4EO5B

Yeast asf1 bound to h3/h4g94p mutant
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
76
structure length
76
Chain Sequence
ALIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/chaperone
molecule keywords Histone chaperone ASF1
publication title The conformational flexibility of the C-terminus of histone H4 promotes histone octamer and nucleosome stability and yeast viability.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 25
structure length 76
sequence length 76
ec nomenclature
pdb deposition date 2012-04-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4eo5B00
1P3PD 5CP6B 5B0YB 3MGPD 3B0CW 5CPJB 3KXBA 2NZDB 1P3PC 4Z66B 3MGPC 3KWQA 2YFWB 4E44A 3AZGA 3W98D 3UTBD 3W98C 4Z2MH 2YFVB 5BS7A 3UTBC 1P3OD 1P3MD 4CAYA 3AZFD 3AZKC 1P34D 4AWLB 5B2JD 5JRGA 3MGQA 4WU8A 3AZFC 1TZYD 3REKA 1P34C 2HIOD 3X1UA 1Q9CA 5B2JC 5B32G 5AVBD 4KHAB 1TZYC 5GT3D 3KUYA 2HIOC 5AVBC 3REHC 3C1BA 5GT3C 3AV1D 5BO0B 3REIA 3WKJB 3C1CD 4WNNA 2AROA 3AV1C 1WWIA 1KX5D 3C1CC 4J8WD 5AV5D 1KX5C 3TU4B 4J8WC 1P3ID 1U35A 4WU9D 3RELA 3B6GD 3UT9B 4WU9C 4CSRB 4J8UB 3AZJA 3AZLC 3VH5T 2BYMB 4Z5TA 5E5AA 1P3AA 3REJA 3AZHC 1P3LB 2PYOC 5B33A 4QLCA 3AZNA 3AN2B 1M18C 2RVQC 5DNND 4KUDD 5B1MA 3KWQD 5DNNC 4KUDC 3KWQC 3VH6T 1P3BA 4R8PB 5JRGD 3MGQD 4WU8D 3REKD 5AV6A 3X1UD 4H9SA 3MGQC 5B0ZA 4WU8C 3REKC 4J8XA 3X1UC 1ZLAA 3C1BD 1B6WA 1H3OB 5AY8C 1EQZD 1P3PB 3MGPB 4HGAC 3REID 3X1VA 5GT0D 2AROD 5GXQA 3LJAD 1EQZC 4XUJA 4LD9D 3A6ND 3REIC 1P3KA 5GT0C 4LD9C 3LJAC 3W98B 5B32A 3A6NC 3UTBB 1U35D 3AZKB 2F8NG 3W96A 4DRBA 1AOIA 1U35C 3AZFB 1P34B 4M6BA 5B2JB 5G49B 1P3GA 4KGCD 1TZYB 5AV9A 2HIOB 4H9RA 3NQUA 5AVBB 3REHB 5BNXB 4NE5A 1P3AD 3REJD 1S32D 2F8NK 4KGCC 5B33D 1BH9A 3UTAA 1P3AC 4QLCD 1S32C 5B33C 5GSUD 3V9RB 3AYWA 3AV1B 5B1MD 4XZQA 3C1CB 5B24D 5GSUC 3X1SA 5B1MC 4ZUXA 1KX5B 5B24C 3AV2A 1P3BD 3VH5A 4YM6A 4WU9B 5B31C 2CV5B 1P3BC 1KX3A 5AV6D 3B6FA 3AZLB 3W99A 1BH8B 5DNMA 1ID3A 5AV6C 4J8XD 5BT1C 3AZHB 4H9SC 2PYOB 3WTPC 3WA9D 1BFMA 1M18B 3X1VD 3WA9C 3VH6A 5GXQD 4XUJD 3X1VC 5DNNB 4YS3A 1KX4A 4KUDB 3KWQB 5GXQC 3R45B 3AZED 1M19A 5B32D 4UUZB 3AZEC 1F1EA 1AOID 4H9NA 3WAAD 3MGQB 1AOIC 2BYKA 4WU8B 3REKB 3WAAC 5AV9D 3X1UB 3X1TA 3MVDA 5AV9C 3MGSD 5AY8B 4HGAB 3AZMA 3W97D 1R4VA 3MGSC 1EQZB 3AYWD 3LELD 2F8NA 3W97C 4WNNB 5GT0B 4LD9B 3LJAB 3LZ0D 3X1SD 5BNVB 3LELC 4ZUXD 3A6NB 3AYWC 1KU5A 5F99D 4H9QA 1P3OC 3B0DC 3LZ0C 3AV2D 1P3MC 1M1AA 4H9OB 5F99C 1U35B 4YM6D 3AV2C 1HQ3A 4YM6C 3B6FD 1F66A 4H9PA 1ID3D 5CPIA 4KGCB 5B40D 1ID3C 1P3AB 1S32B 1TAFA 5B33B 5B40C 3O62A 4G92C 2FJ7A 5GSUB 1KX4D 4YS3D 5B1MB 5AVCA 5AV5C 5B24B 5AV8A 1M19D 4JJND 1P3IC 5CP6A 5B0YA 4J8VD 1M19C 4JJNC 2NZDA 3B6GC 5B31B 3AFAA 1P3BB 4NE3A 4J8VC 4NFTA 5KDMA 5AV6B 3LZ1A 3KXBD 3X1TD 3WTPB 3KXBC 4EO5C 2L5AA 3AZGD 3WA9B 3NQJA 2F8ND 3X1VB 3AZGC 5GXQB 5BS7C 3AZEB 5JA4B 5JRGC 3WKJA 1B67A 3KUYD 1AOIB 3WAAB 1F66D 3KUYC 3C1BC 5CPID 3TU4A 5AV9B 4H9RB 4Z2MG 1F66C 3MGRA 3MGSB 2AROC 3W97B 4J8UA 2FJ7D 3AYWB 3LELB 5AVCD 2BYMA 1P3OB 3B0DB 3LZ0B 3RELD 1P3MB 1P3LA 5AVCC 5F99B 3RELC 3AN2A 3AZJD 3AFAD 3B0CT 4Z5TD 4YM6B 3AZJC 3AFAC 5E5AD 5GT3B 4Z5TC 3LZ1D 5E5AC 4WZSB 3AZND 3REJC 3AZIA 1ID3B 3LZ1C 1P3FA 4QLCC 3AZNC 5B40B 4R8PA 4G92B 4AWLC 4J8WB 5AV5B 1P3IB 3MNNA 1M19B 4JJNB 1H3OA 3B6GB 1P3PA 4J8VB 1JFIB 5B0ZD 3VH5W 4H9NB 5B0ZC 1ZLAD 2HUEC 2NQBA 4J8XC 2BYKB 1ZLAC 3UTBA 5B1LA 3MGRD 3KXBB 3AZKA 4EO5B 1P3KD 3MGRC 3AZFA 1P34A 3AZGB 4XUJC 2IO5C 5G49A 3VH6W 1P3KC 1TZYA 4ZBJC 5CPKA 2HIOA 5C3IC 5B32C 3REHA 3W96D 5BNXA 4CAYB 3W96C 5JRGB 4X23A 1A7WA 1P3GD 4NE6A 3V9RA 3C1CA 1P3GC 3KUYB 3UTAD 3C1BB 1F66B 3AZID 3UTAC 5B2IA 1P3FD 3REIB 4XZQD 3AZIC 2AROB 2CV5A 1P3FC 4XZQC 1TAFB 5FUGA 1N1JA 3AZLA 3X1SC 4ZUXC 1BH8A 3AZHA 2PYOA 5B31G 3MNND 1KX3D 3RELB 1M18A 3MNNC 1KX3C 3W99D 5DNMD 3AZJB 3AFAB 3B6FC 2NQBD 5DNNA 4KUDA 3W99C 4Z5TB 5KDMB 5DNMC 5E5AB 3B0BA 3R45A 3REJB 2NQBC 5B1LD 3LZ1B 4UUZA 4QLCB 3AZKD 3AZNB 5B1LC 2LY8A 3KSYA 3NQJB 1KX4C 4YS3C 5CPKD 5CPJA 3REHD 4G91C 4Z66A 5CPKC 2F8NH 5AY8A 2YFWA 4X23D 4WV4B 1EQZA 5B0ZB 4X23C 2HUEB 3MVDD 2YFVA 5GT0A 3LJAA 4J8XB 4LD9A 5BNVA 3A6NA 1ZLAB 3X1TC 3MVDC 3AZMD 5B2ID 4H9OA 3AZMC 3MGRB 2CV5D 4KHAA 5B2IC 4XUJB 2IO5B 1P3KB 4ZBJB 2CV5C 3AZLD 5C3IB 5B32B 1M1AD 3WTPE 4KGCA 3AZHD 5BO0A 2PYOD 1M1AC 3W96B 1HQ3D 1S32A 1M18D 2RVQD 1ULYA 1HQ3C 1P3GB 5GSUA 3NQUB 5B24A 5CPIC 1BH9B 3UT9A 3UTAB 3O62D 4CSRA 3AZIB 5B31A 3O62C 1P3FB 4XZQB 2FJ7C 5AV8D 3X1SB 4ZUXB 5CP6D 5B0YD 5AV8C 5CPJD 3AV2B 2NZDD 4Z66D 5CP6C 5B0YC 3WTPA 5AY8D 5CHLB 5CPJC 2NZDC 3MNNB 1KX3B 4Z66C 3WA9A 3B6FB 3W99B 5DNMB 2JSSA 2NQBB 3AZEA 5JA4A 1WWSA 5B1LB 4DRAA 1KX4B 4YS3B 3WAAA 4G91B 5CPKB 3MGPA 3WKJD 3MGSA 3WKJC 3W98A 4X23B 3W97A 3TU4D 3LELA 3X1TB 3MVDB 1P3OA 3TU4C 3LZ0A 1P3MA 3UT9D 5F99A 3AZMB 2CWEA 5B2JA 4J8UD 5B31D 5B2IB 3UT9C 2F8NB 5AVBA 4J8UC 5GT3A 1P3LD 5FUGB 1N1JB 4H9QB 5BT1D 3AN2D 1P3LC 3WTPD 1M1AB 4E45A 3AV1A 3AN2C 5B40A 1HQ3B 1KX5A 4J8WA 4H9PB 5AV5A 1HTAA 5CPIB 1P3IA 4WU9A 4R8PD 4JJNA 3B6GA 4R8PC 3O62B 4J8VA 1JFIA 2FJ7B 5AVCB 5AV8B
