5B1MC

The mouse nucleosome structure containing h3.1
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
108
structure length
108
Chain Sequence
RAKAKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.1
publication title Testis-Specific Histone Variant H3t Gene Is Essential for Entry into Spermatogenesis
pubmed doi rcsb
source organism Mus musculus
molecule tags Structural protein/dna
total genus 31
structure length 108
sequence length 108
chains with identical sequence G
ec nomenclature
pdb deposition date 2015-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5b1mC00
3LZ0A 3AZJC 3KSYA 3R45A 5B0ZC 1S32D 3WKJD 4Z5TA 1EQZC 4R8PA 5B24B 5F99C 3AZNC 3X1VD 3MGQA 5B0YA 3B0DB 4Z2MG 1TAFB 3MVDC 3AN2D 3X1TB 2BYMA 2PYOC 3VH6W 3UTBD 3AV2A 1M19C 3B6GC 1BFMA 1P3PC 4J8XB 4CSRA 4XZQC 3MGSB 3C1BC 4NE6A 3UT9D 3RELC 3LELC 3AZMA 1H3OB 4Z66A 3AZLC 5B0ZB 1HQ3D 1P34C 3REKA 5DNNC 1EQZB 3A6NA 3AZNB 5F99B 4HGAC 3X1UA 1F66C 3VH5A 5AVBB 4EO5C 4QLCC 3MVDB 2HIOD 1P3OA 5GSUA 2PYOB 3LZ1C 3TU4D 1P3BC 5B1MD 1M19B 3REJC 3REHD 2CV5D 4ZUXA 3B6FB 3B6GB 3W96D 5BNVA 4XZQB 3KUYA 3C1BB 2NZDC 3RELB 3LELB 4LD9D 3MNNB 3W98D 3REID 3VH6A 1P34B 5DNNB 1ZLAD 4HGAB 4KHAB 5B32A 1P3LC 1F66B 4JJNA 1TAFA 5B40C 3X1TA 4EO5B 5CPKC 4QLCB 3AFAD 2JSSA 4YS3D 1P3BB 5AY8A 3REJB 3MGSA 4G92C 3AZIC 2RVQD 5BS7A 4YM6C 1TZYD 3B0BA 1S32A 1H3OA 1P3MC 4WU8C 3WKJA 5B2JD 1P3AD 3KWQD 5JRGD 3AZNA 3W99C 3O62D 1P3LB 3AN2A 5AVBA 3X1SB 5B40B 3UTBA 1B67A 3B6GA 3LZ0C 3AZFD 3B6FA 4Z5TC 4XZQA 4G92B 4H9NB 3UT9A 3AZIB 4R8PC 4H9OB 4YM6B 3MGQC 3RELA 3WTPB 1HQ3A 4WU8B 3MNNA 5DNNA 3AZED 4KUDC 1KX4D 3W99B 4KHAA 3WAAC 3LJAB 2F8NH 3TU4A 5B1MA 3W96A 2CV5A 3LZ0B 3B0CT 3R45B 5G49B 4Z5TB 4ZBJC 5DNMD 3AYWD 4LD9A 1N1JB 3X1UC 3MGQB 3W98A 5B2ID 3REIA 5B32G 1ID3B 3NQJA 1P3OC 5GSUC 4KUDB 3VH6T 4ZUXC 1B6WA 1F1EA 3X1SA 3AZKD 5B40A 3WAAB 4CSRB 3MGRD 4Z2MH 1P3KC 4H9NA 4WU9D 3AZIA 1TZYA 4H9OA 2YFWB 5AVCC 4H9PA 3WTPA 5B2JA 1P3AA 4WU8A 3X1UB 5B32C 1M1AC 4WNNB 4JJNC 5AV5D 3X1TC 5AV9D 3WA9D 5CPID 1P3OB 5GSUB 5AY8C 1M18D 3WTPE 3LJAA 3MGSC 4E44A 5BS7C 3AZFA 1S32C 3WKJC 3B0CW 5G49A 5B31D 1KX5D 1P3KB 1N1JA 5AVCB 4CAYB 4E45A 4J8WD 1ID3A 5B32B 5B33D 1M1AB 5CHLB 5AVBC 5CP6B 3AN2C 1KX4A 4JJNB 5AV6D 3MGPB 3UTBC 4KUDA 3B6FC 2BYKA 4KGCB 5AY8B 3WAAA 3UT9C 1S32B 1HQ3C 3WKJB 3MNNC 5DNMA 3AYWA 5B1LD 3X1VB 2YFWA 3AZJD 5B2IA 1EQZD 2F8ND 4WNNA 2HIOC 4H9QB 3AN2B 5AV8D 5C3IC 3TU4C 5B1MC 3UTBB 3W96C 2CV5C 3AZKA 5GXQD 1P3PD 4XUJD 3UT9B 2NQBD 5BT1C 4LD9C 