1P3PB

Crystallographic studies of nucleosome core particles containing histone 'sin' mutants
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
81
structure length
81
Chain Sequence
LRDNIQGITKPAIRRLARRGGIKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of histone Sin mutant nucleosomes reveal altered protein-DNA interactions
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
molecule keywords Palindromic 146bp Human Alpha-Satellite DNA fragment
total genus 24
structure length 81
sequence length 81
chains with identical sequence F
ec nomenclature
pdb deposition date 2003-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1p3pB00
1AOIA 4DRAA 4J8UC 4KGCC 5B1LB 1B6WA 3O62B 4YS3A 1P3GA 3MGQC 1P3PA 4X23A 5AVBA 1TZYD 5GXQC 4LD9A 5AV9B 3X1VB 3REJC 5B1MB 2YFVA 4YS3D 1P3GD 4UUZA 3AZGD 1P3OA 3MGRB 4Z66A 4G92C 3B6FC 3AZNB 5GSUC 1P3LB 5B32A 5CPKC 5JA4A 5GXQB 3AZIA 4Z5TD 5B40B 3RELB 4LD9C 2CV5A 2PYOA 4KUDC 5BT1D 5B32B 5BNVB 4Z5TC 3LELA 5AVCB 3AN2A 2IO5B 3AV2B 3AZJC 1S32B 4JJND 5B1MA 1HQ3A 4WU8B 5AV6D 3KUYA 1ULYA 5B2IC 5B2JB 5B31C 3MVDC 3REIC 5AV8B 4Z66D 1P3IA 3WAAC 2CWEA 3LZ1D 3W97B 5DNMD 2HIOA 5B0ZC 4ZUXA 4R8PB 3AV1A 4EO5C 3W96B 3KXBA 3REID 3AFAC 5G49B 5AVBD 3VH6W 5AY8B 3LJAC 1U35A 1P34C 4AWLB 3X1UB 1P3PD 5B33C 3AZJD 5AV8C 1P3LD 3C1CB 3WAAB 3R45B 4CAYA 5CHLB 5JRGA 1P3KA 1KX5B 2FJ7C 3AN2B 3MGSD 3AZEA 2NZDD 3AZKC 2YFWB 5JRGB 2F8ND 1M1AC 3MGSC 3C1BA 5GSUD 3AZMB 1KX4D 3B0DB 3AZIB 3KUYC 5CP6B 2AROB 3AZGC 1Q9CA 1EQZB 1KX5C 5B24D 3AZNA 3MGPA 3B0BA 2FJ7B 3A6NC 3WTPA 3X1TB 3KXBB 1P3OB 3W96A 1KX4A 3AFAA 4WU9C 4G91C 5DNMB 4KUDA 1M1AB 5B1LC 5GT3C 2NZDA 1P3BD 1KX3B 5AV5B 4HGAB 3WTPD 1HQ3D 3B0CT 5B1MD 4J8VA 3VH5T 5B31A 4Z66C 5B2IA 1P3FD 5GSUA 4WU9B 3W99C 5B0ZD 4G91B 5DNNA 5DNMC 3KWQD 5AVCA 5GT0C 3MGRC 4YM6D 1U35D 3W99D 4Z5TA 2PYOB 5CPKB 4M6BA 5GXQA 3REHC 5CPIB 2NQBB 1P3LA 5CPJA 5E5AC 5B32C 5DNNB 3MGRA 4WU9A 3MNNB 4J8UD 5F99B 3TU4B 4QLCB 4LD9D 3W98A 1S32C 5C3IB 3X1VA 4J8WD 1P3MA 5KDMA 3WA9B 5AVBB 3LZ1A 3NQJB 2F8NA 3MVDB 2L5AA 1M1AA 1TZYC 5GXQD 1S32D 3MGQA 3AZFB 3AZMD 1KX4B 3B6GC 5B24A 5F99C 3TU4C 4QLCC 5FUGA 3AZND 3W96C 5B32D 1M18C 3WTPC 4XUJD 2BYMB 5B33B 1P3KC 3UT9A 4WV4B 1P3AC 4XZQC 3MGSA 3C1BC 3LJAA 1KX5D 4X23D 1F66A 3NQUB 1ID3A 1U35C 1P34A 5GT0D 1P3FC 1P3AA 4J8UB 3LZ1C 3UT9C 2BYMA 3UTBB 3REKA 3W97D 4XZQB 1BH8B 1BFMA 5AY8A 3AZGB 1HQ3C 5G49A 5B1LD 1EQZC 3AYWD 4H9QA 5AV6C 1ZLAA 3WKJB 2HIOD 3WA9A 3X1TD 1M18A 1P3FB 3W98B 2CV5D 2HIOC 1P3IB 4H9OA 5KDMB 4YM6B 3LELC 3A6ND 5AV5C 5B2JA 4JJNB 1M19A 1P3MC 1S32A 1M1AD 3VH6T 5B0YD 3B6FA 3AZJA 4CSRA 1R4VA 3W99B 5CPKA 1ZLAD 2FJ7D 3MVDD 3AZKD 5AY8D 2NQBA 3LZ0A 1TAFB 2PYOC 3AZJB 4ZUXD 4Z2MG 4XUJC 1M19B 5B31B 2BYKB 1P34D 3REIB 3LZ0C 4UUZB 5B2JD 5CP6D 3LJAD 2NQBD 4EO5B 5F99D 3TU4D 3AZNC 5AV9A 3UTAB 1H3OA 3AZHB 3WAAD 4J8XC 5AV5A 5BS7A 3X1UC 4XUJB 1M19C 1BH8A 2F8NG 4J8VC 5B1LA 4KUDB 4YS3C 3KWQB 4H9RB 3AZID 5B31D 1P3GC 1A7WA 5CP6A 3AZFD 1B67A 4WNNB 2IO5C 5JRGD 3AZMA 3B6GB 3X1SB 4KHAB 5B0YB 3AV2C 1EQZA 3MGPC 4E44A 2AROA 3AYWC 3AZKB 2LY8A 4KGCD 5JRGC 2YFWA 3MGPD 3W98D 3WTPE 3AZKA 2AROC 4R8PC 5CPKD 2HUEC 3B6FD 4J8WB 5B0YA 3AYWB 2AROD 3X1SA 1U35B 3KXBC 4CAYB 3REJD 4AWLC 4XZQD 1F66D 3AZFA 3AV1B 3X1UA 4R8PA 1BH9A 5GT3D 3MGQD 3MVDA 3AN2D 2JSSA 1M18D 3WA9D 2PYOD 3AYWA 4QLCA 5F99A 5B24C 3TU4A 3AZLB 5E5AA 1KU5A 5CPJC 3AV1C 3KUYB 4YM6C 3LELB 4H9NA 2CV5B 2NQBC 1ID3D 1TAFA 5BNVA 1P3OC 5B1MC 5BO0B 3LZ0D 1P3BB 3WKJD 3MNNC 4CSRB 4H9NB 4G92B 1KX3C 3B6FB 4HGAC 5GSUB 1P3LC 3REHD 2CV5C 1AOID 1EQZD 4Z66B 5AV8D 5AVBC 1JFIB 4LD9B 5B33D 3AZED 1P3PC 4J8VD 1KX3A 2YFVB 1H3OB 4X23B 4DRBA 5AVCC 1KX4C 5B31G 5AVCD 5CPID 3X1SD 3X1TA 4J8XB 3WTPB 5CPIC 3REHB 5B2JC 3VH6A 3VH5W 3REJB 4J8UA 3UTBD 4X23C 1P3AB 4Z2MH 5B0ZB 4E45A 3C1BB 1P3BA 3AZEC 5CPJD 1ID3B 4KUDD 5AY8C 3LJAB 3W96D 3O62D 3WA9C 1KX5A 3RELC 5B40C 1ZLAC 3UT9B 3AV2D 3R45A 1TZYB 4YM6A 3AZFC 4H9OB 1WWIA 1ID3C 2HUEB 3B6GA 4WNNA 1P3FA 4J8WC 5FUGB 5B2ID 1M18B 1M19D 3V9RA 4H9RA 1ZLAB 3WKJA 4NE6A 4ZUXB 2HIOB 3AV1D 1BH9B 3B0DC 2F8NB 4XZQA 3REKB 5AV8A 4H9SC 3V9RB 2RVQD 3UTAA 3AZHA 3KSYA 4NE3A 3AFAD 1P3MB 4WU8A 2RVQC 1N1JA 3A6NB 4J8WA 4NFTA 3X1VD 1P34B 3AV2A 3KXBD 3REIA 4ZUXC 2BYKA 5CPJB 3MGRD 3C1CC 3UTBC 5CPIA 5B32G 1WWSA 5BS7C 5JA4B 3C1CD 4H9PB 4R8PD 4KHAA 1P3KD 3W99A 1P3BC 3W98C 5GT0B 3REJA 3O62C 5CP6C 3KWQA 3MGQB 3REHA 2F8NK 4XUJA 2F8NH 3NQJA 5AV9D 5GT3A 4NE5A 3X1TC 2NZDB 3X1UD 1P3PB 1KX3D 3KWQC 4YS3B 1P3GB 3O62A 5DNNC 5DNMA 5GT3B 3MNNA 1AOIB 1P3ID 1JFIA 4H9QB 5GT0A 1P3OD 3AZGA 5BNXA 3MGPB 5C3IC 4J8XD 4WZSB 3UTBA 5E5AD 2NZDC 3VH5A 3LZ0B 4WU8D 4H9PA 4Z5TB 5B40D 3LELD 1HTAA 3RELD 5BO0A 3C1BD 4KGCA 3UTAD 3AZHD 1F66B 1AOIC 3AZEB 3UTAC 3AZHC 4WU8C 5AV6A 3KUYD 5B2IB 4ZBJC 1N1JB 3A6NA 4JJNA 3C1CA 5B33A 4J8VB 4QLCD 5E5AB 3B6GD 3AZLA 3W97C 1F66C 5AV5D 3X1SC 5B0YC 3AFAB 1P3MD 4ZBJB 4H9SA 3W97A 3REKD 3AZLC 2FJ7A 4WU9D 3LZ1B 1P3AD 5BT1C 3REKC 3AZLD 1F1EA 3MNND 1HQ3B 5AV6B 3WKJC 3AN2C 3NQUA 1TZYA 1P3KB 3MGSB 1P3IC 3UT9D 4KGCB 3AZMC 3AZIC 5DNND 5B0ZA 5B40A 3RELA 3WAAA 4JJNC 5AV9C 3X1VC 5BNXB 4J8XA 5B24B 3B0CW
