H9O A;  4ZBJ B;  1P3K C;  4ZBJ C;  5BNV B;  5B0Y B;  2ZY2 A;  1P3F B;  5B0Y C;  1KX4 D;  1P3F C;  1TZY B;  3W96 B;  2DF4 C;  5BNV A;  5B0Y A;  1TZY C;  3W96 C;  5DNN D;  3AN2 B;  1ZLA B;  2CV5 D;  1P3F A;  3UTB D;  3AN2 C;  5GXQ B;  1ZLA C;  5B1M D;  2NQB D;  1TZY A;  3W96 A;  2HUE B;  3VH6 A;  1M18 C;  5C3I B;  5GXQ C;  5GSU D;  1ZLA A;  2HUE C;  3AN2 A;  5C3I C;  1P3B D;  3MGP B;  5GXQ A;  4NE6 A;  3MGP C;  2ZY3 A;  3MGP A;  1KX4 B;  5DNN B;  4LD9 D;  2CV5 B;  5DNN C;  3H0L C;  3UTB B;  2NQB B;  2CV5 C;  2ARO C;  1KX4 A;  3UTB C;  2NQB C;  1HTA A;  5DNN A;  2CV5 A;  3O62 C;  5G49 A;  3LZ1 D;  4XZQ D;  1P3B B;  3UTB A;  2JE5 A;  2NQB A;  1WWS A;  1P3B C;  5GSU A;  3W97 C;  1P3B A;  5AV8 D;  3AZM B;  4LD9 B;  3AZM C;  4AWL B;  4Z5T C;  4LD9 C;  4AWL C;  3B0D B;  4WV4 B;  3NQU B;  3AZM A;  1JFI B;  3KUY D;  2Y2H A;  3B0D C;  4LD9 A;  4XZQ B;  3VH6 W;  4H9S C;  3KXB D;  5BNX B;  1JFI A;  3NQU A;  4XZQ C;  2F8N K;  4H9S A;  4XZQ A;  5AV8 B;  3TU4 D;  3X1V D;  1F66 D;  5BNX A;  1ID3 D;  5AV8 C;  3LEL D;  4H9R B;  4XUJ D;  5AV8 A;  2Y2J A;  1P3M D;  3LJA D;  3LZ0 B;  1WWI A;  4H9R A;  3AYW D;  3LZ0 C;  5B2I C;  5B32 B;  3TU4 B;  2Y2M A;  3X1V B;  1M19 D;  1F66 B;  1A7W A;  5B32 C;  1ID3 B;  3TU4 C;  3X1V C;  1F66 C;  3MGQ D;  3FDD A;  3LEL B;  1ID3 C;  5B32 A;  4XUJ B;  3LEL C;  3TU4 A;  4QLC D;  3X1V A;  4WU9 D;  1P3M B;  1F66 A;  1ID3 A;  1P3M C;  3LEL A;  4XUJ A;  1P3M A;  2J8P A;  4JJN D;  1P3G B;  2Y2O A;  3WAA D;  3WKJ D;  1P3G C;  3MGQ B;  3B6G D;  3MGQ C;  4QLC B;  3A1I A;  3REH D;  4WU9 B;  1P3G A;  3F6T A;  4X23 C;  4QLC C;  2NZD D;  3MGQ A;  4J8X D;  4WU9 C;  3VH5 T;  3AZF D;  3MNN B;  3C1B D;  4QLC A;  3MNN C;  4WU9 A;  2F8N G;  3REK C;  3MNN A;  2PYO D;  1BFM A;  5CPK D;  3WKJ B;  3MGR D;  3B6G B;  3AZI D;  3REH B;  5B33 D;  3WKJ A;  4HGA B;  4J8X B;  3B6G A;  3AZF B;  4HGA C;  4J8X C;  2BG1 A;  2G5I C;  3REH A;  3AZF C;  2F8N D;  5BS7 C;  4J8X A;  5B24 B;  3AZF A;  1P3K D;  5B24 C;  3MGR B;  3V9R B;  1N1J B;  3AZI B;  5B0Y D;  5B24 A;  3MGR C;  4WU8 C;  3AZI C;  2PYO A;  5B33 B;  2L5A A;  1TZY D;  3MGR A;  3W96 D;  1N1J A;  3VH5 A;  2BYM B;  5B33 C;  3AZI A;  1ZLA D;  3AN2 D;  2RIQ A;  5F99 D;  1M18 D;  5B33 A;  2F8N B;  2BYM A;  1P3K B;  4NFT A;  3MGP D;  5CPJ B; 
#chains in the Genus database with same CATH homology