3W98C 4WU9A 3REIC 1HQ3B 3C1CA 1P3KA 5AVCA 4CAYA 3AZLD 3AZGD 1M1AA 5CP6A 3X1SC 3WA9A 3MGPA 2HIOB 1P3FA 3W97D 5C3IB 3TU4B 3AZHD 5B1MB 3W96B 3REHB 2CV5B 4KGCA 5BNXB 1P3GD 3LZ1D 2RVQC 1TZYC 4M6BA 3WTPC 5B2JC 4LD9B 1P3AC 5JA4B 3W98B 1P3ID 3REIB 3NQJB 3X1VA 3AV1D 2NZDD 3O62C 1ZLAB 4DRAA 4J8WA 2AROD 4H9QA 5AV6A 3LJAC 3AZFC 4YS3B 4H9SC 5CPKD 1KX3D 4UUZA 1TZYB 5CPJD 4H9PB 5B2JB 5GT0D 1P3AB 1ID3C 5B1LA 3KWQB 5JRGB 1KX4C 1P3MD 4J8UD 3O62B 2F8NA 4J8VD 5AV8A 1BH8B 2HIOA 4X23D 5GXQA 3REHA 3AZFB 5BNXA 4XUJA 5DNMC 3LZ0D 3AYWC 2NQBA 5B2IC 5JA4A 4R8PD 1U35D 2FJ7D 3AZEB 1KX4B 1ZLAA 2F8NK 5E5AD 3AZGA 5GT3D 1WWIA 5B0YD 1AOID 3AZKC 2BYKB 3W97A 3AFAA 3AZHA 3KXBD 3AV2D 4YS3A 1P3GA 1ULYA 3UTAD 4WU9C 3C1CC 1HTAA 5DNMB 3AZMD 2YFVB 3AYWB 4Z66D 2CWEA 3V9RA 4WZSB 1P3IA 5FUGA 5B2IB 3KWQA 3REKD 5JRGA 5CP6C 5AV9C 3A6ND 3WA9C 5CPIC 3MGPC 1P3FC 3O62A 2AROA 1M18C 4KGCC 3AZKB 1BH8A 4ZUXD 4NE3A 1KX3A 4H9SA 3KUYD 1KX5C 4WU9B 5BO0A 3C1CB 3X1VC 5CPJA 4J8WC 5GT0A 3NQUB 4AWLB 5B24D 2IO5C 5AV6C 4J8UA 3AZEA 5AV9B 3WA9B 5CPIB 1P3FB 5B32D 1M18B 3X1TD 4X23A 4H9RB 4J8XD 3MGSD 5KDMB 5B31B 5B1LC 1KX5B 2YFVA 5B0ZD 1KU5A 4J8WB 2L5AA 1U35A 2FJ7A 5B33B 3AZND 5F99D 5AV8C 2IO5B 5E5AA 5AV6B 2HUEC 5GT3A 1AOIA 5GXQC 3REHC 5AVBD 3MVDD 2PYOD 3KXBA 2LY8A 3MGRA 4XUJC 1M19D 3B6GD 3B6FD 2NQBC 4UUZB 3UTAA 4XZQD 3C1BD 1JFIA 5B1LB 3RELD 3AZJB 3LELD 1ZLAC 3MNND 3AZGC 3NQUA 1P34D 2F8NB 5DNND 5AV5A 5AV9A 5AV8B 5CPIA 3AFAC 3W97C 3AZHC 1F66D 2HUEB 4YS3C 1M18A 5GXQB 1P3GC 4QLCD 4H9RA 1P3PB 1P3BD 4XUJB 3REJD 2NQBB 4WV4B 1P3IC 5KDMA 5B31A 3KWQC 1KX5A 5JRGC 3AV1C 5BT1D 3AZLB 1BH9B 2AROC 5B24A 3AZGB 5B33A 3W97B 3AFAB 3AZHB 4DRBA 1P3LD 3X1SD 5B40D 1P3GB 1KX3C 3LZ1B 4J8XA 5CPJC 5GT0C 3V9RB 3AZID 1P3IB 5FUGB 4YM6D 2NZDB 3AV1B 3AZJA 4J8UC 1Q9CA 5B0ZA 3WTPD 3AZEC 4WU8D 4J8VC 1EQZA 2AROB 1WWSA 5F99A 3W99D 4X23C 3MVDA 2PYOA 3LJAD 5CPKB 1KX3B 1A7WA 1M19A 1P3PA 5BO0B 5CPJB 3C1BA 4Z5TD 5GT0B 1U35C 2FJ7C 4NFTA 3LELA 3MGQD 5E5AC 3AZLA 4J8UB 1P3MB 5GT3C 1BH9A 5B0YC 1P34A 1ID3D 1AOIC 4J8VB 3AV2C 3KXBC 1F66A 4KUDD 4G91C 3MGRC 4X23B 4QLCA 3UTAC 3VH5T 3WAAD 3LZ1A 5B31G 1P3BA 3REJA 3AZMC 4Z66C 3REKC 4AWLC 4R8PB 3A6NC 1U35B 2FJ7B 2NZDA 5AV5C 3AV1A 3X1UD 5E5AB 5GT3B 5B0YB 1R4VA 1AOIB 2BYMB 1P3OD 5GSUD 3AV2B 3KXBB 1P3LA 4G91B 3MGRB 3KUYC 5CPKA 3UTAB 5B31C 1JFIB 3AZMB 4Z66B 5B24C 3C1CD 1P3KD 4YM6A 4ZBJB 3REKB 5B33C 2F8NG 3A6NB 5AVCD 5AV5B 1P3MA 3B0DC 4J8VA 1M1AD 5CP6D 4JJND 4NE5A 3MGPD 1P3FD 3W99A 4J8XC 4ZUXB 4KGCD 5AY8D 5BNVB 3VH5W 3KUYB
