4EO5B

Yeast asf1 bound to h3/h4g94p mutant
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
76
structure length
76
Chain Sequence
b'ALIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone chaperone ASF1
publication title The conformational flexibility of the C-terminus of histone H4 promotes histone octamer and nucleosome stability and yeast viability.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Structural protein/chaperone
total genus 25
structure length 76
sequence length 76
ec nomenclature
pdb deposition date 2012-04-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4eo5B00
3RELC 4YM6D 5AVBB 3UT9A 3B6GC 3R45B 3TU4D 3C1CA 3C1BB 3UTBB 1M18A 3AZHD 4J8VD 2FJ7D 5B33C 4YM6A 5B2JB 3TU4A 3AYWB 5CPJD 5B31B 3REKB 4KUDC 4NFTA 5CPIC 3W98B 4CAYB 4J8VA 2FJ7A 5AVBD 3AZMA 3A6NC 2CWEA 5CPJA 5E5AB 4M6BA 1P3AB 4AWLB 3C1BD 3UTBD 3W99C 5BO0B 5GT0B 1B6WA 4E45A 5B2JD 5AVBA 4KGCC 4H9SC 5CPKB 3AZLD 3VH6W 4XUJB 3MGQC 3R45A 3AYWD 4UUZB 5B32G 4R8PB 5DNMC 2BYKB 1HQ3C 3LZ0C 3MNNB 3C1BA 3UTBA 3REJC 4WU9B 4J8XC 4KHAB 4HGAC 5B2JA 5BNVB 3B0CW 3VH6A 5G49B 1P3IB 3AYWA 3B0DC 5BT1C 5E5AD 1P3AD 5B31A 3REKA 1P3BC 5GT0D 3W98A 5JRGB 5CPKD 1JFIB 4XUJD 3X1SB 3RELB 5E5AA 1P3AA 3UT9C 4ZUXC 3UTAB 3MNND 3B6GB 5BO0A 5GT0A 3REIB 4WU9D 4WZSB 1P3PC 1M19B 5CPKA 4XUJA 1P3ID 4UUZA 4R8PA 2BYKA 3MNNA 4WU9A 1P3MD 5JRGD 5BNVA 3AZHC 5CPIB 5G49A 1P3IA 2FJ7C 5B1MB 3RELD 3UTAD 1KX4B 3KWQC 5CPJC 3REID 3A6NB 5AV6C 5JRGA 1M19D 1JFIA 4WNNA 3W99B 3X1SA 1TAFB 5AVBC 3RELA 2F8NB 3UTAA 3MGQB 3REIA 5DNMB 3LZ0B 3UTBC 4WV4B 1M19A 2YFWB 3REJB 1WWSA 5B1MD 2HUEC 4J8XB 3AZFB 4HGAB 1P3FD 3AZLC 1KX4D 5B1LB 3A6ND 2NZDD 1ZLAD 1P3BB 3W99D 5CPIA 5B1MA 4LD9C 1AOID 3VH6T 1KX4A 3A6NA 5E5AC 3REHD 2LY8A 2BYMB 5DNMD 4ZUXB 5GT0C 3W99A 5FUGB 1TAFA 5B24B 3REJD 3AZFD 4J8XD 5GXQC 1P3PB 2F8NA 3B0CT 3MGQA 5B1LD 5BT1D 5DNMA 3B6FC 2RVQC 1P3BD 4YS3B 1F1EA 2YFWA 3REJA 3AZFA 4J8XA 3MGRD 5B1LA 3AZHB 5KDMA 4E44A 2CV5B 3AV2B 3WKJB 1P3BA 4H9PB 4H9RB 3KWQB 5B24D 1P3MC 5AV6B 5AVCB 3MGRA 3AZKC 3LJAC 3MGPB 3UTAC 2BYMA 4ZUXA 3REIC 4YS3D 5FUGA 5B24A 1M1AC 1P3PA 1M19C 2JSSA 2HUEB 2CV5D 3KUYD 3AZLB 3AV2D 3WKJD 1Q9CA 2L5AA 4YS3A 3KWQD 5AV6D 3WA9B 5AVCD 3W97C 5B1MC 3AZHA 1P3LD 1P3OD 3MGPD 1P3FC 2CV5A 4LD9B 3AV2A 3VH5A 3AV1C 1KX4C 3WKJA 5B2IC 4H9PA 4H9RA 3KWQA 2NZDC 5AV6A 5B40D 1ZLAC 5AVCA 1U35D 1P3LA 3MGPA 1AOIC 5GXQB 5CP6D 1A7WA 3REHC 5B40A 3WA9D 3B6FB 3AZFC 5B31G 4WU8C 4LD9D 1KU5A 5CP6A 5B0YC 4NE6A 3AZLA 5B1LC 3AZND 3WA9A 1P3GB 1P3MB 4LD9A 5GXQD 4WNNB 3MGRC 1N1JA 3AZKB 3AZNA 5B32D 3LJAB 1TZYC 4H9OB 3B6FD 3AZJB 2RVQD 1KX3C 5B24C 1M1AB 5GXQA 3AZGD 3W96D 3KSYA 1ID3C 1BH9B 4X23D 1P3GD 3B6FA 4YS3C 1H3OB 3X1VC 2PYOB 4G92C 3AZGA 3W97B 5GSUB 3AZKD 3WTPE 3NQUB 3LJAD 3KUYC 4J8WB 3AV2C 2CV5C 1P3FB 1P3GA 3WKJC 3AV1B 4H9NB 3AZJD 5B2IB 2NZDB 3KXBB 1P3MA 1B67A 1M1AD 5AVCC 1ZLAB 1BFMA 3AZID 1P3LC 1P3OC 3AZKA 3MGPC 3X1UB 3LJAA 1AOIB 4H9OA 3AZJA 3MGSB 3REHB 2PYOD 5B40C 5F99C 1M1AA 1U35C 3W97D 5GSUD 5BS7C 1BH9A 5CP6C 4WU8B 4J8WD 5B0YB 3LZ1B 3AV1D 1H3OA 5B2ID 2PYOA 5KDMB 3KXBD 3WA9C 4QLCB 1BH8B 3W97A 5GSUA 5BNXB 3X1UD 3NQUA 4J8WA 1P3FA 4JJNC 5AV9D 3MGRB 4H9NA 3AZNC 3AV1A 5B2IA 3MGSD 2F8NG 1ULYA 2NZDA 3KXBA 5DNNC 1TZYB 1ZLAA 1KX3B 1P34D 3X1UA 1AOIA 5AY8B 4Z2MG 4WU8D 2F8NK 5C3IC 5B0YD 5AV9A 3LZ1D 5B32C 1ID3B 3MGSA 4EO5C 3REHA 4Z66D 4QLCD 3AN2C 4J8UB 4Z5TD 2AROD 3X1VB 1P34A 3AZGC 4WU8A 3W96C 4G92B 1EQZB 5B0YA 3NQJB 3LZ1A 4X23C 4Z66A 1P3GC 4QLCA 3KUYB 1S32D 1TZYD 5JA4B 1BH8A 1KX3D 5BNXA 5AY8D 4CSRB 1P3LB 2NQBD 1P3OB 1ID3D 4DRAA 5AV8D 3WAAB 1TZYA 4J8UD 3AZJC 1KX3A 3X1VD 4G91C 5B40B 2HIOB 5F99B 5AY8A 3AZIC 3X1TD 1U35B 1EQZD 1ID3A 5CP6B 3VH5W 4J8UA 5GT3C 3AZEB 2PYOC 3X1VA 1KX5B 1EQZA 3X1TA 3AFAB 5GSUC 3NQJA 4XZQC 3C1CD 5AV5B 4J8WC 3KUYA 1M18D 3WAAD 4JJNB 5JA4A 1N1JB 3AZNB 3KXBC 3LELC 2HIOD 5F99D 5DNNB 4CSRA 1P3OA 3X1UC 5CHLB 5AV9C 3WAAA 5C3IB 3MGSC 5B32B 3AZED 3AZMD 4EO5B 2HIOA 5F99A 3AN2B 4ZBJC 1KX5D 3WTPB 3AFAD 1U35A 1P34C 5BS7A 5AV5D 3AZGB 3W96B 3LZ1C 4JJND 3AZEA 4Z66C 4QLCC 4X23B 3MVDB 5DNND 1KX5A 4Z5TC 3AFAA 2AROC 5AV5A 4JJNA 1S32C 5DNNA 3AN2D 3WTPD 1WWIA 5B31D 3REKD 4G91B 5AY8C 3W98D 3AZIB 2NQBC 5B32A 2IO5B 5AV8C 3O62C 3MVDD 4J8UC 3AN2A 1P3KB 1F66B 3WTPA 5GT3B 5B0ZB 2YFVB 1EQZC 3X1TC 3W96A 4CAYA 4XZQB 4X23A 3MVDA 4R8PD 3LELB 3C1CC 1M18C 3WAAC 3VH5T 4DRBA 5AV9B 4YM6C 1P3KD 1F66D 5B33B 3V9RB 5GT3D 2HIOC 5B0ZD 3TU4C 4ZBJB 3AZIA 4KHAA 1P34B 4XZQD 4KUDB 3X1SD 4J8VC 1P3KA 1F66A 3AZEC 3AZMC 5GT3A 4Z66B 5B0ZA 2YFVA 1KX5C 3B6GD 3LELD 3AFAC 4Z5TB 2AROB 5AV5C 4XZQA 5B33D 4KGCB 3B6GA 1S32B 3LELA 4NE3A 3B0BA 3C1BC 1HQ3B 4KUDD 5CPID 5B2JC 2NQBB 5B33A 3V9RA 5AV8B 3O62B 3AYWC 1R4VA 3B0DB 3WTPC 5B31C 3REKC 2F8NH 4KUDA 3W98C 3X1TB 2F8ND 4H9QB 4KGCD 1HTAA 3MVDC 3MGQD 4Z2MH 4Z5TA 1P3AC 2AROA 4AWLC 3UT9B 3LZ0D 1HQ3D 3C1CB 5CPKC 4XUJC 4NE5A 4H9SA 4KGCA 3O62D 1M18B 1S32A 4R8PC 4YM6B 3MNNC 3LZ0A 1HQ3A 3TU4B 4WU9C 2NQBA 2IO5C 1P3IC 5AV8A 3O62A 1P3KC 4J8VB 1F66C 2FJ7B 3AZMB 5B0ZC 4ZUXD 3UT9D 5CPJB 5JRGC 1P3PD 4H9QA 3X1SC