 2F8N A;  3KFU G;  2Y2L A;  3AZK C;  5CPJ C;  3W98 C;  4WJ3 C;  1P3K A;  4NE5 A;  5CPJ A;  2YFV B;  5AVB D;  2ARO D;  3MGS D;  5F99 B;  4Z2M H;  5E5A D;  3B0C T;  1M18 B;  5F99 C;  3REL B;  3O62 D;  2YFV A;  3REL C;  4YS3 B;  5F99 A;  3X1T D;  4E45 A;  1M18 A;  4Z66 D;  4YS3 C;  2FJ7 B;  3REL A;  3W97 D;  2FJ7 C;  4YS3 A;  2FJ7 A;  3AZM D;  1B67 A;  4Z5T D;  1P3A B;  5AVB B;  2ARO B;  3MGS B;  3AZG C;  5E5A B;  1P3A C;  5AVB C;  3VH5 W;  3MGS C;  5E5A C;  1ULY A;  5FUG B;  3O62 B;  1P3A A;  5AVB A;  2ARO A;  3MGS A;  3X1T B;  5E5A A;  4Z66 B;  5CP6 D;  3X1T C;  3W97 B;  5FUG A;  4Z66 C;  3O62 A;  2XD5 A;  5B32 G;  3X1T A;  4Z66 A;  3W97 A;  4Z5T B;  1BH8 B;  4Z5T A;  1BH8 A;  3KWQ D;  3LZ0 D;  5CP6 B;  5B2I D;  5CP6 C;  5B32 D;  4DRB A;  5CP6 A;  3B6F D;  2ZY5 A;  4R8P B;  2Y2P A;  4WZS B;  4R8P C;  2JCH A;  3AV2 C;  3KWQ B;  2RVQ D;  4R8P A;  3KWQ C;  1S32 D;  3AZN D;  5B2I B;  3AL0 C;  3KWQ A;  3AZJ D;  3LZ0 A;  1P3G D;  3B6F B;  3R45 B;  4H9Q B;  5B2I A;  3B6F C;  4X23 D;  3WA9 D;  3B6F A;  3R45 A;  5AV5 D;  5AV9 B;  4H9Q A;  3B0C W;  5AV9 C;  4J8U D;  3MNN D;  3UTA C;  1R4V A;  2RVQ C;  3H0M C;  5AV9 A;  3REK D;  4UUZ B;  3AZN B;  1S32 B;  5GT0 B;  3AZN C;  1S32 C;  3UT9 D;  5AY8 B;  5GT0 C;  3AZJ B;  1U35 B;  3NQJ B;  1S32 A;  3AZN A;  5AY8 C;  3AZJ C;  4UUZ A;  1U35 C;  5GT0 A;  3AZL D;  5AY8 A;  4X23 B;  3AZJ A;  3WA9 B;  4CSR B;  1U35 A;  3NQJ A;  5AV5 B;  3WA9 C;  4J8U B;  5AV5 C;  3EPL A;  3REI D;  4J8U C;  1TAF B;  4X23 A;  3EPJ A;  4CSR A;  2Y2G A;  4J8V D;  5AV5 A;  3REK B;  3AV1 D;  3WA9 A;  1P3O B;  1EQZ B;  4J8U A;  5B24 D;  2UWX A;  2CWE A;  3UT9 B;  1P3O C;  1EQZ C;  1TAF A;  3UT9 C;  3REK A;  4WU8 D;  1EQZ A;  3AZL B;  3UT9 A;  5B31 G;  3AZL C;  1M1A B;  3REI B;  2BYK B;  4M6B A;  1BH9 B;  3AZL A;  1M1A C;  3REI C;  3AV1 B;  4J8V B;  3AV1 C;  4J8V C;  1M1A A;  3REI A;  4ZUX B;  1BH9 A;  5BS7 A;  5BT1 C;  3AV1 A;  4ZUX C;  4J8V A;  5CPJ D;  3AZK D;  4WU8 B;  3W98 D;  5B31 D;  4ZUX A;  4WU8 A;  3V9R A;  3C1C B;  3C1C C;  2HIO B;  2IO5 B;  2HIO C;  2IO5 C;  5B0Z D;  3C1C A;  3REL D;  5B2J D;  3WTP D;  2HIO A;  4YS3 D;  5KDM B;  3AZK B;  3W98 B;  2FJ7 D;  5BO0 B;  3VH6 T;  5B31 B;  4DQY B;  4KUD C;  5B31 C;  5KDM A;  5B40 C;  3AZK A;  3W98 A;  5BO0 A;  1HQ3 B;  4Z2M G;  3AZG D;  5JRG B;  1P3A D;  5B31 A;  1F1E A;  