1P3PB

Crystallographic studies of nucleosome core particles containing histone 'sin' mutants
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
81
structure length
81
Chain Sequence
b'LRDNIQGITKPAIRRLARRGGIKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Palindromic 146bp Human Alpha-Satellite DNA fragment
molecule tags Structural protein/dna
source organism Homo sapiens
publication title Crystal structures of histone Sin mutant nucleosomes reveal altered protein-DNA interactions
pubmed doi rcsb
total genus 24
structure length 81
sequence length 81
chains with identical sequence F
ec nomenclature
pdb deposition date 2003-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1p3pB00
3LZ0B 1P3GB 3R45B 5CPKA 3MNNA 3AZND 1M19A 3WA9C 3WTPA 5GSUB 5JRGD 1M1AB 5GT0A 3VH5T 3AZGA 3X1VB 4LD9C 5AV6D 1H3OB 2FJ7D 5B24B 5B40D 1WWSA 3A6NB 1U35B 3X1VD 1P3PA 3KXBC 3REJC 5AV8D 3RELC 5JA4A 5GSUD 4LD9D 4E44A 5B32A 3UTBC 1HQ3C 4M6BA 4KUDB 4Z5TC 3O62D 4ZUXD 3TU4C 5B1MA 3MGRC 1AOID 2F8NB 3AZFB 4Z2MG 4J8VA 4J8UC 3RELA 4QLCB 4WZSB 5AV8B 5BS7A 4R8PD 2AROB 3A6ND 3KWQD 3UTAA 4J8XC 5AVCD 1P3AB 1JFIB 3MGRD 5B33B 4J8WB 4J8UA 3AZKB 4WU8B 5CPKD 3AZNA 5JRGA 3W97C 3LELC 4J8WD 3AV1C 2HIOC 3LZ1A 1N1JB 5AV6A 5GXQC 5DNNC 3REKC 1A7WA 2NQBA 1EQZB 5B0ZC 3AN2A 1P3PB 3AN2B 1P3OD 3WTPC 3KXBA 5AV9B 2FJ7C 3MVDC 3WTPB 5GSUA 3KSYA 3C1BC 1KX4C 3WKJB 5B2JC 4LD9A 3LELD 5AY8D 3X1SB 1F66C 1ID3A 1M1AA 5C3IC 1S32B 1P34D 2YFVB 3AV1B 3VH6W 1P3FB 3MVDD 3LZ0A 4Z66C 2CV5A 4JJNA 3B6FC 3B6GC 3KWQA 1KX5B 3WAAB 4X23D 1P3KC 3MGRA 4J8UD 3KUYC 4WU9B 2NZDB 4J8XB 4J8WC 3AZNB 4HGAC 5B31G 5FUGB 3REHC 5FUGA 3AV1D 1P3AC 3O62C 1TAFA 4Z5TD 5CPID 3AZLA 3W97A 4CSRA 5F99B 1P3LB 4KUDC 3MGSC 5B0YB 1TZYB 5G49A 3VH5W 2NQBD 1P3KB 5B0ZA 3AZIB 4Z2MH 1P3OB 1KX5C 5B2IC 4H9NB 5B32G 5AVBD 5B24A 4CAYB 4J8VB 2HIOA 5KDMA 4KUDD 4ZUXC 3TU4D 1AOIC 5CPIB 1ID3D 1M1AC 5B32B 4XZQB 5B2JD 3MNNC 3AV2A 1M19C 3WA9A 3W96D 1P34A 5AV5C 1P3GA 1B67A 3W99B 3MVDA 3LZ0D 4H9RB 3C1BA 1KX4A 5B33D 3X1VC 4JJNC 1P3MD 5GT3C 3AZEA 1KX3A 5GXQD 1P3BB 5B0ZB 1P3PC 3AV2C 4Z66D 2CWEA 4XZQD 3C1CC 4AWLC 3LJAD 4Z5TA 5CPIA 3W97B 3AZLD 3NQUB 4UUZB 1ZLAD 4KGCB 4G92C 4H9NA 3C1CA 3NQJB 4J8XD 1P3PD 4DRAA 3MGQB 3X1UB 3UTAC 5B0ZD 1P3BD 2IO5C 5BNXA 5BNXB 5B2IA 2AROC 3B6FB 5B40C 3MGQA 5E5AC 3W98D 2HIOD 4CSRB 5DNMC 1TAFB 4WU8D 5JRGC 3WA9D 5CPJB 3MGRB 1P3GD 4KGCC 1P3BC 3WKJA 3W99C 3X1UD 5GT3B 5AV5B 3KXBB 5AV9C 3AZED 2F8NH 1KX3D 3A6NC 5BO0A 2NQBC 5BO0B 4R8PC 1EQZD 2YFVA 3AV2B 4XZQA 3MGPB 2LY8A 2F8NK 2JSSA 3W99A 4XUJD 3LJAA 5CPJA 3LJAB 5CPIC 3AZHA 3LELB 3LZ1D 3WA9B 4LD9B 5B31C 3AZKA 4XZQC 3C1CD 3AN2D 1P3OA 5KDMB 3KXBD 5GT3D 2YFWB 3UT9A 3X1TB 2PYOD 2PYOC 5B2IB 1TZYC 2BYMA 2HUEB 3B6GA 2AROA 4J8VC 3AFAB 1P3KA 3MGQD 3W96B 3W98A 5JRGB 1M1AD 3W96C 3UT9C 3AZFC 5F99C 4H9OB 5DNMB 3REHB 1P3LC 5B1LA 3NQUA 4UUZA 4WU8A 3W98B 5AY8C 3O62B 2CV5D 1F66D 5BNVA 5CP6D 3REIC 3WKJD 2HUEC 4WU9A 4X23A 3X1UA 3AFAA 3WAAC 4Z66B 5B0YD 1HTAA 3AV1A 3B6GB 1KX5A 3MGSD 4YM6C 3W97D 4WNNB 3MGPC 4XUJA 3REHD 3AZHC 3AZHD 4H9QA 3R45A 5BT1C 1ID3B 5C3IB 1S32C 1M18C 4H9PB 3AZKD 4YM6D 5GT3A 3MGPA 5B24D 2FJ7B 1WWIA 2PYOA 3B6GD 3AN2C 1KX3C 3MVDB 4NE5A 3TU4A 5GT0B 5B2JA 5E5AB 5BT1D 1P3IC 5B1LD 3C1BD 1KX4D 5B33A 4NE6A 3VH6A 2L5AA 3REJA 4NFTA 5CP6A 3KUYA 5AV8C 3AZID 3W98C 2IO5B 4QLCC 4Z66A 3X1UC 1HQ3A 1TZYD 3B6FA 3B0CT 5B0YA 3AZJD 5B33C 3MGSA 5DNND 3REKD 2CV5B 1HQ3B 5AV6C 1BH9A 4E45A 3REIA 3VH5A 1ZLAA 3C1CB 4QLCA 4H9OA 3REHA 3REJB 3V9RA 1BH8A 2NZDC 4J8XA 2RVQD 4EO5B 3TU4B 4YM6A 1P3BA 5B2ID 2PYOB 3X1TC 4JJNB 3AZMA 1R4VA 4ZBJB 3AZEB 5B24C 1U35C 4ZUXB 1M18A 1AOIB 3LZ0C 5B32C 3MNNB 1F1EA 1M19B 2RVQC 3LJAC 4H9PA 3X1SC 4H9QB 3B0BA 5DNMD 3REJD 5B31A 3AYWB 3KUYD 2F8NG 5GSUC 1U35D 3AZIA 4WNNA 3WTPE 5BS7C 3UTBA 3B0DB 1EQZA 1P3AA 1TZYA 5G49B 4CAYA 3B6FD 5B0YC 5AV6B 3AZJA 3W99D 5CPJD 4YS3A 4HGAB 3REID 3KUYB 1BH8B 2CV5C 2F8NA 5B1LC 4WU8C 3AZNC 5F99A 1P3LA 1B6WA 4G91B 3UT9D 4KHAB 3MGQC 3AZLB 5AVCB 5JA4B 3WTPD 3UTAB 2AROD 5GT0D 4X23C 1P3KD 3AZGD 3WAAA 1KX3B 3NQJA 3AZMD 1P3FC 2BYMB 2FJ7A 5CP6B 3B0DC 5B40A 5B1MB 1M18D 3LZ1C 3X1VA 1ULYA 3AYWC 1F66A 5CPKC 4XUJC 5B2JB 5B32D 2NZDD 4WU9D 3AZHB 3AFAD 1U35A 5GXQB 1KX5D 4ZUXA 1M18B 5B1MD 1P3MB 1AOIA 3X1TD 5AV9A 1BFMA 3AZMB 3AZJC 4R8PA 3AZGB 1P34C 4YS3D 5AV5A 5AVCA 3AZIC 2F8ND 5F99D 1P3LD 5AY8B 3X1SD 1P3IA 1JFIA 3MGPD 4EO5C 3MGSB 4YS3C 1P3OC 1BH9B 3REIB 4YS3B 4J8WA 3B0CW 4J8UB 3WAAD 2BYKA 2YFWA 5BNVB 3UT9B 1Q9CA 1ZLAC 4WU9C 4H9SC 4Z5TB 5B31B 3AYWA 3AFAC 3AZFA 3LELA 2NZDA 5AY8A 1P3IB 1HQ3D 4DRBA 5E5AA 3AZJB 4H9SA 3KWQB 5DNNA 3REKA 1H3OA 3X1TA 4ZBJC 5AV9D 3AZEC 4R8PB 3AZMC 1P3FD 5GT0C 2NQBB 4QLCD 3AZGC 4JJND 1S32D 5AV5D 1P34B 1P3MC 1P3GC 1N1JA 4KGCD 3LZ1B 4H9RA 3C1BB 1KX4B 3WKJC 1F66B 4XUJB 1ID3C 3MNND 3X1SA 1P3ID 1M19D 3V9RB 1KU5A 5CPKB 4NE3A 1EQZC 2HIOB 5AVCC 5AVBC 4X23B 5B40B 3KWQC 5CPJC 2BYKB 5DNNB 3REKB 5B1MC 4YM6B 5CP6C 5AV8A 3AZKC 5DNMA 3AYWD 5B31D 5AVBA 3AZFD 4G91C 3AZLC 4KHAA 3O62A 3VH6T 1ZLAB 4KUDA 3UTBD 5B1LB 4WV4B 4G92B 1P3AD 5AVBB 4J8VD 3RELD 5E5AD 3AV2D 3W96A 3A6NA 3UTAD 1P3FA 3RELB 1P3MA 1S32A 5CHLB 4AWLB 4KGCA 3UTBB 5GXQA