chains in the Genus database with same CATH superfamily
3LZ0A 3AZJC 3KSYA 3R45A 5B0ZC 1S32D 3WKJD 4Z5TA 1EQZC 4R8PA 5B24B 5F99C 3AZNC 2Y2NA 3MGQA 3FDDA 3X1VD 2ZY4A 5B0YA 3B0DB 4Z2MG 1TAFB 3MVDC 3AN2D 3X1TB 2BYMA 2PYOC 3VH6W 3UTBD 3AV2A 1M19C 3B6GC 1BFMA 1P3PC 4J8XB 3H0RC 2Y2QA 4CSRA 4XZQC 3MGSB 3C1BC 4NE6A 3UT9D 3RELC 3LELC 3AZMA 1H3OB 4Z66A 3AZLC 5B0ZB 1HQ3D 1P34C 3REKA 5DNNC 2JE5A 1EQZB 3A6NA 3AZNB 5F99B 4HGAC 3X1UA 1F66C 3VH5A 5AVBB 4EO5C 4QLCC 3MVDB 2HIOD 1P3OA 5GSUA 1Z2CB 3LZ1C 2PYOB 3TU4D 1P3BC 5B1MD 1M19B 3REJC 3REHD 2CV5D 4ZUXA 3B6FB 3B6GB 3W96D 5BNVA 4XZQB 3KUYA 3C1BB 3EPLA 2NZDC 3RELB 3LELB 4LD9D 3MNNB 3W98D 3REID 3VH6A 1P34B 5DNNB 1ZLAD 4HGAB 4KHAB 5B32A 1P3LC 1F66B 4JJNA 1TAFA 5B40C 3X1TA 4EO5B 5CPKC 4QLCB 3AFAD 2JSSA 4YS3D 1P3BB 5AY8A 3REJB 3MGSA 4G92C 3AZIC 2RVQD 5BS7A 4YM6C 3EPKA 1TZYD 3B0BA 1S32A 1H3OA 1P3MC 4WU8C 3WKJA 5B2JD 1P3AD 3KWQD 5JRGD 2ZY5A 3AZNA 3W99C 3O62D 1P3LB 3AN2A 5AVBA 3X1SB 5B40B 3UTBA 1B67A 3B6GA 3LZ0C 3AZFD 3B6FA 4Z5TC 4XZQA 4G92B 1W2EA 4H9NB 3UT9A 4R8PC 3AZIB 4H9OB 4YM6B 3MGQC 3RELA 3WTPB 1HQ3A 2ZY3A 4WU8B 3MNNA 5DNNA 3AZED 4KUDC 1KX4D 3W99B 4KHAA 3WAAC 3LJAB 2BG1A 2F8NH 3TU4A 2Y2GA 5B1MA 3W96A 2CV5A 3A1KA 3LZ0B 3B0CT 3R45B 5G49B 4Z5TB 2UWXA 4ZBJC 5DNMD 3AYWD 4LD9A 1N1JB 3IP4C 3X1UC 3MGQB 3W98A 5B2ID 3REIA 5B32G 1ID3B 3NQJA 1P3OC 5GSUC 4KUDB 3VH6T 4ZUXC 1B6WA 1F1EA 3X1SA 3AZKD 5B40A 2J8PA 3WAAB 4CSRB 3MGRD 4Z2MH 1P3KC 4H9NA 4WU9D 3AZIA 1TZYA 4H9OA 2YFWB 5AVCC 4H9PA 3WTPA 5B2JA 1P3AA 4WU8A 3X1UB 5B32C 1M1AC 4WNNB 4JJNC 5AV5D 3X1TC 5AV9D 3WA9D 5CPID 1P3OB 5GSUB 5AY8C 1M18D 3WTPE 3LJAA 3EPHA 3MGSC 4E44A 5BS7C 3AZFA 1S32C 3WKJC 3B0CW 5G49A 5B31D 1KX5D 1P3KB 1N1JA 5AVCB 4CAYB 4E45A 4J8WD 1ID3A 5B32B 5B33D 1M1AB 5CHLB 5AVBC 5CP6B 3AN2C 1KX4A 4JJNB 5AV6D 3MGPB 3UTBC 4KUDA 3B6FC 2BYKA 4KGCB 5AY8B 3WAAA 3UT9C 1S32B 1HQ3C 3WKJB 3MNNC 5DNMA 3AYWA 5B1LD 3X1VB 2YFWA 3AZJD 5B2IA 1EQZD 2F8ND 4WNNA 2HIOC 4H9QB 3AN2B 5AV8D 5C3IC 3TU4C 5B1MC 3UTBB 3W96C 2CV5C 3AZKA 5GXQD 1P3PD 2ZY2A 4XUJD 3UT9B 2NQBD 5BT1C 4LD9C 3W98C 4WU9A 3REIC 1HQ3B 3C1CA 1P3KA 5AVCA 4CAYA 3AZLD 3AZGD 1M1AA 5CP6A 3X1SC 3WA9A 3MGPA 2HIOB 1P3FA 3W97D 5C3IB 3TU4B 3AZHD 5B1MB 3W96B 3REHB 2CV5B 4KGCA 5BNXB 1P3GD 3LZ1D 2RVQC 1TZYC 4M6BA 3WTPC 5B2JC 4LD9B 1P3AC 5JA4B 3W98B 1P3ID 3REIB 3NQJB 3X1VA 3AV1D 2NZDD 3O62C 1ZLAB 4DRAA 4J8WA 3F6TA 2G5HC 2AROD 4H9QA 5AV6A 3LJAC 3AZFC 4WJ3C 4YS3B 4H9SC 5CPKD 1KX3D 4UUZA 1TZYB 5CPJD 4H9PB 5B2JB 5GT0D 1P3AB 