1P3PB

Crystallographic studies of nucleosome core particles containing histone 'sin' mutants
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
81
structure length
81
Chain Sequence
LRDNIQGITKPAIRRLARRGGIKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords Palindromic 146bp Human Alpha-Satellite DNA fragment
publication title Crystal structures of histone Sin mutant nucleosomes reveal altered protein-DNA interactions
pubmed doi rcsb
source organism Homo sapiens
total genus 24
structure length 81
sequence length 81
chains with identical sequence F
ec nomenclature
pdb deposition date 2003-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1p3pB00
2NZDB 3X1VB 5DNNC 5B40D 3WTPA 5DNMB 5BNVA 1ZLAC 5B1MC 5B0YA 3AV1D 3X1UB 5AY8C 3AZIB 5AV9C 4JJNB 3MGRD 4H9QA 5E5AB 5AVCD 1P3FB 1P3PC 2AROB 1F66A 1BH9A 3B6FA 1JFIA 2F8ND 4WU8A 3TU4B 4Z5TA 3AZHA 4LD9B 5CPIC 5GT3B 3W97C 3AYWD 1P3IA 3AZMB 5BS7A 5AV8D 4G91B 3X1TA 1P3LD 4J8XB 3REHD 2FJ7D 4XUJC 3KXBC 4J8UC 3REIC 4ZBJC 5JRGD 3LELC 4QLCD 4WNNB 3W99D 3AV1A 3MGQD 2NQBD 3WTPB 1ZLAA 4DRBA 5BNVB 1P3BD 3MGRA 5B0ZC 1S32C 5B0YB 5BO0A 5AV9A 3AZJD 4X23B 2F8NA 4H9QB 5GXQD 1P3PA 4YS3D 5B1LA 1B67A 1F66B 1BH9B 4ZUXC 3WA9C 3B6FB 4H9SA 1JFIB 5AV5D 4WU8B 5FUGA 4Z5TB 1KX5C 3AZHB 3W97A 1P34C 1P3LA 5B2IC 3REHA 5DNMC 1P3IB 2BYMA 3X1TB 1TZYC 1U35D 3NQJA 3KXBA 1AOIC 4QLCA 3NQUA 3W99A 3LELA 3W96D 5E5AC 1TAFA 1P3FC 3MGQA 3MNNC 3X1SA 4WV4B 1P3GC 3AFAD 5C3IC 3B6GD 1P3BA 3AZFD 3AV1B 1M1AD 4LD9C 1BH8A 4NFTA 1ZLAB 1S32A 3AZGD 4J8WD 3MGRB 4G91C 1KX4D 3LZ0D 2CV5C 4J8XC 5BO0B 5AV9B 4M6BA 2F8NB 1P3PB 3VH5A 5B1LB 4ZUXA 3MGPC 4KGCA 1Q9CA 3A6ND 1KX5A 1P3AD 3O62C 5FUGB 3UT9D 1P34A 3W97B 5B2IA 3LJAD 1P3LB 3REHB 3WTPC 3UTBD 1EQZC 4Z66D 5B0YC 2BYMB 1TZYA 3UTAC 1P3OC 1AOIA 4XUJB 4R8PC 3NQJB 2HIOC 3KXBB 4QLCB 3NQUB 3W99B 3LELB 1KX3D 1ID3C 1TAFB 3WKJC 1F66C 5CPJD 3MNNA 1P3GA 3REKD 5GSUD 3MGQB 3B6FC 3X1SB 3VH6A 5B31C 1P3BB 2RVQD 5AVBD 4H9RA 1BH8B 2PYOD 1P3IC 5B0ZB 4J8VC 4YM6D 2CV5A 1S32B 1N1JA 5B31G 5F99A 4G92C 4H9NA 3MGPA 5B40C 4ZUXB 4WU9D 4KGCB 3O62A 1KX5B 3AV1C 1P34B 5B2IB 3WAAD 5AV6D 4XZQD 1EQZA 3C1BD 5B24D 3UTAA 3MGRC 1P3OA 1KX3A 1TZYB 5AVCC 4R8PA 2HIOA 4UUZA 5BNXA 5B2JD 3AZND 1AOIB 3REKA 5B32D 1ID3A 3WKJA 5B1LC 3MNNB 1P3GB 3AYWC 5C3IB 5B31A 4H9SC 3RELD 3AZKD 5AV8C 2F8NG 3LZ1D 4KUDD 4H9RB 1P3LC 3REHC 2FJ7C 3REJD 4J8VA 2CV5B 5JRGC 1WWSA 1N1JB 5F99B 4QLCC 4NE3A 3W99C 1HQ3D 5B1MD 4H9NB 5B40A 3MGPB 3C1CD 3MGQC 2NQBC 3X1SC 4XZQA 3MVDD 3O62B 3C1BA 5B24A 1P3BC 5B33D 3KWQD 5B2JA 2F8NK 3AZJC 1EQZB 4KHAA 5CP6D 5AVCA 3MGSD 5GXQC 3UTAB 1P3OB 1KX3B 4YS3C 4R8PB 2HIOB 4UUZB 5BNXB 3AN2D 3REKB 3AV2D 3RELA 5AV5C 1ID3B 1P3MD 3WKJB 3AYWA 4KGCC 4J8UD 5B31B 2HUEB 5AV8A 2FJ7A 5GT0D 1U35C 4J8VB 5JRGA 3W96C 4G92B 1HTAA 1P3KD 3W98D 3AFAC 3B6GC 3AZFC 5B33A 1M1AC 5B40B 2NQBA 3R45A 4E44A 3V9RA 2LY8A 4XZQB 3C1BB 5B24B 4J8WC 1KX4C 3LZ0C 5B2JB 3AZJA 5CPKD 2IO5C 5GXQA 2NZDD 3X1VD 4KHAB 5AVCB 4YS3A 5F99C 4CAYA 5DNMD 1M19D 5AV5A 3A6NC 3RELB 1P3AC 3UT9C 5CHLB 3X1UD 3LJAC 3AYWB 5GT0A 3AZID 4JJND 4Z2MG 3UTBC 5AV8B 4Z66C 2AROD 1U35A 2FJ7B 3AZED 3B0CT 3W96A 3TU4D 3W98A 5JRGB 1B6WA 5BT1D 1KX3C 5GT3D 5CPJC 3REKC 5GSUC 3AFAA 3B6GA 3AZMD 1WWIA 4H9OA 3AZFA 1M1AA 3B0CW 3B0BA 5AVBC 5B33B 2NQBB 3R45B 3WTPE 2HUEC 3V9RB 4J8WA 3AZGA 1KX4A 4YM6C 3LZ0A 1M18D 3AZJB 1M19A 5GXQB 1R4VA 3VH5T 4YS3B 3AZLD 1H3OA 4CAYB 3A6NA 3KUYD 1P3AA 4CSRA 5AV5B 5B0YD 3UT9A 3LJAA 3WAAC 3AZEA 5GT0B 3VH5W 5AV6C 3UTBA 4XZQC 4X23D 4Z66A 3C1BC 5B24C 1U35B 5B2JC 3AZNC 5B32C 3W96B 4WU8D 3W98B 4Z5TD 3AZHD 5CPJA 5GSUA 3AFAB 3VH6T 1P3ID 3B6GB 3RELC 3AZKC 4H9OB 5B32G 3AZFB 5AVBA 1M1AB 1M18A 3X1TD 3B0DB 1KU5A 2PYOA 3REJC 4YM6A 3AZGB 4J8WB 1KX4B 3LZ0B 3VH6W 2IO5B 3AZLA 3KUYA 5KDMA 1M19B 4HGAC 5DNND 1HQ3C 4WU9A 3C1CC 1H3OB 1ZLAD 3A6NB 4X23A 1P3AB 4CSRB 3MVDC 3UT9B 5JA4A 5AY8D 5B33C 3WAAA 3LJAB 3KWQC 5AV6A 5AV9D 3AZEB 3UTBB 4Z66B 2BYKA 5CP6C 3MGSC 1P3PD 3AZNA 5B1LD 5B32A 3AN2C 3AV2C 2CWEA 5CPID 3W97D 1P3MC 5CPJB 5GSUB 3AZKA 5AVBB 3LZ1A 1M18B 4KUDA 4XUJD 3KXBD 3REJA 5GT0C 3REID 2PYOB 4YM6B 3LELD 5DNNA 3X1SD 4NE6A 3AZLB 1P3KC 3KUYB 5KDMB 3W98C 1HQ3A 5B1MA 1BFMA 5G49A 5AY8A 3C1CA 4EO5C 4WU9B 2YFWA 3MVDA 5B0ZD 1S32D 3KWQA 4H9PA 3B0DC 5JA4B 2F8NH 3WAAB 5AV6B 5CPKC 5CP6A 3MGSA 3AZGC 2NZDC 3X1VC 2BYKB 4AWLB 5CPIA 3AZNB 4ZUXD 3AN2A 3WA9D 5B32B 3AV2A 4KGCD 1M19C 1KX5D 1P3MA 1P34D 5B2ID 3X1UC 4XUJA 4J8UA 3REIA 3AZIC 4JJNC 3AZKB 1TZYD 1AOID 2AROC 3LZ1B 4KUDB 3REJB 3AZEC 5E5AD 3TU4C 1P3FD 5DNNB 5BT1C 5GT3C 3MNND 1P3GD 1P3KA 4HGAB 5B0ZA 3AZMC 1HQ3B 5B1MB 4LD9D 5G49B 5AY8B 3C1CB 4NE5A 2YFVA 2L5AA 2YFWB 3MVDB 2RVQC 2CV5D 4J8XD 1M18C 3KWQB 5F99D 4H9PB 5CPKA 3WA9A 3KSYA 2PYOC 2NZDA 3X1VA 5CP6B 3MGSB 3MGPD 5CPIB 5DNMA 3AN2B 3AZLC 3AV2B 3KUYC 3O62D 1P3MB 3X1UA 4WU9C 3WTPD 4JJNA 3AZIA 4J8UB 3REIB 1EQZD 4X23C 4ZBJB 5E5AA 3UTAD 1P3OD 1P3FA 2AROA 4R8PD 2HIOD 4E45A 3TU4A 4WU8C 4LD9A 4Z5TC 1ID3D 3WKJD 4AWLC 5GT3A 3AZHC 4WZSB 1F66D 1ULYA 3B6FD 1F1EA 1P3KB 4DRAA 3AZMA 5B31D 5BS7C 4J8XA 4EO5B 3X1TC 2YFVB 4J8VD 4Z2MH 1A7WA 2JSSA 3LZ1C 4KUDC 4WNNA 5CPKB 3WA9B