chains in the Genus database with same CATH superfamily
3LZ0B 1P3GB 1W2EA 3R45B 5CPKA 2Y2OA 3MNNA 3AZND 1M19A 3WA9C 5GSUB 3WTPA 5JRGD 1M1AB 5GT0A 1T3UA 3VH5T 3AZGA 3X1VB 4LD9C 2ZM5A 5AV6D 1H3OB 2FJ7D 5B24B 5B40D 2DQNC 2Y2KA 1WWSA 3A6NB 1U35B 3X1VD 1P3PA 3KXBC 3REJC 5AV8D 3RELC 5JA4A 5GSUD 4LD9D 4E44A 5B32A 3UTBC 1HQ3C 4M6BA 4KUDB 4Z5TC 3O62D 4ZUXD 3TU4C 5B1MA 3MGRC 4DQYB 1AOID 3AZFB 2DF4C 4Z2MG 4J8UC 4J8VA 3RELA 4QLCB 4WZSB 5AV8B 5BS7A 4R8PD 2AROB 3A6ND 3KWQD 3UTAA 4J8XC 5AVCD 1P3AB 1JFIB 3MGRD 5B33B 4J8WB 4J8UA 3AZKB 4WU8B 5CPKD 3AZNA 5JRGA 3W97C 3LELC 4J8WD 3AV1C 2HIOC 3LZ1A 1N1JB 5AV6A 5GXQC 5DNNC 3REKC 1A7WA 2NQBA 1EQZB 5B0ZC 3AN2A 1P3PB 3AN2B 1P3OD 3WTPC 3KXBA 5AV9B 2FJ7C 3MVDC 2RIQA 3WTPB 3KSYA 5GSUA 3C1BC 1KX4C 5B2JC 2BG1A 3LELD 3WKJB 4LD9A 5AY8D 3X1SB 1F66C 1ID3A 1M1AA 5C3IC 1S32B 1P34D 2YFVB 3AV1B 3VH6W 2JE5A 1P3FB 3MVDD 3LZ0A 4Z66C 2CV5A 4JJNA 3B6FC 3B6GC 3KWQA 1KX5B 3WAAB 4X23D 1P3KC 3MGRA 4J8UD 3KUYC 4WU9B 2NZDB 4J8XB 4J8WC 3AZNB 4HGAC 5B31G 5FUGB 3REHC 5FUGA 3AV1D 1P3AC 4Z5TD 1TAFA 3O62C 5CPID 3AZLA 2J8PA 3W97A 4CSRA 5F99B 1P3LB 4KUDC 2Y2LA 3MGSC 5B0YB 1TZYB 5G49A 3VH5W 2NQBD 1P3KB 5B0ZA 1PZRA 3AZIB 2Y2GA 4Z2MH 1P3OB 1KX5C 5B2IC 4H9NB 5B32G 5AVBD 5B24A 4CAYB 4J8VB 4WJ3C 2HIOA 5KDMA 4KUDD 4ZUXC 3TU4D 1AOIC 5CPIB 1ID3D 1M1AC 5B32B 4XZQB 5B2JD 3MNNC 3AV2A 1M19C 3WA9A 3W96D 1P34A 5AV5C 1P3GA 1B67A 3W99B 3MVDA 3LZ0D 4H9RB 3C1BA 1KX4A 5B33D 3X1VC 4JJNC 1P3MD 5GT3C 3AZEA 1KX3A 5GXQD 1P3BB 5B0ZB 1P3PC 3AV2C 1Z2CB 4Z66D 2CWEA 4XZQD 3C1CC 2Y2JA 4AWLC 2XD1A 3LJAD 4Z5TA 5CPIA 3W97B 3AZLD 3F6TA 3NQUB 4UUZB 1ZLAD 4KGCB 2Y2NA 4G92C 4H9NA 3C1CA 3NQJB 4J8XD 1P3PD 4DRAA 3MGQB 2F2AC 3X1UB 3UTAC 5B0ZD 1P3BD 2IO5C 5BNXA 5BNXB 5B2IA 2AROC 2Y2MA 3B6FB 5B40C 3MGQA 5E5AC 3W98D 2HIOD 4CSRB 5DNMC 1TAFB 2Y2QA 4WU8D 5JRGC 3WA9D 5CPJB 3MGRB 1P3GD 4KGCC 1P3BC 3WKJA 3W99C 3X1UD 5GT3B 5AV5B 3KXBB 5AV9C 3AZED 2F8NH 1KX3D 3A6NC 5BO0A 2NQBC 5BO0B 4R8PC 1EQZD 2YFVA 3AV2B 4XZQA 3MGPB 2LY8A 2F8NK 2JSSA 3W99A 4XUJD 3LJAA 5CPJA 3LJAB 5CPIC 3AZHA 3LELB 3EPJA 3AL0C 3LZ1D 3WA9B 4LD9B 3IP4C 5B31C 3AZKA 4XZQC 3C1CD 3AN2D 1P3OA 5KDMB 3KXBD 5GT3D 2YFWB 3UT9A 3X1TB 2F8NB 2PYOD 2PYOC 5B2IB 1TZYC 2BYMA 2HUEB 3B6GA 2AROA 4J8VC 3AFAB 1P3KA 3MGQD 3W96B 3W98A 5JRGB 1M1AD 3W96C 3UT9C 3AZFC 5F99C 4H9OB 5DNMB 3REHB 1P3LC 5B1LA 3NQUA 4UUZA 4WU8A 3W98B 5AY8C 3O62B 2CV5D 1F66D 5BNVA 5CP6D 3REIC 3EPKA 3WKJD 2HUEC 4WU9A 4X23A 3X1UA 3AFAA 3WAAC 4Z66B 5B0YD 1HTAA 3AV1A 3B6GB 1KX5A 3MGSD 4YM6C 2ZY5A 3W97D 4WNNB 3MGPC 4XUJA 3REHD 3AZHC 3AZHD 3H0RC 4H9QA 3R45A 5BT1C 2Y2HA 1ID3B 5C3IB 1S32C 1M18C 4H9PB 3AZKD 4YM6D 2G5IC 2Y2IA 5GT3A 3MGPA 5B24D 2FJ7B 1WWIA 2PYOA 3B6GD 3AN2C 1KX3C 3MVDB 4NE5A 3TU4A 5GT0B 5B2JA 5E5AB 5BT1D 2W8SA 1P3IC 5B1LD 3C1BD 1KX4D 5B33A 3FDDA 4NE6A 3VH6A 2L5AA 3REJA 4NFTA 5CP6A 3KUYA 5AV8C 3A1KA 3AZID 3W98C 3KFUG 2IO5B 4QLCC 4Z66A 3X1UC 1HQ3A 1TZYD 2ZY4A 3B6FA 3B0CT 5B0YA 3AZJD 5B33C 3MGSA 5DNND 3REKD 2CV5B 1HQ3B 2ZY3A 5AV6C 1BH9A 2JCHA 4E45A 3VH5A 3REIA 1ZLAA 3C1CB 4QLCA 4H9OA 3REHA 3REJB 3V9RA 1BH8A 2NZDC 4J8XA 2RVQD 4EO5B 3TU4B 4YM6A 1P3BA 5B2ID 2PYOB 3X1TC 3H0MC 4JJNB 3AZMA 1R4VA 4ZBJB 3AZEB 5B24C 1U35C 4ZUXB 1M18A 1AOIB 3LZ0C 5B32C 3MNNB 1F1EA 2ZY2A 1M19B 2RVQC 3LJAC 4H9PA 3X1SC 4H9QB 3B0BA 5DNMD 3REJD 5B31A 3AYWB 3KUYD 2F8NG 5GSUC 1U35D 3AZIA 4WNNA 3WTPE 5BS7C 3UTBA 3B0DB 1EQZA 1P3AA 1TZYA 5G49B 4CAYA 3B6FD 5B0YC 5AV6B 3AZJA 2XD5A 3W99D 5CPJD 4YS3A 4HGAB 3REID 3KUYB 1BH8B 2CV5C 2F8NA 5B1LC 4WU8C 3AZNC 5F99A 1P3LA 1B6WA 4UPKA 4G91B 3UT9D 4KHAB 3MGQC 3AZLB 5AVCB 5JA4B 3WTPD 3UTAB 2AROD 5GT0D 4X23C 1P3KD 3EG5B 3AZGD 3WAAA 1KX3B 3NQJA 3AZMD 1P3FC 2BYMB 2FJ7A 5CP6B 3B0DC 5B40A 5B1MB 1M18D 3LZ1C 3X1VA 1ULYA 3AYWC 1F66A 5CPKC 4XUJC 5B2JB 5B32D 2NZDD 4WU9D 3AZHB 3AFAD 1U35A 5GXQB 1KX5D 