1ID3C 5B1LA 3KWQB 5JRGB 1KX4C 1P3MD 4J8UD 3O62B 2Y2JA 2F8NA 4J8VD 5AV8A 1BH8B 2HIOA 2XD5A 4X23D 5GXQA 2ZM5A 3REHA 3AZFB 5BNXA 2Y2IA 3EG5B 4XUJA 5DNMC 3LZ0D 3AYWC 2NQBA 5B2IC 5JA4A 4R8PD 1U35D 2FJ7D 3AZEB 1KX4B 1ZLAA 2Y2KA 5E5AD 2F8NK 3AZGA 5GT3D 1WWIA 5B0YD 1AOID 3AZKC 3H0MC 2BYKB 3W97A 3AFAA 3AZHA 3KXBD 3AV2D 2JCHA 4YS3A 1P3GA 4DQYB 1ULYA 3UTAD 4WU9C 3C1CC 1HTAA 5DNMB 3AZMD 2YFVB 3AYWB 4Z66D 2CWEA 3V9RA 4WZSB 1P3IA 5FUGA 5B2IB 3KWQA 3REKD 2XD1A 5JRGA 5CP6C 5AV9C 3A6ND 3WA9C 5CPIC 3MGPC 1P3FC 3KFUG 3O62A 2AROA 1M18C 4KGCC 3AZKB 2W8SA 1BH8A 4ZUXD 4NE3A 1KX3A 4H9SA 3KUYD 1KX5C 4WU9B 5BO0A 2VQRA 3C1CB 3X1VC 5CPJA 4J8WC 5GT0A 3NQUB 4AWLB 5B24D 2IO5C 5AV6C 4J8UA 3AZEA 5AV9B 3WA9B 5CPIB 1P3FB 2Y2LA 5B32D 1M18B 3X1TD 2Y2HA 4X23A 4H9RB 4J8XD 3MGSD 5B31B 5KDMB 5B1LC 1KX5B 2YFVA 5B0ZD 1KU5A 4J8WB 2L5AA 1U35A 2FJ7A 5B33B 3AZND 5F99D 5AV8C 2IO5B 5E5AA 5AV6B 2HUEC 5GT3A 3P5JB 1AOIA 5GXQC 3REHC 5AVBD 3MVDD 2PYOD 3KXBA 2LY8A 3MGRA 4XUJC 3H0LC 1M19D 3B6GD 3B6FD 2NQBC 4UUZB 3UTAA 4XZQD 3C1BD 1JFIA 5B1LB 3RELD 3AZJB 3LELD 1ZLAC 3MNND 3AZGC 3NQUA 1P34D 2F8NB 5DNND 5AV5A 5AV9A 5AV8B 5CPIA 3AFAC 3W97C 3AZHC 1F66D 2HUEB 4YS3C 1M18A 5GXQB 1P3GC 4QLCD 4H9RA 1P3PB 1P3BD 4XUJB 3REJD 2NQBB 4WV4B 1P3IC 5KDMA 5B31A 3KWQC 1KX5A 5JRGC 3AV1C 5BT1D 4UPKA 3AZLB 1BH9B 2AROC 5B24A 3AZGB 5B33A 3W97B 3AFAB 3AZHB 4DRBA 2RIQA 1P3LD 3X1SD 5B40D 1P3GB 1KX3C 3LZ1B 4J8XA 5CPJC 3AL0C 5GT0C 3V9RB 3AZID 1P3IB 5FUGB 4YM6D 2NZDB 3AV1B 3AZJA 4J8UC 1Q9CA 5B0ZA 3WTPD 3AZEC 4WU8D 4J8VC 1EQZA 2AROB 1WWSA 5F99A 2FFFB 3W99D 4X23C 3MVDA 2PYOA 3LJAD 5CPKB 1KX3B 1A7WA 1M19A 1P3PA 5BO0B 5CPJB 3C1BA 4Z5TD 5GT0B 1U35C 2FJ7C 4NFTA 3LELA 3MGQD 5E5AC 3AZLA 4J8UB 1P3MB 5GT3C 1BH9A 5B0YC 1P34A 1ID3D 1AOIC 4J8VB 3EPJA 3AV2C 3KXBC 1F66A 4KUDD 4G91C 3MGRC 4X23B 4QLCA 3UTAC 3VH5T 3WAAD 3LZ1A 5B31G 1P3BA 3REJA 3A1IA 3AZMC 4Z66C 3REKC 4AWLC 4R8PB 1PZRA 3A6NC 1U35B 2FJ7B 5AV5C 3AV1A 2NZDA 1T3UA 3X1UD 5E5AB 5GT3B 5B0YB 1R4VA 1AOIB 2BYMB 2G5IC 1P3OD 5GSUD 3AV2B 3KXBB 1P3LA 2F2AC 4G91B 3MGRB 3KUYC 2DQNC 5CPKA 3UTAB 5B31C 1JFIB 3AZMB 4Z66B 2DF4C 2Y2PA 2Y2OA 5B24C 3C1CD 1P3KD 4YM6A 4ZBJB 3REKB 5B33C 2F8NG 3A6NB 5AVCD 5AV5B 1P3MA 2Y2MA 3B0DC 4J8VA 1M1AD 5CP6D 4JJND 4NE5A 3MGPD 1P3FD 3W99A 4J8XC 4ZUXB 4KGCD 5AY8D 5BNVB 3VH5W 3KUYB
chains in the Genus database with same CATH topology