chains in the Genus database with same CATH superfamily
2NZDB 3X1VB 5DNNC 5B40D 3WTPA 5DNMB 5BNVA 1ZLAC 5B1MC 5B0YA 3AV1D 3X1UB 5AY8C 2F2AC 3AZIB 5AV9C 4JJNB 3MGRD 4H9QA 5E5AB 5AVCD 2Y2LA 1P3FB 2AROB 1P3PC 1F66A 1BH9A 3B6FA 1JFIA 2F8ND 4WU8A 3TU4B 4Z5TA 3AZHA 4LD9B 2ZY5A 5CPIC 5GT3B 3W97C 3AYWD 1P3IA 3AZMB 5BS7A 5AV8D 4G91B 3X1TA 1P3LD 4J8XB 3REHD 2FJ7D 4XUJC 3KXBC 4J8UC 3REIC 4ZBJC 5JRGD 3LELC 4QLCD 4WNNB 3W99D 3AV1A 3MGQD 2NQBD 3H0RC 2DQNC 3WTPB 1ZLAA 4DRBA 5BNVB 1P3BD 3MGRA 5B0ZC 1S32C 5B0YB 5BO0A 5AV9A 3AZJD 4X23B 2F8NA 4H9QB 5GXQD 1P3PA 4YS3D 5B1LA 1B67A 1F66B 1BH9B 4ZUXC 3WA9C 3B6FB 4H9SA 1JFIB 3EG5B 5AV5D 5FUGA 4WU8B 4Z5TB 1KX5C 3AZHB 3W97A 1P34C 1P3LA 4WJ3C 5B2IC 3REHA 5DNMC 1P3IB 3FDDA 2BYMA 3X1TB 1TZYC 1U35D 3NQJA 3KXBA 1AOIC 4QLCA 3NQUA 3W99A 3LELA 3W96D 5E5AC 1TAFA 1P3FC 3MGQA 3MNNC 3X1SA 4WV4B 1P3GC 3F6TA 5C3IC 3AFAD 3B6GD 1P3BA 3AZFD 3AV1B 1M1AD 4LD9C 1BH8A 4NFTA 1ZLAB 1S32A 3AZGD 4J8WD 3MGRB 4G91C 2XD5A 1KX4D 3LZ0D 2CV5C 2Y2PA 4J8XC 5BO0B 5AV9B 4M6BA 2VQRA 2F8NB 1P3PB 2Y2OA 3VH5A 5B1LB 4ZUXA 3MGPC 4KGCA 1Q9CA 3A6ND 1KX5A 1P3AD 3O62C 5FUGB 3UT9D 1P34A 3W97B 5B2IA 3LJAD 1P3LB 3REHB 2Y2HA 3WTPC 3UTBD 3H0LC 1EQZC 5B0YC 4Z66D 2BYMB 1TZYA 3UTAC 1P3OC 1AOIA 4XUJB 4R8PC 3NQJB 2HIOC 3KXBB 4QLCB 4DQYB 3NQUB 3W99B 3LELB 1KX3D 1ID3C 1TAFB 3WKJC 1F66C 5CPJD 3MNNA 3P5JB 1P3GA 3REKD 5GSUD 3MGQB 3B6FC 3X1SB 3VH6A 5B31C 1P3BB 2RVQD 5AVBD 4H9RA 1BH8B 2PYOD 1P3IC 5B0ZB 4J8VC 4YM6D 2CV5A 1S32B 3EPKA 1N1JA 5B31G 5F99A 4G92C 4H9NA 3MGPA 5B40C 4ZUXB 4WU9D 4KGCB 3O62A 1KX5B 3AV1C 1P34B 5B2IB 3WAAD 5AV6D 4XZQD 1EQZA 3C1BD 5B24D 3UTAA 3MGRC 1P3OA 3AL0C 1KX3A 1TZYB 5AVCC 4R8PA 2HIOA 4UUZA 5BNXA 5B2JD 3AZND 1AOIB 3REKA 5B32D 3KFUG 1ID3A 3WKJA 5B1LC 3MNNB 1P3GB 3AYWC 5C3IB 1Z2CB 5B31A 4H9SC 3RELD 3AZKD 5AV8C 2F8NG 3LZ1D 4KUDD 4H9RB 1P3LC 3REHC 2FJ7C 3REJD 4J8VA 2J8PA 2CV5B 5JRGC 1WWSA 1N1JB 5F99B 4QLCC 2ZY3A 4NE3A 3W99C 1HQ3D 5B1MD 4H9NB 5B40A 3MGPB 3C1CD 3MGQC 2NQBC 3X1SC 4XZQA 3MVDD 3O62B 3C1BA 5B24A 1P3BC 5B33D 3KWQD 5B2JA 3A1KA 2F8NK 3AZJC 1EQZB 4KHAA 5CP6D 5AVCA 3MGSD 5GXQC 3UTAB 1P3OB 1KX3B 4YS3C 4R8PB 2HIOB 4UUZB 5BNXB 3AN2D 3REKB 3AV2D 3RELA 2G5HC 5AV5C 3A1IA 1ID3B 1P3MD 3WKJB 2Y2QA 2BG1A 3AYWA 4KGCC 4J8UD 5B31B 2HUEB 5AV8A 2FJ7A 3EPHA 5GT0D 1U35C 4J8VB 5JRGA 3W96C 4G92B 1HTAA 1P3KD 3W98D 3AFAC 3B6GC 3IP4C 5B33A 3AZFC 5B40B 1M1AC 2NQBA 3R45A 4E44A 3V9RA 2LY8A 4XZQB 3C1BB 5B24B 4J8WC 1KX4C 2RIQA 3LZ0C 5B2JB 3AZJA 5CPKD 2IO5C 5GXQA 2NZDD 1W2EA 3X1VD 4KHAB 5AVCB 4YS3A 2G5IC 5F99C 4CAYA 5DNMD 1M19D 5AV5A 3A6NC 3RELB 1P3AC 3UT9C 5CHLB 3X1UD 2FFFB 3LJAC 3AYWB 5GT0A 3AZID 4JJND 4Z2MG 3UTBC 1PZRA 5AV8B 4Z66C 2AROD 1U35A 2FJ7B 3AZED 3B0CT 3W96A 3TU4D 3W98A 5JRGB 1B6WA 5BT1D 1KX3C 5GT3D 5CPJC 3REKC 5GSUC 3AFAA 3B6GA 3AZMD 1WWIA 2Y2MA 4H9OA 3AZFA 1M1AA 3B0CW 3B0BA 5AVBC 5B33B 2NQBB 3R45B 3V9RB 2HUEC 3WTPE 4J8WA 3AZGA 1KX4A 4YM6C 3LZ0A 1M18D 3AZJB 1M19A 5GXQB 1R4VA 3VH5T 4YS3B 2Y2GA 3AZLD 1H3OA 2Y2IA 4CAYB 3A6NA 3KUYD 1P3AA 4CSRA 5AV5B 5B0YD 3UT9A 3LJAA 3WAAC 3AZEA 5GT0B 3VH5W 5AV6C 3UTBA 4XZQC 4X23D 2UWXA 2ZY4A 4Z66A 3C1BC 5B24C 1U35B 5B2JC 3AZNC 5B32C 4UPKA 3W96B 4WU8D 3W98B 4Z5TD 3AZHD 5CPJA 5GSUA 3AFAB 3VH6T 1P3ID 3B6GB 3RELC 3AZKC 4H9OB 5B32G 3AZFB 5AVBA 1M1AB 1M18A 3X1TD 3B0DB 1KU5A 2PYOA 3H0MC 3REJC 4YM6A 3AZGB 4J8WB 1KX4B 3LZ0B 3VH6W 2IO5B 3AZLA 3KUYA 5KDMA 1M19B 4HGAC 5DNND 1HQ3C 4WU9A 3C1CC 1H3OB 1ZLAD 3A6NB 4X23A 1P3AB 4CSRB 3MVDC 3UT9B 5JA4A 5AY8D 5B33C 3WAAA 2Y2NA 3LJAB 2Y2KA 3KWQC 5AV6A 5AV9D 3AZEB 3UTBB 2W8SA 4Z66B 2BYKA 5CP6C 3MGSC 1P3PD 3AZNA 5B1LD 5B32A 3AN2C 2ZM5A 3AV2C 2CWEA 5CPID 3W97D 1P3MC 5CPJB 5GSUB 3AZKA 5AVBB 3LZ1A 1M18B 4KUDA 4XUJD 3KXBD 3REJA 5GT0C 3REID 2PYOB 4YM6B 3EPJA 3LELD 5DNNA 3X1SD 4NE6A 3AZLB 1P3KC 3KUYB 5KDMB 3W98C 1HQ3A 5B1MA 2JCHA 1BFMA 5G49A 5AY8A 3C1CA 