4ZUXA 1M18B 5B1MD 1P3MB 1AOIA 3X1TD 5AV9A 1BFMA 3AZMB 3AZJC 4R8PA 3AZGB 1P34C 3EPHA 4YS3D 5AV5A 5AVCA 3AZIC 2F8ND 2G5HC 5F99D 1P3LD 5AY8B 3X1SD 1P3IA 1JFIA 3MGPD 4EO5C 3MGSB 4YS3C 2Y2PA 3H0LC 1P3OC 1BH9B 3REIB 2VQRA 4YS3B 4J8WA 3B0CW 4J8UB 3WAAD 2BYKA 2YFWA 5BNVB 3UT9B 1Q9CA 1ZLAC 4WU9C 4H9SC 4Z5TB 5B31B 3AYWA 3AFAC 3A1IA 3AZFA 3LELA 2NZDA 5AY8A 1P3IB 1HQ3D 4DRBA 5E5AA 3AZJB 4H9SA 3KWQB 5DNNA 3REKA 1H3OA 3X1TA 4ZBJC 5AV9D 3AZEC 4R8PB 3AZMC 1P3FD 5GT0C 2NQBB 2FFFB 4QLCD 3AZGC 4JJND 1S32D 5AV5D 1P34B 1P3MC 1P3GC 1N1JA 4KGCD 3LZ1B 4H9RA 3C1BB 1KX4B 3WKJC 1F66B 4XUJB 1ID3C 3MNND 3X1SA 1P3ID 2UWXA 1M19D 3V9RB 1KU5A 5CPKB 4NE3A 1EQZC 2HIOB 5AVCC 5AVBC 4X23B 5B40B 3KWQC 5CPJC 2BYKB 5DNNB 3REKB 5B1MC 4YM6B 3EPLA 5CP6C 5AV8A 3AZKC 5DNMA 3AYWD 5B31D 5AVBA 3AZFD 4G91C 3AZLC 4KHAA 3O62A 3VH6T 1ZLAB 4KUDA 3UTBD 5B1LB 4WV4B 4G92B 1P3AD 5AVBB 4J8VD 3RELD 5E5AD 3AV2D 3W96A 3A6NA 3UTAD 1P3FA 3P5JB 3RELB 1P3MA 1S32A 5CHLB 4AWLB 4KGCA 3UTBB 5GXQA
chains in the Genus database with same CATH topology
3LZ0B 1P3GB 1W2EA 3R45B 5CPKA 2Y2OA 3MNNA 3AZND 1M19A 3WA9C 5GSUB 3WTPA 5JRGD 1M1AB 5GT0A 1T3UA 3VH5T 3AZGA 3X1VB 4LD9C 2ZM5A 5AV6D 1H3OB 2FJ7D 5B24B 5B40D 2DQNC 2Y2KA 1WWSA 3A6NB 1U35B 3X1VD 1P3PA 3KXBC 3REJC 5AV8D 3RELC 5JA4A 5GSUD 4LD9D 4E44A 5B32A 3UTBC 1HQ3C 4M6BA 4KUDB 4Z5TC 3O62D 4ZUXD 3TU4C 5B1MA 3MGRC 4DQYB 1AOID 3AZFB 2DF4C 4Z2MG 4J8UC 4J8VA 3RELA 4QLCB 4WZSB 5AV8B 5BS7A 4R8PD 2AROB 3A6ND 3KWQD 3UTAA 4J8XC 5AVCD 1P3AB 1JFIB 3MGRD 5B33B 4J8WB 4J8UA 3AZKB 4WU8B 5CPKD 3AZNA 5JRGA 3W97C 3LELC 4J8WD 3AV1C 2HIOC 3LZ1A 1N1JB 5AV6A 5GXQC 5DNNC 3REKC 1A7WA 2NQBA 1EQZB 5B0ZC 3AN2A 1P3PB 3AN2B 1P3OD 3WTPC 3KXBA 5AV9B 2FJ7C 3MVDC 2RIQA 3WTPB 3KSYA 5GSUA 3C1BC 1KX4C 5B2JC 2BG1A 3LELD 3WKJB 4LD9A 5AY8D 3X1SB 1F66C 1ID3A 1M1AA 5C3IC 1S32B 1P34D 2YFVB 3AV1B 3VH6W 2JE5A 1P3FB 3MVDD 3LZ0A 4Z66C 2CV5A 4JJNA 3B6FC 3B6GC 3KWQA 1KX5B 3WAAB 4X23D 1P3KC 3MGRA 4J8UD 3KUYC 4WU9B 2NZDB 4J8XB 4J8WC 3AZNB 4HGAC 5B31G 5FUGB 3REHC 5FUGA 3AV1D 1P3AC 4Z5TD 1TAFA 3O62C 5CPID 3AZLA 2J8PA 3W97A 4CSRA 5F99B 1P3LB 4KUDC 2Y2LA 3MGSC 5B0YB 1TZYB 5G49A 3VH5W 2NQBD 1P3KB 5B0ZA 1PZRA 3AZIB 2Y2GA 4Z2MH 1P3OB 1KX5C 5B2IC 4H9NB 5B32G 5AVBD 5B24A 4CAYB 4J8VB 4WJ3C 2HIOA 5KDMA 4KUDD 4ZUXC 3TU4D 1AOIC 5CPIB 1ID3D 1M1AC 5B32B 4XZQB 5B2JD 3MNNC 3AV2A 1M19C 3WA9A 3W96D 1P34A 5AV5C 1P3GA 1B67A 3W99B 3MVDA 3LZ0D 4H9RB 3C1BA 1KX4A 5B33D 3X1VC 4JJNC 1P3MD 5GT3C 3AZEA 1KX3A 5GXQD 1P3BB 5B0ZB 1P3PC 3AV2C 1Z2CB 4Z66D 2CWEA 4XZQD 3C1CC 2Y2JA 4AWLC 2XD1A 3LJAD 4Z5TA 5CPIA 3W97B 3AZLD 3F6TA 3NQUB 4UUZB 1ZLAD 4KGCB 2Y2NA 4G92C 4H9NA 3C1CA 3NQJB 4J8XD 1P3PD 4DRAA 3MGQB 2F2AC 3X1UB 3UTAC 5B0ZD 1P3BD 2IO5C 5BNXA 5BNXB 5B2IA 2AROC 2Y2MA 3B6FB 5B40C 3MGQA 5E5AC 3W98D 2HIOD 4CSRB 5DNMC 1TAFB 2Y2QA 4WU8D 5JRGC 3WA9D 5CPJB 3MGRB 1P3GD 4KGCC 1P3BC 3WKJA 3W99C 3X1UD 5GT3B 5AV5B 3KXBB 5AV9C 3AZED 2F8NH 1KX3D 3A6NC 5BO0A 2NQBC 5BO0B 4R8PC 1EQZD 2YFVA 3AV2B 4XZQA 3MGPB 2LY8A 2F8NK 2JSSA 3W99A 4XUJD 3LJAA 5CPJA 3LJAB 5CPIC 3AZHA 3LELB 3EPJA 3AL0C 3LZ1D 3WA9B 4LD9B 3IP4C 5B31C 3AZKA 4XZQC 3C1CD 3AN2D 1P3OA 5KDMB 3KXBD 5GT3D 2YFWB 3UT9A 3X1TB 2F8NB 2PYOD 2PYOC 5B2IB 1TZYC 2BYMA 2HUEB 3B6GA 2AROA 4J8VC 3AFAB 1P3KA 3MGQD 3W96B 3W98A 5JRGB 1M1AD 3W96C 3UT9C 3AZFC 5F99C 4H9OB 5DNMB 3REHB 1P3LC 5B1LA 3NQUA 4UUZA 4WU8A 3W98B 5AY8C 3O62B 2CV5D 1F66D 5BNVA 5CP6D 3REIC 3EPKA 3WKJD 2HUEC 4WU9A 4X23A 3X1UA 3AFAA 3WAAC 4Z66B 5B0YD 1HTAA 3AV1A 3B6GB 1KX5A 3MGSD 4YM6C 2ZY5A 3W97D 4WNNB 3MGPC 4XUJA 3REHD 3AZHC 3AZHD 3H0RC 4H9QA 3R45A 5BT1C 2Y2HA 1ID3B 5C3IB 1S32C 1M18C 4H9PB 3AZKD 4YM6D 2G5IC 2Y2IA 5GT3A 3MGPA 5B24D 2FJ7B 1WWIA 2PYOA 3B6GD 3AN2C 1KX3C 3MVDB 4NE5A 3TU4A 5GT0B 5B2JA 5E5AB 5BT1D 2W8SA 1P3IC 5B1LD 3C1BD 1KX4D 5B33A 3FDDA 4NE6A 3VH6A 2L5AA 3REJA 4NFTA 5CP6A 3KUYA 5AV8C 3A1KA 3AZID 3W98C 3KFUG 2IO5B 4QLCC 4Z66A 3X1UC 1HQ3A 1TZYD 2ZY4A 3B6FA 3B0CT 5B0YA 3AZJD 5B33C 3MGSA 5DNND 3REKD 2CV5B 1HQ3B 2ZY3A 5AV6C 1BH9A 2JCHA 4E45A 3VH5A 3REIA 1ZLAA 3C1CB 4QLCA 4H9OA 3REHA 3REJB 3V9RA 1BH8A 2NZDC 4J8XA 2RVQD 4EO5B 3TU4B 4YM6A 1P3BA 5B2ID 2PYOB 3X1TC 3H0MC 4JJNB 3AZMA 1R4VA 4ZBJB 3AZEB 5B24C 1U35C 4ZUXB 1M18A 1AOIB 3LZ0C 5B32C 3MNNB 1F1EA 2ZY2A 1M19B 2RVQC 3LJAC 4H9PA 3X1SC 4H9QB 3B0BA 5DNMD 3REJD 5B31A 3AYWB 3KUYD 2F8NG 5GSUC 1U35D 3AZIA 4WNNA 3WTPE 5BS7C 3UTBA 3B0DB 1EQZA 1P3AA 1TZYA 5G49B 4CAYA 3B6FD 5B0YC 5AV6B 3AZJA 2XD5A 3W99D 5CPJD 4YS3A 4HGAB 3REID 3KUYB 1BH8B 2CV5C 