chains in the Genus database with same CATH superfamily
3RELC 1Z2CB 4YM6D 5AVBB 2J8PA 3UT9A 3EG5B 3B6GC 3R45B 3TU4D 3C1CA 3C1BB 3UTBB 1M18A 3AZHD 4J8VD 2FJ7D 5B33C 4YM6A 5B2JB 2Y2OA 3TU4A 3AYWB 5CPJD 5B31B 3REKB 4KUDC 4NFTA 5CPIC 3W98B 4CAYB 4J8VA 2FJ7A 5AVBD 3AZMA 3A6NC 2CWEA 5CPJA 2JE5A 4M6BA 5E5AB 1P3AB 4WJ3C 4AWLB 3C1BD 3UTBD 3W99C 5BO0B 5GT0B 2Y2IA 1B6WA 4E45A 2G5IC 5B2JD 5AVBA 4KGCC 4H9SC 5CPKB 3AZLD 3VH6W 4XUJB 3MGQC 3R45A 3AYWD 4UUZB 3H0MC 5B32G 4R8PB 5DNMC 2BYKB 1HQ3C 3LZ0C 3MNNB 3C1BA 3UTBA 3F6TA 3AL0C 3REJC 4WU9B 4J8XC 4KHAB 4DQYB 4HGAC 5B2JA 5BNVB 3B0CW 2VQRA 3VH6A 5G49B 1P3IB 3AYWA 3B0DC 5BT1C 2Y2HA 5E5AD 1P3AD 5B31A 3REKA 1P3BC 5GT0D 3W98A 5JRGB 2Y2QA 5CPKD 1JFIB 4XUJD 3X1SB 3RELB 5E5AA 1P3AA 3UT9C 4ZUXC 3UTAB 3MNND 3B6GB 5BO0A 5GT0A 3REIB 4WU9D 4WZSB 2F2AC 1P3PC 1M19B 5CPKA 4XUJA 1P3ID 4UUZA 4R8PA 2UWXA 2BYKA 3MNNA 4WU9A 1P3MD 5JRGD 5BNVA 3AZHC 5CPIB 5G49A 1P3IA 2FJ7C 5B1MB 3RELD 3UTAD 1KX4B 3KWQC 5CPJC 3REID 3A6NB 5AV6C 5JRGA 1M19D 1JFIA 4WNNA 3W99B 3X1SA 1TAFB 2ZY3A 5AVBC 3RELA 2F8NB 3UTAA 3MGQB 1W2EA 3REIA 5DNMB 3LZ0B 3UTBC 4WV4B 1M19A 3KFUG 2YFWB 3REJB 1WWSA 5B1MD 2HUEC 4J8XB 3AZFB 4HGAB 1P3FD 3AZLC 1KX4D 5B1LB 3A6ND 2NZDD 1ZLAD 1P3BB 3W99D 5CPIA 5B1MA 4LD9C 1AOID 3VH6T 1KX4A 3A6NA 5E5AC 3REHD 2LY8A 2BYMB 5DNMD 4ZUXB 5GT0C 3W99A 5FUGB 1TAFA 5B24B 3REJD 3AZFD 4J8XD 5GXQC 1P3PB 2F8NA 3B0CT 3MGQA 5B1LD 5BT1D 5DNMA 3B6FC 2RVQC 1P3BD 4YS3B 1F1EA 2YFWA 3REJA 3AZFA 4J8XA 3MGRD 5B1LA 3AZHB 5KDMA 4E44A 2CV5B 3AV2B 3WKJB 1P3BA 4H9PB 4H9RB 3KWQB 3EPKA 5B24D 1P3MC 5AV6B 5AVCB 3MGRA 3AZKC 3LJAC 3MGPB 3UTAC 2BYMA 4ZUXA 3REIC 4YS3D 5FUGA 5B24A 1M1AC 1P3PA 1M19C 2JSSA 2HUEB 2CV5D 3KUYD 3AZLB 3AV2D 3WKJD 1Q9CA 2L5AA 4YS3A 3KWQD 5AV6D 3WA9B 5AVCD 3W97C 5B1MC 3AZHA 1P3LD 1P3OD 3MGPD 1P3FC 2CV5A 4LD9B 3AV2A 3VH5A 3AV1C 1KX4C 3WKJA 5B2IC 4H9PA 4H9RA 3KWQA 2NZDC 5AV6A 5B40D 1ZLAC 5AVCA 1U35D 1P3LA 3MGPA 1AOIC 5GXQB 5CP6D 1A7WA 3REHC 5B40A 3WA9D 3B6FB 3AZFC 5B31G 4WU8C 4LD9D 1KU5A 5CP6A 5B0YC 4NE6A 3AZLA 5B1LC 3AZND 3WA9A 1P3GB 2BG1A 1P3MB 4LD9A 5GXQD 4WNNB 3MGRC 1N1JA 3AZKB 3AZNA 5B32D 3LJAB 1TZYC 4H9OB 3B6FD 3AZJB 2RVQD 1KX3C 5B24C 1M1AB 5GXQA 3AZGD 3W96D 3KSYA 1ID3C 1BH9B 3H0RC 4X23D 1P3GD 3B6FA 4YS3C 1H3OB 3X1VC 2PYOB 4G92C 3AZGA 3W97B 5GSUB 3AZKD 4UPKA 3WTPE 3NQUB 3LJAD 3KUYC 4J8WB 3AV2C 2Y2PA 2CV5C 1P3FB 1P3GA 3WKJC 3AV1B 4H9NB 3AZJD 5B2IB 2NZDB 3KXBB 1P3MA 1B67A 2Y2MA 1T3UA 5AVCC 1M1AD 1ZLAB 2JCHA 1BFMA 3AZID 1P3LC 1P3OC 3AZKA 3MGPC 3X1UB 3LJAA 1AOIB 4H9OA 2RIQA 3AZJA 3MGSB 3REHB 2PYOD 5B40C 5F99C 1M1AA 1U35C 3W97D 5GSUD 5BS7C 1BH9A 5CP6C 4WU8B 2ZM5A 4J8WD 5B0YB 3LZ1B 3AV1D 1H3OA 5B2ID 2PYOA 3EPHA 5KDMB 3KXBD 3WA9C 4QLCB 2XD5A 1BH8B 2G5HC 3W97A 5GSUA 2FFFB 5BNXB 3X1UD 3NQUA 4J8WA 1P3FA 4JJNC 5AV9D 3MGRB 4H9NA 3AZNC 3AV1A 5B2IA 3IP4C 3MGSD 1ULYA 2F8NG 2NZDA 3KXBA 5DNNC 1TZYB 1ZLAA 1KX3B 1P34D 3X1UA 1AOIA 5AY8B 4Z2MG 4WU8D 2F8NK 5C3IC 5B0YD 5AV9A 3LZ1D 5B32C 1ID3B 3MGSA 4EO5C 3REHA 3A1IA 4Z66D 4QLCD 3AN2C 4J8UB 4Z5TD 2DQNC 2AROD 3X1VB 1P34A 3EPLA 3AZGC 4WU8A 3W96C 4G92B 1EQZB 2DF4C 5B0YA 3NQJB 3LZ1A 4X23C 4Z66A 1P3GC 4QLCA 3KUYB 1S32D 1TZYD 2XD1A 5JA4B 1BH8A 1KX3D 5BNXA 5AY8D 4CSRB 2ZY2A 1P3LB 2NQBD 1P3OB 1ID3D 2Y2LA 4DRAA 5AV8D 3WAAB 1TZYA 4J8UD 3AZJC 1KX3A 3X1VD 1PZRA 4G91C 5B40B 2HIOB 5F99B 5AY8A 3AZIC 3X1TD 1U35B 1EQZD 1ID3A 5CP6B 3A1KA 3VH5W 4J8UA 5GT3C 3AZEB 2PYOC 3X1VA 1KX5B 1EQZA 3X1TA 3AFAB 5GSUC 3NQJA 2Y2KA 4XZQC 5AV5B 3C1CD 4J8WC 3KUYA 1M18D 3WAAD 4JJNB 5JA4A 1N1JB 3AZNB 3KXBC 3LELC 2HIOD 5F99D 5DNNB 4CSRA 1P3OA 3X1UC 5CHLB 5AV9C 3WAAA 5C3IB 3MGSC 5B32B 3AZED 3AZMD 4EO5B 2HIOA 5F99A 3AN2B 4ZBJC 2W8SA 1KX5D 3WTPB 3AFAD 1U35A 1P34C 5BS7A 5AV5D 3AZGB 3W96B 3LZ1C 4JJND 3AZEA 4Z66C 4QLCC 4X23B 3MVDB 5DNND 1KX5A 4Z5TC 3AFAA 2AROC 5AV5A 4JJNA 1S32C 5DNNA 3AN2D 3WTPD 1WWIA 5B31D 3REKD 4G91B 5AY8C 3W98D 3AZIB 2Y2GA 