chains in the Genus database with same CATH superfamily
1AOIA 4DRAA 4J8UC 4KGCC 5B1LB 1B6WA 3O62B 4YS3A 1P3GA 3MGQC 1P3PA 3F6TA 4X23A 5AVBA 1TZYD 5GXQC 4LD9A 5AV9B 3X1VB 3REJC 5B1MB 2BG1A 2J8PA 2YFVA 4YS3D 1P3GD 4UUZA 3AZGD 1P3OA 3MGRB 4Z66A 4G92C 1Z2CB 3B6FC 3AZNB 5GSUC 1P3LB 5B32A 5CPKC 5JA4A 5GXQB 3AZIA 4Z5TD 5B40B 3RELB 4LD9C 2CV5A 2PYOA 4KUDC 5BT1D 4KGCA 5B32B 5BNVB 4Z5TC 3LELA 5AVCB 3AN2A 2IO5B 3AV2B 3AZJC 1S32B 2ZY2A 4JJND 5B1MA 1HQ3A 4WU8B 2JCHA 5AV6D 3KUYA 1ULYA 5B2IC 5B2JB 5B31C 3MVDC 3REIC 5AV8B 4Z66D 1P3IA 3WAAC 2CWEA 3LZ1D 3W97B 5DNMD 2HIOA 5B0ZC 4ZUXA 4R8PB 3AV1A 4EO5C 3W96B 3KXBA 3REID 3AFAC 5G49B 5AVBD 3VH6W 5AY8B 3LJAC 1U35A 1P34C 4AWLB 3X1UB 1P3PD 5B33C 3AZJD 5AV8C 1P3LD 3C1CB 3WAAB 3R45B 4CAYA 5CHLB 5JRGA 1P3KA 1KX5B 2FJ7C 3AN2B 3MGSD 3EPLA 3AZEA 2NZDD 3AZKC 2YFWB 5JRGB 2F8ND 1M1AC 3MGSC 3C1BA 5GSUD 3AZMB 1KX4D 3B0DB 3AZIB 3KUYC 5CP6B 2AROB 3AZGC 1Q9CA 2Y2OA 1EQZB 1KX5C 5B24D 3AZNA 3MGPA 3B0BA 2FJ7B 3A6NC 3WTPA 3X1TB 3KXBB 1P3OB 3W96A 1KX4A 3AFAA 4WU9C 4G91C 5DNMB 4KUDA 1M1AB 5B1LC 5GT3C 2NZDA 1P3BD 1KX3B 5AV5B 4HGAB 2DQNC 2RIQA 3WTPD 1HQ3D 3B0CT 5B1MD 4J8VA 3KFUG 3VH5T 5B31A 4Z66C 5B2IA 1P3FD 5GSUA 4WU9B 3W99C 5DNMC 5B0ZD 4G91B 2Y2GA 5DNNA 3KWQD 5AVCA 5GT0C 3MGRC 4YM6D 1U35D 3W99D 4Z5TA 2PYOB 5CPKB 4M6BA 5GXQA 3REHC 5CPIB 2NQBB 1P3LA 5CPJA 5E5AC 5B32C 1PZRA 5DNNB 3MGRA 4WU9A 3MNNB 4J8UD 5F99B 3TU4B 4QLCB 4LD9D 3W98A 1S32C 5C3IB 3X1VA 4J8WD 1P3MA 5KDMA 3WA9B 5AVBB 3LZ1A 3NQJB 2F8NA 3MVDB 2L5AA 1M1AA 1TZYC 5GXQD 1S32D 3MGQA 3AZFB 3AZMD 1KX4B 3B6GC 5B24A 5F99C 3TU4C 4QLCC 5FUGA 3AZND 3W96C 5B32D 1M18C 3WTPC 4XUJD 2BYMB 5B33B 1P3KC 3UT9A 4WV4B 1P3AC 4XZQC 3MGSA 3C1BC 3LJAA 1KX5D 4X23D 1F66A 3NQUB 1ID3A 1U35C 1P34A 2ZY4A 5GT0D 1P3FC 1P3AA 4J8UB 3LZ1C 3UT9C 2BYMA 3UTBB 3REKA 3W97D 2XD5A 4XZQB 1BH8B 1BFMA 5AY8A 3AZGB 1HQ3C 5G49A 2F2AC 5B1LD 3AYWD 4H9QA 5AV6C 1EQZC 1ZLAA 3WKJB 2HIOD 3WA9A 3H0LC 3X1TD 1M18A 1P3FB 3W98B 2CV5D 2HIOC 1P3IB 4H9OA 5KDMB 4YM6B 3LELC 3A6ND 5AV5C 5B2JA 4JJNB 1M19A 1P3MC 1S32A 1M1AD 3VH6T 5B0YD 3B6FA 3AZJA 4CSRA 1R4VA 3W99B 5CPKA 1ZLAD 2FJ7D 3MVDD 2Y2MA 3AZKD 5AY8D 2NQBA 3LZ0A 1TAFB 2FFFB 2PYOC 3AZJB 4ZUXD 4Z2MG 4XUJC 1M19B 5B31B 3H0MC 2BYKB 1P34D 3REIB 3LZ0C 3EG5B 4UUZB 5B2JD 5CP6D 3LJAD 2NQBD 4EO5B 5F99D 3TU4D 2Y2IA 5AV9A 2Y2QA 3AZNC 3UTAB 1H3OA 3AZHB 3WAAD 4J8XC 5AV5A 5BS7A 3X1UC 4XUJB 1M19C 1BH8A 2F8NG 4J8VC 5B1LA 4KUDB 2DF4C 4YS3C 4H9RB 3KWQB 5B31D 3AZID 1A7WA 1P3GC 5CP6A 3AZFD 1B67A 4WNNB 2IO5C 5JRGD 3AZMA 3B6GB 3X1SB 4KHAB 5B0YB 3AV2C 1EQZA 3MGPC 4E44A 2AROA 3AYWC 3AZKB 2LY8A 4KGCD 5JRGC 2Y2KA 2Y2LA 2YFWA 3MGPD 3W98D 3WTPE 3AZKA 2AROC 4R8PC 5CPKD 2HUEC 3B6FD 4J8WB 5B0YA 3AYWB 2AROD 3X1SA 1U35B 3KXBC 4CAYB 3REJD 4AWLC 4XZQD 1F66D 3AZFA 3AV1B 3X1UA 4R8PA 1BH9A 3A1IA 5GT3D 3MGQD 3MVDA 3AN2D 2JSSA 1M18D 3WA9D 2Y2PA 2PYOD 3AYWA 4QLCA 5F99A 5B24C 3TU4A 3AZLB 5E5AA 1KU5A 5CPJC 3AV1C 3KUYB 4YM6C 3LELB 4H9NA 2CV5B 2NQBC 1ID3D 1TAFA 2ZY5A 5BNVA 1P3OC 1T3UA 5B1MC 5BO0B 3LZ0D 1P3BB 3WKJD 4UPKA 2UWXA 3MNNC 4CSRB 4H9NB 4G92B 1KX3C 3B6FB 4HGAC 5GSUB 1P3LC 3REHD 3P5JB 2CV5C 1AOID 1EQZD 4Z66B 2Y2NA 5AVBC 5AV8D 1JFIB 5B33D 4LD9B 3AZED 1P3PC 4J8VD 1KX3A 2YFVB 1H3OB 4X23B 4DRBA 5AVCC 1KX4C 5B31G 5AVCD 5CPID 3X1SD 3X1TA 4J8XB 3WTPB 5CPIC 3REHB 5B2JC 3VH6A 3VH5W 3REJB 4J8UA 3UTBD 4X23C 1P3AB 4Z2MH 5B0ZB 4E45A 3C1BB 2Y2HA 3EPKA 1P3BA 3AZEC 5CPJD 1ID3B 4KUDD 5AY8C 3LJAB 3W96D 3O62D 3WA9C 1KX5A 3RELC 5B40C 1ZLAC 3UT9B 3AV2D 3R45A 1TZYB 4YM6A 3AZFC 4H9OB 1WWIA 1ID3C 2HUEB 2G5HC 2ZY3A 3B6GA 4WNNA 1P3FA 4J8WC 5FUGB 5B2ID 1M18B 1M19D 3V9RA 4H9RA 1ZLAB 3WKJA 4NE6A 3FDDA 4ZUXB 2HIOB 3AV1D 1BH9B 3B0DC 2F8NB 4XZQA 3REKB 5AV8A 4H9SC 3EPHA 3V9RB 2RVQD 3UTAA 3AZHA 3KSYA 4NE3A 3AFAD 1P3MB 4WU8A 2RVQC 1N1JA 3A6NB 4J8WA 4NFTA 3X1VD 1P34B 4WJ3C 3AV2A 3KXBD 3REIA 4ZUXC 2BYKA 5CPJB 3MGRD 