2F8NA 5B1LC 4WU8C 3AZNC 5F99A 1P3LA 1B6WA 4UPKA 4G91B 3UT9D 4KHAB 3MGQC 3AZLB 5AVCB 5JA4B 3WTPD 3UTAB 2AROD 5GT0D 4X23C 1P3KD 3EG5B 3AZGD 3WAAA 1KX3B 3NQJA 3AZMD 1P3FC 2BYMB 2FJ7A 5CP6B 3B0DC 5B40A 5B1MB 1M18D 3LZ1C 3X1VA 1ULYA 3AYWC 1F66A 5CPKC 4XUJC 5B2JB 5B32D 2NZDD 4WU9D 3AZHB 3AFAD 1U35A 5GXQB 1KX5D 4ZUXA 1M18B 5B1MD 1P3MB 1AOIA 3X1TD 5AV9A 1BFMA 3AZMB 3AZJC 4R8PA 3AZGB 1P34C 3EPHA 4YS3D 5AV5A 5AVCA 3AZIC 2F8ND 2G5HC 5F99D 1P3LD 5AY8B 3X1SD 1P3IA 1JFIA 3MGPD 4EO5C 3MGSB 4YS3C 2Y2PA 3H0LC 1P3OC 1BH9B 3REIB 2VQRA 4YS3B 4J8WA 3B0CW 4J8UB 3WAAD 2BYKA 2YFWA 5BNVB 3UT9B 1Q9CA 1ZLAC 4WU9C 4H9SC 4Z5TB 5B31B 3AYWA 3AFAC 3A1IA 3AZFA 3LELA 2NZDA 5AY8A 1P3IB 1HQ3D 4DRBA 5E5AA 3AZJB 4H9SA 3KWQB 5DNNA 3REKA 1H3OA 3X1TA 4ZBJC 5AV9D 3AZEC 4R8PB 3AZMC 1P3FD 5GT0C 2NQBB 2FFFB 4QLCD 3AZGC 4JJND 1S32D 5AV5D 1P34B 1P3MC 1P3GC 1N1JA 4KGCD 3LZ1B 4H9RA 3C1BB 1KX4B 3WKJC 1F66B 4XUJB 1ID3C 3MNND 3X1SA 1P3ID 2UWXA 1M19D 3V9RB 1KU5A 5CPKB 4NE3A 1EQZC 2HIOB 5AVCC 5AVBC 4X23B 5B40B 3KWQC 5CPJC 2BYKB 5DNNB 3REKB 5B1MC 4YM6B 3EPLA 5CP6C 5AV8A 3AZKC 5DNMA 3AYWD 5B31D 5AVBA 3AZFD 4G91C 3AZLC 4KHAA 3O62A 3VH6T 1ZLAB 4KUDA 3UTBD 5B1LB 4WV4B 4G92B 1P3AD 5AVBB 4J8VD 3RELD 5E5AD 3AV2D 3W96A 3A6NA 3UTAD 1P3FA 3P5JB 3RELB 1P3MA 1S32A 5CHLB 4AWLB 4KGCA 3UTBB 5GXQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LZ0 B;  1P3G B;  3R45 B;  5CPK A;  3MNN A;  3AZN D;  1M19 A;  3WA9 C;  3WTP A;  5GSU B;  5JRG D;  1M1A B;  5GT0 A;  3VH5 T;  3AZG A;  3X1V B;  4LD9 C;  5AV6 D;  1H3O B;  2FJ7 D;  5B24 B;  5B40 D;  1WWS A;  3A6N B;  1U35 B;  3X1V D;  1P3P A;  3KXB C;  3REJ C;  5AV8 D;  3REL C;  5JA4 A;  5GSU D;  4LD9 D;  4E44 A;  5B32 A;  3UTB C;  1HQ3 C;  4M6B A;  4KUD B;  4Z5T C;  3O62 D;  4ZUX D;  3TU4 C;  5B1M A;  3MGR C;  1AOI D;  2F8N B;  3AZF B;  4Z2M G;  4J8V A;  4J8U C;  3REL A;  4QLC B;  4WZS B;  5AV8 B;  5BS7 A;  4R8P D;  2ARO B;  3A6N D;  3KWQ D;  3UTA A;  4J8X C;  5AVC D;  1P3A B;  1JFI B;  3MGR D;  5B33 B;  4J8W B;  4J8U A;  3AZK B;  4WU8 B;  5CPK D;  3AZN A;  5JRG A;  3W97 C;  3LEL C;  4J8W D;  3AV1 C;  2HIO C;  3LZ1 A;  1N1J B;  5AV6 A;  5GXQ C;  5DNN C;  3REK C;  1A7W A;  2NQB A;  1EQZ B;  5B0Z C;  3AN2 A;  1P3P B;  3AN2 B;  1P3O D;  3WTP C;  3KXB A;  5AV9 B;  2FJ7 C;  3MVD C;  3WTP B;  5GSU A;  3KSY A;  3C1B C;  1KX4 C;  3WKJ B;  5B2J C;  4LD9 A;  3LEL D;  5AY8 D;  3X1S B;  1F66 C;  1ID3 A;  1M1A A;  5C3I C;  1S32 B;  1P34 D;  2YFV B;  3AV1 B;  3VH6 W;  1P3F B;  3MVD D;  3LZ0 A;  4Z66 C;  2CV5 A;  4JJN A;  3B6F C;  3B6G C;  3KWQ A;  1KX5 B;  3WAA B;  4X23 D;  1P3K C;  3MGR A;  4J8U D;  3KUY C;  4WU9 B;  2NZD B;  4J8X B;  4J8W C;  3AZN B;  4HGA C;  5B31 G;  5FUG B;  3REH C;  5FUG A;  3AV1 D;  1P3A C;  3O62 C;  1TAF A;  4Z5T D;  5CPI D;  3AZL A;  3W97 A;  4CSR A;  5F99 B;  1P3L B;  4KUD C;  3MGS C;  5B0Y B;  1TZY B;  5G49 A;  3VH5 W;  2NQB D;  1P3K B;  5B0Z A;  3AZI B;  4Z2M H;  1P3O B;  1KX5 C;  5B2I C;  4H9N B;  5B32 G;  5AVB D;  5B24 A;  4CAY B;  4J8V B;  2HIO A;  5KDM A;  4KUD D;  4ZUX C;  3TU4 D;  1AOI C;  5CPI B;  1ID3 D;  1M1A C;  5B32 B;  4XZQ B;  5B2J D;  3MNN C;  3AV2 A;  1M19 C;  3WA9 A;  3W96 D;  1P34 A;  5AV5 C;  1P3G A;  1B67 A;  3W99 B;  3MVD A;  3LZ0 D;  4H9R B;  3C1B A;  1KX4 A;  5B33 D;  3X1V C;  4JJN C;  1P3M D;  5GT3 C;  3AZE A;  1KX3 A;  5GXQ D;  1P3B B;  5B0Z B;  1P3P C;  3AV2 C;  4Z66 D;  2CWE A;  4XZQ D;  3C1C C;  4AWL C;  3LJA D;  4Z5T A;  5CPI A;  3W97 B;  3AZL D;  3NQU B;  4UUZ B;  1ZLA D;  4KGC B;  4G92 C;  4H9N A;  3C1C A;  3NQJ B;  4J8X D;  1P3P D;  4DRA A;  3MGQ B;  3X1U B;  3UTA C;  5B0Z D;  1P3B D;  2IO5 C;  5BNX A;  5BNX B;  5B2I A;  2ARO C;  3B6F B;  5B40 C;  3MGQ A;  5E5A C;  3W98 D;  2HIO D;  4CSR B;  5DNM C;  1TAF B;  4WU8 D;  5JRG C;  3WA9 D;  5CPJ B;  3MGR B;  1P3G D;  4KGC C;  1P3B C;  3WKJ A;  3W99 C;  3X1U D;  5GT3 B;  5AV5 B;  3KXB B;  5AV9 C;  3AZE D;  2F8N H;  1KX3 D;  3A6N C;  5BO0 A;  2NQB C;  5BO0 B;  4R8P C;  1EQZ D;  2YFV A;  3AV2 B;  4XZQ A;  3MGP B;  2LY8 A;  2F8N K;  2JSS A;  3W99 A;  4XUJ D;  3LJA A;  5CPJ A;  3LJA B;  5CPI C;  3AZH A;  3LEL B;  3LZ1 D;  3WA9 B;  4LD9 B;  5B31 C;  3AZK A;  4XZQ C;  3C1C D;  3AN2 D;  1P3O A;  5KDM B;  3KXB D;  5GT3 D;  2YFW B;  3UT9 A;  3X1T B;  2PYO D;  2PYO C;  5B2I B;  1TZY C;  2BYM A;  2HUE B;  3B6G A;  2ARO A;  4J8V C;  3AFA B;  1P3K A;  3MGQ D;  3W96 B;  3W98 A;  5JRG B;  1M1A D;  3W96 C;  3UT9 C;  