4EO5C 4WU9B 2YFWA 2DF4C 3MVDA 5B0ZD 1S32D 3KWQA 4H9PA 3B0DC 5JA4B 2F8NH 3WAAB 5AV6B 5CPKC 5CP6A 3MGSA 3AZGC 2NZDC 3X1VC 2BYKB 4AWLB 5CPIA 3AZNB 4ZUXD 3AN2A 3WA9D 5B32B 3AV2A 4KGCD 1M19C 1KX5D 1P3MA 1P34D 5B2ID 3X1UC 4XUJA 4J8UA 3REIA 3AZIC 4JJNC 3AZKB 2Y2JA 1TZYD 1AOID 2AROC 3LZ1B 4KUDB 3REJB 3AZEC 5E5AD 3TU4C 1P3FD 5DNNB 5BT1C 5GT3C 3MNND 1P3GD 1P3KA 4HGAB 5B0ZA 3AZMC 1HQ3B 5B1MB 4LD9D 5G49B 5AY8B 3C1CB 4NE5A 2YFVA 2L5AA 2YFWB 3MVDB 2RVQC 2CV5D 4J8XD 1M18C 3KWQB 5F99D 4H9PB 5CPKA 3WA9A 3KSYA 2PYOC 3EPLA 2NZDA 3X1VA 5CP6B 3MGSB 3MGPD 5CPIB 5DNMA 3AN2B 3AZLC 3AV2B 3KUYC 3O62D 1P3MB 3X1UA 4WU9C 3WTPD 4JJNA 3AZIA 4J8UB 3REIB 1EQZD 4X23C 4ZBJB 5E5AA 3UTAD 1P3OD 1P3FA 2AROA 4R8PD 2HIOD 4E45A 3TU4A 4WU8C 4LD9A 4Z5TC 1ID3D 3WKJD 4AWLC 5GT3A 3AZHC 4WZSB 1F66D 1ULYA 3B6FD 1F1EA 1P3KB 4DRAA 3AZMA 5B31D 2XD1A 5BS7C 4J8XA 2ZY2A 2JE5A 4EO5B 3X1TC 2YFVB 4J8VD 4Z2MH 1A7WA 2JSSA 3LZ1C 4KUDC 4WNNA 1T3UA 5CPKB 3WA9B
chains in the Genus database with same CATH topology
2NZDB 3X1VB 5DNNC 5B40D 3WTPA 5DNMB 5BNVA 1ZLAC 5B1MC 5B0YA 3AV1D 3X1UB 5AY8C 2F2AC 3AZIB 5AV9C 4JJNB 3MGRD 4H9QA 5E5AB 5AVCD 2Y2LA 1P3FB 2AROB 1P3PC 1F66A 1BH9A 3B6FA 1JFIA 2F8ND 4WU8A 3TU4B 4Z5TA 3AZHA 4LD9B 2ZY5A 5CPIC 5GT3B 3W97C 3AYWD 1P3IA 3AZMB 5BS7A 5AV8D 4G91B 3X1TA 1P3LD 4J8XB 3REHD 2FJ7D 4XUJC 3KXBC 4J8UC 3REIC 4ZBJC 5JRGD 3LELC 4QLCD 4WNNB 3W99D 3AV1A 3MGQD 2NQBD 3H0RC 2DQNC 3WTPB 1ZLAA 4DRBA 5BNVB 1P3BD 3MGRA 5B0ZC 1S32C 5B0YB 5BO0A 5AV9A 3AZJD 4X23B 2F8NA 4H9QB 5GXQD 1P3PA 4YS3D 5B1LA 1B67A 1F66B 1BH9B 4ZUXC 3WA9C 3B6FB 4H9SA 1JFIB 3EG5B 5AV5D 5FUGA 4WU8B 4Z5TB 1KX5C 3AZHB 3W97A 1P34C 1P3LA 4WJ3C 5B2IC 3REHA 5DNMC 1P3IB 3FDDA 2BYMA 3X1TB 1TZYC 1U35D 3NQJA 3KXBA 1AOIC 4QLCA 3NQUA 3W99A 3LELA 3W96D 5E5AC 1TAFA 1P3FC 3MGQA 3MNNC 3X1SA 4WV4B 1P3GC 3F6TA 5C3IC 3AFAD 3B6GD 1P3BA 3AZFD 3AV1B 1M1AD 4LD9C 1BH8A 4NFTA 1ZLAB 1S32A 3AZGD 4J8WD 3MGRB 4G91C 2XD5A 1KX4D 3LZ0D 2CV5C 2Y2PA 4J8XC 5BO0B 5AV9B 4M6BA 2VQRA 2F8NB 1P3PB 2Y2OA 3VH5A 5B1LB 4ZUXA 3MGPC 4KGCA 1Q9CA 3A6ND 1KX5A 1P3AD 3O62C 5FUGB 3UT9D 1P34A 3W97B 5B2IA 3LJAD 1P3LB 3REHB 2Y2HA 3WTPC 3UTBD 3H0LC 1EQZC 5B0YC 4Z66D 2BYMB 1TZYA 3UTAC 1P3OC 1AOIA 4XUJB 4R8PC 3NQJB 2HIOC 3KXBB 4QLCB 4DQYB 3NQUB 3W99B 3LELB 1KX3D 1ID3C 1TAFB 3WKJC 1F66C 5CPJD 3MNNA 3P5JB 1P3GA 3REKD 5GSUD 3MGQB 3B6FC 3X1SB 3VH6A 5B31C 1P3BB 2RVQD 5AVBD 4H9RA 1BH8B 2PYOD 1P3IC 5B0ZB 4J8VC 4YM6D 2CV5A 1S32B 3EPKA 1N1JA 5B31G 5F99A 4G92C 4H9NA 3MGPA 5B40C 4ZUXB 4WU9D 4KGCB 3O62A 1KX5B 3AV1C 1P34B 5B2IB 3WAAD 5AV6D 4XZQD 1EQZA 3C1BD 5B24D 3UTAA 3MGRC 1P3OA 3AL0C 1KX3A 1TZYB 5AVCC 4R8PA 2HIOA 4UUZA 5BNXA 5B2JD 3AZND 1AOIB 3REKA 5B32D 3KFUG 1ID3A 3WKJA 5B1LC 3MNNB 1P3GB 3AYWC 5C3IB 1Z2CB 5B31A 4H9SC 3RELD 3AZKD 5AV8C 2F8NG 3LZ1D 4KUDD 4H9RB 1P3LC 3REHC 2FJ7C 3REJD 4J8VA 2J8PA 2CV5B 5JRGC 1WWSA 1N1JB 5F99B 4QLCC 2ZY3A 4NE3A 3W99C 1HQ3D 5B1MD 4H9NB 5B40A 3MGPB 3C1CD 3MGQC 2NQBC 3X1SC 4XZQA 3MVDD 3O62B 3C1BA 5B24A 1P3BC 5B33D 3KWQD 5B2JA 3A1KA 2F8NK 3AZJC 1EQZB 4KHAA 5CP6D 5AVCA 3MGSD 5GXQC 3UTAB 1P3OB 1KX3B 4YS3C 4R8PB 2HIOB 4UUZB 5BNXB 3AN2D 3REKB 3AV2D 3RELA 2G5HC 5AV5C 3A1IA 1ID3B 1P3MD 3WKJB 2Y2QA 2BG1A 3AYWA 4KGCC 4J8UD 5B31B 2HUEB 5AV8A 2FJ7A 3EPHA 5GT0D 1U35C 4J8VB 5JRGA 3W96C 4G92B 1HTAA 1P3KD 3W98D 3AFAC 3B6GC 3IP4C 5B33A 3AZFC 5B40B 1M1AC 2NQBA 3R45A 4E44A 3V9RA 2LY8A 4XZQB 3C1BB 5B24B 4J8WC 1KX4C 2RIQA 3LZ0C 5B2JB 3AZJA 5CPKD 2IO5C 5GXQA 2NZDD 1W2EA 3X1VD 4KHAB 5AVCB 4YS3A 2G5IC 5F99C 4CAYA 5DNMD 1M19D 5AV5A 3A6NC 3RELB 1P3AC 3UT9C 5CHLB 3X1UD 2FFFB 3LJAC 3AYWB 5GT0A 3AZID 4JJND 4Z2MG 3UTBC 1PZRA 5AV8B 4Z66C 2AROD 1U35A 2FJ7B 3AZED 3B0CT 3W96A 3TU4D 3W98A 5JRGB 1B6WA 5BT1D 1KX3C 5GT3D 5CPJC 3REKC 5GSUC 3AFAA 3B6GA 3AZMD 1WWIA 2Y2MA 4H9OA 3AZFA 1M1AA 3B0CW 3B0BA 5AVBC 5B33B 2NQBB 3R45B 3V9RB 2HUEC 3WTPE 4J8WA 3AZGA 1KX4A 4YM6C 3LZ0A 1M18D 3AZJB 1M19A 5GXQB 1R4VA 3VH5T 4YS3B 2Y2GA 3AZLD 1H3OA 2Y2IA 4CAYB 3A6NA 3KUYD 1P3AA 4CSRA 5AV5B 5B0YD 3UT9A 3LJAA 3WAAC 3AZEA 5GT0B 3VH5W 5AV6C 3UTBA 4XZQC 4X23D 2UWXA 2ZY4A 4Z66A 3C1BC 5B24C 1U35B 5B2JC 3AZNC 5B32C 4UPKA 3W96B 4WU8D 3W98B 4Z5TD 3AZHD 5CPJA 5GSUA 3AFAB 3VH6T 1P3ID 3B6GB 3RELC 3AZKC 4H9OB 5B32G 3AZFB 5AVBA 1M1AB 1M18A 3X1TD 3B0DB 1KU5A 2PYOA 3H0MC 3REJC 4YM6A 3AZGB 4J8WB 1KX4B 3LZ0B 3VH6W 2IO5B 3AZLA 3KUYA 5KDMA 1M19B 4HGAC 5DNND 1HQ3C 4WU9A 3C1CC 1H3OB 1ZLAD 3A6NB 4X23A 1P3AB 4CSRB 3MVDC 3UT9B 5JA4A 5AY8D 5B33C 3WAAA 2Y2NA 3LJAB 