chains in the Genus database with same CATH superfamily
1P3PD 5CP6B 5B0YB 3MGPD 2DQNC 3B0CW 2Y2NA 3KXBA 5CPJB 2NZDB 1P3PC 4Z66B 3MGPC 3KWQA 2YFWB 1T3UA 4E44A 3AZGA 3W98D 3UTBD 3W98C 4Z2MH 2YFVB 5BS7A 3UTBC 1P3OD 1P3MD 4CAYA 3AZFD 3AZKC 1P34D 4AWLB 3FDDA 5B2JD 5JRGA 3MGQA 4WU8A 3AZFC 1TZYD 3REKA 1P34C 2HIOD 3X1UA 1Q9CA 5B2JC 5B32G 5AVBD 4KHAB 1TZYC 5GT3D 3KUYA 2HIOC 5AVBC 3REHC 3C1BA 5GT3C 3AV1D 5BO0B 3REIA 3WKJB 3C1CD 4DQYB 4WNNA 2AROA 3A1IA 3AV1C 1WWIA 1KX5D 3C1CC 4J8WD 5AV5D 1KX5C 2ZY3A 3TU4B 4J8WC 1P3ID 1U35A 2J8PA 4WU9D 3RELA 3B6GD 3UT9B 4WU9C 4CSRB 4J8UB 3AZJA 3AZLC 3VH5T 2BYMB 4Z5TA 5E5AA 1P3AA 3REJA 3AZHC 1P3LB 2PYOC 5B33A 4QLCA 2JE5A 3AZNA 3AN2B 1M18C 2RVQC 5DNND 4KUDD 5B1MA 3KWQD 5DNNC 4KUDC 3KWQC 2Y2KA 3VH6T 1P3BA 4R8PB 5JRGD 3MGQD 4WU8D 3REKD 2RIQA 5AV6A 3X1UD 2W8SA 4H9SA 5B0ZA 3MGQC 4WU8C 3REKC 4J8XA 3X1UC 1ZLAA 3C1BD 1B6WA 1H3OB 5AY8C 1EQZD 1P3PB 3MGPB 4HGAC 3REID 3X1VA 2Y2IA 5GT0D 2AROD 5GXQA 3LJAD 1EQZC 3IP4C 4XUJA 4LD9D 3A6ND 3REIC 1P3KA 5GT0C 4LD9C 3LJAC 3W98B 5B32A 3A6NC 3UTBB 1U35D 3AZKB 2F8NG 3W96A 4DRBA 1AOIA 1U35C 3AZFB 1P34B 4M6BA 5B2JB 5G49B 1P3GA 4KGCD 1TZYB 5AV9A 2HIOB 4H9RA 3NQUA 5AVBB 3REHB 5BNXB 4NE5A 1P3AD 3REJD 1S32D 2F8NK 4KGCC 5B33D 1BH9A 3UTAA 1P3AC 4QLCD 1S32C 5B33C 5GSUD 3V9RB 3AYWA 3AV1B 5B1MD 1W2EA 3H0RC 4XZQA 3C1CB 5B24D 5GSUC 3X1SA 5B1MC 4ZUXA 1KX5B 5B24C 3AV2A 1P3BD 3VH5A 2F2AC 4YM6A 4WU9B 5B31C 2CV5B 1P3BC 1KX3A 5AV6D 3B6FA 3AZLB 3W99A 1BH8B 5DNMA 1ID3A 5AV6C 4J8XD 5BT1C 3KFUG 3AZHB 4H9SC 2PYOB 3WTPC 3WA9D 1BFMA 3EPLA 1M18B 3X1VD 3WA9C 3VH6A 5GXQD 4XUJD 3X1VC 5DNNB 4YS3A 1KX4A 4KUDB 3KWQB 5GXQC 3R45B 3AZED 1M19A 5B32D 4UUZB 3AZEC 1F1EA 3F6TA 1AOID 4H9NA 3WAAD 1PZRA 3MGQB 1AOIC 2BYKA 2XD1A 4WU8B 3REKB 3WAAC 5AV9D 3X1UB 3X1TA 3MVDA 5AV9C 3MGSD 5AY8B 4HGAB 3AZMA 3W97D 1R4VA 3MGSC 1EQZB 3AYWD 3LELD 2F8NA 2JCHA 4WNNB 3W97C 5GT0B 4LD9B 3LJAB 3LZ0D 3X1SD 5BNVB 3LELC 4ZUXD 3A6NB 3AYWC 1KU5A 5F99D 4H9QA 1P3OC 3B0DC 3LZ0C 3AV2D 1P3MC 1M1AA 4H9OB 5F99C 1U35B 4YM6D 3AV2C 1HQ3A 3P5JB 4YM6C 3B6FD 1F66A 4H9PA 1ID3D 5CPIA 4KGCB 5B40D 1ID3C 1P3AB 1S32B 1TAFA 5B33B 5B40C 3O62A 4G92C 2FJ7A 5GSUB 1KX4D 4YS3D 5B1MB 5AVCA 5AV5C 5B24B 5AV8A 1M19D 4JJND 1P3IC 5CP6A 5B0YA 4J8VD 2DF4C 1M19C 4JJNC 2NZDA 3B6GC 5B31B 3AFAA 1P3BB 4NE3A 4J8VC 4NFTA 5KDMA 5AV6B 3LZ1A 3KXBD 3X1TD 2ZY5A 3H0LC 3WTPB 3KXBC 4EO5C 2L5AA 3AZGD 3WA9B 3NQJA 2F8ND 3X1VB 3AZGC 4UPKA 5GXQB 3AL0C 5BS7C 3AZEB 2Y2QA 5JA4B 5JRGC 3WKJA 1B67A 3KUYD 1AOIB 3WAAB 1F66D 3KUYC 3C1BC 5CPID 3TU4A 5AV9B 4H9RB 4Z2MG 1F66C 3MGRA 3MGSB 2AROC 3W97B 4J8UA 2FJ7D 3AYWB 3LELB 5AVCD 2BYMA 1P3OB 3B0DB 3LZ0B 3RELD 1P3MB 1P3LA 5AVCC 5F99B 2ZM5A 3RELC 3AN2A 3AZJD 3AFAD 3B0CT 4Z5TD 4YM6B 3AZJC 3AFAC 5E5AD 5GT3B 4Z5TC 3LZ1D 5E5AC 4WZSB 3AZND 3REJC 3A1KA 3AZIA 1ID3B 2Y2MA 3LZ1C 1P3FA 4QLCC 3AZNC 5B40B 4R8PA 4G92B 4AWLC 4J8WB 5AV5B 1P3IB 3MNNA 1M19B 4JJNB 1H3OA 3B6GB 1P3PA 4J8VB 1JFIB 5B0ZD 3VH5W 4H9NB 5B0ZC 1ZLAD 2HUEC 2NQBA 4J8XC 2BYKB 1ZLAC 3UTBA 2ZY2A 5B1LA 3MGRD 3KXBB 3AZKA 4EO5B 2ZY4A 1P3KD 3MGRC 3AZFA 1P34A 3AZGB 4XUJC 2IO5C 5G49A 3VH6W 1P3KC 1TZYA 4ZBJC 5CPKA 2HIOA 5C3IC 5B32C 3REHA 3W96D 5BNXA 4CAYB 3W96C 5JRGB 4X23A 4WJ3C 1A7WA 1P3GD 4NE6A 3V9RA 3C1CA 2G5HC 1P3GC 3KUYB 3UTAD 3C1BB 1F66B 3AZID 3UTAC 5B2IA 1P3FD 3REIB 4XZQD 3AZIC 2AROB 2CV5A 1Z2CB 1P3FC 4XZQC 1TAFB 5FUGA 1N1JA 3AZLA 3X1SC 4ZUXC 1BH8A 3AZHA 2PYOA 3EG5B 5B31G 3MNND 1KX3D 3RELB 1M18A 3MNNC 1KX3C 3W99D 5DNMD 3AZJB 3AFAB 3EPHA 3B6FC 2NQBD 5DNNA 4KUDA 3W99C 4Z5TB 5KDMB 5DNMC 5E5AB 3B0BA 3R45A 3REJB 2NQBC 5B1LD 3LZ1B 2FFFB 4UUZA 4QLCB 3AZKD 3AZNB 5B1LC 2Y2OA 2LY8A 3KSYA 3NQJB 1KX4C 4YS3C 5CPKD 5CPJA 3REHD 4G91C 4Z66A 5CPKC 2F8NH 5AY8A 2YFWA 4X23D 4WV4B 3H0MC 1EQZA 5B0ZB 4X23C 2HUEB 3MVDD 2YFVA 5GT0A 3LJAA 4J8XB 4LD9A 5BNVA 3A6NA 1ZLAB 3X1TC 3MVDC 3AZMD 5B2ID 4H9OA 3AZMC 3MGRB 2CV5D 4KHAA 5B2IC 4XUJB 2IO5B 