3AZF C;  5F99 C;  4H9O B;  5DNM B;  3REH B;  1P3L C;  5B1L A;  3NQU A;  4UUZ A;  4WU8 A;  3W98 B;  5AY8 C;  3O62 B;  2CV5 D;  1F66 D;  5BNV A;  5CP6 D;  3REI C;  3WKJ D;  2HUE C;  4WU9 A;  4X23 A;  3X1U A;  3AFA A;  3WAA C;  4Z66 B;  5B0Y D;  1HTA A;  3AV1 A;  3B6G B;  1KX5 A;  3MGS D;  4YM6 C;  3W97 D;  4WNN B;  3MGP C;  4XUJ A;  3REH D;  3AZH C;  3AZH D;  4H9Q A;  3R45 A;  5BT1 C;  1ID3 B;  5C3I B;  1S32 C;  1M18 C;  4H9P B;  3AZK D;  4YM6 D;  5GT3 A;  3MGP A;  5B24 D;  2FJ7 B;  1WWI A;  2PYO A;  3B6G D;  3AN2 C;  1KX3 C;  3MVD B;  4NE5 A;  3TU4 A;  5GT0 B;  5B2J A;  5E5A B;  5BT1 D;  1P3I C;  5B1L D;  3C1B D;  1KX4 D;  5B33 A;  4NE6 A;  3VH6 A;  2L5A A;  3REJ A;  4NFT A;  5CP6 A;  3KUY A;  5AV8 C;  3AZI D;  3W98 C;  2IO5 B;  4QLC C;  4Z66 A;  3X1U C;  1HQ3 A;  1TZY D;  3B6F A;  3B0C T;  5B0Y A;  3AZJ D;  5B33 C;  3MGS A;  5DNN D;  3REK D;  2CV5 B;  1HQ3 B;  5AV6 C;  1BH9 A;  4E45 A;  3REI A;  3VH5 A;  1ZLA A;  3C1C B;  4QLC A;  4H9O A;  3REH A;  3REJ B;  3V9R A;  1BH8 A;  2NZD C;  4J8X A;  2RVQ D;  4EO5 B;  3TU4 B;  4YM6 A;  1P3B A;  5B2I D;  2PYO B;  3X1T C;  4JJN B;  3AZM A;  1R4V A;  4ZBJ B;  3AZE B;  5B24 C;  1U35 C;  4ZUX B;  1M18 A;  1AOI B;  3LZ0 C;  5B32 C;  3MNN B;  1F1E A;  1M19 B;  2RVQ C;  3LJA C;  4H9P A;  3X1S C;  4H9Q B;  3B0B A;  5DNM D;  3REJ D;  5B31 A;  3AYW B;  3KUY D;  2F8N G;  5GSU C;  1U35 D;  3AZI A;  4WNN A;  3WTP E;  5BS7 C;  3UTB A;  3B0D B;  1EQZ A;  1P3A A;  1TZY A;  5G49 B;  4CAY A;  3B6F D;  5B0Y C;  5AV6 B;  3AZJ A;  3W99 D;  5CPJ D;  4YS3 A;  4HGA B;  3REI D;  3KUY B;  1BH8 B;  2CV5 C;  2F8N A;  5B1L C;  4WU8 C;  3AZN C;  5F99 A;  1P3L A;  1B6W A;  4G91 B;  3UT9 D;  4KHA B;  3MGQ C;  3AZL B;  5AVC B;  5JA4 B;  3WTP D;  3UTA B;  2ARO D;  5GT0 D;  4X23 C;  1P3K D;  3AZG D;  3WAA A;  1KX3 B;  3NQJ A;  3AZM D;  1P3F C;  2BYM B;  2FJ7 A;  5CP6 B;  3B0D C;  5B40 A;  5B1M B;  1M18 D;  3LZ1 C;  3X1V A;  1ULY A;  3AYW C;  1F66 A;  5CPK C;  4XUJ C;  5B2J B;  5B32 D;  2NZD D;  4WU9 D;  3AZH B;  3AFA D;  1U35 A;  5GXQ B;  1KX5 D;  4ZUX A;  1M18 B;  5B1M D;  1P3M B;  1AOI A;  3X1T D;  5AV9 A;  1BFM A;  3AZM B;  3AZJ C;  4R8P A;  3AZG B;  1P34 C;  4YS3 D;  5AV5 A;  5AVC A;  3AZI C;  2F8N D;  5F99 D;  1P3L D;  5AY8 B;  3X1S D;  1P3I A;  1JFI A;  3MGP D;  4EO5 C;  3MGS B;  4YS3 C;  1P3O C;  1BH9 B;  3REI B;  4YS3 B;  4J8W A;  3B0C W;  4J8U B;  3WAA D;  2BYK A;  2YFW A;  5BNV B;  3UT9 B;  1Q9C A;  1ZLA C;  4WU9 C;  4H9S C;  4Z5T B;  5B31 B;  3AYW A;  3AFA C;  3AZF A;  3LEL A;  2NZD A;  5AY8 A;  1P3I B;  1HQ3 D;  4DRB A;  5E5A A;  3AZJ B;  4H9S A;  3KWQ B;  5DNN A;  3REK A;  1H3O A;  3X1T A;  4ZBJ C;  5AV9 D;  3AZE C;  4R8P B;  3AZM C;  1P3F D;  5GT0 C;  2NQB B;  4QLC D;  3AZG C;  4JJN D;  1S32 D;  5AV5 D;  1P34 B;  1P3M C;  1P3G C;  1N1J A;  4KGC D;  3LZ1 B;  4H9R A;  3C1B B;  1KX4 B;  3WKJ C;  1F66 B;  4XUJ B;  1ID3 C;  3MNN D;  3X1S A;  1P3I D;  1M19 D;  3V9R B;  1KU5 A;  5CPK B;  4NE3 A;  1EQZ C;  2HIO B;  5AVC C;  5AVB C;  4X23 B;  5B40 B;  3KWQ C;  5CPJ C;  2BYK B;  5DNN B;  3REK B;  5B1M C;  4YM6 B;  5CP6 C;  5AV8 A;  3AZK C;  5DNM A;  3AYW D;  5B31 D;  5AVB A;  3AZF D;  4G91 C;  3AZL C;  4KHA A;  3O62 A;  3VH6 T;  1ZLA B;  4KUD A;  3UTB D;  5B1L B;  4WV4 B;  4G92 B;  1P3A D;  5AVB B;  4J8V D;  3REL D;  5E5A D;  3AV2 D;  3W96 A;  3A6N A;  3UTA D;  1P3F A;  3REL B;  1P3M A;  1S32 A;  5CHL B;  4AWL B;  4KGC A;  3UTB B;  5GXQ A; 
#chains in the Genus database with same CATH topology
 3LZ0 B;  1P3G B;  1W2E A;  3R45 B;  5CPK A;  2Y2O A;  3MNN A;  3AZN D;  1M19 A;  3WA9 C;  5GSU B;  3WTP A;  5JRG D;  1M1A B;  5GT0 A;  1T3U A;  3VH5 T;  3AZG A;  3X1V B;  4LD9 C;  2ZM5 A;  5AV6 D;  1H3O B;  2FJ7 D;  5B24 B;  5B40 D;  2DQN C;  2Y2K A;  1WWS A;  3A6N B;  1U35 B;  3X1V D;  1P3P A;  3KXB C;  3REJ C;  5AV8 D;  3REL C;  5JA4 A;  5GSU D;  4LD9 D;  4E44 A;  5B32 A;  3UTB C;  1HQ3 C;  4M6B A;  4KUD B;  4Z5T C;  3O62 D;  4ZUX D;  3TU4 C;  5B1M A;  3MGR C;  4DQY B;  1AOI D;  3AZF B;  2DF4 C;  4Z2M G;  4J8U C;  4J8V A;  3REL A;  4QLC B;  4WZS B;  5AV8 B;  5BS7 A;  4R8P D;  2ARO B;  3A6N D;  3KWQ D;  3UTA A;  4J8X C;  5AVC D;  1P3A B;  1JFI B;  3MGR D;  5B33 B;  4J8W B;  4J8U A;  3AZK B;  4WU8 B;  5CPK D;  3AZN A;  5JRG A;  3W97 C;  3LEL C;  4J8W D;  3AV1 C;  2HIO C;  3LZ1 A;  1N1J B;  5AV6 A;  5GXQ C;  5DNN C;  3REK C;  1A7W A;  2NQB A;  1EQZ B;  5B0Z C;  3AN2 