3LZ0A 3AZJC 3KSYA 3R45A 5B0ZC 1S32D 3WKJD 4Z5TA 1EQZC 4R8PA 5B24B 5F99C 3AZNC 2Y2NA 3MGQA 3FDDA 3X1VD 2ZY4A 5B0YA 3B0DB 4Z2MG 1TAFB 3MVDC 3AN2D 3X1TB 2BYMA 2PYOC 3VH6W 3UTBD 3AV2A 1M19C 3B6GC 1BFMA 1P3PC 4J8XB 3H0RC 2Y2QA 4CSRA 4XZQC 3MGSB 3C1BC 4NE6A 3UT9D 3RELC 3LELC 3AZMA 1H3OB 4Z66A 3AZLC 5B0ZB 1HQ3D 1P34C 3REKA 5DNNC 2JE5A 1EQZB 3A6NA 3AZNB 5F99B 4HGAC 3X1UA 1F66C 3VH5A 5AVBB 4EO5C 4QLCC 3MVDB 2HIOD 1P3OA 5GSUA 1Z2CB 3LZ1C 2PYOB 3TU4D 1P3BC 5B1MD 1M19B 3REJC 3REHD 2CV5D 4ZUXA 3B6FB 3B6GB 3W96D 5BNVA 4XZQB 3KUYA 3C1BB 3EPLA 2NZDC 3RELB 3LELB 4LD9D 3MNNB 3W98D 3REID 3VH6A 1P34B 5DNNB 1ZLAD 4HGAB 4KHAB 5B32A 1P3LC 1F66B 4JJNA 1TAFA 5B40C 3X1TA 4EO5B 5CPKC 4QLCB 3AFAD 2JSSA 4YS3D 1P3BB 5AY8A 3REJB 3MGSA 4G92C 3AZIC 2RVQD 5BS7A 4YM6C 3EPKA 1TZYD 3B0BA 1S32A 1H3OA 1P3MC 4WU8C 3WKJA 5B2JD 1P3AD 3KWQD 5JRGD 2ZY5A 3AZNA 3W99C 3O62D 1P3LB 3AN2A 5AVBA 3X1SB 5B40B 3UTBA 1B67A 3B6GA 3LZ0C 3AZFD 3B6FA 4Z5TC 4XZQA 4G92B 1W2EA 4H9NB 3UT9A 4R8PC 3AZIB 4H9OB 4YM6B 3MGQC 3RELA 3WTPB 1HQ3A 2ZY3A 4WU8B 3MNNA 5DNNA 3AZED 4KUDC 1KX4D 3W99B 4KHAA 3WAAC 3LJAB 2BG1A 2F8NH 3TU4A 2Y2GA 5B1MA 3W96A 2CV5A 3A1KA 3LZ0B 3B0CT 3R45B 5G49B 4Z5TB 2UWXA 4ZBJC 5DNMD 3AYWD 4LD9A 1N1JB 3IP4C 3X1UC 3MGQB 3W98A 5B2ID 3REIA 5B32G 1ID3B 3NQJA 1P3OC 5GSUC 4KUDB 3VH6T 4ZUXC 1B6WA 1F1EA 3X1SA 3AZKD 5B40A 2J8PA 3WAAB 4CSRB 3MGRD 4Z2MH 1P3KC 4H9NA 4WU9D 3AZIA 1TZYA 4H9OA 2YFWB 5AVCC 4H9PA 3WTPA 5B2JA 1P3AA 4WU8A 3X1UB 5B32C 1M1AC 4WNNB 4JJNC 5AV5D 3X1TC 5AV9D 3WA9D 5CPID 1P3OB 5GSUB 5AY8C 1M18D 3WTPE 3LJAA 3EPHA 3MGSC 4E44A 5BS7C 3AZFA 1S32C 3WKJC 3B0CW 5G49A 5B31D 1KX5D 1P3KB 1N1JA 5AVCB 4CAYB 4E45A 4J8WD 1ID3A 5B32B 5B33D 1M1AB 5CHLB 5AVBC 5CP6B 3AN2C 1KX4A 4JJNB 5AV6D 3MGPB 3UTBC 4KUDA 3B6FC 2BYKA 4KGCB 5AY8B 3WAAA 3UT9C 1S32B 1HQ3C 3WKJB 3MNNC 5DNMA 3AYWA 5B1LD 3X1VB 2YFWA 3AZJD 5B2IA 1EQZD 2F8ND 4WNNA 2HIOC 4H9QB 3AN2B 5AV8D 5C3IC 3TU4C 5B1MC 3UTBB 3W96C 2CV5C 3AZKA 5GXQD 1P3PD 2ZY2A 4XUJD 3UT9B 2NQBD 5BT1C 4LD9C 3W98C 4WU9A 3REIC 1HQ3B 3C1CA 1P3KA 5AVCA 4CAYA 3AZLD 3AZGD 1M1AA 5CP6A 3X1SC 3WA9A 3MGPA 2HIOB 1P3FA 3W97D 5C3IB 3TU4B 3AZHD 5B1MB 3W96B 3REHB 2CV5B 4KGCA 5BNXB 1P3GD 3LZ1D 2RVQC 1TZYC 4M6BA 3WTPC 5B2JC 4LD9B 1P3AC 5JA4B 3W98B 1P3ID 3REIB 3NQJB 3X1VA 3AV1D 2NZDD 3O62C 1ZLAB 4DRAA 4J8WA 3F6TA 2G5HC 2AROD 4H9QA 5AV6A 3LJAC 3AZFC 4WJ3C 4YS3B 4H9SC 5CPKD 1KX3D 4UUZA 1TZYB 5CPJD 4H9PB 5B2JB 5GT0D 1P3AB 1ID3C 5B1LA 3KWQB 5JRGB 1KX4C 1P3MD 4J8UD 3O62B 2Y2JA 2F8NA 4J8VD 5AV8A 1BH8B 2HIOA 2XD5A 4X23D 5GXQA 2ZM5A 3REHA 3AZFB 5BNXA 2Y2IA 3EG5B 4XUJA 5DNMC 3LZ0D 3AYWC 2NQBA 5B2IC 5JA4A 4R8PD 1U35D 