2NQBC 5B32A 2IO5B 5AV8C 3O62C 3MVDD 4J8UC 3AN2A 1P3KB 1F66B 3WTPA 5GT3B 5B0ZB 2YFVB 1EQZC 3X1TC 2Y2JA 3W96A 4CAYA 4XZQB 4X23A 3MVDA 4R8PD 3LELB 3C1CC 1M18C 3WAAC 3VH5T 4DRBA 2ZY5A 5AV9B 4YM6C 1P3KD 1F66D 5B33B 3V9RB 5GT3D 2HIOC 5B0ZD 3TU4C 4ZBJB 3AZIA 4KHAA 1P34B 4XZQD 4KUDB 3X1SD 4J8VC 1P3KA 1F66A 3AZEC 3AZMC 5GT3A 4Z66B 5B0ZA 2YFVA 1KX5C 3B6GD 3LELD 3AFAC 4Z5TB 2AROB 5AV5C 4XZQA 3P5JB 5B33D 4KGCB 3B6GA 1S32B 3LELA 4NE3A 3B0BA 3C1BC 1HQ3B 4KUDD 5CPID 5B2JC 2NQBB 5B33A 3V9RA 5AV8B 3O62B 3AYWC 1R4VA 3B0DB 3WTPC 5B31C 3REKC 2ZY4A 2F8NH 2Y2NA 4KUDA 3FDDA 3W98C 3X1TB 2F8ND 4H9QB 4KGCD 1HTAA 3MVDC 3MGQD 4Z2MH 4Z5TA 1P3AC 2AROA 4AWLC 3UT9B 3LZ0D 1HQ3D 3C1CB 5CPKC 4XUJC 4NE5A 4H9SA 4KGCA 3O62D 1M18B 1S32A 4R8PC 4YM6B 3MNNC 3LZ0A 1HQ3A 3EPJA 3TU4B 4WU9C 2NQBA 2IO5C 1P3IC 5AV8A 3O62A 1P3KC 4J8VB 1F66C 2FJ7B 3AZMB 5B0ZC 4ZUXD 3UT9D 5CPJB 5JRGC 3H0LC 1P3PD 4H9QA 3X1SC
chains in the Genus database with same CATH topology
3RELC 1Z2CB 4YM6D 5AVBB 2J8PA 3UT9A 3EG5B 3B6GC 3R45B 3TU4D 3C1CA 3C1BB 3UTBB 1M18A 3AZHD 4J8VD 2FJ7D 5B33C 4YM6A 5B2JB 2Y2OA 3TU4A 3AYWB 5CPJD 5B31B 3REKB 4KUDC 4NFTA 5CPIC 3W98B 4CAYB 4J8VA 2FJ7A 5AVBD 3AZMA 3A6NC 2CWEA 5CPJA 2JE5A 4M6BA 5E5AB 1P3AB 4WJ3C 4AWLB 3C1BD 3UTBD 3W99C 5BO0B 5GT0B 2Y2IA 1B6WA 4E45A 2G5IC 5B2JD 5AVBA 4KGCC 4H9SC 5CPKB 3AZLD 3VH6W 4XUJB 3MGQC 3R45A 3AYWD 4UUZB 3H0MC 5B32G 4R8PB 5DNMC 2BYKB 1HQ3C 3LZ0C 3MNNB 3C1BA 3UTBA 3F6TA 3AL0C 3REJC 4WU9B 4J8XC 4KHAB 4DQYB 4HGAC 5B2JA 5BNVB 3B0CW 2VQRA 3VH6A 5G49B 1P3IB 3AYWA 3B0DC 5BT1C 2Y2HA 5E5AD 1P3AD 5B31A 3REKA 1P3BC 5GT0D 3W98A 5JRGB 2Y2QA 5CPKD 1JFIB 4XUJD 3X1SB 3RELB 5E5AA 1P3AA 3UT9C 4ZUXC 3UTAB 3MNND 3B6GB 5BO0A 5GT0A 3REIB 4WU9D 4WZSB 2F2AC 1P3PC 1M19B 5CPKA 4XUJA 1P3ID 4UUZA 4R8PA 2UWXA 2BYKA 3MNNA 4WU9A 1P3MD 5JRGD 5BNVA 3AZHC 5CPIB 5G49A 1P3IA 2FJ7C 5B1MB 3RELD 3UTAD 1KX4B 3KWQC 5CPJC 3REID 3A6NB 5AV6C 5JRGA 1M19D 1JFIA 4WNNA 3W99B 3X1SA 1TAFB 2ZY3A 5AVBC 3RELA 2F8NB 3UTAA 3MGQB 1W2EA 3REIA 5DNMB 3LZ0B 3UTBC 4WV4B 1M19A 3KFUG 2YFWB 3REJB 1WWSA 5B1MD 2HUEC 4J8XB 3AZFB 4HGAB 1P3FD 3AZLC 1KX4D 5B1LB 3A6ND 2NZDD 1ZLAD 1P3BB 3W99D 5CPIA 5B1MA 4LD9C 1AOID 3VH6T 1KX4A 3A6NA 5E5AC 3REHD 2LY8A 2BYMB 5DNMD 4ZUXB 5GT0C 3W99A 5FUGB 1TAFA 5B24B 3REJD 3AZFD 4J8XD 5GXQC 1P3PB 2F8NA 3B0CT 3MGQA 5B1LD 5BT1D 5DNMA 3B6FC 2RVQC 1P3BD 4YS3B 1F1EA 2YFWA 3REJA 3AZFA 4J8XA 3MGRD 5B1LA 3AZHB 5KDMA 4E44A 2CV5B 3AV2B 3WKJB 1P3BA 4H9PB 4H9RB 3KWQB 3EPKA 5B24D 1P3MC 5AV6B 5AVCB 3MGRA 3AZKC 3LJAC 3MGPB 3UTAC 2BYMA 4ZUXA 3REIC 4YS3D 5FUGA 5B24A 1M1AC 1P3PA 1M19C 2JSSA 2HUEB 2CV5D 3KUYD 3AZLB 3AV2D 3WKJD 1Q9CA 2L5AA 4YS3A 3KWQD 5AV6D 3WA9B 5AVCD 3W97C 5B1MC 3AZHA 1P3LD 1P3OD 3MGPD 1P3FC 2CV5A 4LD9B 3AV2A 3VH5A 3AV1C 1KX4C 3WKJA 5B2IC 4H9PA 4H9RA 3KWQA 2NZDC 5AV6A 5B40D 1ZLAC 5AVCA 1U35D 1P3LA 3MGPA 1AOIC 5GXQB 5CP6D 1A7WA 3REHC 5B40A 3WA9D 3B6FB 3AZFC 5B31G 4WU8C 4LD9D 1KU5A 5CP6A 5B0YC 4NE6A 3AZLA 5B1LC 3AZND 3WA9A 1P3GB 2BG1A 1P3MB 4LD9A 5GXQD 4WNNB 3MGRC 1N1JA 3AZKB 3AZNA 5B32D 3LJAB 1TZYC 4H9OB 3B6FD 3AZJB 2RVQD 1KX3C 5B24C 1M1AB 5GXQA 3AZGD 3W96D 3KSYA 1ID3C 1BH9B 3H0RC 4X23D 1P3GD 3B6FA 4YS3C 1H3OB 3X1VC 2PYOB 4G92C 3AZGA 3W97B 5GSUB 3AZKD 4UPKA 3WTPE 3NQUB 3LJAD 3KUYC 4J8WB 3AV2C 2Y2PA 2CV5C 1P3FB 1P3GA 3WKJC 3AV1B 4H9NB 3AZJD 5B2IB 2NZDB 3KXBB 1P3MA 1B67A 2Y2MA 1T3UA 5AVCC 1M1AD 1ZLAB 2JCHA 1BFMA 3AZID 1P3LC 1P3OC 3AZKA 3MGPC 3X1UB 3LJAA 1AOIB 4H9OA 2RIQA 3AZJA 3MGSB 3REHB 2PYOD 5B40C 5F99C 1M1AA 1U35C 3W97D 5GSUD 5BS7C 1BH9A 5CP6C 4WU8B 2ZM5A 4J8WD 5B0YB 3LZ1B 3AV1D 1H3OA 5B2ID 2PYOA 3EPHA 5KDMB 3KXBD 3WA9C 4QLCB 2XD5A 1BH8B 2G5HC 3W97A 5GSUA 2FFFB 5BNXB 3X1UD 3NQUA 4J8WA 1P3FA 4JJNC 5AV9D 3MGRB 4H9NA 3AZNC 3AV1A 5B2IA 3IP4C 3MGSD 1ULYA 2F8NG 2NZDA 3KXBA 5DNNC 1TZYB 1ZLAA 1KX3B 1P34D 3X1UA 1AOIA 5AY8B 4Z2MG 4WU8D 2F8NK 5C3IC 5B0YD 5AV9A 3LZ1D 5B32C 1ID3B 3MGSA 4EO5C 3REHA 3A1IA 4Z66D 4QLCD 3AN2C 4J8UB 4Z5TD 2DQNC 2AROD 3X1VB 1P34A 3EPLA 3AZGC 4WU8A 3W96C 4G92B 1EQZB 2DF4C 5B0YA 3NQJB 3LZ1A 4X23C 4Z66A 1P3GC 4QLCA 3KUYB 1S32D 1TZYD 2XD1A 5JA4B 1BH8A 1KX3D 5BNXA 5AY8D 4CSRB 2ZY2A 1P3LB 2NQBD 1P3OB 1ID3D 2Y2LA 4DRAA 5AV8D 3WAAB 1TZYA 4J8UD 3AZJC 1KX3A 3X1VD 1PZRA 4G91C 5B40B 2HIOB 5F99B 5AY8A 3AZIC 3X1TD 1U35B 1EQZD 1ID3A 5CP6B 3A1KA 3VH5W 4J8UA 5GT3C 3AZEB 2PYOC 3X1VA 1KX5B 1EQZA 3X1TA 3AFAB 5GSUC 3NQJA 2Y2KA 4XZQC 5AV5B 3C1CD 4J8WC 3KUYA 1M18D 3WAAD 4JJNB 5JA4A 1N1JB 3AZNB 3KXBC 3LELC 2HIOD 5F99D 