A;  1P3P B;  3AN2 B;  1P3O D;  3WTP C;  3KXB A;  5AV9 B;  2FJ7 C;  3MVD C;  2RIQ A;  3WTP B;  3KSY A;  5GSU A;  3C1B C;  1KX4 C;  5B2J C;  2BG1 A;  3LEL D;  3WKJ B;  4LD9 A;  5AY8 D;  3X1S B;  1F66 C;  1ID3 A;  1M1A A;  5C3I C;  1S32 B;  1P34 D;  2YFV B;  3AV1 B;  3VH6 W;  2JE5 A;  1P3F B;  3MVD D;  3LZ0 A;  4Z66 C;  2CV5 A;  4JJN A;  3B6F C;  3B6G C;  3KWQ A;  1KX5 B;  3WAA B;  4X23 D;  1P3K C;  3MGR A;  4J8U D;  3KUY C;  4WU9 B;  2NZD B;  4J8X B;  4J8W C;  3AZN B;  4HGA C;  5B31 G;  5FUG B;  3REH C;  5FUG A;  3AV1 D;  1P3A C;  4Z5T D;  1TAF A;  3O62 C;  5CPI D;  3AZL A;  2J8P A;  3W97 A;  4CSR A;  5F99 B;  1P3L B;  4KUD C;  2Y2L A;  3MGS C;  5B0Y B;  1TZY B;  5G49 A;  3VH5 W;  2NQB D;  1P3K B;  5B0Z A;  1PZR A;  3AZI B;  2Y2G A;  4Z2M H;  1P3O B;  1KX5 C;  5B2I C;  4H9N B;  5B32 G;  5AVB D;  5B24 A;  4CAY B;  4J8V B;  4WJ3 C;  2HIO A;  5KDM A;  4KUD D;  4ZUX C;  3TU4 D;  1AOI C;  5CPI B;  1ID3 D;  1M1A C;  5B32 B;  4XZQ B;  5B2J D;  3MNN C;  3AV2 A;  1M19 C;  3WA9 A;  3W96 D;  1P34 A;  5AV5 C;  1P3G A;  1B67 A;  3W99 B;  3MVD A;  3LZ0 D;  4H9R B;  3C1B A;  1KX4 A;  5B33 D;  3X1V C;  4JJN C;  1P3M D;  5GT3 C;  3AZE A;  1KX3 A;  5GXQ D;  1P3B B;  5B0Z B;  1P3P C;  3AV2 C;  1Z2C B;  4Z66 D;  2CWE A;  4XZQ D;  3C1C C;  2Y2J A;  4AWL C;  2XD1 A;  3LJA D;  4Z5T A;  5CPI A;  3W97 B;  3AZL D;  3F6T A;  3NQU B;  4UUZ B;  1ZLA D;  4KGC B;  2Y2N A;  4G92 C;  4H9N A;  3C1C A;  3NQJ B;  4J8X D;  1P3P D;  4DRA A;  3MGQ B;  2F2A C;  3X1U B;  3UTA C;  5B0Z D;  1P3B D;  2IO5 C;  5BNX A;  5BNX B;  5B2I A;  2ARO C;  2Y2M A;  3B6F B;  5B40 C;  3MGQ A;  5E5A C;  3W98 D;  2HIO D;  4CSR B;  5DNM C;  1TAF B;  2Y2Q A;  4WU8 D;  5JRG C;  3WA9 D;  5CPJ B;  3MGR B;  1P3G D;  4KGC C;  1P3B C;  3WKJ A;  3W99 C;  3X1U D;  5GT3 B;  5AV5 B;  3KXB B;  5AV9 C;  3AZE D;  2F8N H;  1KX3 D;  3A6N C;  5BO0 A;  2NQB C;  5BO0 B;  4R8P C;  1EQZ D;  2YFV A;  3AV2 B;  4XZQ A;  3MGP B;  2LY8 A;  2F8N K;  2JSS A;  3W99 A;  4XUJ D;  3LJA A;  5CPJ A;  3LJA B;  5CPI C;  3AZH A;  3LEL B;  3EPJ A;  3AL0 C;  3LZ1 D;  3WA9 B;  4LD9 B;  3IP4 C;  5B31 C;  3AZK A;  4XZQ C;  3C1C D;  3AN2 D;  1P3O A;  5KDM B;  3KXB D;  5GT3 D;  2YFW B;  3UT9 A;  3X1T B;  2F8N B;  2PYO D;  2PYO C;  5B2I B;  1TZY C;  2BYM A;  2HUE B;  3B6G A;  2ARO A;  4J8V C;  3AFA B;  1P3K A;  3MGQ D;  3W96 B;  3W98 A;  5JRG B;  1M1A D;  3W96 C;  3UT9 C;  3AZF C;  5F99 C;  4H9O B;  5DNM B;  3REH B;  1P3L C;  5B1L A;  3NQU A;  4UUZ A;  4WU8 A;  3W98 B;  5AY8 C;  3O62 B;  2CV5 D;  1F66 D;  5BNV A;  5CP6 D;  3REI C;  3EPK A;  3WKJ D;  2HUE C;  4WU9 A;  4X23 A;  3X1U A;  3AFA A;  3WAA C;  4Z66 B;  5B0Y D;  1HTA A;  3AV1 A;  3B6G B;  1KX5 A;  3MGS D;  4YM6 C;  2ZY5 A;  3W97 D;  4WNN B;  3MGP C;  4XUJ A;  3REH D;  3AZH C;  3AZH D;  3H0R C;  4H9Q A;  3R45 A;  5BT1 C;  2Y2H A;  1ID3 B;  5C3I B;  1S32 C;  1M18 C;  4H9P B;  3AZK D;  4YM6 D;  2G5I C;  2Y2I A;  5GT3 A;  3MGP A;  5B24 D;  2FJ7 B;  1WWI A;  2PYO A;  3B6G D;  3AN2 C;  1KX3 C;  3MVD B;  4NE5 A;  3TU4 A;  5GT0 B;  5B2J A;  5E5A B;  5BT1 D;  2W8S A;  1P3I C;  5B1L D;  3C1B D;  1KX4 D;  5B33 A;  3FDD A;  4NE6 A;  3VH6 A;  2L5A A;  3REJ A;  4NFT A;  5CP6 A;  3KUY A;  5AV8 C;  3A1K A;  3AZI D;  3W98 C;  3KFU G;  2IO5 B;  4QLC C;  4Z66 A;  3X1U C;  1HQ3 A;  1TZY D;  2ZY4 A;  3B6F A;  3B0C T;  5B0Y A;  3AZJ D;  5B33 C;  3MGS A;  5DNN D;  3REK D;  2CV5 B;  1HQ3 B;  2ZY3 A;  5AV6 C;  1BH9 A;  2JCH A;  4E45 A;  3VH5 A;  3REI A;  1ZLA A;  3C1C B;  4QLC A;  4H9O A;  3REH A;  3REJ B;  3V9R A;  1BH8 A;  2NZD C;  4J8X A;  2RVQ D;  4EO5 B;  3TU4 B;  4YM6 A;  1P3B A;  5B2I D;  2PYO B;  3X1T C;  3H0M C;  4JJN B;  3AZM A;  1R4V A;  4ZBJ B;  3AZE B;  5B24 C;  1U35 C;  4ZUX B;  1M18 A;  1AOI B;  3LZ0 C;  5B32 C;  3MNN B;  1F1E A;  2ZY2 A;  1M19 B;  2RVQ C;  3LJA C;  4H9P A;  3X1S C;  4H9Q B;  3B0B A;  5DNM D;  3REJ D;  5B31 A;  3AYW B;  3KUY D;  2F8N G;  5GSU C;  1U35 D;  3AZI A;  4WNN A;  3WTP E;  5BS7 C;  3UTB A;  3B0D B;  1EQZ A;  1P3A A;  1TZY A;  5G49 B;  4CAY A;  3B6F D;  5B0Y C;  5AV6 B;  3AZJ A;  2XD5 A;  3W99 D;  5CPJ D;  4YS3 A;  4HGA B;  3REI D;  3KUY B;  1BH8 B;  2CV5 C;  2F8N A;  5B1L C;  4WU8 C;  3AZN C;  5F99 A;  1P3L A;  1B6W A;  4UPK A;  4G91 B;  3UT9 D;  4KHA B;  3MGQ C;  3AZL B;  5AVC B;  5JA4 B;  3WTP D;  3UTA B;  2ARO D;  5GT0 D;  4X23 C;  1P3K D;  3EG5 B;  3AZG D;  3WAA A;  1KX3 B;  3NQJ A;  3AZM D;  