3C1CC 3UTBC 1W2EA 2Y2JA 5CPIA 5B32G 3EPJA 1WWSA 5BS7C 3AL0C 5JA4B 3C1CD 4H9PB 4R8PD 4KHAA 1P3KD 3W99A 1P3BC 3W98C 5GT0B 3REJA 3O62C 5CP6C 3KWQA 3MGQB 3REHA 2F8NK 4XUJA 2F8NH 3NQJA 5AV9D 5GT3A 4NE5A 3X1TC 2NZDB 3X1UD 1P3PB 1KX3D 3KWQC 4YS3B 1P3GB 3O62A 5DNNC 5DNMA 5GT3B 3MNNA 3A1KA 1AOIB 1P3ID 1JFIA 4H9QB 5GT0A 1P3OD 3AZGA 5BNXA 3MGPB 5C3IC 4J8XD 4WZSB 3UTBA 5E5AD 2NZDC 3VH5A 3LZ0B 4WU8D 4H9PA 4Z5TB 5B40D 3LELD 1HTAA 3RELD 5BO0A 3C1BD 2ZM5A 3UTAD 3AZHD 1F66B 1AOIC 3AZEB 2XD1A 3UTAC 3AZHC 3IP4C 4WU8C 5AV6A 3KUYD 5B2IB 4ZBJC 1N1JB 3A6NA 4DQYB 4JJNA 3C1CA 5B33A 4J8VB 4QLCD 5E5AB 3B6GD 3AZLA 3W97C 1F66C 5AV5D 3X1SC 5B0YC 3AFAB 1P3MD 4ZBJB 4H9SA 3W97A 3REKD 3AZLC 2FJ7A 4WU9D 3LZ1B 1P3AD 5BT1C 3REKC 3AZLD 1F1EA 3MNND 1HQ3B 5AV6B 3WKJC 3H0RC 3AN2C 3NQUA 2W8SA 1TZYA 2G5IC 1P3KB 3MGSB 1P3IC 3UT9D 4KGCB 3AZMC 3AZIC 5B0ZA 5DNND 5B40A 3RELA 3WAAA 4JJNC 2JE5A 2VQRA 5AV9C 3X1VC 5BNXB 4J8XA 5B24B 3B0CW
chains in the Genus database with same CATH topology
1AOIA 4DRAA 4J8UC 4KGCC 5B1LB 1B6WA 3O62B 4YS3A 1P3GA 3MGQC 1P3PA 3F6TA 4X23A 5AVBA 1TZYD 5GXQC 4LD9A 5AV9B 3X1VB 3REJC 5B1MB 2BG1A 2J8PA 2YFVA 4YS3D 1P3GD 4UUZA 3AZGD 1P3OA 3MGRB 4Z66A 4G92C 1Z2CB 3B6FC 3AZNB 5GSUC 1P3LB 5B32A 5CPKC 5JA4A 5GXQB 3AZIA 4Z5TD 5B40B 3RELB 4LD9C 2CV5A 2PYOA 4KUDC 5BT1D 4KGCA 5B32B 5BNVB 4Z5TC 3LELA 5AVCB 3AN2A 2IO5B 3AV2B 3AZJC 1S32B 2ZY2A 4JJND 5B1MA 1HQ3A 4WU8B 2JCHA 5AV6D 3KUYA 1ULYA 5B2IC 5B2JB 5B31C 3MVDC 3REIC 5AV8B 4Z66D 1P3IA 3WAAC 2CWEA 3LZ1D 3W97B 5DNMD 2HIOA 5B0ZC 4ZUXA 4R8PB 3AV1A 4EO5C 3W96B 3KXBA 3REID 3AFAC 5G49B 5AVBD 3VH6W 5AY8B 3LJAC 1U35A 1P34C 4AWLB 3X1UB 1P3PD 5B33C 3AZJD 5AV8C 1P3LD 3C1CB 3WAAB 3R45B 4CAYA 5CHLB 5JRGA 1P3KA 1KX5B 2FJ7C 3AN2B 3MGSD 3EPLA 3AZEA 2NZDD 3AZKC 2YFWB 5JRGB 2F8ND 1M1AC 3MGSC 3C1BA 5GSUD 3AZMB 1KX4D 3B0DB 3AZIB 3KUYC 5CP6B 2AROB 3AZGC 1Q9CA 2Y2OA 1EQZB 1KX5C 5B24D 3AZNA 3MGPA 3B0BA 2FJ7B 3A6NC 3WTPA 3X1TB 3KXBB 1P3OB 3W96A 1KX4A 3AFAA 4WU9C 4G91C 5DNMB 4KUDA 1M1AB 5B1LC 5GT3C 2NZDA 1P3BD 1KX3B 5AV5B 4HGAB 2DQNC 2RIQA 3WTPD 1HQ3D 3B0CT 5B1MD 4J8VA 3KFUG 3VH5T 5B31A 4Z66C 5B2IA 1P3FD 5GSUA 4WU9B 3W99C 5DNMC 5B0ZD 4G91B 2Y2GA 5DNNA 3KWQD 5AVCA 5GT0C 3MGRC 4YM6D 1U35D 3W99D 4Z5TA 2PYOB 5CPKB 4M6BA 5GXQA 3REHC 5CPIB 2NQBB 1P3LA 5CPJA 5E5AC 5B32C 1PZRA 5DNNB 3MGRA 4WU9A 3MNNB 4J8UD 5F99B 3TU4B 4QLCB 4LD9D 3W98A 1S32C 5C3IB 3X1VA 4J8WD 1P3MA 5KDMA 3WA9B 5AVBB 3LZ1A 3NQJB 2F8NA 3MVDB 2L5AA 1M1AA 1TZYC 5GXQD 1S32D 3MGQA 3AZFB 3AZMD 1KX4B 3B6GC 5B24A 5F99C 3TU4C 4QLCC 5FUGA 3AZND 3W96C 5B32D 1M18C 3WTPC 4XUJD 2BYMB 5B33B 1P3KC 3UT9A 4WV4B 1P3AC 4XZQC 3MGSA 3C1BC 3LJAA 1KX5D 4X23D 1F66A 3NQUB 1ID3A 1U35C 1P34A 2ZY4A 5GT0D 1P3FC 1P3AA 4J8UB 3LZ1C 3UT9C 2BYMA 3UTBB 3REKA 3W97D 2XD5A 4XZQB 1BH8B 1BFMA 5AY8A 3AZGB 1HQ3C 5G49A 2F2AC 5B1LD 3AYWD 4H9QA 5AV6C 1EQZC 1ZLAA 3WKJB 2HIOD 3WA9A 3H0LC 3X1TD 1M18A 1P3FB 3W98B 2CV5D 2HIOC 1P3IB 4H9OA 5KDMB 4YM6B 3LELC 3A6ND 5AV5C 5B2JA 4JJNB 1M19A 1P3MC 1S32A 1M1AD 3VH6T 5B0YD 3B6FA 3AZJA 4CSRA 1R4VA 3W99B 5CPKA 1ZLAD 2FJ7D 3MVDD 2Y2MA 3AZKD 5AY8D 2NQBA 3LZ0A 1TAFB 2FFFB 2PYOC 3AZJB 4ZUXD 4Z2MG 4XUJC 1M19B 5B31B 3H0MC 2BYKB 1P34D 3REIB 3LZ0C 3EG5B 4UUZB 5B2JD 5CP6D 3LJAD 2NQBD 4EO5B 5F99D 3TU4D 2Y2IA 5AV9A 2Y2QA 3AZNC 3UTAB 1H3OA 3AZHB 3WAAD 4J8XC 5AV5A 5BS7A 3X1UC 4XUJB 1M19C 1BH8A 2F8NG 4J8VC 5B1LA 4KUDB 2DF4C 4YS3C 4H9RB 3KWQB 5B31D 3AZID 1A7WA 1P3GC 5CP6A 3AZFD 1B67A 4WNNB 2IO5C 5JRGD 3AZMA 3B6GB 3X1SB 4KHAB 5B0YB 3AV2C 1EQZA 3MGPC 4E44A 2AROA 3AYWC 3AZKB 2LY8A 4KGCD 5JRGC 2Y2KA 2Y2LA 2YFWA 3MGPD 3W98D 3WTPE 3AZKA 2AROC 4R8PC 5CPKD 2HUEC 3B6FD 4J8WB 5B0YA 3AYWB 2AROD 3X1SA 1U35B 3KXBC 4CAYB 3REJD 4AWLC 4XZQD 1F66D 3AZFA 3AV1B 3X1UA 4R8PA 1BH9A 3A1IA 5GT3D 3MGQD 3MVDA 3AN2D 2JSSA 1M18D 3WA9D 2Y2PA 2PYOD 3AYWA 4QLCA 5F99A 5B24C 3TU4A 3AZLB 5E5AA 1KU5A 5CPJC 3AV1C 3KUYB 4YM6C 3LELB 4H9NA 2CV5B 2NQBC 1ID3D 1TAFA 2ZY5A 5BNVA 1P3OC 1T3UA 5B1MC 5BO0B 3LZ0D 1P3BB 3WKJD 4UPKA 2UWXA 3MNNC 4CSRB 4H9NB 4G92B 1KX3C 3B6FB 4HGAC 5GSUB 1P3LC 3REHD 3P5JB 2CV5C 1AOID 1EQZD 4Z66B 2Y2NA 5AVBC 5AV8D 1JFIB 5B33D 4LD9B 3AZED 1P3PC 4J8VD 1KX3A 2YFVB 1H3OB 4X23B 4DRBA 5AVCC 1KX4C 5B31G 5AVCD 5CPID 3X1SD 3X1TA 4J8XB 3WTPB 5CPIC 3REHB 5B2JC 3VH6A 3VH5W 3REJB 4J8UA 3UTBD 4X23C 1P3AB 4Z2MH 5B0ZB 4E45A 3C1BB 2Y2HA 3EPKA 1P3BA 3AZEC 5CPJD 1ID3B 4KUDD 5AY8C 3LJAB 3W96D 3O62D 3WA9C 1KX5A 3RELC 5B40C 1ZLAC 3UT9B 3AV2D 3R45A 1TZYB 4YM6A 3AZFC 4H9OB 1WWIA 