2Y2KA 3KWQC 5AV6A 5AV9D 3AZEB 3UTBB 2W8SA 4Z66B 2BYKA 5CP6C 3MGSC 1P3PD 3AZNA 5B1LD 5B32A 3AN2C 2ZM5A 3AV2C 2CWEA 5CPID 3W97D 1P3MC 5CPJB 5GSUB 3AZKA 5AVBB 3LZ1A 1M18B 4KUDA 4XUJD 3KXBD 3REJA 5GT0C 3REID 2PYOB 4YM6B 3EPJA 3LELD 5DNNA 3X1SD 4NE6A 3AZLB 1P3KC 3KUYB 5KDMB 3W98C 1HQ3A 5B1MA 2JCHA 1BFMA 5G49A 5AY8A 3C1CA 4EO5C 4WU9B 2YFWA 2DF4C 3MVDA 5B0ZD 1S32D 3KWQA 4H9PA 3B0DC 5JA4B 2F8NH 3WAAB 5AV6B 5CPKC 5CP6A 3MGSA 3AZGC 2NZDC 3X1VC 2BYKB 4AWLB 5CPIA 3AZNB 4ZUXD 3AN2A 3WA9D 5B32B 3AV2A 4KGCD 1M19C 1KX5D 1P3MA 1P34D 5B2ID 3X1UC 4XUJA 4J8UA 3REIA 3AZIC 4JJNC 3AZKB 2Y2JA 1TZYD 1AOID 2AROC 3LZ1B 4KUDB 3REJB 3AZEC 5E5AD 3TU4C 1P3FD 5DNNB 5BT1C 5GT3C 3MNND 1P3GD 1P3KA 4HGAB 5B0ZA 3AZMC 1HQ3B 5B1MB 4LD9D 5G49B 5AY8B 3C1CB 4NE5A 2YFVA 2L5AA 2YFWB 3MVDB 2RVQC 2CV5D 4J8XD 1M18C 3KWQB 5F99D 4H9PB 5CPKA 3WA9A 3KSYA 2PYOC 3EPLA 2NZDA 3X1VA 5CP6B 3MGSB 3MGPD 5CPIB 5DNMA 3AN2B 3AZLC 3AV2B 3KUYC 3O62D 1P3MB 3X1UA 4WU9C 3WTPD 4JJNA 3AZIA 4J8UB 3REIB 1EQZD 4X23C 4ZBJB 5E5AA 3UTAD 1P3OD 1P3FA 2AROA 4R8PD 2HIOD 4E45A 3TU4A 4WU8C 4LD9A 4Z5TC 1ID3D 3WKJD 4AWLC 5GT3A 3AZHC 4WZSB 1F66D 1ULYA 3B6FD 1F1EA 1P3KB 4DRAA 3AZMA 5B31D 2XD1A 5BS7C 4J8XA 2ZY2A 2JE5A 4EO5B 3X1TC 2YFVB 4J8VD 4Z2MH 1A7WA 2JSSA 3LZ1C 4KUDC 4WNNA 1T3UA 5CPKB 3WA9B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NZD B;  3X1V B;  5DNN C;  5B40 D;  3WTP A;  5DNM B;  5BNV A;  1ZLA C;  5B1M C;  5B0Y A;  3AV1 D;  3X1U B;  5AY8 C;  3AZI B;  5AV9 C;  4JJN B;  3MGR D;  4H9Q A;  5E5A B;  5AVC D;  1P3F B;  1P3P C;  2ARO B;  1F66 A;  1BH9 A;  3B6F A;  1JFI A;  2F8N D;  4WU8 A;  3TU4 B;  4Z5T A;  3AZH A;  4LD9 B;  5CPI C;  5GT3 B;  3W97 C;  3AYW D;  1P3I A;  3AZM B;  5BS7 A;  5AV8 D;  4G91 B;  3X1T A;  1P3L D;  4J8X B;  3REH D;  2FJ7 D;  4XUJ C;  3KXB C;  4J8U C;  3REI C;  4ZBJ C;  5JRG D;  3LEL C;  4QLC D;  4WNN B;  3W99 D;  3AV1 A;  3MGQ D;  2NQB D;  3WTP B;  1ZLA A;  4DRB A;  5BNV B;  1P3B D;  3MGR A;  5B0Z C;  1S32 C;  5B0Y B;  5BO0 A;  5AV9 A;  3AZJ D;  4X23 B;  2F8N A;  4H9Q B;  5GXQ D;  1P3P A;  4YS3 D;  5B1L A;  1B67 A;  1F66 B;  1BH9 B;  4ZUX C;  3WA9 C;  3B6F B;  4H9S A;  1JFI B;  5AV5 D;  4WU8 B;  5FUG A;  4Z5T B;  1KX5 C;  3AZH B;  3W97 A;  1P34 C;  1P3L A;  5B2I C;  3REH A;  5DNM C;  1P3I B;  2BYM A;  3X1T B;  1TZY C;  1U35 D;  3NQJ A;  3KXB A;  1AOI C;  4QLC A;  3NQU A;  3W99 A;  3LEL A;  3W96 D;  5E5A C;  1TAF A;  1P3F C;  3MGQ A;  3MNN C;  3X1S A;  4WV4 B;  1P3G C;  3AFA D;  5C3I C;  3B6G D;  1P3B A;  3AZF D;  3AV1 B;  1M1A D;  4LD9 C;  1BH8 A;  4NFT A;  1ZLA B;  1S32 A;  3AZG D;  4J8W D;  3MGR B;  4G91 C;  1KX4 D;  3LZ0 D;  2CV5 C;  4J8X C;  5BO0 B;  5AV9 B;  4M6B A;  2F8N B;  1P3P B;  3VH5 A;  5B1L B;  4ZUX A;  3MGP C;  4KGC A;  1Q9C A;  3A6N D;  1KX5 A;  1P3A D;  3O62 C;  5FUG B;  3UT9 D;  1P34 A;  3W97 B;  5B2I A;  3LJA D;  1P3L B;  3REH B;  3WTP C;  3UTB D;  1EQZ C;  4Z66 D;  5B0Y C;  2BYM B;  1TZY A;  3UTA C;  1P3O C;  1AOI A;  4XUJ B;  4R8P C;  3NQJ B;  2HIO C;  3KXB B;  4QLC B;  3NQU B;  3W99 B;  3LEL B;  1KX3 D;  1ID3 C;  1TAF B;  3WKJ C;  1F66 C;  5CPJ D;  3MNN A;  1P3G A;  3REK D;  5GSU D;  3MGQ B;  3B6F C;  3X1S B;  3VH6 A;  5B31 C;  1P3B B;  2RVQ D;  5AVB D;  4H9R A;  1BH8 B;  2PYO D;  1P3I C;  5B0Z B;  4J8V C;  4YM6 D;  2CV5 A;  1S32 B;  1N1J A;  5B31 G;  5F99 A;  4G92 C;  4H9N A;  3MGP A;  5B40 C;  4ZUX B;  4WU9 D;  4KGC B;  3O62 A;  1KX5 B;  3AV1 C;  1P34 B;  5B2I B;  3WAA D;  5AV6 D;  4XZQ D;  1EQZ A;  3C1B D;  5B24 D;  3UTA A;  3MGR C;  1P3O A;  1KX3 A;  1TZY B;  5AVC C;  4R8P A;  2HIO A;  4UUZ A;  5BNX A;  5B2J D;  3AZN D;  1AOI B;  3REK A;  5B32 D;  1ID3 A;  3WKJ A;  5B1L C;  3MNN B;  1P3G B;  3AYW C;  5C3I B;  5B31 A;  4H9S C;  3REL D;  3AZK D;  5AV8 C;  2F8N G;  3LZ1 D;  4KUD D;  4H9R B;  1P3L C;  3REH C;  2FJ7 C;  3REJ D;  4J8V A;  2CV5 B;  5JRG C;  1WWS A;  1N1J B;  5F99 B;  4QLC C;  4NE3 A;  3W99 C;  1HQ3 D;  5B1M D;  4H9N B;  5B40 A;  3MGP B;  3C1C D;  3MGQ C;  2NQB C;  3X1S C;  4XZQ A;  3MVD D;  3O62 B;  3C1B A;  5B24 A;  1P3B C;  5B33 D;  3KWQ D;  5B2J A;  2F8N K;  3AZJ C;  1EQZ B;  4KHA A;  5CP6 D;  5AVC A;  3MGS D;  5GXQ C;  3UTA B;  1P3O B;  1KX3 B;  4YS3 C;  4R8P B;  2HIO B;  4UUZ B;  5BNX B;  3AN2 D;  3REK B;  3AV2 D;  3REL A;  5AV5 C;  1ID3 B;  1P3M D;  3WKJ B;  3AYW A;  4KGC C;  4J8U D;  5B31 B;  2HUE B;  5AV8 A;  2FJ7 A;  5GT0 D;  1U35 C;  4J8V B;  5JRG A;  3W96 C;  4G92 B;  