1P3KB 4ZBJB 2CV5C 3AZLD 2UWXA 5C3IB 5B32B 1M1AD 2VQRA 3WTPE 4KGCA 3AZHD 5BO0A 2PYOD 1M1AC 3W96B 1HQ3D 1S32A 1M18D 2RVQD 1ULYA 1HQ3C 1P3GB 5GSUA 3NQUB 5B24A 5CPIC 3EPKA 1BH9B 3UT9A 3UTAB 3O62D 4CSRA 3AZIB 5B31A 3O62C 1P3FB 4XZQB 2FJ7C 5AV8D 2BG1A 3X1SB 4ZUXB 5CP6D 5B0YD 5AV8C 5CPJD 3AV2B 2NZDD 4Z66D 5CP6C 5B0YC 3WTPA 5AY8D 5CHLB 5CPJC 2NZDC 3MNNB 2Y2JA 1KX3B 4Z66C 3WA9A 3B6FB 2Y2HA 3W99B 5DNMB 2JSSA 2Y2GA 2NQBB 3AZEA 5JA4A 1WWSA 5B1LB 4DRAA 1KX4B 4YS3B 3WAAA 4G91B 5CPKB 3MGPA 3WKJD 3MGSA 3WKJC 3W98A 4X23B 3W97A 3TU4D 3LELA 3X1TB 2Y2LA 3MVDB 1P3OA 3TU4C 3LZ0A 1P3MA 3UT9D 5F99A 2XD5A 3AZMB 2CWEA 5B2JA 4J8UD 5B31D 5B2IB 3UT9C 2F8NB 5AVBA 4J8UC 5GT3A 3EPJA 1P3LD 5FUGB 1N1JB 4H9QB 5BT1D 3AN2D 1P3LC 3WTPD 1M1AB 4E45A 3AV1A 3AN2C 5B40A 2G5IC 1HQ3B 1KX5A 4J8WA 4H9PB 5AV5A 1HTAA 5CPIB 1P3IA 4WU9A 4R8PD 4JJNA 3B6GA 4R8PC 3O62B 4J8VA 1JFIA 2FJ7B 2Y2PA 5AVCB 5AV8B
chains in the Genus database with same CATH topology
1P3PD 5CP6B 5B0YB 3MGPD 2DQNC 3B0CW 2Y2NA 3KXBA 5CPJB 2NZDB 1P3PC 4Z66B 3MGPC 3KWQA 2YFWB 1T3UA 4E44A 3AZGA 3W98D 3UTBD 3W98C 4Z2MH 2YFVB 5BS7A 3UTBC 1P3OD 1P3MD 4CAYA 3AZFD 3AZKC 1P34D 4AWLB 3FDDA 5B2JD 5JRGA 3MGQA 4WU8A 3AZFC 1TZYD 3REKA 1P34C 2HIOD 3X1UA 1Q9CA 5B2JC 5B32G 5AVBD 4KHAB 1TZYC 5GT3D 3KUYA 2HIOC 5AVBC 3REHC 3C1BA 5GT3C 3AV1D 5BO0B 3REIA 3WKJB 3C1CD 4DQYB 4WNNA 2AROA 3A1IA 3AV1C 1WWIA 1KX5D 3C1CC 4J8WD 5AV5D 1KX5C 2ZY3A 3TU4B 4J8WC 1P3ID 1U35A 2J8PA 4WU9D 3RELA 3B6GD 3UT9B 4WU9C 4CSRB 4J8UB 3AZJA 3AZLC 3VH5T 2BYMB 4Z5TA 5E5AA 1P3AA 3REJA 3AZHC 1P3LB 2PYOC 5B33A 4QLCA 2JE5A 3AZNA 3AN2B 1M18C 2RVQC 5DNND 4KUDD 5B1MA 3KWQD 5DNNC 4KUDC 3KWQC 2Y2KA 3VH6T 1P3BA 4R8PB 5JRGD 3MGQD 4WU8D 3REKD 2RIQA 5AV6A 3X1UD 2W8SA 4H9SA 5B0ZA 3MGQC 4WU8C 3REKC 4J8XA 3X1UC 1ZLAA 3C1BD 1B6WA 1H3OB 5AY8C 1EQZD 1P3PB 3MGPB 4HGAC 3REID 3X1VA 2Y2IA 5GT0D 2AROD 5GXQA 3LJAD 1EQZC 3IP4C 4XUJA 4LD9D 3A6ND 3REIC 1P3KA 5GT0C 4LD9C 3LJAC 3W98B 5B32A 3A6NC 3UTBB 1U35D 3AZKB 2F8NG 3W96A 4DRBA 1AOIA 1U35C 3AZFB 1P34B 4M6BA 5B2JB 5G49B 1P3GA 4KGCD 1TZYB 5AV9A 2HIOB 4H9RA 3NQUA 5AVBB 3REHB 5BNXB 4NE5A 1P3AD 3REJD 1S32D 2F8NK 4KGCC 5B33D 1BH9A 3UTAA 1P3AC 4QLCD 1S32C 5B33C 5GSUD 3V9RB 3AYWA 3AV1B 5B1MD 1W2EA 3H0RC 4XZQA 3C1CB 5B24D 5GSUC 3X1SA 5B1MC 4ZUXA 1KX5B 5B24C 3AV2A 1P3BD 3VH5A 2F2AC 4YM6A 4WU9B 5B31C 2CV5B 1P3BC 1KX3A 5AV6D 3B6FA 3AZLB 3W99A 1BH8B 5DNMA 1ID3A 5AV6C 4J8XD 5BT1C 3KFUG 3AZHB 4H9SC 2PYOB 3WTPC 3WA9D 1BFMA 3EPLA 1M18B 3X1VD 3WA9C 3VH6A 5GXQD 4XUJD 3X1VC 5DNNB 4YS3A 1KX4A 4KUDB 3KWQB 5GXQC 3R45B 3AZED 1M19A 5B32D 4UUZB 3AZEC 1F1EA 3F6TA 1AOID 4H9NA 3WAAD 1PZRA 3MGQB 1AOIC 2BYKA 2XD1A 4WU8B 3REKB 3WAAC 5AV9D 3X1UB 3X1TA 3MVDA 5AV9C 3MGSD 5AY8B 4HGAB 3AZMA 3W97D 1R4VA 3MGSC 1EQZB 3AYWD 3LELD 2F8NA 2JCHA 4WNNB 3W97C 5GT0B 4LD9B 3LJAB 3LZ0D 3X1SD 5BNVB 3LELC 4ZUXD 3A6NB 3AYWC 1KU5A 5F99D 4H9QA 1P3OC 3B0DC 3LZ0C 3AV2D 1P3MC 1M1AA 4H9OB 5F99C 1U35B 4YM6D 3AV2C 1HQ3A 3P5JB 4YM6C 3B6FD 1F66A 4H9PA 1ID3D 5CPIA 4KGCB 5B40D 1ID3C 1P3AB 1S32B 1TAFA 5B33B 5B40C 3O62A 4G92C 2FJ7A 5GSUB 1KX4D 4YS3D 5B1MB 5AVCA 5AV5C 5B24B 5AV8A 1M19D 4JJND 1P3IC 5CP6A 5B0YA 4J8VD 2DF4C 1M19C 4JJNC 2NZDA 3B6GC 5B31B 3AFAA 1P3BB 4NE3A 4J8VC 4NFTA 5KDMA 5AV6B 3LZ1A 3KXBD 3X1TD 2ZY5A 3H0LC 3WTPB 3KXBC 4EO5C 2L5AA 3AZGD 3WA9B 3NQJA 2F8ND 3X1VB 3AZGC 4UPKA 5GXQB 3AL0C 5BS7C 3AZEB 2Y2QA 5JA4B 5JRGC 3WKJA 1B67A 3KUYD 1AOIB 3WAAB 1F66D 3KUYC 3C1BC 5CPID 3TU4A 5AV9B 4H9RB 4Z2MG 1F66C 3MGRA 3MGSB 2AROC 3W97B 4J8UA 2FJ7D 3AYWB 3LELB 5AVCD 2BYMA 1P3OB 3B0DB 3LZ0B 3RELD 1P3MB 1P3LA 5AVCC 5F99B 2ZM5A 3RELC 3AN2A 3AZJD 3AFAD 3B0CT 4Z5TD 4YM6B 3AZJC 3AFAC 5E5AD 5GT3B 4Z5TC 3LZ1D 5E5AC 4WZSB 3AZND 3REJC 3A1KA 3AZIA 1ID3B 2Y2MA 3LZ1C 1P3FA 4QLCC 3AZNC 5B40B 4R8PA 4G92B 4AWLC 4J8WB 5AV5B 1P3IB 3MNNA 1M19B 4JJNB 1H3OA 3B6GB 1P3PA 4J8VB 1JFIB 5B0ZD 3VH5W 4H9NB 5B0ZC 1ZLAD 2HUEC 2NQBA 4J8XC 2BYKB 1ZLAC 3UTBA 2ZY2A 5B1LA 3MGRD 3KXBB 3AZKA 4EO5B 2ZY4A 1P3KD 3MGRC 3AZFA 1P34A 3AZGB 4XUJC 2IO5C 5G49A 3VH6W 1P3KC 1TZYA 4ZBJC 5CPKA 2HIOA 5C3IC 5B32C 3REHA 3W96D 5BNXA 4CAYB 3W96C 5JRGB 4X23A 4WJ3C 1A7WA 1P3GD 4NE6A 3V9RA 3C1CA 2G5HC 1P3GC 3KUYB 3UTAD 3C1BB 1F66B 3AZID 3UTAC 5B2IA 1P3FD 3REIB 4XZQD 3AZIC 2AROB 2CV5A 1Z2CB 1P3FC 4XZQC 1TAFB 5FUGA 1N1JA 3AZLA 3X1SC 4ZUXC 1BH8A 3AZHA 2PYOA 3EG5B 5B31G 3MNND 1KX3D 3RELB 1M18A 3MNNC 1KX3C 3W99D 5DNMD 3AZJB 3AFAB 3EPHA 3B6FC 2NQBD 5DNNA 4KUDA 3W99C 4Z5TB 5KDMB 5DNMC 5E5AB 3B0BA 3R45A 