5DNNB 4CSRA 1P3OA 3X1UC 5CHLB 5AV9C 3WAAA 5C3IB 3MGSC 5B32B 3AZED 3AZMD 4EO5B 2HIOA 5F99A 3AN2B 4ZBJC 2W8SA 1KX5D 3WTPB 3AFAD 1U35A 1P34C 5BS7A 5AV5D 3AZGB 3W96B 3LZ1C 4JJND 3AZEA 4Z66C 4QLCC 4X23B 3MVDB 5DNND 1KX5A 4Z5TC 3AFAA 2AROC 5AV5A 4JJNA 1S32C 5DNNA 3AN2D 3WTPD 1WWIA 5B31D 3REKD 4G91B 5AY8C 3W98D 3AZIB 2Y2GA 2NQBC 5B32A 2IO5B 5AV8C 3O62C 3MVDD 4J8UC 3AN2A 1P3KB 1F66B 3WTPA 5GT3B 5B0ZB 2YFVB 1EQZC 3X1TC 2Y2JA 3W96A 4CAYA 4XZQB 4X23A 3MVDA 4R8PD 3LELB 3C1CC 1M18C 3WAAC 3VH5T 4DRBA 2ZY5A 5AV9B 4YM6C 1P3KD 1F66D 5B33B 3V9RB 5GT3D 2HIOC 5B0ZD 3TU4C 4ZBJB 3AZIA 4KHAA 1P34B 4XZQD 4KUDB 3X1SD 4J8VC 1P3KA 1F66A 3AZEC 3AZMC 5GT3A 4Z66B 5B0ZA 2YFVA 1KX5C 3B6GD 3LELD 3AFAC 4Z5TB 2AROB 5AV5C 4XZQA 3P5JB 5B33D 4KGCB 3B6GA 1S32B 3LELA 4NE3A 3B0BA 3C1BC 1HQ3B 4KUDD 5CPID 5B2JC 2NQBB 5B33A 3V9RA 5AV8B 3O62B 3AYWC 1R4VA 3B0DB 3WTPC 5B31C 3REKC 2ZY4A 2F8NH 2Y2NA 4KUDA 3FDDA 3W98C 3X1TB 2F8ND 4H9QB 4KGCD 1HTAA 3MVDC 3MGQD 4Z2MH 4Z5TA 1P3AC 2AROA 4AWLC 3UT9B 3LZ0D 1HQ3D 3C1CB 5CPKC 4XUJC 4NE5A 4H9SA 4KGCA 3O62D 1M18B 1S32A 4R8PC 4YM6B 3MNNC 3LZ0A 1HQ3A 3EPJA 3TU4B 4WU9C 2NQBA 2IO5C 1P3IC 5AV8A 3O62A 1P3KC 4J8VB 1F66C 2FJ7B 3AZMB 5B0ZC 4ZUXD 3UT9D 5CPJB 5JRGC 3H0LC 1P3PD 4H9QA 3X1SC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3REL C;  4YM6 D;  5AVB B;  3UT9 A;  3B6G C;  3R45 B;  3TU4 D;  3C1C A;  3C1B B;  3UTB B;  1M18 A;  3AZH D;  4J8V D;  2FJ7 D;  5B33 C;  4YM6 A;  5B2J B;  3TU4 A;  3AYW B;  5CPJ D;  5B31 B;  3REK B;  4KUD C;  4NFT A;  5CPI C;  3W98 B;  4CAY B;  4J8V A;  2FJ7 A;  5AVB D;  3AZM A;  3A6N C;  2CWE A;  5CPJ A;  5E5A B;  4M6B A;  1P3A B;  4AWL B;  3C1B D;  3UTB D;  3W99 C;  5BO0 B;  5GT0 B;  1B6W A;  4E45 A;  5B2J D;  5AVB A;  4KGC C;  4H9S C;  5CPK B;  3AZL D;  3VH6 W;  4XUJ B;  3MGQ C;  3R45 A;  3AYW D;  4UUZ B;  5B32 G;  4R8P B;  5DNM C;  2BYK B;  1HQ3 C;  3LZ0 C;  3MNN B;  3C1B A;  3UTB A;  3REJ C;  4WU9 B;  4J8X C;  4KHA B;  4HGA C;  5B2J A;  5BNV B;  3B0C W;  3VH6 A;  5G49 B;  1P3I B;  3AYW A;  3B0D C;  5BT1 C;  5E5A D;  1P3A D;  5B31 A;  3REK A;  1P3B C;  5GT0 D;  3W98 A;  5JRG B;  5CPK D;  1JFI B;  4XUJ D;  3X1S B;  3REL B;  5E5A A;  1P3A A;  3UT9 C;  4ZUX C;  3UTA B;  3MNN D;  3B6G B;  5BO0 A;  5GT0 A;  3REI B;  4WU9 D;  4WZS B;  1P3P C;  1M19 B;  5CPK A;  4XUJ A;  1P3I D;  4UUZ A;  4R8P A;  2BYK A;  3MNN A;  4WU9 A;  1P3M D;  5JRG D;  5BNV A;  3AZH C;  5CPI B;  5G49 A;  1P3I A;  2FJ7 C;  5B1M B;  3REL D;  3UTA D;  1KX4 B;  3KWQ C;  5CPJ C;  3REI D;  3A6N B;  5AV6 C;  5JRG A;  1M19 D;  1JFI A;  4WNN A;  3W99 B;  3X1S A;  1TAF B;  5AVB C;  3REL A;  2F8N B;  3UTA A;  3MGQ B;  3REI A;  5DNM B;  3LZ0 B;  3UTB C;  4WV4 B;  1M19 A;  2YFW B;  3REJ B;  1WWS A;  5B1M D;  2HUE C;  4J8X B;  3AZF B;  4HGA B;  1P3F D;  3AZL C;  1KX4 D;  5B1L B;  3A6N D;  2NZD D;  1ZLA D;  1P3B B;  3W99 D;  5CPI A;  5B1M A;  4LD9 C;  1AOI D;  3VH6 T;  1KX4 A;  3A6N A;  5E5A C;  3REH D;  2LY8 A;  2BYM B;  5DNM D;  4ZUX B;  5GT0 C;  3W99 A;  5FUG B;  1TAF A;  5B24 B;  3REJ D;  3AZF D;  4J8X D;  5GXQ C;  1P3P B;  2F8N A;  3B0C T;  3MGQ A;  5B1L D;  5BT1 D;  5DNM A;  3B6F C;  2RVQ C;  1P3B D;  4YS3 B;  1F1E A;  2YFW A;  3REJ A;  3AZF A;  4J8X A;  3MGR D;  5B1L A;  3AZH B;  5KDM A;  4E44 A;  2CV5 B;  3AV2 B;  3WKJ B;  1P3B A;  4H9P B;  4H9R B;  3KWQ B;  5B24 D;  1P3M C;  5AV6 B;  5AVC B;  3MGR A;  3AZK C;  3LJA C;  3MGP B;  3UTA C;  2BYM A;  4ZUX A;  3REI C;  4YS3 D;  5FUG A;  5B24 A;  1M1A C;  1P3P A;  1M19 C;  2JSS A;  2HUE B;  2CV5 D;  3KUY D;  3AZL B;  3AV2 D;  3WKJ D;  1Q9C A;  2L5A A;  4YS3 A;  3KWQ D;  5AV6 D;  3WA9 B;  5AVC D;  3W97 C;  5B1M C;  3AZH A;  1P3L D;  1P3O D;  3MGP D;  1P3F C;  2CV5 A;  4LD9 B;  3AV2 A;  3VH5 A;  3AV1 C;  1KX4 C;  3WKJ A;  5B2I C;  4H9P A;  4H9R A;  3KWQ A;  2NZD C;  5AV6 A;  5B40 D;  1ZLA C;  5AVC A;  1U35 D;  1P3L A;  3MGP A;  1AOI C;  5GXQ B;  5CP6 D;  1A7W A;  3REH C;  5B40 A;  3WA9 D;  3B6F B;  3AZF C;  5B31 G;  4WU8 C;  4LD9 D;  1KU5 A;  5CP6 A;  5B0Y C;  4NE6 A;  3AZL A;  5B1L C;  3AZN D;  3WA9 A;  1P3G B;  1P3M B;  4LD9 A;  5GXQ D;  4WNN B;  3MGR C;  1N1J A;  3AZK B;  3AZN A;  5B32 D;  3LJA B;  1TZY C;  4H9O B;  3B6F D;  3AZJ B;  2RVQ D;  1KX3 C;  5B24 C;  1M1A B;  5GXQ A;  3AZG D;  3W96 D;  3KSY A;  1ID3 C;  1BH9 B;  4X23 D;  1P3G D;  3B6F A;  4YS3 C;  1H3O B;  3X1V C;  2PYO B;  4G92 C;  3AZG A;  3W97 B;  5GSU B;  3AZK D;  3WTP