1P3F C;  2BYM B;  2FJ7 A;  5CP6 B;  3B0D C;  5B40 A;  5B1M B;  1M18 D;  3LZ1 C;  3X1V A;  1ULY A;  3AYW C;  1F66 A;  5CPK C;  4XUJ C;  5B2J B;  5B32 D;  2NZD D;  4WU9 D;  3AZH B;  3AFA D;  1U35 A;  5GXQ B;  1KX5 D;  4ZUX A;  1M18 B;  5B1M D;  1P3M B;  1AOI A;  3X1T D;  5AV9 A;  1BFM A;  3AZM B;  3AZJ C;  4R8P A;  3AZG B;  1P34 C;  3EPH A;  4YS3 D;  5AV5 A;  5AVC A;  3AZI C;  2F8N D;  2G5H C;  5F99 D;  1P3L D;  5AY8 B;  3X1S D;  1P3I A;  1JFI A;  3MGP D;  4EO5 C;  3MGS B;  4YS3 C;  2Y2P A;  3H0L C;  1P3O C;  1BH9 B;  3REI B;  2VQR A;  4YS3 B;  4J8W A;  3B0C W;  4J8U B;  3WAA D;  2BYK A;  2YFW A;  5BNV B;  3UT9 B;  1Q9C A;  1ZLA C;  4WU9 C;  4H9S C;  4Z5T B;  5B31 B;  3AYW A;  3AFA C;  3A1I A;  3AZF A;  3LEL A;  2NZD A;  5AY8 A;  1P3I B;  1HQ3 D;  4DRB A;  5E5A A;  3AZJ B;  4H9S A;  3KWQ B;  5DNN A;  3REK A;  1H3O A;  3X1T A;  4ZBJ C;  5AV9 D;  3AZE C;  4R8P B;  3AZM C;  1P3F D;  5GT0 C;  2NQB B;  2FFF B;  4QLC D;  3AZG C;  4JJN D;  1S32 D;  5AV5 D;  1P34 B;  1P3M C;  1P3G C;  1N1J A;  4KGC D;  3LZ1 B;  4H9R A;  3C1B B;  1KX4 B;  3WKJ C;  1F66 B;  4XUJ B;  1ID3 C;  3MNN D;  3X1S A;  1P3I D;  2UWX A;  1M19 D;  3V9R B;  1KU5 A;  5CPK B;  4NE3 A;  1EQZ C;  2HIO B;  5AVC C;  5AVB C;  4X23 B;  5B40 B;  3KWQ C;  5CPJ C;  2BYK B;  5DNN B;  3REK B;  5B1M C;  4YM6 B;  3EPL A;  5CP6 C;  5AV8 A;  3AZK C;  5DNM A;  3AYW D;  5B31 D;  5AVB A;  3AZF D;  4G91 C;  3AZL C;  4KHA A;  3O62 A;  3VH6 T;  1ZLA B;  4KUD A;  3UTB D;  5B1L B;  4WV4 B;  4G92 B;  1P3A D;  5AVB B;  4J8V D;  3REL D;  5E5A D;  3AV2 D;  3W96 A;  3A6N A;  3UTA D;  1P3F A;  3P5J B;  3REL B;  1P3M A;  1S32 A;  5CHL B;  4AWL B;  4KGC A;  3UTB B;  5GXQ A; 
#chains in the Genus database with same CATH homology
 3LZ0 B;  1P3G B;  1W2E A;  3R45 B;  5CPK A;  2Y2O A;  3MNN A;  3AZN D;  1M19 A;  3WA9 C;  5GSU B;  3WTP A;  5JRG D;  1M1A B;  5GT0 A;  1T3U A;  3VH5 T;  3AZG A;  3X1V B;  4LD9 C;  2ZM5 A;  5AV6 D;  1H3O B;  2FJ7 D;  5B24 B;  5B40 D;  2DQN C;  2Y2K A;  1WWS A;  3A6N B;  1U35 B;  3X1V D;  1P3P A;  3KXB C;  3REJ C;  5AV8 D;  3REL C;  5JA4 A;  5GSU D;  4LD9 D;  4E44 A;  5B32 A;  3UTB C;  1HQ3 C;  4M6B A;  4KUD B;  4Z5T C;  3O62 D;  4ZUX D;  3TU4 C;  5B1M A;  3MGR C;  4DQY B;  1AOI D;  3AZF B;  2DF4 C;  4Z2M G;  4J8U C;  4J8V A;  3REL A;  4QLC B;  4WZS B;  5AV8 B;  5BS7 A;  4R8P D;  2ARO B;  3A6N D;  3KWQ D;  3UTA A;  4J8X C;  5AVC D;  1P3A B;  1JFI B;  3MGR D;  5B33 B;  4J8W B;  4J8U A;  3AZK B;  4WU8 B;  5CPK D;  3AZN A;  5JRG A;  3W97 C;  3LEL C;  4J8W D;  3AV1 C;  2HIO C;  3LZ1 A;  1N1J B;  5AV6 A;  5GXQ C;  5DNN C;  3REK C;  1A7W A;  2NQB A;  1EQZ B;  5B0Z C;  3AN2 A;  1P3P B;  3AN2 B;  1P3O D;  3WTP C;  3KXB A;  5AV9 B;  2FJ7 C;  3MVD C;  2RIQ A;  3WTP B;  3KSY A;  5GSU A;  3C1B C;  1KX4 C;  5B2J C;  2BG1 A;  3LEL D;  3WKJ B;  4LD9 A;  5AY8 D;  3X1S B;  1F66 C;  1ID3 A;  1M1A A;  5C3I C;  1S32 B;  1P34 D;  2YFV B;  3AV1 B;  3VH6 W;  2JE5 A;  1P3F B;  3MVD D;  3LZ0 A;  4Z66 C;  2CV5 A;  4JJN A;  3B6F C;  3B6G C;  3KWQ A;  1KX5 B;  3WAA B;  4X23 D;  1P3K C;  3MGR A;  4J8U D;  3KUY C;  4WU9 B;  2NZD B;  4J8X B;  4J8W C;  3AZN B;  4HGA C;  5B31 G;  5FUG B;  3REH C;  5FUG A;  3AV1 D;  1P3A C;  4Z5T D;  1TAF A;  3O62 C;  5CPI D;  3AZL A;  2J8P A;  3W97 A;  4CSR A;  5F99 B;  1P3L B;  4KUD C;  2Y2L A;  3MGS C;  5B0Y B;  1TZY B;  5G49 A;  3VH5 W;  2NQB D;  1P3K B;  5B0Z A;  1PZR A;  3AZI B;  2Y2G A;  4Z2M H;  1P3O B;  1KX5 C;  5B2I C;  4H9N B;  5B32 G;  5AVB D;  5B24 A;  4CAY B;  4J8V B;  4WJ3 C;  2HIO A;  5KDM A;  4KUD D;  4ZUX C;  3TU4 D;  1AOI C;  5CPI B;  1ID3 D;  1M1A C;  5B32 B;  4XZQ B;  5B2J D;  3MNN C;  3AV2 A;  1M19 C;  3WA9 A;  3W96 D;  1P34 A;  5AV5 C;  1P3G A;  1B67 A;  3W99 B;  3MVD A;  3LZ0 D;  4H9R B;  3C1B A;  1KX4 A;  5B33 D;  3X1V C;  4JJN C;  1P3M D;  5GT3 C;  3AZE A;  1KX3 A;  5GXQ D;  1P3B B;  5B0Z B;  1P3P C;  3AV2 C;  1Z2C B;  4Z66 D;  2CWE A;  4XZQ D;  3C1C C;  2Y2J A;  4AWL C;  2XD1 A;  3LJA D;  4Z5T A;  5CPI A;  3W97 B;  3AZL D;  3F6T A;  3NQU B;  4UUZ B;  1ZLA D;  4KGC B;  2Y2N A;  4G92 C;  4H9N A;  3C1C A;  3NQJ B;  4J8X D;  1P3P D;  4DRA A;  3MGQ B;  2F2A C;  3X1U B;  3UTA C;  5B0Z D;  1P3B D;  2IO5 C;  5BNX A;  5BNX B;  5B2I A;  2ARO C;  2Y2M A;  3B6F B;  5B40 C;  3MGQ A;  5E5A C;  3W98 D;  2HIO D;  4CSR B;  5DNM C;  1TAF B;  2Y2Q A;  4WU8 D;  5JRG C;  3WA9 D;  5CPJ B;  3MGR B;  1P3G D;  