1HTA A;  1P3K D;  3W98 D;  3AFA C;  3B6G C;  3AZF C;  5B33 A;  1M1A C;  5B40 B;  2NQB A;  3R45 A;  4E44 A;  3V9R A;  2LY8 A;  4XZQ B;  3C1B B;  5B24 B;  4J8W C;  1KX4 C;  3LZ0 C;  5B2J B;  3AZJ A;  5CPK D;  2IO5 C;  5GXQ A;  2NZD D;  3X1V D;  4KHA B;  5AVC B;  4YS3 A;  5F99 C;  4CAY A;  5DNM D;  1M19 D;  5AV5 A;  3A6N C;  3REL B;  1P3A C;  3UT9 C;  5CHL B;  3X1U D;  3LJA C;  3AYW B;  5GT0 A;  3AZI D;  4JJN D;  4Z2M G;  3UTB C;  5AV8 B;  4Z66 C;  2ARO D;  1U35 A;  2FJ7 B;  3AZE D;  3B0C T;  3W96 A;  3TU4 D;  3W98 A;  5JRG B;  1B6W A;  5BT1 D;  1KX3 C;  5GT3 D;  5CPJ C;  3REK C;  5GSU C;  3AFA A;  3B6G A;  3AZM D;  1WWI A;  4H9O A;  3AZF A;  1M1A A;  3B0C W;  3B0B A;  5AVB C;  5B33 B;  2NQB B;  3R45 B;  3WTP E;  2HUE C;  3V9R B;  4J8W A;  3AZG A;  1KX4 A;  4YM6 C;  3LZ0 A;  1M18 D;  3AZJ B;  1M19 A;  5GXQ B;  1R4V A;  3VH5 T;  4YS3 B;  3AZL D;  1H3O A;  4CAY B;  3A6N A;  3KUY D;  1P3A A;  4CSR A;  5AV5 B;  5B0Y D;  3UT9 A;  3LJA A;  3WAA C;  3AZE A;  5GT0 B;  3VH5 W;  5AV6 C;  3UTB A;  4XZQ C;  4X23 D;  4Z66 A;  3C1B C;  5B24 C;  1U35 B;  5B2J C;  3AZN C;  5B32 C;  3W96 B;  4WU8 D;  3W98 B;  4Z5T D;  3AZH D;  5CPJ A;  5GSU A;  3AFA B;  3VH6 T;  1P3I D;  3B6G B;  3REL C;  3AZK C;  4H9O B;  5B32 G;  3AZF B;  5AVB A;  1M1A B;  1M18 A;  3X1T D;  3B0D B;  1KU5 A;  2PYO A;  3REJ C;  4YM6 A;  3AZG B;  4J8W B;  1KX4 B;  3LZ0 B;  3VH6 W;  2IO5 B;  3AZL A;  3KUY A;  5KDM A;  1M19 B;  4HGA C;  5DNN D;  1HQ3 C;  4WU9 A;  3C1C C;  1H3O B;  1ZLA D;  3A6N B;  4X23 A;  1P3A B;  4CSR B;  3MVD C;  3UT9 B;  5JA4 A;  5AY8 D;  5B33 C;  3WAA A;  3LJA B;  3KWQ C;  5AV6 A;  5AV9 D;  3AZE B;  3UTB B;  4Z66 B;  2BYK A;  5CP6 C;  3MGS C;  1P3P D;  3AZN A;  5B1L D;  5B32 A;  3AN2 C;  3AV2 C;  2CWE A;  5CPI D;  3W97 D;  1P3M C;  5CPJ B;  5GSU B;  3AZK A;  5AVB B;  3LZ1 A;  1M18 B;  4KUD A;  4XUJ D;  3KXB D;  3REJ A;  5GT0 C;  3REI D;  2PYO B;  4YM6 B;  3LEL D;  5DNN A;  3X1S D;  4NE6 A;  3AZL B;  1P3K C;  3KUY B;  5KDM B;  3W98 C;  1HQ3 A;  5B1M A;  1BFM A;  5G49 A;  5AY8 A;  3C1C A;  4EO5 C;  4WU9 B;  2YFW A;  3MVD A;  5B0Z D;  1S32 D;  3KWQ A;  4H9P A;  3B0D C;  5JA4 B;  2F8N H;  3WAA B;  5AV6 B;  5CPK C;  5CP6 A;  3MGS A;  3AZG C;  2NZD C;  3X1V C;  2BYK B;  4AWL B;  5CPI A;  3AZN B;  4ZUX D;  3AN2 A;  3WA9 D;  5B32 B;  3AV2 A;  4KGC D;  1M19 C;  1KX5 D;  1P3M A;  1P34 D;  5B2I D;  3X1U C;  4XUJ A;  4J8U A;  3REI A;  3AZI C;  4JJN C;  3AZK B;  1TZY D;  1AOI D;  2ARO C;  3LZ1 B;  4KUD B;  3REJ B;  3AZE C;  5E5A D;  3TU4 C;  1P3F D;  5DNN B;  5BT1 C;  5GT3 C;  3MNN D;  1P3G D;  1P3K A;  4HGA B;  5B0Z A;  3AZM C;  1HQ3 B;  5B1M B;  4LD9 D;  5G49 B;  5AY8 B;  3C1C B;  4NE5 A;  2YFV A;  2L5A A;  2YFW B;  3MVD B;  2RVQ C;  2CV5 D;  4J8X D;  1M18 C;  3KWQ B;  5F99 D;  4H9P B;  5CPK A;  3WA9 A;  3KSY A;  2PYO C;  2NZD A;  3X1V A;  5CP6 B;  3MGS B;  3MGP D;  5CPI B;  5DNM A;  3AN2 B;  3AZL C;  3AV2 B;  3KUY C;  3O62 D;  1P3M B;  3X1U A;  4WU9 C;  3WTP D;  4JJN A;  3AZI A;  4J8U B;  3REI B;  1EQZ D;  4X23 C;  4ZBJ B;  5E5A A;  3UTA D;  1P3O D;  1P3F A;  2ARO A;  4R8P D;  2HIO D;  4E45 A;  3TU4 A;  4WU8 C;  4LD9 A;  4Z5T C;  1ID3 D;  3WKJ D;  4AWL C;  5GT3 A;  3AZH C;  4WZS B;  1F66 D;  1ULY A;  3B6F D;  1F1E A;  1P3K B;  4DRA A;  3AZM A;  5B31 D;  5BS7 C;  4J8X A;  4EO5 B;  3X1T C;  2YFV B;  4J8V D;  4Z2M H;  1A7W A;  2JSS A;  3LZ1 C;  4KUD C;  4WNN A;  5CPK B;  3WA9 B; 
#chains in the Genus database with same CATH topology
 2NZD B;  3X1V B;  5DNN C;  5B40 D;  3WTP A;  5DNM B;  5BNV A;  1ZLA C;  5B1M C;  5B0Y A;  3AV1 D;  3X1U B;  5AY8 C;  2F2A C;  3AZI B;  5AV9 C;  4JJN B;  3MGR D;  4H9Q A;  5E5A B;  5AVC D;  2Y2L A;  1P3F B;  2ARO B;  1P3P C;  1F66 A;  1BH9 A;  3B6F A;  1JFI A;  2F8N D;  4WU8 A;  3TU4 B;  4Z5T A;  3AZH A;  4LD9 B;  2ZY5 A;  5CPI C;  5GT3 B;  3W97 C;  3AYW D;  1P3I A;  3AZM B;  5BS7 A;  5AV8 D;  4G91 B;  3X1T A;  1P3L D;  4J8X B;  3REH D;  2FJ7 D;  4XUJ C;  3KXB C;  4J8U C;  3REI C;  4ZBJ C;  5JRG D;  3LEL C;  4QLC D;  4WNN B;  3W99 D;  3AV1 A;  3MGQ D;  2NQB D;  3H0R C;  2DQN C;  3WTP B;  1ZLA A;  4DRB A;  5BNV B;  1P3B D;  3MGR A;  5B0Z C;  1S32 C;  5B0Y B;  5BO0 A;  5AV9 A;  3AZJ D;  4X23 B;  2F8N A;  4H9Q B;  5GXQ D;  1P3P A;  4YS3 D;  5B1L A;  1B67 A;  1F66 B;  1BH9 B;  4ZUX C;  3WA9 C;  3B6F B;  4H9S A;  1JFI B;  3EG5 B;  5AV5 D;  5FUG A;  4WU8 B;  4Z5T B;  1KX5 C;  3AZH B;  