1ID3C 2HUEB 2G5HC 2ZY3A 3B6GA 4WNNA 1P3FA 4J8WC 5FUGB 5B2ID 1M18B 1M19D 3V9RA 4H9RA 1ZLAB 3WKJA 4NE6A 3FDDA 4ZUXB 2HIOB 3AV1D 1BH9B 3B0DC 2F8NB 4XZQA 3REKB 5AV8A 4H9SC 3EPHA 3V9RB 2RVQD 3UTAA 3AZHA 3KSYA 4NE3A 3AFAD 1P3MB 4WU8A 2RVQC 1N1JA 3A6NB 4J8WA 4NFTA 3X1VD 1P34B 4WJ3C 3AV2A 3KXBD 3REIA 4ZUXC 2BYKA 5CPJB 3MGRD 3C1CC 3UTBC 1W2EA 2Y2JA 5CPIA 5B32G 3EPJA 1WWSA 5BS7C 3AL0C 5JA4B 3C1CD 4H9PB 4R8PD 4KHAA 1P3KD 3W99A 1P3BC 3W98C 5GT0B 3REJA 3O62C 5CP6C 3KWQA 3MGQB 3REHA 2F8NK 4XUJA 2F8NH 3NQJA 5AV9D 5GT3A 4NE5A 3X1TC 2NZDB 3X1UD 1P3PB 1KX3D 3KWQC 4YS3B 1P3GB 3O62A 5DNNC 5DNMA 5GT3B 3MNNA 3A1KA 1AOIB 1P3ID 1JFIA 4H9QB 5GT0A 1P3OD 3AZGA 5BNXA 3MGPB 5C3IC 4J8XD 4WZSB 3UTBA 5E5AD 2NZDC 3VH5A 3LZ0B 4WU8D 4H9PA 4Z5TB 5B40D 3LELD 1HTAA 3RELD 5BO0A 3C1BD 2ZM5A 3UTAD 3AZHD 1F66B 1AOIC 3AZEB 2XD1A 3UTAC 3AZHC 3IP4C 4WU8C 5AV6A 3KUYD 5B2IB 4ZBJC 1N1JB 3A6NA 4DQYB 4JJNA 3C1CA 5B33A 4J8VB 4QLCD 5E5AB 3B6GD 3AZLA 3W97C 1F66C 5AV5D 3X1SC 5B0YC 3AFAB 1P3MD 4ZBJB 4H9SA 3W97A 3REKD 3AZLC 2FJ7A 4WU9D 3LZ1B 1P3AD 5BT1C 3REKC 3AZLD 1F1EA 3MNND 1HQ3B 5AV6B 3WKJC 3H0RC 3AN2C 3NQUA 2W8SA 1TZYA 2G5IC 1P3KB 3MGSB 1P3IC 3UT9D 4KGCB 3AZMC 3AZIC 5B0ZA 5DNND 5B40A 3RELA 3WAAA 4JJNC 2JE5A 2VQRA 5AV9C 3X1VC 5BNXB 4J8XA 5B24B 3B0CW
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AOI A;  4DRA A;  4J8U C;  4KGC C;  5B1L B;  1B6W A;  3O62 B;  4YS3 A;  1P3G A;  3MGQ C;  1P3P A;  4X23 A;  5AVB A;  1TZY D;  5GXQ C;  4LD9 A;  5AV9 B;  3X1V B;  3REJ C;  5B1M B;  2YFV A;  4YS3 D;  1P3G D;  4UUZ A;  3AZG D;  1P3O A;  3MGR B;  4Z66 A;  4G92 C;  3B6F C;  3AZN B;  5GSU C;  1P3L B;  5B32 A;  5CPK C;  5JA4 A;  5GXQ B;  3AZI A;  4Z5T D;  5B40 B;  3REL B;  4LD9 C;  2CV5 A;  2PYO A;  4KUD C;  5BT1 D;  5B32 B;  5BNV B;  4Z5T C;  3LEL A;  5AVC B;  3AN2 A;  2IO5 B;  3AV2 B;  3AZJ C;  1S32 B;  4JJN D;  5B1M A;  1HQ3 A;  4WU8 B;  5AV6 D;  3KUY A;  1ULY A;  5B2I C;  5B2J B;  5B31 C;  3MVD C;  3REI C;  5AV8 B;  4Z66 D;  1P3I A;  3WAA C;  2CWE A;  3LZ1 D;  3W97 B;  5DNM D;  2HIO A;  5B0Z C;  4ZUX A;  4R8P B;  3AV1 A;  4EO5 C;  3W96 B;  3KXB A;  3REI D;  3AFA C;  5G49 B;  5AVB D;  3VH6 W;  5AY8 B;  3LJA C;  1U35 A;  1P34 C;  4AWL B;  3X1U B;  1P3P D;  5B33 C;  3AZJ D;  5AV8 C;  1P3L D;  3C1C B;  3WAA B;  3R45 B;  4CAY A;  5CHL B;  5JRG A;  1P3K A;  1KX5 B;  2FJ7 C;  3AN2 B;  3MGS D;  3AZE A;  2NZD D;  3AZK C;  2YFW B;  5JRG B;  2F8N D;  1M1A C;  3MGS C;  3C1B A;  5GSU D;  3AZM B;  1KX4 D;  3B0D B;  3AZI B;  3KUY C;  5CP6 B;  2ARO B;  3AZG C;  1Q9C A;  1EQZ B;  1KX5 C;  5B24 D;  3AZN A;  3MGP A;  3B0B A;  2FJ7 B;  3A6N C;  3WTP A;  3X1T B;  3KXB B;  1P3O B;  3W96 A;  1KX4 A;  3AFA A;  4WU9 C;  4G91 C;  5DNM B;  4KUD A;  1M1A B;  5B1L C;  5GT3 C;  2NZD A;  1P3B D;  1KX3 B;  5AV5 B;  4HGA B;  3WTP D;  1HQ3 D;  3B0C T;  5B1M D;  4J8V A;  3VH5 T;  5B31 A;  4Z66 C;  5B2I A;  1P3F D;  5GSU A;  4WU9 B;  3W99 C;  5B0Z D;  4G91 B;  5DNN A;  5DNM C;  3KWQ D;  5AVC A;  5GT0 C;  3MGR C;  4YM6 D;  1U35 D;  3W99 D;  4Z5T A;  2PYO B;  5CPK B;  4M6B A;  5GXQ A;  3REH C;  5CPI B;  2NQB B;  1P3L A;  5CPJ A;  5E5A C;  5B32 C;  5DNN B;  3MGR A;  4WU9 A;  3MNN B;  4J8U D;  5F99 B;  3TU4 B;  4QLC B;  4LD9 D;  3W98 A;  1S32 C;  5C3I B;  3X1V A;  4J8W D;  1P3M A;  5KDM A;  3WA9 B;  5AVB B;  3LZ1 A;  3NQJ B;  2F8N A;  3MVD B;  2L5A A;  1M1A A;  1TZY C;  5GXQ D;  1S32 D;  3MGQ A;  3AZF B;  3AZM D;  1KX4 B;  3B6G C;  5B24 A;  5F99 C;  3TU4 C;  4QLC C;  5FUG A;  3AZN D;  3W96 C;  5B32 D;  1M18 C;  3WTP C;  4XUJ D;  2BYM B;  5B33 B;  1P3K C;  3UT9 A;  4WV4 B;  1P3A C;  4XZQ C;  3MGS A;  3C1B C;  3LJA A;  1KX5 D;  4X23 D;  1F66 A;  3NQU B;  1ID3 A;  1U35 C;  1P34 A;  5GT0 D;  1P3F C;  1P3A A;  4J8U B;  3LZ1 C;  3UT9 C;  2BYM A;  3UTB B;  3REK A;  3W97 D;  4XZQ B;  1BH8 B;  1BFM A;  5AY8 A;  3AZG B;  1HQ3 C;  5G49 A;  5B1L D;  1EQZ C;  3AYW D;  4H9Q A;  5AV6 C;  1ZLA A;  3WKJ B;  2HIO D;  3WA9 A;  3X1T D;  1M18 A;  1P3F B;  3W98 B;  2CV5 D;  2HIO C;  1P3I B;  4H9O A;  5KDM B;  4YM6 B;  3LEL C;  3A6N D;  5AV5 C;  5B2J A;  4JJN B;  1M19 A;  1P3M C;  1S32 A;  1M1A D;  3VH6 T;  5B0Y D;  3B6F A;  3AZJ A;  4CSR A;  1R4V A;  3W99 B;  5CPK A;  1ZLA D;  2FJ7 D;  3MVD D;  3AZK D;  5AY8 D;  2NQB A;  3LZ0 A;  1TAF B;  2PYO C;  3AZJ B;  4ZUX D;  4Z2M G;  4XUJ C;  1M19 B;  5B31 B;  2BYK B;  1P34 D;  3REI B;  3LZ0 C;  4UUZ B;  5B2J D;  5CP6 D;  3LJA D;  2NQB D;  