E;  3NQU B;  3LJA D;  3KUY C;  4J8W B;  3AV2 C;  2CV5 C;  1P3F B;  1P3G A;  3WKJ C;  3AV1 B;  4H9N B;  3AZJ D;  5B2I B;  2NZD B;  3KXB B;  1P3M A;  1B67 A;  1M1A D;  5AVC C;  1ZLA B;  1BFM A;  3AZI D;  1P3L C;  1P3O C;  3AZK A;  3MGP C;  3X1U B;  3LJA A;  1AOI B;  4H9O A;  3AZJ A;  3MGS B;  3REH B;  2PYO D;  5B40 C;  5F99 C;  1M1A A;  1U35 C;  3W97 D;  5GSU D;  5BS7 C;  1BH9 A;  5CP6 C;  4WU8 B;  4J8W D;  5B0Y B;  3LZ1 B;  3AV1 D;  1H3O A;  5B2I D;  2PYO A;  5KDM B;  3KXB D;  3WA9 C;  4QLC B;  1BH8 B;  3W97 A;  5GSU A;  5BNX B;  3X1U D;  3NQU A;  4J8W A;  1P3F A;  4JJN C;  5AV9 D;  3MGR B;  4H9N A;  3AZN C;  3AV1 A;  5B2I A;  3MGS D;  2F8N G;  1ULY A;  2NZD A;  3KXB A;  5DNN C;  1TZY B;  1ZLA A;  1KX3 B;  1P34 D;  3X1U A;  1AOI A;  5AY8 B;  4Z2M G;  4WU8 D;  2F8N K;  5C3I C;  5B0Y D;  5AV9 A;  3LZ1 D;  5B32 C;  1ID3 B;  3MGS A;  4EO5 C;  3REH A;  4Z66 D;  4QLC D;  3AN2 C;  4J8U B;  4Z5T D;  2ARO D;  3X1V B;  1P34 A;  3AZG C;  4WU8 A;  3W96 C;  4G92 B;  1EQZ B;  5B0Y A;  3NQJ B;  3LZ1 A;  4X23 C;  4Z66 A;  1P3G C;  4QLC A;  3KUY B;  1S32 D;  1TZY D;  5JA4 B;  1BH8 A;  1KX3 D;  5BNX A;  5AY8 D;  4CSR B;  1P3L B;  2NQB D;  1P3O B;  1ID3 D;  4DRA A;  5AV8 D;  3WAA B;  1TZY A;  4J8U D;  3AZJ C;  1KX3 A;  3X1V D;  4G91 C;  5B40 B;  2HIO B;  5F99 B;  5AY8 A;  3AZI C;  3X1T D;  1U35 B;  1EQZ D;  1ID3 A;  5CP6 B;  3VH5 W;  4J8U A;  5GT3 C;  3AZE B;  2PYO C;  3X1V A;  1KX5 B;  1EQZ A;  3X1T A;  3AFA B;  5GSU C;  3NQJ A;  4XZQ C;  3C1C D;  5AV5 B;  4J8W C;  3KUY A;  1M18 D;  3WAA D;  4JJN B;  5JA4 A;  1N1J B;  3AZN B;  3KXB C;  3LEL C;  2HIO D;  5F99 D;  5DNN B;  4CSR A;  1P3O A;  3X1U C;  5CHL B;  5AV9 C;  3WAA A;  5C3I B;  3MGS C;  5B32 B;  3AZE D;  3AZM D;  4EO5 B;  2HIO A;  5F99 A;  3AN2 B;  4ZBJ C;  1KX5 D;  3WTP B;  3AFA D;  1U35 A;  1P34 C;  5BS7 A;  5AV5 D;  3AZG B;  3W96 B;  3LZ1 C;  4JJN D;  3AZE A;  4Z66 C;  4QLC C;  4X23 B;  3MVD B;  5DNN D;  1KX5 A;  4Z5T C;  3AFA A;  2ARO C;  5AV5 A;  4JJN A;  1S32 C;  5DNN A;  3AN2 D;  3WTP D;  1WWI A;  5B31 D;  3REK D;  4G91 B;  5AY8 C;  3W98 D;  3AZI B;  2NQB C;  5B32 A;  2IO5 B;  5AV8 C;  3O62 C;  3MVD D;  4J8U C;  3AN2 A;  1P3K B;  1F66 B;  3WTP A;  5GT3 B;  5B0Z B;  2YFV B;  1EQZ C;  3X1T C;  3W96 A;  4CAY A;  4XZQ B;  4X23 A;  3MVD A;  4R8P D;  3LEL B;  3C1C C;  1M18 C;  3WAA C;  3VH5 T;  4DRB A;  5AV9 B;  4YM6 C;  1P3K D;  1F66 D;  5B33 B;  3V9R B;  5GT3 D;  2HIO C;  5B0Z D;  3TU4 C;  4ZBJ B;  3AZI A;  4KHA A;  1P34 B;  4XZQ D;  4KUD B;  3X1S D;  4J8V C;  1P3K A;  1F66 A;  3AZE C;  3AZM C;  5GT3 A;  4Z66 B;  5B0Z A;  2YFV A;  1KX5 C;  3B6G D;  3LEL D;  3AFA C;  4Z5T B;  2ARO B;  5AV5 C;  4XZQ A;  5B33 D;  4KGC B;  3B6G A;  1S32 B;  3LEL A;  4NE3 A;  3B0B A;  3C1B C;  1HQ3 B;  4KUD D;  5CPI D;  5B2J C;  2NQB B;  5B33 A;  3V9R A;  5AV8 B;  3O62 B;  3AYW C;  1R4V A;  3B0D B;  3WTP C;  5B31 C;  3REK C;  2F8N H;  4KUD A;  3W98 C;  3X1T B;  2F8N D;  4H9Q B;  4KGC D;  1HTA A;  3MVD C;  3MGQ D;  4Z2M H;  4Z5T A;  1P3A C;  2ARO A;  4AWL C;  3UT9 B;  3LZ0 D;  1HQ3 D;  3C1C B;  5CPK C;  4XUJ C;  4NE5 A;  4H9S A;  4KGC A;  3O62 D;  1M18 B;  1S32 A;  4R8P C;  4YM6 B;  3MNN C;  3LZ0 A;  1HQ3 A;  3TU4 B;  4WU9 C;  2NQB A;  2IO5 C;  1P3I C;  5AV8 A;  3O62 A;  1P3K C;  4J8V B;  1F66 C;  2FJ7 B;  3AZM B;  5B0Z C;  4ZUX D;  3UT9 D;  5CPJ B;  5JRG C;  1P3P D;  4H9Q A;  3X1S C; 
#chains in the Genus database with same CATH topology
 3REL C;  1Z2C B;  4YM6 D;  5AVB B;  2J8P A;  3UT9 A;  3EG5 B;  3B6G C;  3R45 B;  3TU4 D;  3C1C A;  3C1B B;  3UTB B;  1M18 A;  3AZH D;  4J8V D;  2FJ7 D;  5B33 C;  4YM6 A;  5B2J B;  2Y2O A;  3TU4 A;  3AYW B;  5CPJ D;  5B31 B;  3REK B;  4KUD C;  4NFT A;  5CPI C;  3W98 B;  4CAY B;  4J8V A;  2FJ7 A;  5AVB D;  3AZM A;  3A6N C;  2CWE A;  5CPJ A;  2JE5 A;  4M6B A;  5E5A B;  1P3A B;  4WJ3 C;  4AWL B;  3C1B D;  3UTB D;  3W99 C;  5BO0 B;  5GT0 B;  2Y2I A;  1B6W A;  4E45 A;  2G5I C;  5B2J D;  5AVB A;  4KGC C;  4H9S C;  5CPK B;  3AZL D;  3VH6 W;  4XUJ B;  3MGQ C;  3R45 A;  3AYW D;  4UUZ B;  3H0M C;  5B32 G;  4R8P B;  5DNM C;  2BYK B;  1HQ3 C;  3LZ0 C;  3MNN B;  3C1B A;  3UTB A;  3F6T A;  3AL0 C;  3REJ C;  4WU9 B;  4J8X C;  4KHA B;  4DQY B;  4HGA C;  5B2J A;  5BNV B;  3B0C W;  2VQR A;  3VH6 A;  5G49 B;  1P3I B;  3AYW A;  3B0D C;  5BT1 C;  2Y2H A;  5E5A D;  1P3A D;  5B31 A;  3REK A;  1P3B C;  5GT0 D;  3W98 A;  5JRG