3W97 A;  1P34 C;  1P3L A;  4WJ3 C;  5B2I C;  3REH A;  5DNM C;  1P3I B;  3FDD A;  2BYM A;  3X1T B;  1TZY C;  1U35 D;  3NQJ A;  3KXB A;  1AOI C;  4QLC A;  3NQU A;  3W99 A;  3LEL A;  3W96 D;  5E5A C;  1TAF A;  1P3F C;  3MGQ A;  3MNN C;  3X1S A;  4WV4 B;  1P3G C;  3F6T A;  5C3I C;  3AFA D;  3B6G D;  1P3B A;  3AZF D;  3AV1 B;  1M1A D;  4LD9 C;  1BH8 A;  4NFT A;  1ZLA B;  1S32 A;  3AZG D;  4J8W D;  3MGR B;  4G91 C;  2XD5 A;  1KX4 D;  3LZ0 D;  2CV5 C;  2Y2P A;  4J8X C;  5BO0 B;  5AV9 B;  4M6B A;  2VQR A;  2F8N B;  1P3P B;  2Y2O A;  3VH5 A;  5B1L B;  4ZUX A;  3MGP C;  4KGC A;  1Q9C A;  3A6N D;  1KX5 A;  1P3A D;  3O62 C;  5FUG B;  3UT9 D;  1P34 A;  3W97 B;  5B2I A;  3LJA D;  1P3L B;  3REH B;  2Y2H A;  3WTP C;  3UTB D;  3H0L C;  1EQZ C;  5B0Y C;  4Z66 D;  2BYM B;  1TZY A;  3UTA C;  1P3O C;  1AOI A;  4XUJ B;  4R8P C;  3NQJ B;  2HIO C;  3KXB B;  4QLC B;  4DQY B;  3NQU B;  3W99 B;  3LEL B;  1KX3 D;  1ID3 C;  1TAF B;  3WKJ C;  1F66 C;  5CPJ D;  3MNN A;  3P5J B;  1P3G A;  3REK D;  5GSU D;  3MGQ B;  3B6F C;  3X1S B;  3VH6 A;  5B31 C;  1P3B B;  2RVQ D;  5AVB D;  4H9R A;  1BH8 B;  2PYO D;  1P3I C;  5B0Z B;  4J8V C;  4YM6 D;  2CV5 A;  1S32 B;  3EPK A;  1N1J A;  5B31 G;  5F99 A;  4G92 C;  4H9N A;  3MGP A;  5B40 C;  4ZUX B;  4WU9 D;  4KGC B;  3O62 A;  1KX5 B;  3AV1 C;  1P34 B;  5B2I B;  3WAA D;  5AV6 D;  4XZQ D;  1EQZ A;  3C1B D;  5B24 D;  3UTA A;  3MGR C;  1P3O A;  3AL0 C;  1KX3 A;  1TZY B;  5AVC C;  4R8P A;  2HIO A;  4UUZ A;  5BNX A;  5B2J D;  3AZN D;  1AOI B;  3REK A;  5B32 D;  3KFU G;  1ID3 A;  3WKJ A;  5B1L C;  3MNN B;  1P3G B;  3AYW C;  5C3I B;  1Z2C B;  5B31 A;  4H9S C;  3REL D;  3AZK D;  5AV8 C;  2F8N G;  3LZ1 D;  4KUD D;  4H9R B;  1P3L C;  3REH C;  2FJ7 C;  3REJ D;  4J8V A;  2J8P A;  2CV5 B;  5JRG C;  1WWS A;  1N1J B;  5F99 B;  4QLC C;  2ZY3 A;  4NE3 A;  3W99 C;  1HQ3 D;  5B1M D;  4H9N B;  5B40 A;  3MGP B;  3C1C D;  3MGQ C;  2NQB C;  3X1S C;  4XZQ A;  3MVD D;  3O62 B;  3C1B A;  5B24 A;  1P3B C;  5B33 D;  3KWQ D;  5B2J A;  3A1K A;  2F8N K;  3AZJ C;  1EQZ B;  4KHA A;  5CP6 D;  5AVC A;  3MGS D;  5GXQ C;  3UTA B;  1P3O B;  1KX3 B;  4YS3 C;  4R8P B;  2HIO B;  4UUZ B;  5BNX B;  3AN2 D;  3REK B;  3AV2 D;  3REL A;  2G5H C;  5AV5 C;  3A1I A;  1ID3 B;  1P3M D;  3WKJ B;  2Y2Q A;  2BG1 A;  3AYW A;  4KGC C;  4J8U D;  5B31 B;  2HUE B;  5AV8 A;  2FJ7 A;  3EPH A;  5GT0 D;  1U35 C;  4J8V B;  5JRG A;  3W96 C;  4G92 B;  1HTA A;  1P3K D;  3W98 D;  3AFA C;  3B6G C;  3IP4 C;  5B33 A;  3AZF C;  5B40 B;  1M1A C;  2NQB A;  3R45 A;  4E44 A;  3V9R A;  2LY8 A;  4XZQ B;  3C1B B;  5B24 B;  4J8W C;  1KX4 C;  2RIQ A;  3LZ0 C;  5B2J B;  3AZJ A;  5CPK D;  2IO5 C;  5GXQ A;  2NZD D;  1W2E A;  3X1V D;  4KHA B;  5AVC B;  4YS3 A;  2G5I C;  5F99 C;  4CAY A;  5DNM D;  1M19 D;  5AV5 A;  3A6N C;  3REL B;  1P3A C;  3UT9 C;  5CHL B;  3X1U D;  2FFF B;  3LJA C;  3AYW B;  5GT0 A;  3AZI D;  4JJN D;  4Z2M G;  3UTB C;  1PZR A;  5AV8 B;  4Z66 C;  2ARO D;  1U35 A;  2FJ7 B;  3AZE D;  3B0C T;  3W96 A;  3TU4 D;  3W98 A;  5JRG B;  1B6W A;  5BT1 D;  1KX3 C;  5GT3 D;  5CPJ C;  3REK C;  5GSU C;  3AFA A;  3B6G A;  3AZM D;  1WWI A;  2Y2M A;  4H9O A;  3AZF A;  1M1A A;  3B0C W;  3B0B A;  5AVB C;  5B33 B;  2NQB B;  3R45 B;  3V9R B;  2HUE C;  3WTP E;  4J8W A;  3AZG A;  1KX4 A;  4YM6 C;  3LZ0 A;  1M18 D;  3AZJ B;  1M19 A;  5GXQ B;  1R4V A;  3VH5 T;  4YS3 B;  2Y2G A;  3AZL D;  1H3O A;  2Y2I A;  4CAY B;  3A6N A;  3KUY D;  1P3A A;  4CSR A;  5AV5 B;  5B0Y D;  3UT9 A;  3LJA A;  3WAA C;  3AZE A;  5GT0 B;  3VH5 W;  5AV6 C;  3UTB A;  4XZQ C;  4X23 D;  2UWX A;  2ZY4 A;  4Z66 A;  3C1B C;  5B24 C;  1U35 B;  5B2J C;  3AZN C;  5B32 C;  4UPK A;  3W96 B;  4WU8 D;  3W98 B;  4Z5T D;  3AZH D;  5CPJ A;  5GSU A;  3AFA B;  3VH6 T;  1P3I D;  3B6G B;  3REL C;  3AZK C;  4H9O B;  5B32 G;  3AZF B;  5AVB A;  1M1A B;  1M18 A;  3X1T D;  3B0D B;  1KU5 A;  2PYO A;  3H0M C;  3REJ C;  4YM6 A;  3AZG B;  4J8W B;  1KX4 B;  3LZ0 B;  3VH6 W;  2IO5 B;  3AZL A;  3KUY A;  5KDM A;  1M19 B;  4HGA C;  5DNN D;  1HQ3 C;  4WU9 A;  3C1C C;  1H3O B;  1ZLA D;  3A6N B;  4X23 A;  1P3A B;  4CSR B;  3MVD C;  3UT9 B;  5JA4 A;  5AY8 D;  5B33 C;  3WAA A;  2Y2N A;  3LJA B;  2Y2K A;  3KWQ C;  5AV6 A;  5AV9 D;  3AZE B;  3UTB B;  2W8S A;  4Z66 B;  2BYK A;  5CP6 C;  3MGS C;  1P3P D;  3AZN A;  5B1L D;  5B32 A;  3AN2 C;  2ZM5 A;  3AV2 C;  2CWE A;  5CPI D;  3W97 D;  1P3M C;  5CPJ B;  5GSU B;  3AZK A;  