4KGC C;  1P3B C;  3WKJ A;  3W99 C;  3X1U D;  5GT3 B;  5AV5 B;  3KXB B;  5AV9 C;  3AZE D;  2F8N H;  1KX3 D;  3A6N C;  5BO0 A;  2NQB C;  5BO0 B;  4R8P C;  1EQZ D;  2YFV A;  3AV2 B;  4XZQ A;  3MGP B;  2LY8 A;  2F8N K;  2JSS A;  3W99 A;  4XUJ D;  3LJA A;  5CPJ A;  3LJA B;  5CPI C;  3AZH A;  3LEL B;  3EPJ A;  3AL0 C;  3LZ1 D;  3WA9 B;  4LD9 B;  3IP4 C;  5B31 C;  3AZK A;  4XZQ C;  3C1C D;  3AN2 D;  1P3O A;  5KDM B;  3KXB D;  5GT3 D;  2YFW B;  3UT9 A;  3X1T B;  2F8N B;  2PYO D;  2PYO C;  5B2I B;  1TZY C;  2BYM A;  2HUE B;  3B6G A;  2ARO A;  4J8V C;  3AFA B;  1P3K A;  3MGQ D;  3W96 B;  3W98 A;  5JRG B;  1M1A D;  3W96 C;  3UT9 C;  3AZF C;  5F99 C;  4H9O B;  5DNM B;  3REH B;  1P3L C;  5B1L A;  3NQU A;  4UUZ A;  4WU8 A;  3W98 B;  5AY8 C;  3O62 B;  2CV5 D;  1F66 D;  5BNV A;  5CP6 D;  3REI C;  3EPK A;  3WKJ D;  2HUE C;  4WU9 A;  4X23 A;  3X1U A;  3AFA A;  3WAA C;  4Z66 B;  5B0Y D;  1HTA A;  3AV1 A;  3B6G B;  1KX5 A;  3MGS D;  4YM6 C;  2ZY5 A;  3W97 D;  4WNN B;  3MGP C;  4XUJ A;  3REH D;  3AZH C;  3AZH D;  3H0R C;  4H9Q A;  3R45 A;  5BT1 C;  2Y2H A;  1ID3 B;  5C3I B;  1S32 C;  1M18 C;  4H9P B;  3AZK D;  4YM6 D;  2G5I C;  2Y2I A;  5GT3 A;  3MGP A;  5B24 D;  2FJ7 B;  1WWI A;  2PYO A;  3B6G D;  3AN2 C;  1KX3 C;  3MVD B;  4NE5 A;  3TU4 A;  5GT0 B;  5B2J A;  5E5A B;  5BT1 D;  2W8S A;  1P3I C;  5B1L D;  3C1B D;  1KX4 D;  5B33 A;  3FDD A;  4NE6 A;  3VH6 A;  2L5A A;  3REJ A;  4NFT A;  5CP6 A;  3KUY A;  5AV8 C;  3A1K A;  3AZI D;  3W98 C;  3KFU G;  2IO5 B;  4QLC C;  4Z66 A;  3X1U C;  1HQ3 A;  1TZY D;  2ZY4 A;  3B6F A;  3B0C T;  5B0Y A;  3AZJ D;  5B33 C;  3MGS A;  5DNN D;  3REK D;  2CV5 B;  1HQ3 B;  2ZY3 A;  5AV6 C;  1BH9 A;  2JCH A;  4E45 A;  3VH5 A;  3REI A;  1ZLA A;  3C1C B;  4QLC A;  4H9O A;  3REH A;  3REJ B;  3V9R A;  1BH8 A;  2NZD C;  4J8X A;  2RVQ D;  4EO5 B;  3TU4 B;  4YM6 A;  1P3B A;  5B2I D;  2PYO B;  3X1T C;  3H0M C;  4JJN B;  3AZM A;  1R4V A;  4ZBJ B;  3AZE B;  5B24 C;  1U35 C;  4ZUX B;  1M18 A;  1AOI B;  3LZ0 C;  5B32 C;  3MNN B;  1F1E A;  2ZY2 A;  1M19 B;  2RVQ C;  3LJA C;  4H9P A;  3X1S C;  4H9Q B;  3B0B A;  5DNM D;  3REJ D;  5B31 A;  3AYW B;  3KUY D;  2F8N G;  5GSU C;  1U35 D;  3AZI A;  4WNN A;  3WTP E;  5BS7 C;  3UTB A;  3B0D B;  1EQZ A;  1P3A A;  1TZY A;  5G49 B;  4CAY A;  3B6F D;  5B0Y C;  5AV6 B;  3AZJ A;  2XD5 A;  3W99 D;  5CPJ D;  4YS3 A;  4HGA B;  3REI D;  3KUY B;  1BH8 B;  2CV5 C;  2F8N A;  5B1L C;  4WU8 C;  3AZN C;  5F99 A;  1P3L A;  1B6W A;  4UPK A;  4G91 B;  3UT9 D;  4KHA B;  3MGQ C;  3AZL B;  5AVC B;  5JA4 B;  3WTP D;  3UTA B;  2ARO D;  5GT0 D;  4X23 C;  1P3K D;  3EG5 B;  3AZG D;  3WAA A;  1KX3 B;  3NQJ A;  3AZM D;  1P3F C;  2BYM B;  2FJ7 A;  5CP6 B;  3B0D C;  5B40 A;  5B1M B;  1M18 D;  3LZ1 C;  3X1V A;  1ULY A;  3AYW C;  1F66 A;  5CPK C;  4XUJ C;  5B2J B;  5B32 D;  2NZD D;  4WU9 D;  3AZH B;  3AFA D;  1U35 A;  5GXQ B;  1KX5 D;  4ZUX A;  1M18 B;  5B1M D;  1P3M B;  1AOI A;  3X1T D;  5AV9 A;  1BFM A;  3AZM B;  3AZJ C;  4R8P A;  3AZG B;  1P34 C;  3EPH A;  4YS3 D;  5AV5 A;  5AVC A;  3AZI C;  2F8N D;  2G5H C;  5F99 D;  1P3L D;  5AY8 B;  3X1S D;  1P3I A;  1JFI A;  3MGP D;  4EO5 C;  3MGS B;  4YS3 C;  2Y2P A;  3H0L C;  1P3O C;  1BH9 B;  3REI B;  2VQR A;  4YS3 B;  4J8W A;  3B0C W;  4J8U B;  3WAA D;  2BYK A;  2YFW A;  5BNV B;  3UT9 B;  1Q9C A;  1ZLA C;  4WU9 C;  4H9S C;  4Z5T B;  5B31 B;  3AYW A;  3AFA C;  3A1I A;  3AZF A;  3LEL A;  2NZD A;  5AY8 A;  1P3I B;  1HQ3 D;  4DRB A;  5E5A A;  3AZJ B;  4H9S A;  3KWQ B;  5DNN A;  3REK A;  1H3O A;  3X1T A;  4ZBJ C;  5AV9 D;  3AZE C;  4R8P B;  3AZM C;  1P3F D;  5GT0 C;  2NQB B;  2FFF B;  4QLC D;  3AZG C;  4JJN D;  1S32 D;  5AV5 D;  1P34 B;  1P3M C;  1P3G C;  1N1J A;  4KGC D;  3LZ1 B;  4H9R A;  3C1B B;  1KX4 B;  3WKJ C;  1F66 B;  4XUJ B;  1ID3 C;  3MNN D;  3X1S A;  1P3I D;  2UWX A;  1M19 D;  3V9R B;  1KU5 A;  5CPK B;  4NE3 A;  1EQZ C;  2HIO B;  5AVC C;  5AVB C;  4X23 B;  5B40 B;  3KWQ C;  5CPJ C;  2BYK B;  5DNN B;  3REK B;  5B1M C;  4YM6 B;  3EPL A;  5CP6 C;  5AV8 A;  3AZK C;  5DNM A;  3AYW D;  5B31 D;  5AVB A;  3AZF D;  4G91 C;  3AZL C;  4KHA A;  3O62 A;  3VH6 T;  1ZLA B;  4KUD A;  3UTB D;  5B1L B;  4WV4 B;  4G92 B;  1P3A D;  5AVB B;  4J8V D;  3REL D;  5E5A D;  3AV2 D;  3W96 A;  3A6N A;  3UTA D;  1P3F A;  3P5J B;  3REL B;  1P3M A;  1S32 A;  5CHL B;  4AWL B;  4KGC A;  3UTB B;  5GXQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...