3REJB 2NQBC 5B1LD 3LZ1B 2FFFB 4UUZA 4QLCB 3AZKD 3AZNB 5B1LC 2Y2OA 2LY8A 3KSYA 3NQJB 1KX4C 4YS3C 5CPKD 5CPJA 3REHD 4G91C 4Z66A 5CPKC 2F8NH 5AY8A 2YFWA 4X23D 4WV4B 3H0MC 1EQZA 5B0ZB 4X23C 2HUEB 3MVDD 2YFVA 5GT0A 3LJAA 4J8XB 4LD9A 5BNVA 3A6NA 1ZLAB 3X1TC 3MVDC 3AZMD 5B2ID 4H9OA 3AZMC 3MGRB 2CV5D 4KHAA 5B2IC 4XUJB 2IO5B 1P3KB 4ZBJB 2CV5C 3AZLD 2UWXA 5C3IB 5B32B 1M1AD 2VQRA 3WTPE 4KGCA 3AZHD 5BO0A 2PYOD 1M1AC 3W96B 1HQ3D 1S32A 1M18D 2RVQD 1ULYA 1HQ3C 1P3GB 5GSUA 3NQUB 5B24A 5CPIC 3EPKA 1BH9B 3UT9A 3UTAB 3O62D 4CSRA 3AZIB 5B31A 3O62C 1P3FB 4XZQB 2FJ7C 5AV8D 2BG1A 3X1SB 4ZUXB 5CP6D 5B0YD 5AV8C 5CPJD 3AV2B 2NZDD 4Z66D 5CP6C 5B0YC 3WTPA 5AY8D 5CHLB 5CPJC 2NZDC 3MNNB 2Y2JA 1KX3B 4Z66C 3WA9A 3B6FB 2Y2HA 3W99B 5DNMB 2JSSA 2Y2GA 2NQBB 3AZEA 5JA4A 1WWSA 5B1LB 4DRAA 1KX4B 4YS3B 3WAAA 4G91B 5CPKB 3MGPA 3WKJD 3MGSA 3WKJC 3W98A 4X23B 3W97A 3TU4D 3LELA 3X1TB 2Y2LA 3MVDB 1P3OA 3TU4C 3LZ0A 1P3MA 3UT9D 5F99A 2XD5A 3AZMB 2CWEA 5B2JA 4J8UD 5B31D 5B2IB 3UT9C 2F8NB 5AVBA 4J8UC 5GT3A 3EPJA 1P3LD 5FUGB 1N1JB 4H9QB 5BT1D 3AN2D 1P3LC 3WTPD 1M1AB 4E45A 3AV1A 3AN2C 5B40A 2G5IC 1HQ3B 1KX5A 4J8WA 4H9PB 5AV5A 1HTAA 5CPIB 1P3IA 4WU9A 4R8PD 4JJNA 3B6GA 4R8PC 3O62B 4J8VA 1JFIA 2FJ7B 2Y2PA 5AVCB 5AV8B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1P3P D;  5CP6 B;  5B0Y B;  3MGP D;  3B0C W;  5CPJ B;  3KXB A;  2NZD B;  1P3P C;  4Z66 B;  3MGP C;  3KWQ A;  2YFW B;  4E44 A;  3AZG A;  3W98 D;  3UTB D;  3W98 C;  4Z2M H;  2YFV B;  5BS7 A;  3UTB C;  1P3O D;  1P3M D;  4CAY A;  3AZF D;  3AZK C;  1P34 D;  4AWL B;  5B2J D;  5JRG A;  3MGQ A;  4WU8 A;  3AZF C;  1TZY D;  3REK A;  1P34 C;  2HIO D;  3X1U A;  1Q9C A;  5B2J C;  5B32 G;  5AVB D;  4KHA B;  1TZY C;  5GT3 D;  3KUY A;  2HIO C;  5AVB C;  3REH C;  3C1B A;  5GT3 C;  3AV1 D;  5BO0 B;  3REI A;  3WKJ B;  3C1C D;  4WNN A;  2ARO A;  3AV1 C;  1WWI A;  1KX5 D;  3C1C C;  4J8W D;  5AV5 D;  1KX5 C;  3TU4 B;  4J8W C;  1P3I D;  1U35 A;  4WU9 D;  3REL A;  3B6G D;  3UT9 B;  4WU9 C;  4CSR B;  4J8U B;  3AZJ A;  3AZL C;  3VH5 T;  2BYM B;  4Z5T A;  5E5A A;  1P3A A;  3REJ A;  3AZH C;  1P3L B;  2PYO C;  5B33 A;  4QLC A;  3AZN A;  3AN2 B;  1M18 C;  2RVQ C;  5DNN D;  4KUD D;  5B1M A;  3KWQ D;  5DNN C;  4KUD C;  3KWQ C;  3VH6 T;  1P3B A;  4R8P B;  5JRG D;  3MGQ D;  4WU8 D;  3REK D;  5AV6 A;  3X1U D;  4H9S A;  3MGQ C;  5B0Z A;  4WU8 C;  3REK C;  4J8X A;  3X1U C;  1ZLA A;  3C1B D;  1B6W A;  1H3O B;  5AY8 C;  1EQZ D;  1P3P B;  3MGP B;  4HGA C;  3REI D;  3X1V A;  5GT0 D;  2ARO D;  5GXQ A;  3LJA D;  1EQZ C;  4XUJ A;  4LD9 D;  3A6N D;  3REI C;  1P3K A;  5GT0 C;  4LD9 C;  3LJA C;  3W98 B;  5B32 A;  3A6N C;  3UTB B;  1U35 D;  3AZK B;  2F8N G;  3W96 A;  4DRB A;  1AOI A;  1U35 C;  3AZF B;  1P34 B;  4M6B A;  5B2J B;  5G49 B;  1P3G A;  4KGC D;  1TZY B;  5AV9 A;  2HIO B;  4H9R A;  3NQU A;  5AVB B;  3REH B;  5BNX B;  4NE5 A;  1P3A D;  3REJ D;  1S32 D;  2F8N K;  4KGC C;  5B33 D;  1BH9 A;  3UTA A;  1P3A C;  4QLC D;  1S32 C;  5B33 C;  5GSU D;  3V9R B;  3AYW A;  3AV1 B;  5B1M D;  4XZQ A;  3C1C B;  5B24 D;  5GSU C;  3X1S A;  5B1M C;  4ZUX A;  1KX5 B;  5B24 C;  3AV2 A;  1P3B D;  3VH5 A;  4YM6 A;  4WU9 B;  5B31 C;  2CV5 B;  1P3B C;  1KX3 A;  5AV6 D;  3B6F A;  3AZL B;  3W99 A;  1BH8 B;  5DNM A;  1ID3 A;  5AV6 C;  4J8X D;  5BT1 C;  3AZH B;  4H9S C;  2PYO B;  3WTP C;  3WA9 D;  1BFM A;  1M18 B;  3X1V D;  3WA9 C;  3VH6 A;  5GXQ D;  4XUJ D;  3X1V C;  5DNN B;  4YS3 A;  1KX4 A;  4KUD B;  3KWQ B;  5GXQ C;  3R45 B;  3AZE D;  1M19 A;  5B32 D;  4UUZ B;  3AZE C;  1F1E A;  1AOI D;  4H9N A;  3WAA D;  3MGQ B;  1AOI C;  2BYK A;  4WU8 B;  3REK B;  3WAA C;  5AV9 D;  3X1U B;  3X1T A;  3MVD A;  5AV9 C;  3MGS D;  5AY8 B;  4HGA B;  3AZM A;  3W97 D;  1R4V A;  3MGS C;  1EQZ B;  3AYW D;  3LEL D;  2F8N A;  3W97 C;  4WNN B;  5GT0 B;  4LD9 B;  3LJA B;  3LZ0 D;  3X1S D;  5BNV B;  3LEL C;  4ZUX D;  3A6N B;  3AYW C;  1KU5 A;  5F99 D;  4H9Q A;  1P3O C;  3B0D C;  3LZ0 C;  3AV2 D;  1P3M C;  1M1A A;  4H9O B;  5F99 C;  1U35 B;  4YM6 D;  3AV2 C;  1HQ3 A;  4YM6 C;  3B6F D;  1F66 A;  4H9P A;  1ID3 D;  5CPI A;  4KGC B;  5B40 D;  1ID3 C;  1P3A B;  1S32 B;  1TAF A;  5B33 B;  5B40 C;  3O62 A;  4G92 C;  2FJ7 A;  5GSU B;  1KX4 D;  4YS3 D;  5B1M B;  5AVC A;  5AV5 C;  5B24 B;  5AV8 A;  1M19 D;  4JJN D;  1P3I C;  5CP6 A;  5B0Y A;  4J8V D;  1M19 C;  4JJN C;  2NZD A;  3B6G C;  5B31 B;  3AFA A;  1P3B B;  4NE3 A;  4J8V C;  4NFT A;  5KDM