5AV6 B;  1HQ3 C;  5JRG C;  3AFA B;  5AV6 C;  5B0Z B;  1KX3 B;  1PZR A;  1HQ3 A;  5B2J B;  3WTP B;  5B0Z C;  5JRG A;  3AFA C;  1KX3 C;  3X1U D;  5AV6 A;  4YM6 D;  5B2J C;  5AVC C;  3WTP C;  3A6N D;  5B0Z A;  4KGC C;  5B2J A;  3WTP A;  1T3U A;  3AZG B;  2LY8 A;  4DRA A;  1Z2C B;  4J8W B;  4J8W C;  4NE3 A;  2Y2N A;  3AZG A;  4J8W A;  3X1U B;  4YM6 B;  3A6N B;  3H0R C;  3X1U C;  4YM6 C;  3A6N C;  3REJ B;  3MVD B;  3X1U A;  4YM6 A;  3A6N A;  3REJ C;  3MVD C;  2VQR A;  4KHA B;  3REJ A;  1AOI D;  3MVD A;  4R8P D;  5CPI D;  4UPK A;  3AV2 D;  1KU5 A;  4KHA A;  1KX4 C;  5G49 B;  4EO5 B;  5B1M B;  1B6W A;  2FFF B;  4EO5 C;  5B1M C;  5GSU B;  3AZH D;  5DNM D;  3A1K A;  5GSU C;  5B1M A;  1AOI B;  1H3O B;  5CPI B;  1AOI C;  5AV9 D;  3AV2 B;  5CPI C;  2Y2I A;  1AOI A;  3UTA D;  1H3O A;  5CPI A;  3AV2 A;  5GT0 D;  3AZH B;  5GT3 D;  1Q9C A;  5DNM B;  5AY8 D;  3KSY A;  3LZ1 B;  3AZH C;  1U35 D;  3EPH A;  5DNM C;  1P3I D;  3LZ1 C;  1W2E A;  2JSS A;  4H9N B;  3AZH A;  5DNM A;  3LZ1 A;  4G92 B;  3W99 D;  4G92 C;  3UTA B;  4H9N A;  2Y2K A;  3KUY B;  3EPK A;  1P3O D;  1EQZ D;  3UTA A;  5GT3 B;  5B1L D;  3EG5 B;  3KUY C;  3KXB B;  5GT3 C;  1P3I B;  2G5H C;  3KXB C;  3KUY A;  3AZE D;  1P3I C;  5GT3 A;  3KXB A;  2ZY4 A;  1P3L D;  1P3I A;  4E44 A;  3W99 B;  1M1A D;  3W99 C;  4G91 B;  3W99 A;  3LJA B;  4XUJ C;  4G91 C;  5B1L B;  5BT1 D;  4ZUX D;  3LJA C;  5B1L C;  3AYW B;  3LJA A;  3AZE B;  3AYW C;  1P3O A;  3X1S D;  5B1L A;  3AZE C;  1P3L B;  1M19 B;  3AYW A;  3C1C D;  1P3L C;  1M19 C;  3AZE A;  1P34 D;  2HIO D;  1P3L A;  1M19 A;  2BYK A;  3P5J B;  3X1S B;  4JJN B;  4KUD D;  3IP4 C;  5B40 D;  2F8N H;  3X1S C;  4JJN C;  3WAA B;  4CAY B;  1P34 B;  1HQ3 D;  3X1S A;  5JA4 B;  5JRG D;  3WAA C;  4JJN A;  1P3P D;  3WKJ C;  5AV6 D;  1P34 C;  3B6G C;  4H9P B;  3AFA D;  1KX5 D;  2DQN C;  3WAA A;  1KX3 D;  4CAY A;  3REH C;  1P34 A;  2NZD B;  5JA4 A;  5AVC D;  4WNN B;  3C1B B;  2NZD C;  2Y2Q A;  4KGC D;  4H9P A;  3C1B C;  2F2A C;  2W8S A;  2NZD A;  4KUD B;  2ZM5 A;  5B40 B;  4WNN A;  3C1B A;  2PYO B;  5CPK B;  2PYO C;  5CPK C;  1P3P B;  4KUD A;  4J8W D;  5B40 A;  2YFW B;  1P3P C;  3B0B A;  1P3F D;  5CPK A;  1KX5 B;  5CHL B;  1KX5 C;  5AVC B;  1P3P A;  3WTP E;  4KGC B;  2YFW A;  4H9O B;  3AFA A;  1KX5 A;  5GXQ D;  1KX3 A;  3REJ D;  5AVC A;  3MVD D;  4KGC A;  2XD1 