4EO5 B;  5F99 D;  3TU4 D;  3AZN C;  5AV9 A;  3UTA B;  1H3O A;  3AZH B;  3WAA D;  4J8X C;  5AV5 A;  5BS7 A;  3X1U C;  4XUJ B;  1M19 C;  1BH8 A;  2F8N G;  4J8V C;  5B1L A;  4KUD B;  4YS3 C;  3KWQ B;  4H9R B;  3AZI D;  5B31 D;  1P3G C;  1A7W A;  5CP6 A;  3AZF D;  1B67 A;  4WNN B;  2IO5 C;  5JRG D;  3AZM A;  3B6G B;  3X1S B;  4KHA B;  5B0Y B;  3AV2 C;  1EQZ A;  3MGP C;  4E44 A;  2ARO A;  3AYW C;  3AZK B;  2LY8 A;  4KGC D;  5JRG C;  2YFW A;  3MGP D;  3W98 D;  3WTP E;  3AZK A;  2ARO C;  4R8P C;  5CPK D;  2HUE C;  3B6F D;  4J8W B;  5B0Y A;  3AYW B;  2ARO D;  3X1S A;  1U35 B;  3KXB C;  4CAY B;  3REJ D;  4AWL C;  4XZQ D;  1F66 D;  3AZF A;  3AV1 B;  3X1U A;  4R8P A;  1BH9 A;  5GT3 D;  3MGQ D;  3MVD A;  3AN2 D;  2JSS A;  1M18 D;  3WA9 D;  2PYO D;  3AYW A;  4QLC A;  5F99 A;  5B24 C;  3TU4 A;  3AZL B;  5E5A A;  1KU5 A;  5CPJ C;  3AV1 C;  3KUY B;  4YM6 C;  3LEL B;  4H9N A;  2CV5 B;  2NQB C;  1ID3 D;  1TAF A;  5BNV A;  1P3O C;  5B1M C;  5BO0 B;  3LZ0 D;  1P3B B;  3WKJ D;  3MNN C;  4CSR B;  4H9N B;  4G92 B;  1KX3 C;  3B6F B;  4HGA C;  5GSU B;  1P3L C;  3REH D;  2CV5 C;  1AOI D;  1EQZ D;  4Z66 B;  5AV8 D;  5AVB C;  1JFI B;  4LD9 B;  5B33 D;  3AZE D;  1P3P C;  4J8V D;  1KX3 A;  2YFV B;  1H3O B;  4X23 B;  4DRB A;  5AVC C;  1KX4 C;  5B31 G;  5AVC D;  5CPI D;  3X1S D;  3X1T A;  4J8X B;  3WTP B;  5CPI C;  3REH B;  5B2J C;  3VH6 A;  3VH5 W;  3REJ B;  4J8U A;  3UTB D;  4X23 C;  1P3A B;  4Z2M H;  5B0Z B;  4E45 A;  3C1B B;  1P3B A;  3AZE C;  5CPJ D;  1ID3 B;  4KUD D;  5AY8 C;  3LJA B;  3W96 D;  3O62 D;  3WA9 C;  1KX5 A;  3REL C;  5B40 C;  1ZLA C;  3UT9 B;  3AV2 D;  3R45 A;  1TZY B;  4YM6 A;  3AZF C;  4H9O B;  1WWI A;  1ID3 C;  2HUE B;  3B6G A;  4WNN A;  1P3F A;  4J8W C;  5FUG B;  5B2I D;  1M18 B;  1M19 D;  3V9R A;  4H9R A;  1ZLA B;  3WKJ A;  4NE6 A;  4ZUX B;  2HIO B;  3AV1 D;  1BH9 B;  3B0D C;  2F8N B;  4XZQ A;  3REK B;  5AV8 A;  4H9S C;  3V9R B;  2RVQ D;  3UTA A;  3AZH A;  3KSY A;  4NE3 A;  3AFA D;  1P3M B;  4WU8 A;  2RVQ C;  1N1J A;  3A6N B;  4J8W A;  4NFT A;  3X1V D;  1P34 B;  3AV2 A;  3KXB D;  3REI A;  4ZUX C;  2BYK A;  5CPJ B;  3MGR D;  3C1C C;  3UTB C;  5CPI A;  5B32 G;  1WWS A;  5BS7 C;  5JA4 B;  3C1C D;  4H9P B;  4R8P D;  4KHA A;  1P3K D;  3W99 A;  1P3B C;  3W98 C;  5GT0 B;  3REJ A;  3O62 C;  5CP6 C;  3KWQ A;  3MGQ B;  3REH A;  2F8N K;  4XUJ A;  2F8N H;  3NQJ A;  5AV9 D;  5GT3 A;  4NE5 A;  3X1T C;  2NZD B;  3X1U D;  1P3P B;  1KX3 D;  3KWQ C;  4YS3 B;  1P3G B;  3O62 A;  5DNN C;  5DNM A;  5GT3 B;  3MNN A;  1AOI B;  1P3I D;  1JFI A;  4H9Q B;  5GT0 A;  1P3O D;  3AZG A;  5BNX A;  3MGP B;  5C3I C;  4J8X D;  4WZS B;  3UTB A;  5E5A D;  2NZD C;  3VH5 A;  3LZ0 B;  4WU8 D;  4H9P A;  4Z5T B;  5B40 D;  3LEL D;  1HTA A;  3REL D;  5BO0 A;  3C1B D;  4KGC A;  3UTA D;  3AZH D;  1F66 B;  1AOI C;  3AZE B;  3UTA C;  3AZH C;  4WU8 C;  5AV6 A;  3KUY D;  5B2I B;  4ZBJ C;  1N1J B;  3A6N A;  4JJN A;  3C1C A;  5B33 A;  4J8V B;  4QLC D;  5E5A B;  3B6G D;  3AZL A;  3W97 C;  1F66 C;  5AV5 D;  3X1S C;  5B0Y C;  3AFA B;  1P3M D;  4ZBJ B;  4H9S A;  3W97 A;  3REK D;  3AZL C;  2FJ7 A;  4WU9 D;  3LZ1 B;  1P3A D;  5BT1 C;  3REK C;  3AZL D;  1F1E A;  3MNN D;  1HQ3 B;  5AV6 B;  3WKJ C;  3AN2 C;  3NQU A;  1TZY A;  1P3K B;  3MGS B;  1P3I C;  3UT9 D;  4KGC B;  3AZM C;  3AZI C;  5DNN D;  5B0Z A;  5B40 A;  3REL A;  3WAA A;  4JJN C;  5AV9 C;  3X1V C;  5BNX B;  4J8X A;  5B24 B;  3B0C W; 
#chains in the Genus database with same CATH topology
 1AOI A;  4DRA A;  4J8U C;  4KGC C;  5B1L B;  1B6W A;  3O62 B;  4YS3 A;  1P3G A;  3MGQ C;  1P3P A;  3F6T A;  4X23 A;  5AVB A;  1TZY D;  5GXQ C;  4LD9 A;  5AV9 B;  3X1V B;  3REJ C;  5B1M B;  2BG1 A;  2J8P A;  2YFV A;  4YS3 D;  1P3G D;  4UUZ A;  3AZG D;  1P3O A;  3MGR B;  4Z66 A;  4G92 C;  1Z2C B;  3B6F C;  3AZN B;  5GSU C;  1P3L B;  5B32 A;  5CPK C;  5JA4 A;  5GXQ B;  3AZI A;  4Z5T D;  5B40 B;  3REL B;  4LD9 C;  2CV5 A;  2PYO A;  4KUD C;  5BT1 D;  4KGC A;  5B32 B;  5BNV B;  4Z5T C;  3LEL A;  5AVC B;  3AN2 A;  2IO5 B;  3AV2 B;  3AZJ C;  1S32 B;  2ZY2 A;  4JJN D;  5B1M A;  1HQ3 A;  4WU8 B;  2JCH A;  5AV6 D;  3KUY A;  1ULY A;  5B2I C;  5B2J B;  5B31 C;  3MVD C;  3REI C;  5AV8 B;  4Z66 D;  1P3I A;  3WAA C;  2CWE A;  3LZ1 D;  3W97 B;  5DNM D;  2HIO A;  5B0Z C;  4ZUX A;  4R8P B;  3AV1 A;  4EO5 C;  3W96 B;  3KXB A;  3REI D;  3AFA C;  5G49 B;  5AVB D;  3VH6 W;  5AY8 B;  3LJA C;  1U35 A;  1P34 