A;  5AV6 B;  3LZ1 A;  3KXB D;  3X1T D;  3WTP B;  3KXB C;  4EO5 C;  2L5A A;  3AZG D;  3WA9 B;  3NQJ A;  2F8N D;  3X1V B;  3AZG C;  5GXQ B;  5BS7 C;  3AZE B;  5JA4 B;  5JRG C;  3WKJ A;  1B67 A;  3KUY D;  1AOI B;  3WAA B;  1F66 D;  3KUY C;  3C1B C;  5CPI D;  3TU4 A;  5AV9 B;  4H9R B;  4Z2M G;  1F66 C;  3MGR A;  3MGS B;  2ARO C;  3W97 B;  4J8U A;  2FJ7 D;  3AYW B;  3LEL B;  5AVC D;  2BYM A;  1P3O B;  3B0D B;  3LZ0 B;  3REL D;  1P3M B;  1P3L A;  5AVC C;  5F99 B;  3REL C;  3AN2 A;  3AZJ D;  3AFA D;  3B0C T;  4Z5T D;  4YM6 B;  3AZJ C;  3AFA C;  5E5A D;  5GT3 B;  4Z5T C;  3LZ1 D;  5E5A C;  4WZS B;  3AZN D;  3REJ C;  3AZI A;  1ID3 B;  3LZ1 C;  1P3F A;  4QLC C;  3AZN C;  5B40 B;  4R8P A;  4G92 B;  4AWL C;  4J8W B;  5AV5 B;  1P3I B;  3MNN A;  1M19 B;  4JJN B;  1H3O A;  3B6G B;  1P3P A;  4J8V B;  1JFI B;  5B0Z D;  3VH5 W;  4H9N B;  5B0Z C;  1ZLA D;  2HUE C;  2NQB A;  4J8X C;  2BYK B;  1ZLA C;  3UTB A;  5B1L A;  3MGR D;  3KXB B;  3AZK A;  4EO5 B;  1P3K D;  3MGR C;  3AZF A;  1P34 A;  3AZG B;  4XUJ C;  2IO5 C;  5G49 A;  3VH6 W;  1P3K C;  1TZY A;  4ZBJ C;  5CPK A;  2HIO A;  5C3I C;  5B32 C;  3REH A;  3W96 D;  5BNX A;  4CAY B;  3W96 C;  5JRG B;  4X23 A;  1A7W A;  1P3G D;  4NE6 A;  3V9R A;  3C1C A;  1P3G C;  3KUY B;  3UTA D;  3C1B B;  1F66 B;  3AZI D;  3UTA C;  5B2I A;  1P3F D;  3REI B;  4XZQ D;  3AZI C;  2ARO B;  2CV5 A;  1P3F C;  4XZQ C;  1TAF B;  5FUG A;  1N1J A;  3AZL A;  3X1S C;  4ZUX C;  1BH8 A;  3AZH A;  2PYO A;  5B31 G;  3MNN D;  1KX3 D;  3REL B;  1M18 A;  3MNN C;  1KX3 C;  3W99 D;  5DNM D;  3AZJ B;  3AFA B;  3B6F C;  2NQB D;  5DNN A;  4KUD A;  3W99 C;  4Z5T B;  5KDM B;  5DNM C;  5E5A B;  3B0B A;  3R45 A;  3REJ B;  2NQB C;  5B1L D;  3LZ1 B;  4UUZ A;  4QLC B;  3AZK D;  3AZN B;  5B1L C;  2LY8 A;  3KSY A;  3NQJ B;  1KX4 C;  4YS3 C;  5CPK D;  5CPJ A;  3REH D;  4G91 C;  4Z66 A;  5CPK C;  2F8N H;  5AY8 A;  2YFW A;  4X23 D;  4WV4 B;  1EQZ A;  5B0Z B;  4X23 C;  2HUE B;  3MVD D;  2YFV A;  5GT0 A;  3LJA A;  4J8X B;  4LD9 A;  5BNV A;  3A6N A;  1ZLA B;  3X1T C;  3MVD C;  3AZM D;  5B2I D;  4H9O A;  3AZM C;  3MGR B;  2CV5 D;  4KHA A;  5B2I C;  4XUJ B;  2IO5 B;  1P3K B;  4ZBJ B;  2CV5 C;  3AZL D;  5C3I B;  5B32 B;  1M1A D;  3WTP E;  4KGC A;  3AZH D;  5BO0 A;  2PYO D;  1M1A C;  3W96 B;  1HQ3 D;  1S32 A;  1M18 D;  2RVQ D;  1ULY A;  1HQ3 C;  1P3G B;  5GSU A;  3NQU B;  5B24 A;  5CPI C;  1BH9 B;  3UT9 A;  3UTA B;  3O62 D;  4CSR A;  3AZI B;  5B31 A;  3O62 C;  1P3F B;  4XZQ B;  2FJ7 C;  5AV8 D;  3X1S B;  4ZUX B;  5CP6 D;  5B0Y D;  5AV8 C;  5CPJ D;  3AV2 B;  2NZD D;  4Z66 D;  5CP6 C;  5B0Y C;  3WTP A;  5AY8 D;  5CHL B;  5CPJ C;  2NZD C;  3MNN B;  1KX3 B;  4Z66 C;  3WA9 A;  3B6F B;  3W99 B;  5DNM B;  2JSS A;  2NQB B;  3AZE A;  5JA4 A;  1WWS A;  5B1L B;  4DRA A;  1KX4 B;  4YS3 B;  3WAA A;  4G91 B;  5CPK B;  3MGP A;  3WKJ D;  3MGS A;  3WKJ C;  3W98 A;  4X23 B;  3W97 A;  3TU4 D;  3LEL A;  3X1T B;  3MVD B;  1P3O A;  3TU4 C;  3LZ0 A;  1P3M A;  3UT9 D;  5F99 A;  3AZM B;  2CWE A;  5B2J A;  4J8U D;  5B31 D;  5B2I B;  3UT9 C;  2F8N B;  5AVB A;  4J8U C;  5GT3 A;  1P3L D;  5FUG B;  1N1J B;  4H9Q B;  5BT1 D;  3AN2 D;  1P3L C;  3WTP D;  1M1A B;  4E45 A;  3AV1 A;  3AN2 C;  5B40 A;  1HQ3 B;  1KX5 A;  4J8W A;  4H9P B;  5AV5 A;  1HTA A;  5CPI B;  1P3I A;  4WU9 A;  4R8P D;  4JJN A;  3B6G A;  4R8P C;  3O62 B;  4J8V A;  1JFI A;  2FJ7 B;  5AVC B;  5AV8 B; 
#chains in the Genus database with same CATH topology
 1P3P D;  5CP6 B;  5B0Y B;  3MGP D;  2DQN C;  3B0C W;  2Y2N A;  3KXB A;  5CPJ B;  2NZD B;  1P3P C;  4Z66 B;  3MGP C;  3KWQ A;  2YFW B;  1T3U A;  4E44 A;  3AZG A;  3W98 D;  3UTB D;  3W98 C;  4Z2M H;  2YFV B;  5BS7 A;  3UTB C;  1P3O D;  1P3M D;  4CAY A;  3AZF D;  3AZK C;  1P34 D;  4AWL B;  3FDD A;  5B2J D;  5JRG A;  3MGQ A;  4WU8 A;  3AZF C;  1TZY D;  3REK A;  1P34 C;  2HIO D;  3X1U A;  1Q9C A;  5B2J C;  5B32 G;  5AVB D;  4KHA B;  1TZY C;  5GT3 D;  3KUY A;  2HIO C;  5AVB C;  3REH C;  3C1B A;  5GT3 C;  3AV1 D;  5BO0 B;  3REI A;  3WKJ B;  3C1C D;  4DQY B;  4WNN A;  2ARO A;  3A1I A;  3AV1 C;  1WWI A;  1KX5 D;  3C1C C;  4J8W D;  5AV5 D;  1KX5 C;  2ZY3 A;  3TU4 B;  4J8W C;  1P3I D;  1U35 A;  2J8P A;  4WU9 D;  3REL A;  3B6G D;  3UT9 B;  4WU9 C;  4CSR B;  4J8U B;  3AZJ A;  3AZL C;  3VH5 T;  2BYM B;  4Z5T A;  5E5A A;  1P3A A;  3REJ A;  3AZH C;  1P3L B;  2PYO C;  5B33 A;  4QLC A;  2JE5 A;  3AZN A;  3AN2 B;  1M18 