A;  4H9O A;  4ZBJ B;  1P3K C;  4ZBJ C;  5BNV B;  5B0Y B;  2ZY2 A;  1P3F B;  5B0Y C;  1KX4 D;  1P3F C;  1TZY B;  3W96 B;  2DF4 C;  5BNV A;  5B0Y A;  1TZY C;  3W96 C;  5DNN D;  3AN2 B;  1ZLA B;  2CV5 D;  1P3F A;  3UTB D;  3AN2 C;  5GXQ B;  1ZLA C;  5B1M D;  2NQB D;  1TZY A;  3W96 A;  2HUE B;  3VH6 A;  1M18 C;  5C3I B;  5GXQ C;  5GSU D;  1ZLA A;  2HUE C;  3AN2 A;  5C3I C;  1P3B D;  3MGP B;  5GXQ A;  4NE6 A;  3MGP C;  2ZY3 A;  3MGP A;  1KX4 B;  5DNN B;  4LD9 D;  2CV5 B;  5DNN C;  3H0L C;  3UTB B;  2NQB B;  2CV5 C;  2ARO C;  1KX4 A;  3UTB C;  2NQB C;  1HTA A;  5DNN A;  2CV5 A;  3O62 C;  5G49 A;  3LZ1 D;  4XZQ D;  1P3B B;  3UTB A;  2JE5 A;  2NQB A;  1WWS A;  1P3B C;  5GSU A;  3W97 C;  1P3B A;  5AV8 D;  3AZM B;  4LD9 B;  3AZM C;  4AWL B;  4Z5T C;  4LD9 C;  4AWL C;  3B0D B;  4WV4 B;  3NQU B;  3AZM A;  1JFI B;  3KUY D;  2Y2H A;  3B0D C;  4LD9 A;  4XZQ B;  3VH6 W;  4H9S C;  3KXB D;  5BNX B;  1JFI A;  3NQU A;  4XZQ C;  2F8N K;  4H9S A;  4XZQ A;  5AV8 B;  3TU4 D;  3X1V D;  1F66 D;  5BNX A;  1ID3 D;  5AV8 C;  3LEL D;  4H9R B;  4XUJ D;  5AV8 A;  2Y2J A;  1P3M D;  3LJA D;  3LZ0 B;  1WWI A;  4H9R A;  3AYW D;  3LZ0 C;  5B2I C;  5B32 B;  3TU4 B;  2Y2M A;  3X1V B;  1M19 D;  1F66 B;  1A7W A;  5B32 C;  1ID3 B;  3TU4 C;  3X1V C;  1F66 C;  3MGQ D;  3FDD A;  3LEL B;  1ID3 C;  5B32 A;  4XUJ B;  3LEL C;  3TU4 A;  4QLC D;  3X1V A;  4WU9 D;  1P3M B;  1F66 A;  1ID3 A;  1P3M C;  3LEL A;  4XUJ A;  1P3M A;  2J8P A;  4JJN D;  1P3G B;  2Y2O A;  3WAA D;  3WKJ D;  1P3G C;  3MGQ B;  3B6G D;  3MGQ C;  4QLC B;  3A1I A;  3REH D;  4WU9 B;  1P3G A;  3F6T A;  4X23 C;  4QLC C;  2NZD D;  3MGQ A;  4J8X D;  4WU9 C;  3VH5 T;  3AZF D;  3MNN B;  3C1B D;  4QLC A;  3MNN C;  4WU9 A;  2F8N G;  3REK C;  3MNN A;  2PYO D;  1BFM A;  5CPK D;  3WKJ B;  3MGR D;  3B6G B;  3AZI D;  3REH B;  5B33 D;  3WKJ A;  4HGA B;  4J8X B;  3B6G A;  3AZF B;  4HGA C;  4J8X C;  2BG1 A;  2G5I C;  3REH A;  3AZF C;  2F8N D;  5BS7 C;  4J8X A;  5B24 B;  3AZF A;  1P3K D;  5B24 C;  3MGR B;  3V9R B;  1N1J B;  3AZI B;  5B0Y D;  5B24 A;  3MGR C;  4WU8 C;  3AZI C;  2PYO A;  5B33 B;  2L5A A;  1TZY D;  3MGR A;  3W96 D;  1N1J A;  3VH5 A;  2BYM B;  5B33 C;  3AZI A;  1ZLA D;  3AN2 D;  2RIQ A;  5F99 D;  1M18 D;  5B33 A;  2F8N B;  2BYM A;  1P3K B;  4NFT A;  3MGP D;  5CPJ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...