5AVB B;  3LZ1 A;  1M18 B;  4KUD A;  4XUJ D;  3KXB D;  3REJ A;  5GT0 C;  3REI D;  2PYO B;  4YM6 B;  3EPJ A;  3LEL D;  5DNN A;  3X1S D;  4NE6 A;  3AZL B;  1P3K C;  3KUY B;  5KDM B;  3W98 C;  1HQ3 A;  5B1M A;  2JCH A;  1BFM A;  5G49 A;  5AY8 A;  3C1C A;  4EO5 C;  4WU9 B;  2YFW A;  2DF4 C;  3MVD A;  5B0Z D;  1S32 D;  3KWQ A;  4H9P A;  3B0D C;  5JA4 B;  2F8N H;  3WAA B;  5AV6 B;  5CPK C;  5CP6 A;  3MGS A;  3AZG C;  2NZD C;  3X1V C;  2BYK B;  4AWL B;  5CPI A;  3AZN B;  4ZUX D;  3AN2 A;  3WA9 D;  5B32 B;  3AV2 A;  4KGC D;  1M19 C;  1KX5 D;  1P3M A;  1P34 D;  5B2I D;  3X1U C;  4XUJ A;  4J8U A;  3REI A;  3AZI C;  4JJN C;  3AZK B;  2Y2J A;  1TZY D;  1AOI D;  2ARO C;  3LZ1 B;  4KUD B;  3REJ B;  3AZE C;  5E5A D;  3TU4 C;  1P3F D;  5DNN B;  5BT1 C;  5GT3 C;  3MNN D;  1P3G D;  1P3K A;  4HGA B;  5B0Z A;  3AZM C;  1HQ3 B;  5B1M B;  4LD9 D;  5G49 B;  5AY8 B;  3C1C B;  4NE5 A;  2YFV A;  2L5A A;  2YFW B;  3MVD B;  2RVQ C;  2CV5 D;  4J8X D;  1M18 C;  3KWQ B;  5F99 D;  4H9P B;  5CPK A;  3WA9 A;  3KSY A;  2PYO C;  3EPL A;  2NZD A;  3X1V A;  5CP6 B;  3MGS B;  3MGP D;  5CPI B;  5DNM A;  3AN2 B;  3AZL C;  3AV2 B;  3KUY C;  3O62 D;  1P3M B;  3X1U A;  4WU9 C;  3WTP D;  4JJN A;  3AZI A;  4J8U B;  3REI B;  1EQZ D;  4X23 C;  4ZBJ B;  5E5A A;  3UTA D;  1P3O D;  1P3F A;  2ARO A;  4R8P D;  2HIO D;  4E45 A;  3TU4 A;  4WU8 C;  4LD9 A;  4Z5T C;  1ID3 D;  3WKJ D;  4AWL C;  5GT3 A;  3AZH C;  4WZS B;  1F66 D;  1ULY A;  3B6F D;  1F1E A;  1P3K B;  4DRA A;  3AZM A;  5B31 D;  2XD1 A;  5BS7 C;  4J8X A;  2ZY2 A;  2JE5 A;  4EO5 B;  3X1T C;  2YFV B;  4J8V D;  4Z2M H;  1A7W A;  2JSS A;  3LZ1 C;  4KUD C;  4WNN A;  1T3U A;  5CPK B;  3WA9 B; 
#chains in the Genus database with same CATH homology
 2NZD B;  3X1V B;  5DNN C;  5B40 D;  3WTP A;  5DNM B;  5BNV A;  1ZLA C;  5B1M C;  5B0Y A;  3AV1 D;  3X1U B;  5AY8 C;  2F2A C;  3AZI B;  5AV9 C;  4JJN B;  3MGR D;  4H9Q A;  5E5A B;  5AVC D;  2Y2L A;  1P3F B;  2ARO B;  1P3P C;  1F66 A;  1BH9 A;  3B6F A;  1JFI A;  2F8N D;  4WU8 A;  3TU4 B;  4Z5T A;  3AZH A;  4LD9 B;  2ZY5 A;  5CPI C;  5GT3 B;  3W97 C;  3AYW D;  1P3I A;  3AZM B;  5BS7 A;  5AV8 D;  4G91 B;  3X1T A;  1P3L D;  4J8X B;  3REH D;  2FJ7 D;  4XUJ C;  3KXB C;  4J8U C;  3REI C;  4ZBJ C;  5JRG D;  3LEL C;  4QLC D;  4WNN B;  3W99 D;  3AV1 A;  3MGQ D;  2NQB D;  3H0R C;  2DQN C;  3WTP B;  1ZLA A;  4DRB A;  5BNV B;  1P3B D;  3MGR A;  5B0Z C;  1S32 C;  5B0Y B;  5BO0 A;  5AV9 A;  3AZJ D;  4X23 B;  2F8N A;  4H9Q B;  5GXQ D;  1P3P A;  4YS3 D;  5B1L A;  1B67 A;  1F66 B;  1BH9 B;  4ZUX C;  3WA9 C;  3B6F B;  4H9S A;  1JFI B;  3EG5 B;  5AV5 D;  5FUG A;  4WU8 B;  4Z5T B;  1KX5 C;  3AZH B;  3W97 A;  1P34 C;  1P3L A;  4WJ3 C;  5B2I C;  3REH A;  5DNM C;  1P3I B;  3FDD A;  2BYM A;  3X1T B;  1TZY C;  1U35 D;  3NQJ A;  3KXB A;  1AOI C;  4QLC A;  3NQU A;  3W99 A;  3LEL A;  3W96 D;  5E5A C;  1TAF A;  1P3F C;  3MGQ A;  3MNN C;  3X1S A;  4WV4 B;  1P3G C;  3F6T A;  5C3I C;  3AFA D;  3B6G D;  1P3B A;  3AZF D;  3AV1 B;  1M1A D;  4LD9 C;  1BH8 A;  4NFT A;  1ZLA B;  1S32 A;  3AZG D;  4J8W D;  3MGR B;  4G91 C;  2XD5 A;  1KX4 D;  3LZ0 D;  2CV5 C;  2Y2P A;  4J8X C;  5BO0 B;  5AV9 B;  4M6B A;  2VQR A;  2F8N B;  1P3P B;  2Y2O A;  3VH5 A;  5B1L B;  4ZUX A;  3MGP C;  4KGC A;  1Q9C A;  3A6N D;  1KX5 A;  1P3A D;  3O62 C;  5FUG B;  3UT9 D;  1P34 A;  3W97 B;  5B2I A;  3LJA D;  1P3L B;  3REH B;  2Y2H A;  3WTP C;  3UTB D;  3H0L C;  1EQZ C;  5B0Y C;  4Z66 D;  2BYM B;  1TZY A;  3UTA C;  1P3O C;  1AOI A;  4XUJ B;  4R8P C;  3NQJ B;  2HIO C;  3KXB B;  4QLC B;  4DQY B;  3NQU B;  3W99 B;  3LEL B;  1KX3 D;  1ID3 C;  1TAF B;  3WKJ C;  1F66 C;  5CPJ D;  3MNN A;  3P5J B;  1P3G A;  3REK D;  5GSU D;  3MGQ B;  3B6F C;  3X1S B;  3VH6 A;  5B31 C;  1P3B B;  2RVQ D;  5AVB D;  4H9R A;  1BH8 B;  2PYO D;  1P3I C;  5B0Z B;  4J8V C;  4YM6 D;  2CV5 A;  1S32 B;  3EPK A;  1N1J A;  5B31 G;  5F99 A;  4G92 C;  4H9N A;  3MGP A;  5B40 C;  4ZUX B;  4WU9 D;  4KGC B;  3O62 A;  1KX5 B;  3AV1 C;  1P34 B;  5B2I B;  3WAA D;  5AV6 D;  4XZQ D;  1EQZ A;  3C1B D;  5B24 D;  3UTA A;  3MGR C;  1P3O A;  3AL0 C;  1KX3 A;  1TZY B;  5AVC C;  4R8P A;  2HIO A;  4UUZ A;  5BNX A;  5B2J D;  3AZN D;  1AOI B;  3REK A;  5B32 D;  3KFU G;  1ID3 A;  3WKJ A;  5B1L C;  3MNN B;  1P3G B;  3AYW C;  5C3I B;  1Z2C B;  5B31 A;  4H9S C;  3REL D;  3AZK D;  5AV8 C;  2F8N G;  3LZ1 D;  4KUD D;  4H9R B;  1P3L C;  3REH C;  2FJ7 