C;  2RVQ C;  5DNN D;  4KUD D;  5B1M A;  3KWQ D;  5DNN C;  4KUD C;  3KWQ C;  2Y2K A;  3VH6 T;  1P3B A;  4R8P B;  5JRG D;  3MGQ D;  4WU8 D;  3REK D;  2RIQ A;  5AV6 A;  3X1U D;  2W8S A;  4H9S A;  5B0Z A;  3MGQ C;  4WU8 C;  3REK C;  4J8X A;  3X1U C;  1ZLA A;  3C1B D;  1B6W A;  1H3O B;  5AY8 C;  1EQZ D;  1P3P B;  3MGP B;  4HGA C;  3REI D;  3X1V A;  2Y2I A;  5GT0 D;  2ARO D;  5GXQ A;  3LJA D;  1EQZ C;  3IP4 C;  4XUJ A;  4LD9 D;  3A6N D;  3REI C;  1P3K A;  5GT0 C;  4LD9 C;  3LJA C;  3W98 B;  5B32 A;  3A6N C;  3UTB B;  1U35 D;  3AZK B;  2F8N G;  3W96 A;  4DRB A;  1AOI A;  1U35 C;  3AZF B;  1P34 B;  4M6B A;  5B2J B;  5G49 B;  1P3G A;  4KGC D;  1TZY B;  5AV9 A;  2HIO B;  4H9R A;  3NQU A;  5AVB B;  3REH B;  5BNX B;  4NE5 A;  1P3A D;  3REJ D;  1S32 D;  2F8N K;  4KGC C;  5B33 D;  1BH9 A;  3UTA A;  1P3A C;  4QLC D;  1S32 C;  5B33 C;  5GSU D;  3V9R B;  3AYW A;  3AV1 B;  5B1M D;  1W2E A;  3H0R C;  4XZQ A;  3C1C B;  5B24 D;  5GSU C;  3X1S A;  5B1M C;  4ZUX A;  1KX5 B;  5B24 C;  3AV2 A;  1P3B D;  3VH5 A;  2F2A C;  4YM6 A;  4WU9 B;  5B31 C;  2CV5 B;  1P3B C;  1KX3 A;  5AV6 D;  3B6F A;  3AZL B;  3W99 A;  1BH8 B;  5DNM A;  1ID3 A;  5AV6 C;  4J8X D;  5BT1 C;  3KFU G;  3AZH B;  4H9S C;  2PYO B;  3WTP C;  3WA9 D;  1BFM A;  3EPL A;  1M18 B;  3X1V D;  3WA9 C;  3VH6 A;  5GXQ D;  4XUJ D;  3X1V C;  5DNN B;  4YS3 A;  1KX4 A;  4KUD B;  3KWQ B;  5GXQ C;  3R45 B;  3AZE D;  1M19 A;  5B32 D;  4UUZ B;  3AZE C;  1F1E A;  3F6T A;  1AOI D;  4H9N A;  3WAA D;  1PZR A;  3MGQ B;  1AOI C;  2BYK A;  2XD1 A;  4WU8 B;  3REK B;  3WAA C;  5AV9 D;  3X1U B;  3X1T A;  3MVD A;  5AV9 C;  3MGS D;  5AY8 B;  4HGA B;  3AZM A;  3W97 D;  1R4V A;  3MGS C;  1EQZ B;  3AYW D;  3LEL D;  2F8N A;  2JCH A;  4WNN B;  3W97 C;  5GT0 B;  4LD9 B;  3LJA B;  3LZ0 D;  3X1S D;  5BNV B;  3LEL C;  4ZUX D;  3A6N B;  3AYW C;  1KU5 A;  5F99 D;  4H9Q A;  1P3O C;  3B0D C;  3LZ0 C;  3AV2 D;  1P3M C;  1M1A A;  4H9O B;  5F99 C;  1U35 B;  4YM6 D;  3AV2 C;  1HQ3 A;  3P5J B;  4YM6 C;  3B6F D;  1F66 A;  4H9P A;  1ID3 D;  5CPI A;  4KGC B;  5B40 D;  1ID3 C;  1P3A B;  1S32 B;  1TAF A;  5B33 B;  5B40 C;  3O62 A;  4G92 C;  2FJ7 A;  5GSU B;  1KX4 D;  4YS3 D;  5B1M B;  5AVC A;  5AV5 C;  5B24 B;  5AV8 A;  1M19 D;  4JJN D;  1P3I C;  5CP6 A;  5B0Y A;  4J8V D;  2DF4 C;  1M19 C;  4JJN C;  2NZD A;  3B6G C;  5B31 B;  3AFA A;  1P3B B;  4NE3 A;  4J8V C;  4NFT A;  5KDM A;  5AV6 B;  3LZ1 A;  3KXB D;  3X1T D;  2ZY5 A;  3H0L C;  3WTP B;  3KXB C;  4EO5 C;  2L5A A;  3AZG D;  3WA9 B;  3NQJ A;  2F8N D;  3X1V B;  3AZG C;  4UPK A;  5GXQ B;  3AL0 C;  5BS7 C;  3AZE B;  2Y2Q A;  5JA4 B;  5JRG C;  3WKJ A;  1B67 A;  3KUY D;  1AOI B;  3WAA B;  1F66 D;  3KUY C;  3C1B C;  5CPI D;  3TU4 A;  5AV9 B;  4H9R B;  4Z2M G;  1F66 C;  3MGR A;  3MGS B;  2ARO C;  3W97 B;  4J8U A;  2FJ7 D;  3AYW B;  3LEL B;  5AVC D;  2BYM A;  1P3O B;  3B0D B;  3LZ0 B;  3REL D;  1P3M B;  1P3L A;  5AVC C;  5F99 B;  2ZM5 A;  3REL C;  3AN2 A;  3AZJ D;  3AFA D;  3B0C T;  4Z5T D;  4YM6 B;  3AZJ C;  3AFA C;  5E5A D;  5GT3 B;  4Z5T C;  3LZ1 D;  5E5A C;  4WZS B;  3AZN D;  3REJ C;  3A1K A;  3AZI A;  1ID3 B;  2Y2M A;  3LZ1 C;  1P3F A;  4QLC C;  3AZN C;  5B40 B;  4R8P A;  4G92 B;  4AWL C;  4J8W B;  5AV5 B;  1P3I B;  3MNN A;  1M19 B;  4JJN B;  1H3O A;  3B6G B;  1P3P A;  4J8V B;  1JFI B;  5B0Z D;  3VH5 W;  4H9N B;  5B0Z C;  1ZLA D;  2HUE C;  2NQB A;  4J8X C;  2BYK B;  1ZLA C;  3UTB A;  2ZY2 A;  5B1L A;  3MGR D;  3KXB B;  3AZK A;  4EO5 B;  2ZY4 A;  1P3K D;  3MGR C;  3AZF A;  1P34 A;  3AZG B;  4XUJ C;  2IO5 C;  5G49 A;  3VH6 W;  1P3K C;  1TZY A;  4ZBJ C;  5CPK A;  2HIO A;  5C3I C;  5B32 C;  3REH A;  3W96 D;  5BNX A;  4CAY B;  3W96 C;  5JRG B;  4X23 A;  4WJ3 C;  1A7W A;  1P3G D;  4NE6 A;  3V9R A;  3C1C A;  2G5H C;  1P3G C;  3KUY B;  3UTA D;  3C1B B;  1F66 B;  3AZI D;  3UTA C;  5B2I A;  1P3F D;  3REI B;  4XZQ D;  3AZI C;  2ARO B;  2CV5 A;  1Z2C B;  1P3F C;  4XZQ C;  1TAF B;  5FUG A;  1N1J A;  3AZL A;  3X1S C;  4ZUX C;  1BH8 A;  3AZH A;  2PYO A;  3EG5 B;  5B31 G;  3MNN D;  1KX3 D;  3REL B;  1M18 A;  3MNN C;  1KX3 C;  3W99 D;  5DNM D;  3AZJ B;  3AFA B;  3EPH A;  3B6F C;  2NQB D;  5DNN A;  4KUD A;  3W99 C;  4Z5T B;  5KDM B;  5DNM C;  5E5A B;  3B0B A;  3R45 A;  3REJ B;  2NQB C;  5B1L D;  3LZ1 B;  2FFF B;  4UUZ A;  4QLC B;  3AZK D;  3AZN B;  5B1L C;  2Y2O A;  2LY8 A;  3KSY A;  3NQJ B;  1KX4 C;  4YS3 C;  5CPK D;  5CPJ A;  3REH