C;  4AWL B;  3X1U B;  1P3P D;  5B33 C;  3AZJ D;  5AV8 C;  1P3L D;  3C1C B;  3WAA B;  3R45 B;  4CAY A;  5CHL B;  5JRG A;  1P3K A;  1KX5 B;  2FJ7 C;  3AN2 B;  3MGS D;  3EPL A;  3AZE A;  2NZD D;  3AZK C;  2YFW B;  5JRG B;  2F8N D;  1M1A C;  3MGS C;  3C1B A;  5GSU D;  3AZM B;  1KX4 D;  3B0D B;  3AZI B;  3KUY C;  5CP6 B;  2ARO B;  3AZG C;  1Q9C A;  2Y2O A;  1EQZ B;  1KX5 C;  5B24 D;  3AZN A;  3MGP A;  3B0B A;  2FJ7 B;  3A6N C;  3WTP A;  3X1T B;  3KXB B;  1P3O B;  3W96 A;  1KX4 A;  3AFA A;  4WU9 C;  4G91 C;  5DNM B;  4KUD A;  1M1A B;  5B1L C;  5GT3 C;  2NZD A;  1P3B D;  1KX3 B;  5AV5 B;  4HGA B;  2DQN C;  2RIQ A;  3WTP D;  1HQ3 D;  3B0C T;  5B1M D;  4J8V A;  3KFU G;  3VH5 T;  5B31 A;  4Z66 C;  5B2I A;  1P3F D;  5GSU A;  4WU9 B;  3W99 C;  5DNM C;  5B0Z D;  4G91 B;  2Y2G A;  5DNN A;  3KWQ D;  5AVC A;  5GT0 C;  3MGR C;  4YM6 D;  1U35 D;  3W99 D;  4Z5T A;  2PYO B;  5CPK B;  4M6B A;  5GXQ A;  3REH C;  5CPI B;  2NQB B;  1P3L A;  5CPJ A;  5E5A C;  5B32 C;  1PZR A;  5DNN B;  3MGR A;  4WU9 A;  3MNN B;  4J8U D;  5F99 B;  3TU4 B;  4QLC B;  4LD9 D;  3W98 A;  1S32 C;  5C3I B;  3X1V A;  4J8W D;  1P3M A;  5KDM A;  3WA9 B;  5AVB B;  3LZ1 A;  3NQJ B;  2F8N A;  3MVD B;  2L5A A;  1M1A A;  1TZY C;  5GXQ D;  1S32 D;  3MGQ A;  3AZF B;  3AZM D;  1KX4 B;  3B6G C;  5B24 A;  5F99 C;  3TU4 C;  4QLC C;  5FUG A;  3AZN D;  3W96 C;  5B32 D;  1M18 C;  3WTP C;  4XUJ D;  2BYM B;  5B33 B;  1P3K C;  3UT9 A;  4WV4 B;  1P3A C;  4XZQ C;  3MGS A;  3C1B C;  3LJA A;  1KX5 D;  4X23 D;  1F66 A;  3NQU B;  1ID3 A;  1U35 C;  1P34 A;  2ZY4 A;  5GT0 D;  1P3F C;  1P3A A;  4J8U B;  3LZ1 C;  3UT9 C;  2BYM A;  3UTB B;  3REK A;  3W97 D;  2XD5 A;  4XZQ B;  1BH8 B;  1BFM A;  5AY8 A;  3AZG B;  1HQ3 C;  5G49 A;  2F2A C;  5B1L D;  3AYW D;  4H9Q A;  5AV6 C;  1EQZ C;  1ZLA A;  3WKJ B;  2HIO D;  3WA9 A;  3H0L C;  3X1T D;  1M18 A;  1P3F B;  3W98 B;  2CV5 D;  2HIO C;  1P3I B;  4H9O A;  5KDM B;  4YM6 B;  3LEL C;  3A6N D;  5AV5 C;  5B2J A;  4JJN B;  1M19 A;  1P3M C;  1S32 A;  1M1A D;  3VH6 T;  5B0Y D;  3B6F A;  3AZJ A;  4CSR A;  1R4V A;  3W99 B;  5CPK A;  1ZLA D;  2FJ7 D;  3MVD D;  2Y2M A;  3AZK D;  5AY8 D;  2NQB A;  3LZ0 A;  1TAF B;  2FFF B;  2PYO C;  3AZJ B;  4ZUX D;  4Z2M G;  4XUJ C;  1M19 B;  5B31 B;  3H0M C;  2BYK B;  1P34 D;  3REI B;  3LZ0 C;  3EG5 B;  4UUZ B;  5B2J D;  5CP6 D;  3LJA D;  2NQB D;  4EO5 B;  5F99 D;  3TU4 D;  2Y2I A;  5AV9 A;  2Y2Q A;  3AZN C;  3UTA B;  1H3O A;  3AZH B;  3WAA D;  4J8X C;  5AV5 A;  5BS7 A;  3X1U C;  4XUJ B;  1M19 C;  1BH8 A;  2F8N G;  4J8V C;  5B1L A;  4KUD B;  2DF4 C;  4YS3 C;  4H9R B;  3KWQ B;  5B31 D;  3AZI D;  1A7W A;  1P3G C;  5CP6 A;  3AZF D;  1B67 A;  4WNN B;  2IO5 C;  5JRG D;  3AZM A;  3B6G B;  3X1S B;  4KHA B;  5B0Y B;  3AV2 C;  1EQZ A;  3MGP C;  4E44 A;  2ARO A;  3AYW C;  3AZK B;  2LY8 A;  4KGC D;  5JRG C;  2Y2K A;  2Y2L A;  2YFW A;  3MGP D;  3W98 D;  3WTP E;  3AZK A;  2ARO C;  4R8P C;  5CPK D;  2HUE C;  3B6F D;  4J8W B;  5B0Y A;  3AYW B;  2ARO D;  3X1S A;  1U35 B;  3KXB C;  4CAY B;  3REJ D;  4AWL C;  4XZQ D;  1F66 D;  3AZF A;  3AV1 B;  3X1U A;  4R8P A;  1BH9 A;  3A1I A;  5GT3 D;  3MGQ D;  3MVD A;  3AN2 D;  2JSS A;  1M18 D;  3WA9 D;  2Y2P A;  2PYO D;  3AYW A;  4QLC A;  5F99 A;  5B24 C;  3TU4 A;  3AZL B;  5E5A A;  1KU5 A;  5CPJ C;  3AV1 C;  3KUY B;  4YM6 C;  3LEL B;  4H9N A;  2CV5 B;  2NQB C;  1ID3 D;  1TAF A;  2ZY5 A;  5BNV A;  1P3O C;  1T3U A;  5B1M C;  5BO0 B;  3LZ0 D;  1P3B B;  3WKJ D;  4UPK A;  2UWX A;  3MNN C;  4CSR B;  4H9N B;  4G92 B;  1KX3 C;  3B6F B;  4HGA C;  5GSU B;  1P3L C;  3REH D;  3P5J B;  2CV5 C;  1AOI D;  1EQZ D;  4Z66 B;  2Y2N A;  5AVB C;  5AV8 D;  1JFI B;  5B33 D;  4LD9 B;  3AZE D;  1P3P C;  4J8V D;  1KX3 A;  2YFV B;  1H3O B;  4X23 B;  4DRB A;  5AVC C;  1KX4 C;  5B31 G;  5AVC D;  5CPI D;  3X1S D;  3X1T A;  4J8X B;  3WTP B;  5CPI C;  3REH B;  5B2J C;  3VH6 A;  3VH5 W;  3REJ B;  4J8U A;  3UTB D;  4X23 C;  1P3A B;  4Z2M H;  5B0Z B;  4E45 A;  3C1B B;  2Y2H A;  3EPK A;  1P3B A;  3AZE C;  5CPJ D;  1ID3 B;  4KUD D;  5AY8 C;  3LJA B;  3W96 D;  3O62 D;  3WA9 C;  1KX5 A;  3REL C;  5B40 C;  1ZLA C;  3UT9 B;  3AV2 D;  3R45 A;  1TZY B;  4YM6 A;  3AZF C;  4H9O B;  1WWI A;  1ID3 C;  2HUE B;  2G5H C;  2ZY3 A;  3B6G A;  4WNN A;  1P3F A;  4J8W C;  5FUG B;  5B2I D;  1M18 B;  1M19 D;  3V9R A;  4H9R A;  1ZLA B;  3WKJ A;  4NE6 A;  3FDD A;  4ZUX B;  2HIO B;  3AV1 D;  1BH9 B;  3B0D C;  2F8N