B;  2Y2Q A;  5CPK D;  1JFI B;  4XUJ D;  3X1S B;  3REL B;  5E5A A;  1P3A A;  3UT9 C;  4ZUX C;  3UTA B;  3MNN D;  3B6G B;  5BO0 A;  5GT0 A;  3REI B;  4WU9 D;  4WZS B;  2F2A C;  1P3P C;  1M19 B;  5CPK A;  4XUJ A;  1P3I D;  4UUZ A;  4R8P A;  2UWX A;  2BYK A;  3MNN A;  4WU9 A;  1P3M D;  5JRG D;  5BNV A;  3AZH C;  5CPI B;  5G49 A;  1P3I A;  2FJ7 C;  5B1M B;  3REL D;  3UTA D;  1KX4 B;  3KWQ C;  5CPJ C;  3REI D;  3A6N B;  5AV6 C;  5JRG A;  1M19 D;  1JFI A;  4WNN A;  3W99 B;  3X1S A;  1TAF B;  2ZY3 A;  5AVB C;  3REL A;  2F8N B;  3UTA A;  3MGQ B;  1W2E A;  3REI A;  5DNM B;  3LZ0 B;  3UTB C;  4WV4 B;  1M19 A;  3KFU G;  2YFW B;  3REJ B;  1WWS A;  5B1M D;  2HUE C;  4J8X B;  3AZF B;  4HGA B;  1P3F D;  3AZL C;  1KX4 D;  5B1L B;  3A6N D;  2NZD D;  1ZLA D;  1P3B B;  3W99 D;  5CPI A;  5B1M A;  4LD9 C;  1AOI D;  3VH6 T;  1KX4 A;  3A6N A;  5E5A C;  3REH D;  2LY8 A;  2BYM B;  5DNM D;  4ZUX B;  5GT0 C;  3W99 A;  5FUG B;  1TAF A;  5B24 B;  3REJ D;  3AZF D;  4J8X D;  5GXQ C;  1P3P B;  2F8N A;  3B0C T;  3MGQ A;  5B1L D;  5BT1 D;  5DNM A;  3B6F C;  2RVQ C;  1P3B D;  4YS3 B;  1F1E A;  2YFW A;  3REJ A;  3AZF A;  4J8X A;  3MGR D;  5B1L A;  3AZH B;  5KDM A;  4E44 A;  2CV5 B;  3AV2 B;  3WKJ B;  1P3B A;  4H9P B;  4H9R B;  3KWQ B;  3EPK A;  5B24 D;  1P3M C;  5AV6 B;  5AVC B;  3MGR A;  3AZK C;  3LJA C;  3MGP B;  3UTA C;  2BYM A;  4ZUX A;  3REI C;  4YS3 D;  5FUG A;  5B24 A;  1M1A C;  1P3P A;  1M19 C;  2JSS A;  2HUE B;  2CV5 D;  3KUY D;  3AZL B;  3AV2 D;  3WKJ D;  1Q9C A;  2L5A A;  4YS3 A;  3KWQ D;  5AV6 D;  3WA9 B;  5AVC D;  3W97 C;  5B1M C;  3AZH A;  1P3L D;  1P3O D;  3MGP D;  1P3F C;  2CV5 A;  4LD9 B;  3AV2 A;  3VH5 A;  3AV1 C;  1KX4 C;  3WKJ A;  5B2I C;  4H9P A;  4H9R A;  3KWQ A;  2NZD C;  5AV6 A;  5B40 D;  1ZLA C;  5AVC A;  1U35 D;  1P3L A;  3MGP A;  1AOI C;  5GXQ B;  5CP6 D;  1A7W A;  3REH C;  5B40 A;  3WA9 D;  3B6F B;  3AZF C;  5B31 G;  4WU8 C;  4LD9 D;  1KU5 A;  5CP6 A;  5B0Y C;  4NE6 A;  3AZL A;  5B1L C;  3AZN D;  3WA9 A;  1P3G B;  2BG1 A;  1P3M B;  4LD9 A;  5GXQ D;  4WNN B;  3MGR C;  1N1J A;  3AZK B;  3AZN A;  5B32 D;  3LJA B;  1TZY C;  4H9O B;  3B6F D;  3AZJ B;  2RVQ D;  1KX3 C;  5B24 C;  1M1A B;  5GXQ A;  3AZG D;  3W96 D;  3KSY A;  1ID3 C;  1BH9 B;  3H0R C;  4X23 D;  1P3G D;  3B6F A;  4YS3 C;  1H3O B;  3X1V C;  2PYO B;  4G92 C;  3AZG A;  3W97 B;  5GSU B;  3AZK D;  4UPK A;  3WTP E;  3NQU B;  3LJA D;  3KUY C;  4J8W B;  3AV2 C;  2Y2P A;  2CV5 C;  1P3F B;  1P3G A;  3WKJ C;  3AV1 B;  4H9N B;  3AZJ D;  5B2I B;  2NZD B;  3KXB B;  1P3M A;  1B67 A;  2Y2M A;  1T3U A;  5AVC C;  1M1A D;  1ZLA B;  2JCH A;  1BFM A;  3AZI D;  1P3L C;  1P3O C;  3AZK A;  3MGP C;  3X1U B;  3LJA A;  1AOI B;  4H9O A;  2RIQ A;  3AZJ A;  3MGS B;  3REH B;  2PYO D;  5B40 C;  5F99 C;  1M1A A;  1U35 C;  3W97 D;  5GSU D;  5BS7 C;  1BH9 A;  5CP6 C;  4WU8 B;  2ZM5 A;  4J8W D;  5B0Y B;  3LZ1 B;  3AV1 D;  1H3O A;  5B2I D;  2PYO A;  3EPH A;  5KDM B;  3KXB D;  3WA9 C;  4QLC B;  2XD5 A;  1BH8 B;  2G5H C;  3W97 A;  5GSU A;  2FFF B;  5BNX B;  3X1U D;  3NQU A;  4J8W A;  1P3F A;  4JJN C;  5AV9 D;  3MGR B;  4H9N A;  3AZN C;  3AV1 A;  5B2I A;  3IP4 C;  3MGS D;  1ULY A;  2F8N G;  2NZD A;  3KXB A;  5DNN C;  1TZY B;  1ZLA A;  1KX3 B;  1P34 D;  3X1U A;  1AOI A;  5AY8 B;  4Z2M G;  4WU8 D;  2F8N K;  5C3I C;  5B0Y D;  5AV9 A;  3LZ1 D;  5B32 C;  1ID3 B;  3MGS A;  4EO5 C;  3REH A;  3A1I A;  4Z66 D;  4QLC D;  3AN2 C;  4J8U B;  4Z5T D;  2DQN C;  2ARO D;  3X1V B;  1P34 A;  3EPL A;  3AZG C;  4WU8 A;  3W96 C;  4G92 B;  1EQZ B;  2DF4 C;  5B0Y A;  3NQJ B;  3LZ1 A;  4X23 C;  4Z66 A;  1P3G C;  4QLC A;  3KUY B;  1S32 D;  1TZY D;  2XD1 A;  5JA4 B;  1BH8 A;  1KX3 D;  5BNX A;  5AY8 D;  4CSR B;  2ZY2 A;  1P3L B;  2NQB D;  1P3O B;  1ID3 D;  2Y2L A;  4DRA A;  5AV8 D;  3WAA B;  1TZY A;  4J8U D;  3AZJ C;  1KX3 A;  3X1V D;  1PZR A;  4G91 C;  5B40 B;  2HIO B;  5F99 B;  5AY8 A;  3AZI C;  3X1T D;  1U35 B;  1EQZ D;  1ID3 A;  5CP6 B;  3A1K A;  3VH5 W;  4J8U A;  5GT3 C;  3AZE B;  2PYO C;  3X1V A;  1KX5 B;  1EQZ A;  3X1T A;  3AFA B;  5GSU C;  3NQJ A;  2Y2K A;  4XZQ C;  5AV5 B;  3C1C D;  4J8W C;  3KUY A;  1M18 D;  3WAA D;  4JJN B;  5JA4 A;  1N1J B;  3AZN B;  3KXB C;  3LEL C;  2HIO D;  5F99 D;  5DNN B;  4CSR A;  1P3O A;  3X1U C;  5CHL B;  5AV9 C;  3WAA A;  5C3I B;  3MGS C;  5B32 B;  3AZE D;  3AZM D;  4EO5 B;  2HIO A;  5F99 A;  3AN2 B;  4ZBJ C;  2W8S A;  1KX5 D;  3WTP