D;  4G91 C;  4Z66 A;  5CPK C;  2F8N H;  5AY8 A;  2YFW A;  4X23 D;  4WV4 B;  3H0M C;  1EQZ A;  5B0Z B;  4X23 C;  2HUE B;  3MVD D;  2YFV A;  5GT0 A;  3LJA A;  4J8X B;  4LD9 A;  5BNV A;  3A6N A;  1ZLA B;  3X1T C;  3MVD C;  3AZM D;  5B2I D;  4H9O A;  3AZM C;  3MGR B;  2CV5 D;  4KHA A;  5B2I C;  4XUJ B;  2IO5 B;  1P3K B;  4ZBJ B;  2CV5 C;  3AZL D;  2UWX A;  5C3I B;  5B32 B;  1M1A D;  2VQR A;  3WTP E;  4KGC A;  3AZH D;  5BO0 A;  2PYO D;  1M1A C;  3W96 B;  1HQ3 D;  1S32 A;  1M18 D;  2RVQ D;  1ULY A;  1HQ3 C;  1P3G B;  5GSU A;  3NQU B;  5B24 A;  5CPI C;  3EPK A;  1BH9 B;  3UT9 A;  3UTA B;  3O62 D;  4CSR A;  3AZI B;  5B31 A;  3O62 C;  1P3F B;  4XZQ B;  2FJ7 C;  5AV8 D;  2BG1 A;  3X1S B;  4ZUX B;  5CP6 D;  5B0Y D;  5AV8 C;  5CPJ D;  3AV2 B;  2NZD D;  4Z66 D;  5CP6 C;  5B0Y C;  3WTP A;  5AY8 D;  5CHL B;  5CPJ C;  2NZD C;  3MNN B;  2Y2J A;  1KX3 B;  4Z66 C;  3WA9 A;  3B6F B;  2Y2H A;  3W99 B;  5DNM B;  2JSS A;  2Y2G A;  2NQB B;  3AZE A;  5JA4 A;  1WWS A;  5B1L B;  4DRA A;  1KX4 B;  4YS3 B;  3WAA A;  4G91 B;  5CPK B;  3MGP A;  3WKJ D;  3MGS A;  3WKJ C;  3W98 A;  4X23 B;  3W97 A;  3TU4 D;  3LEL A;  3X1T B;  2Y2L A;  3MVD B;  1P3O A;  3TU4 C;  3LZ0 A;  1P3M A;  3UT9 D;  5F99 A;  2XD5 A;  3AZM B;  2CWE A;  5B2J A;  4J8U D;  5B31 D;  5B2I B;  3UT9 C;  2F8N B;  5AVB A;  4J8U C;  5GT3 A;  3EPJ A;  1P3L D;  5FUG B;  1N1J B;  4H9Q B;  5BT1 D;  3AN2 D;  1P3L C;  3WTP D;  1M1A B;  4E45 A;  3AV1 A;  3AN2 C;  5B40 A;  2G5I C;  1HQ3 B;  1KX5 A;  4J8W A;  4H9P B;  5AV5 A;  1HTA A;  5CPI B;  1P3I A;  4WU9 A;  4R8P D;  4JJN A;  3B6G A;  4R8P C;  3O62 B;  4J8V A;  1JFI A;  2FJ7 B;  2Y2P A;  5AVC B;  5AV8 B; 
#chains in the Genus database with same CATH homology
 1P3P D;  5CP6 B;  5B0Y B;  3MGP D;  2DQN C;  3B0C W;  2Y2N A;  3KXB A;  5CPJ B;  2NZD B;  1P3P C;  4Z66 B;  3MGP C;  3KWQ A;  2YFW B;  1T3U A;  4E44 A;  3AZG A;  3W98 D;  3UTB D;  3W98 C;  4Z2M H;  2YFV B;  5BS7 A;  3UTB C;  1P3O D;  1P3M D;  4CAY A;  3AZF D;  3AZK C;  1P34 D;  4AWL B;  3FDD A;  5B2J D;  5JRG A;  3MGQ A;  4WU8 A;  3AZF C;  1TZY D;  3REK A;  1P34 C;  2HIO D;  3X1U A;  1Q9C A;  5B2J C;  5B32 G;  5AVB D;  4KHA B;  1TZY C;  5GT3 D;  3KUY A;  2HIO C;  5AVB C;  3REH C;  3C1B A;  5GT3 C;  3AV1 D;  5BO0 B;  3REI A;  3WKJ B;  3C1C D;  4DQY B;  4WNN A;  2ARO A;  3A1I A;  3AV1 C;  1WWI A;  1KX5 D;  3C1C C;  4J8W D;  5AV5 D;  1KX5 C;  2ZY3 A;  3TU4 B;  4J8W C;  1P3I D;  1U35 A;  2J8P A;  4WU9 D;  3REL A;  3B6G D;  3UT9 B;  4WU9 C;  4CSR B;  4J8U B;  3AZJ A;  3AZL C;  3VH5 T;  2BYM B;  4Z5T A;  5E5A A;  1P3A A;  3REJ A;  3AZH C;  1P3L B;  2PYO C;  5B33 A;  4QLC A;  2JE5 A;  3AZN A;  3AN2 B;  1M18 C;  2RVQ C;  5DNN D;  4KUD D;  5B1M A;  3KWQ D;  5DNN C;  4KUD C;  3KWQ C;  2Y2K A;  3VH6 T;  1P3B A;  4R8P B;  5JRG D;  3MGQ D;  4WU8 D;  3REK D;  2RIQ A;  5AV6 A;  3X1U D;  2W8S A;  4H9S A;  5B0Z A;  3MGQ C;  4WU8 C;  3REK C;  4J8X A;  3X1U C;  1ZLA A;  3C1B D;  1B6W A;  1H3O B;  5AY8 C;  1EQZ D;  1P3P B;  3MGP B;  4HGA C;  3REI D;  3X1V A;  2Y2I A;  5GT0 D;  2ARO D;  5GXQ A;  3LJA D;  1EQZ C;  3IP4 C;  4XUJ A;  4LD9 D;  3A6N D;  3REI C;  1P3K A;  5GT0 C;  4LD9 C;  3LJA C;  3W98 B;  5B32 A;  3A6N C;  3UTB B;  1U35 D;  3AZK B;  2F8N G;  3W96 A;  4DRB A;  1AOI A;  1U35 C;  3AZF B;  1P34 B;  4M6B A;  5B2J B;  5G49 B;  1P3G A;  4KGC D;  1TZY B;  5AV9 A;  2HIO B;  4H9R A;  3NQU A;  5AVB B;  3REH B;  5BNX B;  4NE5 A;  1P3A D;  3REJ D;  1S32 D;  2F8N K;  4KGC C;  5B33 D;  1BH9 A;  3UTA A;  1P3A C;  4QLC D;  1S32 C;  5B33 C;  5GSU D;  3V9R B;  3AYW A;  3AV1 B;  5B1M D;  1W2E A;  3H0R C;  4XZQ A;  3C1C B;  5B24 D;  5GSU C;  3X1S A;  5B1M C;  4ZUX A;  1KX5 B;  5B24 C;  3AV2 A;  1P3B D;  3VH5 A;  2F2A C;  4YM6 A;  4WU9 B;  5B31 C;  2CV5 B;  1P3B C;  1KX3 A;  5AV6 D;  3B6F A;  3AZL B;  3W99 A;  1BH8 B;  5DNM A;  1ID3 A;  5AV6 C;  4J8X D;  5BT1 C;  3KFU G;  3AZH B;  4H9S C;  2PYO B;  3WTP C;  3WA9 D;  1BFM A;  3EPL A;  1M18 B;  3X1V D;  3WA9 C;  3VH6 A;  5GXQ D;  4XUJ D;  3X1V C;  5DNN B;  4YS3 A;  1KX4 A;  4KUD B;  3KWQ B;  5GXQ C;  3R45 B;  3AZE D;  1M19 A;  5B32 D;  4UUZ B;  3AZE C;  1F1E A;  3F6T A;  1AOI D;  4H9N A;  3WAA D;  1PZR A;  3MGQ B;  1AOI C;  2BYK A;  2XD1 A;  4WU8 B;  3REK B;  3WAA C;  5AV9 D;  3X1U B;  3X1T A;  3MVD A;  5AV9 C;  3MGS D;  5AY8 B;  4HGA B;  3AZM A;  3W97 D;  1R4V A;  3MGS C;  1EQZ B;  3AYW D;  3LEL D;  2F8N