B;  4XZQ A;  3REK B;  5AV8 A;  4H9S C;  3EPH A;  3V9R B;  2RVQ D;  3UTA A;  3AZH A;  3KSY A;  4NE3 A;  3AFA D;  1P3M B;  4WU8 A;  2RVQ C;  1N1J A;  3A6N B;  4J8W A;  4NFT A;  3X1V D;  1P34 B;  4WJ3 C;  3AV2 A;  3KXB D;  3REI A;  4ZUX C;  2BYK A;  5CPJ B;  3MGR D;  3C1C C;  3UTB C;  1W2E A;  2Y2J A;  5CPI A;  5B32 G;  3EPJ A;  1WWS A;  5BS7 C;  3AL0 C;  5JA4 B;  3C1C D;  4H9P B;  4R8P D;  4KHA A;  1P3K D;  3W99 A;  1P3B C;  3W98 C;  5GT0 B;  3REJ A;  3O62 C;  5CP6 C;  3KWQ A;  3MGQ B;  3REH A;  2F8N K;  4XUJ A;  2F8N H;  3NQJ A;  5AV9 D;  5GT3 A;  4NE5 A;  3X1T C;  2NZD B;  3X1U D;  1P3P B;  1KX3 D;  3KWQ C;  4YS3 B;  1P3G B;  3O62 A;  5DNN C;  5DNM A;  5GT3 B;  3MNN A;  3A1K A;  1AOI B;  1P3I D;  1JFI A;  4H9Q B;  5GT0 A;  1P3O D;  3AZG A;  5BNX A;  3MGP B;  5C3I C;  4J8X D;  4WZS B;  3UTB A;  5E5A D;  2NZD C;  3VH5 A;  3LZ0 B;  4WU8 D;  4H9P A;  4Z5T B;  5B40 D;  3LEL D;  1HTA A;  3REL D;  5BO0 A;  3C1B D;  2ZM5 A;  3UTA D;  3AZH D;  1F66 B;  1AOI C;  3AZE B;  2XD1 A;  3UTA C;  3AZH C;  3IP4 C;  4WU8 C;  5AV6 A;  3KUY D;  5B2I B;  4ZBJ C;  1N1J B;  3A6N A;  4DQY B;  4JJN A;  3C1C A;  5B33 A;  4J8V B;  4QLC D;  5E5A B;  3B6G D;  3AZL A;  3W97 C;  1F66 C;  5AV5 D;  3X1S C;  5B0Y C;  3AFA B;  1P3M D;  4ZBJ B;  4H9S A;  3W97 A;  3REK D;  3AZL C;  2FJ7 A;  4WU9 D;  3LZ1 B;  1P3A D;  5BT1 C;  3REK C;  3AZL D;  1F1E A;  3MNN D;  1HQ3 B;  5AV6 B;  3WKJ C;  3H0R C;  3AN2 C;  3NQU A;  2W8S A;  1TZY A;  2G5I C;  1P3K B;  3MGS B;  1P3I C;  3UT9 D;  4KGC B;  3AZM C;  3AZI C;  5B0Z A;  5DNN D;  5B40 A;  3REL A;  3WAA A;  4JJN C;  2JE5 A;  2VQR A;  5AV9 C;  3X1V C;  5BNX B;  4J8X A;  5B24 B;  3B0C W; 
#chains in the Genus database with same CATH homology
 1AOI A;  4DRA A;  4J8U C;  4KGC C;  5B1L B;  1B6W A;  3O62 B;  4YS3 A;  1P3G A;  3MGQ C;  1P3P A;  3F6T A;  4X23 A;  5AVB A;  1TZY D;  5GXQ C;  4LD9 A;  5AV9 B;  3X1V B;  3REJ C;  5B1M B;  2BG1 A;  2J8P A;  2YFV A;  4YS3 D;  1P3G D;  4UUZ A;  3AZG D;  1P3O A;  3MGR B;  4Z66 A;  4G92 C;  1Z2C B;  3B6F C;  3AZN B;  5GSU C;  1P3L B;  5B32 A;  5CPK C;  5JA4 A;  5GXQ B;  3AZI A;  4Z5T D;  5B40 B;  3REL B;  4LD9 C;  2CV5 A;  2PYO A;  4KUD C;  5BT1 D;  4KGC A;  5B32 B;  5BNV B;  4Z5T C;  3LEL A;  5AVC B;  3AN2 A;  2IO5 B;  3AV2 B;  3AZJ C;  1S32 B;  2ZY2 A;  4JJN D;  5B1M A;  1HQ3 A;  4WU8 B;  2JCH A;  5AV6 D;  3KUY A;  1ULY A;  5B2I C;  5B2J B;  5B31 C;  3MVD C;  3REI C;  5AV8 B;  4Z66 D;  1P3I A;  3WAA C;  2CWE A;  3LZ1 D;  3W97 B;  5DNM D;  2HIO A;  5B0Z C;  4ZUX A;  4R8P B;  3AV1 A;  4EO5 C;  3W96 B;  3KXB A;  3REI D;  3AFA C;  5G49 B;  5AVB D;  3VH6 W;  5AY8 B;  3LJA C;  1U35 A;  1P34 C;  4AWL B;  3X1U B;  1P3P D;  5B33 C;  3AZJ D;  5AV8 C;  1P3L D;  3C1C B;  3WAA B;  3R45 B;  4CAY A;  5CHL B;  5JRG A;  1P3K A;  1KX5 B;  2FJ7 C;  3AN2 B;  3MGS D;  3EPL A;  3AZE A;  2NZD D;  3AZK C;  2YFW B;  5JRG B;  2F8N D;  1M1A C;  3MGS C;  3C1B A;  5GSU D;  3AZM B;  1KX4 D;  3B0D B;  3AZI B;  3KUY C;  5CP6 B;  2ARO B;  3AZG C;  1Q9C A;  2Y2O A;  1EQZ B;  1KX5 C;  5B24 D;  3AZN A;  3MGP A;  3B0B A;  2FJ7 B;  3A6N C;  3WTP A;  3X1T B;  3KXB B;  1P3O B;  3W96 A;  1KX4 A;  3AFA A;  4WU9 C;  4G91 C;  5DNM B;  4KUD A;  1M1A B;  5B1L C;  5GT3 C;  2NZD A;  1P3B D;  1KX3 B;  5AV5 B;  4HGA B;  2DQN C;  2RIQ A;  3WTP D;  1HQ3 D;  3B0C T;  5B1M D;  4J8V A;  3KFU G;  3VH5 T;  5B31 A;  4Z66 C;  5B2I A;  1P3F D;  5GSU A;  4WU9 B;  3W99 C;  5DNM C;  5B0Z D;  4G91 B;  2Y2G A;  5DNN A;  3KWQ D;  5AVC A;  5GT0 C;  3MGR C;  4YM6 D;  1U35 D;  3W99 D;  4Z5T A;  2PYO B;  5CPK B;  4M6B A;  5GXQ A;  3REH C;  5CPI B;  2NQB B;  1P3L A;  5CPJ A;  5E5A C;  5B32 C;  1PZR A;  5DNN B;  3MGR A;  4WU9 A;  3MNN B;  4J8U D;  5F99 B;  3TU4 B;  4QLC B;  4LD9 D;  3W98 A;  1S32 C;  5C3I B;  3X1V A;  4J8W D;  1P3M A;  5KDM A;  3WA9 B;  5AVB B;  3LZ1 A;  3NQJ B;  2F8N A;  3MVD B;  2L5A A;  1M1A A;  1TZY C;  5GXQ D;  1S32 D;  3MGQ A;  3AZF B;  3AZM D;  1KX4 B;  3B6G C;  5B24 A;  5F99 C;  3TU4 C;  4QLC C;  5FUG A;  3AZN D;  3W96 C;  5B32 D;  1M18 C;  3WTP C;  4XUJ D;  2BYM B;  5B33 B;  1P3K C;  3UT9 A;  4WV4 B;  1P3A C;  4XZQ C;  3MGS A;  3C1B C;  3LJA A;  1KX5 D;  4X23 D;  1F66 A;  3NQU B;  1ID3 A;  1U35 C;  1P34 A;  2ZY4 A;  5GT0 D;  1P3F C;  1P3A A;  4J8U B;  3LZ1 C;  3UT9 C;  2BYM A;  3UTB B;  3REK A;  3W97 D;  2XD5 A;  4XZQ B;  1BH8 B;  1BFM A;  5AY8 A;  3AZG B;  1HQ3 C;  