B;  3AFA D;  1U35 A;  1P34 C;  5BS7 A;  5AV5 D;  3AZG B;  3W96 B;  3LZ1 C;  4JJN D;  3AZE A;  4Z66 C;  4QLC C;  4X23 B;  3MVD B;  5DNN D;  1KX5 A;  4Z5T C;  3AFA A;  2ARO C;  5AV5 A;  4JJN A;  1S32 C;  5DNN A;  3AN2 D;  3WTP D;  1WWI A;  5B31 D;  3REK D;  4G91 B;  5AY8 C;  3W98 D;  3AZI B;  2Y2G A;  2NQB C;  5B32 A;  2IO5 B;  5AV8 C;  3O62 C;  3MVD D;  4J8U C;  3AN2 A;  1P3K B;  1F66 B;  3WTP A;  5GT3 B;  5B0Z B;  2YFV B;  1EQZ C;  3X1T C;  2Y2J A;  3W96 A;  4CAY A;  4XZQ B;  4X23 A;  3MVD A;  4R8P D;  3LEL B;  3C1C C;  1M18 C;  3WAA C;  3VH5 T;  4DRB A;  2ZY5 A;  5AV9 B;  4YM6 C;  1P3K D;  1F66 D;  5B33 B;  3V9R B;  5GT3 D;  2HIO C;  5B0Z D;  3TU4 C;  4ZBJ B;  3AZI A;  4KHA A;  1P34 B;  4XZQ D;  4KUD B;  3X1S D;  4J8V C;  1P3K A;  1F66 A;  3AZE C;  3AZM C;  5GT3 A;  4Z66 B;  5B0Z A;  2YFV A;  1KX5 C;  3B6G D;  3LEL D;  3AFA C;  4Z5T B;  2ARO B;  5AV5 C;  4XZQ A;  3P5J B;  5B33 D;  4KGC B;  3B6G A;  1S32 B;  3LEL A;  4NE3 A;  3B0B A;  3C1B C;  1HQ3 B;  4KUD D;  5CPI D;  5B2J C;  2NQB B;  5B33 A;  3V9R A;  5AV8 B;  3O62 B;  3AYW C;  1R4V A;  3B0D B;  3WTP C;  5B31 C;  3REK C;  2ZY4 A;  2F8N H;  2Y2N A;  4KUD A;  3FDD A;  3W98 C;  3X1T B;  2F8N D;  4H9Q B;  4KGC D;  1HTA A;  3MVD C;  3MGQ D;  4Z2M H;  4Z5T A;  1P3A C;  2ARO A;  4AWL C;  3UT9 B;  3LZ0 D;  1HQ3 D;  3C1C B;  5CPK C;  4XUJ C;  4NE5 A;  4H9S A;  4KGC A;  3O62 D;  1M18 B;  1S32 A;  4R8P C;  4YM6 B;  3MNN C;  3LZ0 A;  1HQ3 A;  3EPJ A;  3TU4 B;  4WU9 C;  2NQB A;  2IO5 C;  1P3I C;  5AV8 A;  3O62 A;  1P3K C;  4J8V B;  1F66 C;  2FJ7 B;  3AZM B;  5B0Z C;  4ZUX D;  3UT9 D;  5CPJ B;  5JRG C;  3H0L C;  1P3P D;  4H9Q A;  3X1S C; 
#chains in the Genus database with same CATH homology
 3REL C;  1Z2C B;  4YM6 D;  5AVB B;  2J8P A;  3UT9 A;  3EG5 B;  3B6G C;  3R45 B;  3TU4 D;  3C1C A;  3C1B B;  3UTB B;  1M18 A;  3AZH D;  4J8V D;  2FJ7 D;  5B33 C;  4YM6 A;  5B2J B;  2Y2O A;  3TU4 A;  3AYW B;  5CPJ D;  5B31 B;  3REK B;  4KUD C;  4NFT A;  5CPI C;  3W98 B;  4CAY B;  4J8V A;  2FJ7 A;  5AVB D;  3AZM A;  3A6N C;  2CWE A;  5CPJ A;  2JE5 A;  4M6B A;  5E5A B;  1P3A B;  4WJ3 C;  4AWL B;  3C1B D;  3UTB D;  3W99 C;  5BO0 B;  5GT0 B;  2Y2I A;  1B6W A;  4E45 A;  2G5I C;  5B2J D;  5AVB A;  4KGC C;  4H9S C;  5CPK B;  3AZL D;  3VH6 W;  4XUJ B;  3MGQ C;  3R45 A;  3AYW D;  4UUZ B;  3H0M C;  5B32 G;  4R8P B;  5DNM C;  2BYK B;  1HQ3 C;  3LZ0 C;  3MNN B;  3C1B A;  3UTB A;  3F6T A;  3AL0 C;  3REJ C;  4WU9 B;  4J8X C;  4KHA B;  4DQY B;  4HGA C;  5B2J A;  5BNV B;  3B0C W;  2VQR A;  3VH6 A;  5G49 B;  1P3I B;  3AYW A;  3B0D C;  5BT1 C;  2Y2H A;  5E5A D;  1P3A D;  5B31 A;  3REK A;  1P3B C;  5GT0 D;  3W98 A;  5JRG B;  2Y2Q A;  5CPK D;  1JFI B;  4XUJ D;  3X1S B;  3REL B;  5E5A A;  1P3A A;  3UT9 C;  4ZUX C;  3UTA B;  3MNN D;  3B6G B;  5BO0 A;  5GT0 A;  3REI B;  4WU9 D;  4WZS B;  2F2A C;  1P3P C;  1M19 B;  5CPK A;  4XUJ A;  1P3I D;  4UUZ A;  4R8P A;  2UWX A;  2BYK A;  3MNN A;  4WU9 A;  1P3M D;  5JRG D;  5BNV A;  3AZH C;  5CPI B;  5G49 A;  1P3I A;  2FJ7 C;  5B1M B;  3REL D;  3UTA D;  1KX4 B;  3KWQ C;  5CPJ C;  3REI D;  3A6N B;  5AV6 C;  5JRG A;  1M19 D;  1JFI A;  4WNN A;  3W99 B;  3X1S A;  1TAF B;  2ZY3 A;  5AVB C;  3REL A;  2F8N B;  3UTA A;  3MGQ B;  1W2E A;  3REI A;  5DNM B;  3LZ0 B;  3UTB C;  4WV4 B;  1M19 A;  3KFU G;  2YFW B;  3REJ B;  1WWS A;  5B1M D;  2HUE C;  4J8X B;  3AZF B;  4HGA B;  1P3F D;  3AZL C;  1KX4 D;  5B1L B;  3A6N D;  2NZD D;  1ZLA D;  1P3B B;  3W99 D;  5CPI A;  5B1M A;  4LD9 C;  1AOI D;  3VH6 T;  1KX4 A;  3A6N A;  5E5A C;  3REH D;  2LY8 A;  2BYM B;  5DNM D;  4ZUX B;  5GT0 C;  3W99 A;  5FUG B;  1TAF A;  5B24 B;  3REJ D;  3AZF D;  4J8X D;  5GXQ C;  1P3P B;  2F8N A;  3B0C T;  3MGQ A;  5B1L D;  5BT1 D;  5DNM A;  3B6F C;  2RVQ C;  1P3B D;  4YS3 B;  1F1E A;  2YFW A;  3REJ A;  3AZF A;  4J8X A;  3MGR D;  5B1L A;  3AZH B;  5KDM A;  4E44 A;  2CV5 B;  3AV2 B;  3WKJ B;  1P3B A;  4H9P B;  4H9R B;  3KWQ B;  3EPK A;  5B24 D;  1P3M C;  5AV6 B;  5AVC B;  3MGR A;  3AZK C;  3LJA C;  3MGP B;  3UTA C;  2BYM A;  4ZUX A;  3REI C;  4YS3 D;  5FUG A;  5B24 A;  1M1A C;  1P3P A;  1M19 C;  2JSS A;  2HUE B;  2CV5 D;  3KUY D;  3AZL B;  3AV2 D;  3WKJ D;  1Q9C A;  2L5A A;  4YS3 A;  3KWQ D;  5AV6 D;  3WA9 B;  5AVC D;  3W97 C;  5B1M C;  3AZH A;  1P3L D;  1P3O D;  3MGP D;  1P3F C;  2CV5 A;  4LD9 B;  3AV2 A;  3VH5 A;  3AV1 C;  1KX4 C;  3WKJ A;  5B2I C;  4H9P