A;  2JCH A;  4WNN B;  3W97 C;  5GT0 B;  4LD9 B;  3LJA B;  3LZ0 D;  3X1S D;  5BNV B;  3LEL C;  4ZUX D;  3A6N B;  3AYW C;  1KU5 A;  5F99 D;  4H9Q A;  1P3O C;  3B0D C;  3LZ0 C;  3AV2 D;  1P3M C;  1M1A A;  4H9O B;  5F99 C;  1U35 B;  4YM6 D;  3AV2 C;  1HQ3 A;  3P5J B;  4YM6 C;  3B6F D;  1F66 A;  4H9P A;  1ID3 D;  5CPI A;  4KGC B;  5B40 D;  1ID3 C;  1P3A B;  1S32 B;  1TAF A;  5B33 B;  5B40 C;  3O62 A;  4G92 C;  2FJ7 A;  5GSU B;  1KX4 D;  4YS3 D;  5B1M B;  5AVC A;  5AV5 C;  5B24 B;  5AV8 A;  1M19 D;  4JJN D;  1P3I C;  5CP6 A;  5B0Y A;  4J8V D;  2DF4 C;  1M19 C;  4JJN C;  2NZD A;  3B6G C;  5B31 B;  3AFA A;  1P3B B;  4NE3 A;  4J8V C;  4NFT A;  5KDM A;  5AV6 B;  3LZ1 A;  3KXB D;  3X1T D;  2ZY5 A;  3H0L C;  3WTP B;  3KXB C;  4EO5 C;  2L5A A;  3AZG D;  3WA9 B;  3NQJ A;  2F8N D;  3X1V B;  3AZG C;  4UPK A;  5GXQ B;  3AL0 C;  5BS7 C;  3AZE B;  2Y2Q A;  5JA4 B;  5JRG C;  3WKJ A;  1B67 A;  3KUY D;  1AOI B;  3WAA B;  1F66 D;  3KUY C;  3C1B C;  5CPI D;  3TU4 A;  5AV9 B;  4H9R B;  4Z2M G;  1F66 C;  3MGR A;  3MGS B;  2ARO C;  3W97 B;  4J8U A;  2FJ7 D;  3AYW B;  3LEL B;  5AVC D;  2BYM A;  1P3O B;  3B0D B;  3LZ0 B;  3REL D;  1P3M B;  1P3L A;  5AVC C;  5F99 B;  2ZM5 A;  3REL C;  3AN2 A;  3AZJ D;  3AFA D;  3B0C T;  4Z5T D;  4YM6 B;  3AZJ C;  3AFA C;  5E5A D;  5GT3 B;  4Z5T C;  3LZ1 D;  5E5A C;  4WZS B;  3AZN D;  3REJ C;  3A1K A;  3AZI A;  1ID3 B;  2Y2M A;  3LZ1 C;  1P3F A;  4QLC C;  3AZN C;  5B40 B;  4R8P A;  4G92 B;  4AWL C;  4J8W B;  5AV5 B;  1P3I B;  3MNN A;  1M19 B;  4JJN B;  1H3O A;  3B6G B;  1P3P A;  4J8V B;  1JFI B;  5B0Z D;  3VH5 W;  4H9N B;  5B0Z C;  1ZLA D;  2HUE C;  2NQB A;  4J8X C;  2BYK B;  1ZLA C;  3UTB A;  2ZY2 A;  5B1L A;  3MGR D;  3KXB B;  3AZK A;  4EO5 B;  2ZY4 A;  1P3K D;  3MGR C;  3AZF A;  1P34 A;  3AZG B;  4XUJ C;  2IO5 C;  5G49 A;  3VH6 W;  1P3K C;  1TZY A;  4ZBJ C;  5CPK A;  2HIO A;  5C3I C;  5B32 C;  3REH A;  3W96 D;  5BNX A;  4CAY B;  3W96 C;  5JRG B;  4X23 A;  4WJ3 C;  1A7W A;  1P3G D;  4NE6 A;  3V9R A;  3C1C A;  2G5H C;  1P3G C;  3KUY B;  3UTA D;  3C1B B;  1F66 B;  3AZI D;  3UTA C;  5B2I A;  1P3F D;  3REI B;  4XZQ D;  3AZI C;  2ARO B;  2CV5 A;  1Z2C B;  1P3F C;  4XZQ C;  1TAF B;  5FUG A;  1N1J A;  3AZL A;  3X1S C;  4ZUX C;  1BH8 A;  3AZH A;  2PYO A;  3EG5 B;  5B31 G;  3MNN D;  1KX3 D;  3REL B;  1M18 A;  3MNN C;  1KX3 C;  3W99 D;  5DNM D;  3AZJ B;  3AFA B;  3EPH A;  3B6F C;  2NQB D;  5DNN A;  4KUD A;  3W99 C;  4Z5T B;  5KDM B;  5DNM C;  5E5A B;  3B0B A;  3R45 A;  3REJ B;  2NQB C;  5B1L D;  3LZ1 B;  2FFF B;  4UUZ A;  4QLC B;  3AZK D;  3AZN B;  5B1L C;  2Y2O A;  2LY8 A;  3KSY A;  3NQJ B;  1KX4 C;  4YS3 C;  5CPK D;  5CPJ A;  3REH D;  4G91 C;  4Z66 A;  5CPK C;  2F8N H;  5AY8 A;  2YFW A;  4X23 D;  4WV4 B;  3H0M C;  1EQZ A;  5B0Z B;  4X23 C;  2HUE B;  3MVD D;  2YFV A;  5GT0 A;  3LJA A;  4J8X B;  4LD9 A;  5BNV A;  3A6N A;  1ZLA B;  3X1T C;  3MVD C;  3AZM D;  5B2I D;  4H9O A;  3AZM C;  3MGR B;  2CV5 D;  4KHA A;  5B2I C;  4XUJ B;  2IO5 B;  1P3K B;  4ZBJ B;  2CV5 C;  3AZL D;  2UWX A;  5C3I B;  5B32 B;  1M1A D;  2VQR A;  3WTP E;  4KGC A;  3AZH D;  5BO0 A;  2PYO D;  1M1A C;  3W96 B;  1HQ3 D;  1S32 A;  1M18 D;  2RVQ D;  1ULY A;  1HQ3 C;  1P3G B;  5GSU A;  3NQU B;  5B24 A;  5CPI C;  3EPK A;  1BH9 B;  3UT9 A;  3UTA B;  3O62 D;  4CSR A;  3AZI B;  5B31 A;  3O62 C;  1P3F B;  4XZQ B;  2FJ7 C;  5AV8 D;  2BG1 A;  3X1S B;  4ZUX B;  5CP6 D;  5B0Y D;  5AV8 C;  5CPJ D;  3AV2 B;  2NZD D;  4Z66 D;  5CP6 C;  5B0Y C;  3WTP A;  5AY8 D;  5CHL B;  5CPJ C;  2NZD C;  3MNN B;  2Y2J A;  1KX3 B;  4Z66 C;  3WA9 A;  3B6F B;  2Y2H A;  3W99 B;  5DNM B;  2JSS A;  2Y2G A;  2NQB B;  3AZE A;  5JA4 A;  1WWS A;  5B1L B;  4DRA A;  1KX4 B;  4YS3 B;  3WAA A;  4G91 B;  5CPK B;  3MGP A;  3WKJ D;  3MGS A;  3WKJ C;  3W98 A;  4X23 B;  3W97 A;  3TU4 D;  3LEL A;  3X1T B;  2Y2L A;  3MVD B;  1P3O A;  3TU4 C;  3LZ0 A;  1P3M A;  3UT9 D;  5F99 A;  2XD5 A;  3AZM B;  2CWE A;  5B2J A;  4J8U D;  5B31 D;  5B2I B;  3UT9 C;  2F8N B;  5AVB A;  4J8U C;  5GT3 A;  3EPJ A;  1P3L D;  5FUG B;  1N1J B;  4H9Q B;  5BT1 D;  3AN2 D;  1P3L C;  3WTP D;  1M1A B;  4E45 A;  3AV1 A;  3AN2 C;  5B40 A;  2G5I C;  1HQ3 B;  1KX5 A;  4J8W A;  4H9P B;  5AV5 A;  1HTA A;  5CPI B;  1P3I A;  4WU9 A;  4R8P D;  4JJN A;  3B6G A;  4R8P C;  3O62 B;  4J8V A;  1JFI A;  2FJ7 B;  2Y2P A;  5AVC B;  5AV8 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...