2FJ7D 3AZEB 1KX4B 1ZLAA 2Y2KA 5E5AD 2F8NK 3AZGA 5GT3D 1WWIA 5B0YD 1AOID 3AZKC 3H0MC 2BYKB 3W97A 3AFAA 3AZHA 3KXBD 3AV2D 2JCHA 4YS3A 1P3GA 4DQYB 1ULYA 3UTAD 4WU9C 3C1CC 1HTAA 5DNMB 3AZMD 2YFVB 3AYWB 4Z66D 2CWEA 3V9RA 4WZSB 1P3IA 5FUGA 5B2IB 3KWQA 3REKD 2XD1A 5JRGA 5CP6C 5AV9C 3A6ND 3WA9C 5CPIC 3MGPC 1P3FC 3KFUG 3O62A 2AROA 1M18C 4KGCC 3AZKB 2W8SA 1BH8A 4ZUXD 4NE3A 1KX3A 4H9SA 3KUYD 1KX5C 4WU9B 5BO0A 2VQRA 3C1CB 3X1VC 5CPJA 4J8WC 5GT0A 3NQUB 4AWLB 5B24D 2IO5C 5AV6C 4J8UA 3AZEA 5AV9B 3WA9B 5CPIB 1P3FB 2Y2LA 5B32D 1M18B 3X1TD 2Y2HA 4X23A 4H9RB 4J8XD 3MGSD 5B31B 5KDMB 5B1LC 1KX5B 2YFVA 5B0ZD 1KU5A 4J8WB 2L5AA 1U35A 2FJ7A 5B33B 3AZND 5F99D 5AV8C 2IO5B 5E5AA 5AV6B 2HUEC 5GT3A 3P5JB 1AOIA 5GXQC 3REHC 5AVBD 3MVDD 2PYOD 3KXBA 2LY8A 3MGRA 4XUJC 3H0LC 1M19D 3B6GD 3B6FD 2NQBC 4UUZB 3UTAA 4XZQD 3C1BD 1JFIA 5B1LB 3RELD 3AZJB 3LELD 1ZLAC 3MNND 3AZGC 3NQUA 1P34D 2F8NB 5DNND 5AV5A 5AV9A 5AV8B 5CPIA 3AFAC 3W97C 3AZHC 1F66D 2HUEB 4YS3C 1M18A 5GXQB 1P3GC 4QLCD 4H9RA 1P3PB 1P3BD 4XUJB 3REJD 2NQBB 4WV4B 1P3IC 5KDMA 5B31A 3KWQC 1KX5A 5JRGC 3AV1C 5BT1D 4UPKA 3AZLB 1BH9B 2AROC 5B24A 3AZGB 5B33A 3W97B 3AFAB 3AZHB 4DRBA 2RIQA 1P3LD 3X1SD 5B40D 1P3GB 1KX3C 3LZ1B 4J8XA 5CPJC 3AL0C 5GT0C 3V9RB 3AZID 1P3IB 5FUGB 4YM6D 2NZDB 3AV1B 3AZJA 4J8UC 1Q9CA 5B0ZA 3WTPD 3AZEC 4WU8D 4J8VC 1EQZA 2AROB 1WWSA 5F99A 2FFFB 3W99D 4X23C 3MVDA 2PYOA 3LJAD 5CPKB 1KX3B 1A7WA 1M19A 1P3PA 5BO0B 5CPJB 3C1BA 4Z5TD 5GT0B 1U35C 2FJ7C 4NFTA 3LELA 3MGQD 5E5AC 3AZLA 4J8UB 1P3MB 5GT3C 1BH9A 5B0YC 1P34A 1ID3D 1AOIC 4J8VB 3EPJA 3AV2C 3KXBC 1F66A 4KUDD 4G91C 3MGRC 4X23B 4QLCA 3UTAC 3VH5T 3WAAD 3LZ1A 5B31G 1P3BA 3REJA 3A1IA 3AZMC 4Z66C 3REKC 4AWLC 4R8PB 1PZRA 3A6NC 1U35B 2FJ7B 5AV5C 3AV1A 2NZDA 1T3UA 3X1UD 5E5AB 5GT3B 5B0YB 1R4VA 1AOIB 2BYMB 2G5IC 1P3OD 5GSUD 3AV2B 3KXBB 1P3LA 2F2AC 4G91B 3MGRB 3KUYC 2DQNC 5CPKA 3UTAB 5B31C 1JFIB 3AZMB 4Z66B 2DF4C 2Y2PA 2Y2OA 5B24C 3C1CD 1P3KD 4YM6A 4ZBJB 3REKB 5B33C 2F8NG 3A6NB 5AVCD 5AV5B 1P3MA 2Y2MA 3B0DC 4J8VA 1M1AD 5CP6D 4JJND 4NE5A 3MGPD 1P3FD 3W99A 4J8XC 4ZUXB 4KGCD 5AY8D 5BNVB 3VH5W 3KUYB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LZ0 A;  3AZJ C;  3KSY A;  3R45 A;  5B0Z C;  1S32 D;  3WKJ D;  4Z5T A;  1EQZ C;  4R8P A;  5B24 B;  5F99 C;  3AZN C;  3X1V D;  3MGQ A;  5B0Y A;  3B0D B;  4Z2M G;  1TAF B;  3MVD C;  3AN2 D;  3X1T B;  2BYM A;  2PYO C;  3VH6 W;  3UTB D;  3AV2 A;  1M19 C;  3B6G C;  1BFM A;  1P3P C;  4J8X B;  4CSR A;  4XZQ C;  3MGS B;  3C1B