C;  3REJ D;  4J8V A;  2J8P A;  2CV5 B;  5JRG C;  1WWS A;  1N1J B;  5F99 B;  4QLC C;  2ZY3 A;  4NE3 A;  3W99 C;  1HQ3 D;  5B1M D;  4H9N B;  5B40 A;  3MGP B;  3C1C D;  3MGQ C;  2NQB C;  3X1S C;  4XZQ A;  3MVD D;  3O62 B;  3C1B A;  5B24 A;  1P3B C;  5B33 D;  3KWQ D;  5B2J A;  3A1K A;  2F8N K;  3AZJ C;  1EQZ B;  4KHA A;  5CP6 D;  5AVC A;  3MGS D;  5GXQ C;  3UTA B;  1P3O B;  1KX3 B;  4YS3 C;  4R8P B;  2HIO B;  4UUZ B;  5BNX B;  3AN2 D;  3REK B;  3AV2 D;  3REL A;  2G5H C;  5AV5 C;  3A1I A;  1ID3 B;  1P3M D;  3WKJ B;  2Y2Q A;  2BG1 A;  3AYW A;  4KGC C;  4J8U D;  5B31 B;  2HUE B;  5AV8 A;  2FJ7 A;  3EPH A;  5GT0 D;  1U35 C;  4J8V B;  5JRG A;  3W96 C;  4G92 B;  1HTA A;  1P3K D;  3W98 D;  3AFA C;  3B6G C;  3IP4 C;  5B33 A;  3AZF C;  5B40 B;  1M1A C;  2NQB A;  3R45 A;  4E44 A;  3V9R A;  2LY8 A;  4XZQ B;  3C1B B;  5B24 B;  4J8W C;  1KX4 C;  2RIQ A;  3LZ0 C;  5B2J B;  3AZJ A;  5CPK D;  2IO5 C;  5GXQ A;  2NZD D;  1W2E A;  3X1V D;  4KHA B;  5AVC B;  4YS3 A;  2G5I C;  5F99 C;  4CAY A;  5DNM D;  1M19 D;  5AV5 A;  3A6N C;  3REL B;  1P3A C;  3UT9 C;  5CHL B;  3X1U D;  2FFF B;  3LJA C;  3AYW B;  5GT0 A;  3AZI D;  4JJN D;  4Z2M G;  3UTB C;  1PZR A;  5AV8 B;  4Z66 C;  2ARO D;  1U35 A;  2FJ7 B;  3AZE D;  3B0C T;  3W96 A;  3TU4 D;  3W98 A;  5JRG B;  1B6W A;  5BT1 D;  1KX3 C;  5GT3 D;  5CPJ C;  3REK C;  5GSU C;  3AFA A;  3B6G A;  3AZM D;  1WWI A;  2Y2M A;  4H9O A;  3AZF A;  1M1A A;  3B0C W;  3B0B A;  5AVB C;  5B33 B;  2NQB B;  3R45 B;  3V9R B;  2HUE C;  3WTP E;  4J8W A;  3AZG A;  1KX4 A;  4YM6 C;  3LZ0 A;  1M18 D;  3AZJ B;  1M19 A;  5GXQ B;  1R4V A;  3VH5 T;  4YS3 B;  2Y2G A;  3AZL D;  1H3O A;  2Y2I A;  4CAY B;  3A6N A;  3KUY D;  1P3A A;  4CSR A;  5AV5 B;  5B0Y D;  3UT9 A;  3LJA A;  3WAA C;  3AZE A;  5GT0 B;  3VH5 W;  5AV6 C;  3UTB A;  4XZQ C;  4X23 D;  2UWX A;  2ZY4 A;  4Z66 A;  3C1B C;  5B24 C;  1U35 B;  5B2J C;  3AZN C;  5B32 C;  4UPK A;  3W96 B;  4WU8 D;  3W98 B;  4Z5T D;  3AZH D;  5CPJ A;  5GSU A;  3AFA B;  3VH6 T;  1P3I D;  3B6G B;  3REL C;  3AZK C;  4H9O B;  5B32 G;  3AZF B;  5AVB A;  1M1A B;  1M18 A;  3X1T D;  3B0D B;  1KU5 A;  2PYO A;  3H0M C;  3REJ C;  4YM6 A;  3AZG B;  4J8W B;  1KX4 B;  3LZ0 B;  3VH6 W;  2IO5 B;  3AZL A;  3KUY A;  5KDM A;  1M19 B;  4HGA C;  5DNN D;  1HQ3 C;  4WU9 A;  3C1C C;  1H3O B;  1ZLA D;  3A6N B;  4X23 A;  1P3A B;  4CSR B;  3MVD C;  3UT9 B;  5JA4 A;  5AY8 D;  5B33 C;  3WAA A;  2Y2N A;  3LJA B;  2Y2K A;  3KWQ C;  5AV6 A;  5AV9 D;  3AZE B;  3UTB B;  2W8S A;  4Z66 B;  2BYK A;  5CP6 C;  3MGS C;  1P3P D;  3AZN A;  5B1L D;  5B32 A;  3AN2 C;  2ZM5 A;  3AV2 C;  2CWE A;  5CPI D;  3W97 D;  1P3M C;  5CPJ B;  5GSU B;  3AZK A;  5AVB B;  3LZ1 A;  1M18 B;  4KUD A;  4XUJ D;  3KXB D;  3REJ A;  5GT0 C;  3REI D;  2PYO B;  4YM6 B;  3EPJ A;  3LEL D;  5DNN A;  3X1S D;  4NE6 A;  3AZL B;  1P3K C;  3KUY B;  5KDM B;  3W98 C;  1HQ3 A;  5B1M A;  2JCH A;  1BFM A;  5G49 A;  5AY8 A;  3C1C A;  4EO5 C;  4WU9 B;  2YFW A;  2DF4 C;  3MVD A;  5B0Z D;  1S32 D;  3KWQ A;  4H9P A;  3B0D C;  5JA4 B;  2F8N H;  3WAA B;  5AV6 B;  5CPK C;  5CP6 A;  3MGS A;  3AZG C;  2NZD C;  3X1V C;  2BYK B;  4AWL B;  5CPI A;  3AZN B;  4ZUX D;  3AN2 A;  3WA9 D;  5B32 B;  3AV2 A;  4KGC D;  1M19 C;  1KX5 D;  1P3M A;  1P34 D;  5B2I D;  3X1U C;  4XUJ A;  4J8U A;  3REI A;  3AZI C;  4JJN C;  3AZK B;  2Y2J A;  1TZY D;  1AOI D;  2ARO C;  3LZ1 B;  4KUD B;  3REJ B;  3AZE C;  5E5A D;  3TU4 C;  1P3F D;  5DNN B;  5BT1 C;  5GT3 C;  3MNN D;  1P3G D;  1P3K A;  4HGA B;  5B0Z A;  3AZM C;  1HQ3 B;  5B1M B;  4LD9 D;  5G49 B;  5AY8 B;  3C1C B;  4NE5 A;  2YFV A;  2L5A A;  2YFW B;  3MVD B;  2RVQ C;  2CV5 D;  4J8X D;  1M18 C;  3KWQ B;  5F99 D;  4H9P B;  5CPK A;  3WA9 A;  3KSY A;  2PYO C;  3EPL A;  2NZD A;  3X1V A;  5CP6 B;  3MGS B;  3MGP D;  5CPI B;  5DNM A;  3AN2 B;  3AZL C;  3AV2 B;  3KUY C;  3O62 D;  1P3M B;  3X1U A;  4WU9 C;  3WTP D;  4JJN A;  3AZI A;  4J8U B;  3REI B;  1EQZ D;  4X23 C;  4ZBJ B;  5E5A A;  3UTA D;  1P3O D;  1P3F A;  2ARO A;  4R8P D;  2HIO D;  4E45 A;  3TU4 A;  4WU8 C;  4LD9 A;  4Z5T C;  1ID3 D;  3WKJ D;  4AWL C;  5GT3 A;  3AZH C;  4WZS B;  1F66 D;  1ULY A;  3B6F D;  1F1E A;  1P3K B;  4DRA A;  3AZM A;  5B31 D;  2XD1 A;  5BS7 C;  4J8X A;  2ZY2 A;  2JE5 A;  4EO5 B;  3X1T C;  2YFV B;  4J8V D;  4Z2M H;  1A7W A;  2JSS A;  3LZ1 C;  4KUD C;  4WNN A;  1T3U A;  5CPK B;  3WA9 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...