A;  4H9R A;  3KWQ A;  2NZD C;  5AV6 A;  5B40 D;  1ZLA C;  5AVC A;  1U35 D;  1P3L A;  3MGP A;  1AOI C;  5GXQ B;  5CP6 D;  1A7W A;  3REH C;  5B40 A;  3WA9 D;  3B6F B;  3AZF C;  5B31 G;  4WU8 C;  4LD9 D;  1KU5 A;  5CP6 A;  5B0Y C;  4NE6 A;  3AZL A;  5B1L C;  3AZN D;  3WA9 A;  1P3G B;  2BG1 A;  1P3M B;  4LD9 A;  5GXQ D;  4WNN B;  3MGR C;  1N1J A;  3AZK B;  3AZN A;  5B32 D;  3LJA B;  1TZY C;  4H9O B;  3B6F D;  3AZJ B;  2RVQ D;  1KX3 C;  5B24 C;  1M1A B;  5GXQ A;  3AZG D;  3W96 D;  3KSY A;  1ID3 C;  1BH9 B;  3H0R C;  4X23 D;  1P3G D;  3B6F A;  4YS3 C;  1H3O B;  3X1V C;  2PYO B;  4G92 C;  3AZG A;  3W97 B;  5GSU B;  3AZK D;  4UPK A;  3WTP E;  3NQU B;  3LJA D;  3KUY C;  4J8W B;  3AV2 C;  2Y2P A;  2CV5 C;  1P3F B;  1P3G A;  3WKJ C;  3AV1 B;  4H9N B;  3AZJ D;  5B2I B;  2NZD B;  3KXB B;  1P3M A;  1B67 A;  2Y2M A;  1T3U A;  5AVC C;  1M1A D;  1ZLA B;  2JCH A;  1BFM A;  3AZI D;  1P3L C;  1P3O C;  3AZK A;  3MGP C;  3X1U B;  3LJA A;  1AOI B;  4H9O A;  2RIQ A;  3AZJ A;  3MGS B;  3REH B;  2PYO D;  5B40 C;  5F99 C;  1M1A A;  1U35 C;  3W97 D;  5GSU D;  5BS7 C;  1BH9 A;  5CP6 C;  4WU8 B;  2ZM5 A;  4J8W D;  5B0Y B;  3LZ1 B;  3AV1 D;  1H3O A;  5B2I D;  2PYO A;  3EPH A;  5KDM B;  3KXB D;  3WA9 C;  4QLC B;  2XD5 A;  1BH8 B;  2G5H C;  3W97 A;  5GSU A;  2FFF B;  5BNX B;  3X1U D;  3NQU A;  4J8W A;  1P3F A;  4JJN C;  5AV9 D;  3MGR B;  4H9N A;  3AZN C;  3AV1 A;  5B2I A;  3IP4 C;  3MGS D;  1ULY A;  2F8N G;  2NZD A;  3KXB A;  5DNN C;  1TZY B;  1ZLA A;  1KX3 B;  1P34 D;  3X1U A;  1AOI A;  5AY8 B;  4Z2M G;  4WU8 D;  2F8N K;  5C3I C;  5B0Y D;  5AV9 A;  3LZ1 D;  5B32 C;  1ID3 B;  3MGS A;  4EO5 C;  3REH A;  3A1I A;  4Z66 D;  4QLC D;  3AN2 C;  4J8U B;  4Z5T D;  2DQN C;  2ARO D;  3X1V B;  1P34 A;  3EPL A;  3AZG C;  4WU8 A;  3W96 C;  4G92 B;  1EQZ B;  2DF4 C;  5B0Y A;  3NQJ B;  3LZ1 A;  4X23 C;  4Z66 A;  1P3G C;  4QLC A;  3KUY B;  1S32 D;  1TZY D;  2XD1 A;  5JA4 B;  1BH8 A;  1KX3 D;  5BNX A;  5AY8 D;  4CSR B;  2ZY2 A;  1P3L B;  2NQB D;  1P3O B;  1ID3 D;  2Y2L A;  4DRA A;  5AV8 D;  3WAA B;  1TZY A;  4J8U D;  3AZJ C;  1KX3 A;  3X1V D;  1PZR A;  4G91 C;  5B40 B;  2HIO B;  5F99 B;  5AY8 A;  3AZI C;  3X1T D;  1U35 B;  1EQZ D;  1ID3 A;  5CP6 B;  3A1K A;  3VH5 W;  4J8U A;  5GT3 C;  3AZE B;  2PYO C;  3X1V A;  1KX5 B;  1EQZ A;  3X1T A;  3AFA B;  5GSU C;  3NQJ A;  2Y2K A;  4XZQ C;  5AV5 B;  3C1C D;  4J8W C;  3KUY A;  1M18 D;  3WAA D;  4JJN B;  5JA4 A;  1N1J B;  3AZN B;  3KXB C;  3LEL C;  2HIO D;  5F99 D;  5DNN B;  4CSR A;  1P3O A;  3X1U C;  5CHL B;  5AV9 C;  3WAA A;  5C3I B;  3MGS C;  5B32 B;  3AZE D;  3AZM D;  4EO5 B;  2HIO A;  5F99 A;  3AN2 B;  4ZBJ C;  2W8S A;  1KX5 D;  3WTP B;  3AFA D;  1U35 A;  1P34 C;  5BS7 A;  5AV5 D;  3AZG B;  3W96 B;  3LZ1 C;  4JJN D;  3AZE A;  4Z66 C;  4QLC C;  4X23 B;  3MVD B;  5DNN D;  1KX5 A;  4Z5T C;  3AFA A;  2ARO C;  5AV5 A;  4JJN A;  1S32 C;  5DNN A;  3AN2 D;  3WTP D;  1WWI A;  5B31 D;  3REK D;  4G91 B;  5AY8 C;  3W98 D;  3AZI B;  2Y2G A;  2NQB C;  5B32 A;  2IO5 B;  5AV8 C;  3O62 C;  3MVD D;  4J8U C;  3AN2 A;  1P3K B;  1F66 B;  3WTP A;  5GT3 B;  5B0Z B;  2YFV B;  1EQZ C;  3X1T C;  2Y2J A;  3W96 A;  4CAY A;  4XZQ B;  4X23 A;  3MVD A;  4R8P D;  3LEL B;  3C1C C;  1M18 C;  3WAA C;  3VH5 T;  4DRB A;  2ZY5 A;  5AV9 B;  4YM6 C;  1P3K D;  1F66 D;  5B33 B;  3V9R B;  5GT3 D;  2HIO C;  5B0Z D;  3TU4 C;  4ZBJ B;  3AZI A;  4KHA A;  1P34 B;  4XZQ D;  4KUD B;  3X1S D;  4J8V C;  1P3K A;  1F66 A;  3AZE C;  3AZM C;  5GT3 A;  4Z66 B;  5B0Z A;  2YFV A;  1KX5 C;  3B6G D;  3LEL D;  3AFA C;  4Z5T B;  2ARO B;  5AV5 C;  4XZQ A;  3P5J B;  5B33 D;  4KGC B;  3B6G A;  1S32 B;  3LEL A;  4NE3 A;  3B0B A;  3C1B C;  1HQ3 B;  4KUD D;  5CPI D;  5B2J C;  2NQB B;  5B33 A;  3V9R A;  5AV8 B;  3O62 B;  3AYW C;  1R4V A;  3B0D B;  3WTP C;  5B31 C;  3REK C;  2ZY4 A;  2F8N H;  2Y2N A;  4KUD A;  3FDD A;  3W98 C;  3X1T B;  2F8N D;  4H9Q B;  4KGC D;  1HTA A;  3MVD C;  3MGQ D;  4Z2M H;  4Z5T A;  1P3A C;  2ARO A;  4AWL C;  3UT9 B;  3LZ0 D;  1HQ3 D;  3C1C B;  5CPK C;  4XUJ C;  4NE5 A;  4H9S A;  4KGC A;  3O62 D;  1M18 B;  1S32 A;  4R8P C;  4YM6 B;  3MNN C;  3LZ0 A;  1HQ3 A;  3EPJ A;  3TU4 B;  4WU9 C;  2NQB A;  2IO5 C;  1P3I C;  5AV8 A;  3O62 A;  1P3K C;  4J8V B;  1F66 C;  2FJ7 B;  3AZM B;  5B0Z C;  4ZUX D;  3UT9 D;  5CPJ B;  5JRG C;  3H0L C;  1P3P D;  4H9Q A;  3X1S C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...