5G49 A;  2F2A C;  5B1L D;  3AYW D;  4H9Q A;  5AV6 C;  1EQZ C;  1ZLA A;  3WKJ B;  2HIO D;  3WA9 A;  3H0L C;  3X1T D;  1M18 A;  1P3F B;  3W98 B;  2CV5 D;  2HIO C;  1P3I B;  4H9O A;  5KDM B;  4YM6 B;  3LEL C;  3A6N D;  5AV5 C;  5B2J A;  4JJN B;  1M19 A;  1P3M C;  1S32 A;  1M1A D;  3VH6 T;  5B0Y D;  3B6F A;  3AZJ A;  4CSR A;  1R4V A;  3W99 B;  5CPK A;  1ZLA D;  2FJ7 D;  3MVD D;  2Y2M A;  3AZK D;  5AY8 D;  2NQB A;  3LZ0 A;  1TAF B;  2FFF B;  2PYO C;  3AZJ B;  4ZUX D;  4Z2M G;  4XUJ C;  1M19 B;  5B31 B;  3H0M C;  2BYK B;  1P34 D;  3REI B;  3LZ0 C;  3EG5 B;  4UUZ B;  5B2J D;  5CP6 D;  3LJA D;  2NQB D;  4EO5 B;  5F99 D;  3TU4 D;  2Y2I A;  5AV9 A;  2Y2Q A;  3AZN C;  3UTA B;  1H3O A;  3AZH B;  3WAA D;  4J8X C;  5AV5 A;  5BS7 A;  3X1U C;  4XUJ B;  1M19 C;  1BH8 A;  2F8N G;  4J8V C;  5B1L A;  4KUD B;  2DF4 C;  4YS3 C;  4H9R B;  3KWQ B;  5B31 D;  3AZI D;  1A7W A;  1P3G C;  5CP6 A;  3AZF D;  1B67 A;  4WNN B;  2IO5 C;  5JRG D;  3AZM A;  3B6G B;  3X1S B;  4KHA B;  5B0Y B;  3AV2 C;  1EQZ A;  3MGP C;  4E44 A;  2ARO A;  3AYW C;  3AZK B;  2LY8 A;  4KGC D;  5JRG C;  2Y2K A;  2Y2L A;  2YFW A;  3MGP D;  3W98 D;  3WTP E;  3AZK A;  2ARO C;  4R8P C;  5CPK D;  2HUE C;  3B6F D;  4J8W B;  5B0Y A;  3AYW B;  2ARO D;  3X1S A;  1U35 B;  3KXB C;  4CAY B;  3REJ D;  4AWL C;  4XZQ D;  1F66 D;  3AZF A;  3AV1 B;  3X1U A;  4R8P A;  1BH9 A;  3A1I A;  5GT3 D;  3MGQ D;  3MVD A;  3AN2 D;  2JSS A;  1M18 D;  3WA9 D;  2Y2P A;  2PYO D;  3AYW A;  4QLC A;  5F99 A;  5B24 C;  3TU4 A;  3AZL B;  5E5A A;  1KU5 A;  5CPJ C;  3AV1 C;  3KUY B;  4YM6 C;  3LEL B;  4H9N A;  2CV5 B;  2NQB C;  1ID3 D;  1TAF A;  2ZY5 A;  5BNV A;  1P3O C;  1T3U A;  5B1M C;  5BO0 B;  3LZ0 D;  1P3B B;  3WKJ D;  4UPK A;  2UWX A;  3MNN C;  4CSR B;  4H9N B;  4G92 B;  1KX3 C;  3B6F B;  4HGA C;  5GSU B;  1P3L C;  3REH D;  3P5J B;  2CV5 C;  1AOI D;  1EQZ D;  4Z66 B;  2Y2N A;  5AVB C;  5AV8 D;  1JFI B;  5B33 D;  4LD9 B;  3AZE D;  1P3P C;  4J8V D;  1KX3 A;  2YFV B;  1H3O B;  4X23 B;  4DRB A;  5AVC C;  1KX4 C;  5B31 G;  5AVC D;  5CPI D;  3X1S D;  3X1T A;  4J8X B;  3WTP B;  5CPI C;  3REH B;  5B2J C;  3VH6 A;  3VH5 W;  3REJ B;  4J8U A;  3UTB D;  4X23 C;  1P3A B;  4Z2M H;  5B0Z B;  4E45 A;  3C1B B;  2Y2H A;  3EPK A;  1P3B A;  3AZE C;  5CPJ D;  1ID3 B;  4KUD D;  5AY8 C;  3LJA B;  3W96 D;  3O62 D;  3WA9 C;  1KX5 A;  3REL C;  5B40 C;  1ZLA C;  3UT9 B;  3AV2 D;  3R45 A;  1TZY B;  4YM6 A;  3AZF C;  4H9O B;  1WWI A;  1ID3 C;  2HUE B;  2G5H C;  2ZY3 A;  3B6G A;  4WNN A;  1P3F A;  4J8W C;  5FUG B;  5B2I D;  1M18 B;  1M19 D;  3V9R A;  4H9R A;  1ZLA B;  3WKJ A;  4NE6 A;  3FDD A;  4ZUX B;  2HIO B;  3AV1 D;  1BH9 B;  3B0D C;  2F8N B;  4XZQ A;  3REK B;  5AV8 A;  4H9S C;  3EPH A;  3V9R B;  2RVQ D;  3UTA A;  3AZH A;  3KSY A;  4NE3 A;  3AFA D;  1P3M B;  4WU8 A;  2RVQ C;  1N1J A;  3A6N B;  4J8W A;  4NFT A;  3X1V D;  1P34 B;  4WJ3 C;  3AV2 A;  3KXB D;  3REI A;  4ZUX C;  2BYK A;  5CPJ B;  3MGR D;  3C1C C;  3UTB C;  1W2E A;  2Y2J A;  5CPI A;  5B32 G;  3EPJ A;  1WWS A;  5BS7 C;  3AL0 C;  5JA4 B;  3C1C D;  4H9P B;  4R8P D;  4KHA A;  1P3K D;  3W99 A;  1P3B C;  3W98 C;  5GT0 B;  3REJ A;  3O62 C;  5CP6 C;  3KWQ A;  3MGQ B;  3REH A;  2F8N K;  4XUJ A;  2F8N H;  3NQJ A;  5AV9 D;  5GT3 A;  4NE5 A;  3X1T C;  2NZD B;  3X1U D;  1P3P B;  1KX3 D;  3KWQ C;  4YS3 B;  1P3G B;  3O62 A;  5DNN C;  5DNM A;  5GT3 B;  3MNN A;  3A1K A;  1AOI B;  1P3I D;  1JFI A;  4H9Q B;  5GT0 A;  1P3O D;  3AZG A;  5BNX A;  3MGP B;  5C3I C;  4J8X D;  4WZS B;  3UTB A;  5E5A D;  2NZD C;  3VH5 A;  3LZ0 B;  4WU8 D;  4H9P A;  4Z5T B;  5B40 D;  3LEL D;  1HTA A;  3REL D;  5BO0 A;  3C1B D;  2ZM5 A;  3UTA D;  3AZH D;  1F66 B;  1AOI C;  3AZE B;  2XD1 A;  3UTA C;  3AZH C;  3IP4 C;  4WU8 C;  5AV6 A;  3KUY D;  5B2I B;  4ZBJ C;  1N1J B;  3A6N A;  4DQY B;  4JJN A;  3C1C A;  5B33 A;  4J8V B;  4QLC D;  5E5A B;  3B6G D;  3AZL A;  3W97 C;  1F66 C;  5AV5 D;  3X1S C;  5B0Y C;  3AFA B;  1P3M D;  4ZBJ B;  4H9S A;  3W97 A;  3REK D;  3AZL C;  2FJ7 A;  4WU9 D;  3LZ1 B;  1P3A D;  5BT1 C;  3REK C;  3AZL D;  1F1E A;  3MNN D;  1HQ3 B;  5AV6 B;  3WKJ C;  3H0R C;  3AN2 C;  3NQU A;  2W8S A;  1TZY A;  2G5I C;  1P3K B;  3MGS B;  1P3I C;  3UT9 D;  4KGC B;  3AZM C;  3AZI C;  5B0Z A;  5DNN D;  5B40 A;  3REL A;  3WAA A;  4JJN C;  2JE5 A;  2VQR A;  5AV9 C;  3X1V C;  5BNX B;  4J8X A;  5B24 B;  3B0C W; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...