C;  4NE6 A;  3UT9 D;  3REL C;  3LEL C;  3AZM A;  1H3O B;  4Z66 A;  3AZL C;  5B0Z B;  1HQ3 D;  1P34 C;  3REK A;  5DNN C;  1EQZ B;  3A6N A;  3AZN B;  5F99 B;  4HGA C;  3X1U A;  1F66 C;  3VH5 A;  5AVB B;  4EO5 C;  4QLC C;  3MVD B;  2HIO D;  1P3O A;  5GSU A;  2PYO B;  3LZ1 C;  3TU4 D;  1P3B C;  5B1M D;  1M19 B;  3REJ C;  3REH D;  2CV5 D;  4ZUX A;  3B6F B;  3B6G B;  3W96 D;  5BNV A;  4XZQ B;  3KUY A;  3C1B B;  2NZD C;  3REL B;  3LEL B;  4LD9 D;  3MNN B;  3W98 D;  3REI D;  3VH6 A;  1P34 B;  5DNN B;  1ZLA D;  4HGA B;  4KHA B;  5B32 A;  1P3L C;  1F66 B;  4JJN A;  1TAF A;  5B40 C;  3X1T A;  4EO5 B;  5CPK C;  4QLC B;  3AFA D;  2JSS A;  4YS3 D;  1P3B B;  5AY8 A;  3REJ B;  3MGS A;  4G92 C;  3AZI C;  2RVQ D;  5BS7 A;  4YM6 C;  1TZY D;  3B0B A;  1S32 A;  1H3O A;  1P3M C;  4WU8 C;  3WKJ A;  5B2J D;  1P3A D;  3KWQ D;  5JRG D;  3AZN A;  3W99 C;  3O62 D;  1P3L B;  3AN2 A;  5AVB A;  3X1S B;  5B40 B;  3UTB A;  1B67 A;  3B6G A;  3LZ0 C;  3AZF D;  3B6F A;  4Z5T C;  4XZQ A;  4G92 B;  4H9N B;  3UT9 A;  3AZI B;  4R8P C;  4H9O B;  4YM6 B;  3MGQ C;  3REL A;  3WTP B;  1HQ3 A;  4WU8 B;  3MNN A;  5DNN A;  3AZE D;  4KUD C;  1KX4 D;  3W99 B;  4KHA A;  3WAA C;  3LJA B;  2F8N H;  3TU4 A;  5B1M A;  3W96 A;  2CV5 A;  3LZ0 B;  3B0C T;  3R45 B;  5G49 B;  4Z5T B;  4ZBJ C;  5DNM D;  3AYW D;  4LD9 A;  1N1J B;  3X1U C;  3MGQ B;  3W98 A;  5B2I D;  3REI A;  5B32 G;  1ID3 B;  3NQJ A;  1P3O C;  5GSU C;  4KUD B;  3VH6 T;  4ZUX C;  1B6W A;  1F1E A;  3X1S A;  3AZK D;  5B40 A;  3WAA B;  4CSR B;  3MGR D;  4Z2M H;  1P3K C;  4H9N A;  4WU9 D;  3AZI A;  1TZY A;  4H9O A;  2YFW B;  5AVC C;  4H9P A;  3WTP A;  5B2J A;  1P3A A;  4WU8 A;  3X1U B;  5B32 C;  1M1A C;  4WNN B;  4JJN C;  5AV5 D;  3X1T C;  5AV9 D;  3WA9 D;  5CPI D;  1P3O B;  5GSU B;  5AY8 C;  1M18 D;  3WTP E;  3LJA A;  3MGS C;  4E44 A;  5BS7 C;  3AZF A;  1S32 C;  3WKJ C;  3B0C W;  5G49 A;  5B31 D;  1KX5 D;  1P3K B;  1N1J A;  5AVC B;  4CAY B;  4E45 A;  4J8W D;  1ID3 A;  5B32 B;  5B33 D;  1M1A B;  5CHL B;  5AVB C;  5CP6 B;  3AN2 C;  1KX4 A;  4JJN B;  5AV6 D;  3MGP B;  3UTB C;  4KUD A;  3B6F C;  2BYK A;  4KGC B;  5AY8 B;  3WAA A;  3UT9 C;  1S32 B;  1HQ3 C;  3WKJ B;  3MNN C;  5DNM A;  3AYW A;  5B1L D;  3X1V B;  2YFW A;  3AZJ D;  5B2I A;  1EQZ D;  2F8N D;  4WNN A;  2HIO C;  4H9Q B;  3AN2 B;  5AV8 D;  5C3I C;  3TU4 C;  5B1M C;  3UTB B;  3W96 C;  2CV5 C;  3AZK A;  5GXQ D;  1P3P D;  4XUJ D;  3UT9 B;  2NQB D;  5BT1 C;  4LD9 C;  3W98 C;  4WU9 A;  3REI C;  1HQ3 B;  3C1C A;  1P3K A;  5AVC A;  4CAY A;  3AZL D;  3AZG D;  1M1A A;  5CP6 A;  3X1S C;  3WA9 A;  3MGP A;  2HIO B;  1P3F A;  3W97 D;  5C3I B;  3TU4 B;  3AZH D;  5B1M B;  3W96 B;  3REH B;  2CV5 B;  4KGC A;  5BNX B;  1P3G D;  3LZ1 D;  2RVQ C;  1TZY C;  4M6B A;  3WTP C;  5B2J C;  4LD9 B;  1P3A C;  5JA4 B;  3W98 B;  1P3I D;  3REI B;  3NQJ B;  3X1V A;  3AV1 D;  2NZD D;  3O62 C;  1ZLA B;  4DRA A;  4J8W A;  2ARO D;  4H9Q A;  5AV6 A;  3LJA C;  3AZF C;  4YS3 B;  4H9S C;  5CPK D;  1KX3 D;  4UUZ A;  1TZY B;  5CPJ D;  4H9P B;  5B2J B;  5GT0 D;  1P3A B;  1ID3 C;  5B1L A;  3KWQ B;  5JRG B;  1KX4 C;  1P3M D;  4J8U D;  3O62 B;  2F8N A;  4J8V D;  5AV8 A;  1BH8 B;  2HIO A;  4X23 D;  5GXQ A;  3REH A;  3AZF B;  5BNX A;  4XUJ A;  5DNM C;  3LZ0 D;  3AYW C;  2NQB A;  5B2I C;  5JA4 A;  4R8P D;  1U35 D;  2FJ7 D;  3AZE B;  1KX4 B;  1ZLA A;  2F8N K;  5E5A D;  3AZG A;  5GT3 D;  1WWI A;  5B0Y D;  1AOI D;  3AZK C;  2BYK B;  3W97 A;  3AFA A;  3AZH A;  3KXB D;  3AV2 D;  4YS3 A;  1P3G A;  1ULY A;  3UTA D;  4WU9 C;  3C1C C;  1HTA A;  5DNM B;  3AZM D;  2YFV B;  3AYW B;  4Z66 D;  2CWE A;  3V9R A;  4WZS B;  1P3I A;  5FUG A;  5B2I B;  3KWQ A;  3REK D;  5JRG A;  5CP6 C;  5AV9 C;  3A6N D;  3WA9 C;  5CPI C;  3MGP C;  1P3F C;  3O62 A;  2ARO A;  1M18 C;  4KGC C;  3AZK B;  1BH8 A;  4ZUX D;  4NE3 A;  1KX3 A;  4H9S A;  3KUY D;  1KX5 C;  4WU9 B;  5BO0 A;  3C1C B;  3X1V C;  5CPJ A;  4J8W C;  5GT0 A;  3NQU B;  4AWL B;  5B24 D;  2IO5 C;  5AV6 C;  4J8U A;  3AZE A;  5AV9 B;  3WA9 B;  5CPI B;  1P3F B;  5B32 D;  1M18 B;  3X1T D;  4X23 A;  4H9R B;  4J8X D;  3MGS D;  5KDM B;  5B31 B;  5B1L C;  1KX5 B;  2YFV A;  5B0Z D;  1KU5 A;  4J8W B;  2L5A A;  1U35 A;  2FJ7 A;  5B33 B;  3AZN D;  5F99 D;  5AV8 C;  2IO5 B;  5E5A A;  5AV6 B;  2HUE C;  5GT3 A;  1AOI A;  5GXQ C;  3REH C;  5AVB D;  3MVD D;  2PYO D;  3KXB A;  2LY8 A;  3MGR A;  4XUJ C;  1M19 D;  3B6G D;  3B6F D;  2NQB C;  4UUZ B;  3UTA A;  4XZQ D;  3C1B D;  1JFI A;  5B1L B;  3REL D;  3AZJ B;  3LEL D;  1ZLA C;  3MNN D;  3AZG C;  3NQU A;  1P34 D;  2F8N B;  5DNN D;  5AV5 A;  5AV9 A;  5AV8 B;  5CPI A;  3AFA C;  3W97 C;  3AZH C;  1F66 D;  2HUE B;  4YS3 C;  1M18 A;  5GXQ B;  1P3G C;  4QLC D;  4H9R A;  1P3P B;  1P3B D;  4XUJ B;  3REJ D;  2NQB B;  4WV4 B;  1P3I C;  5KDM A;  5B31 A;  3KWQ C;  1KX5 A;  5JRG C;  3AV1 C;  5BT1 D;  3AZL B;  1BH9 B;  2ARO C;  5B24 A;  3AZG B;  5B33 A;  3W97 B;  3AFA B;  3AZH B;  4DRB A;  1P3L D;  3X1S D;  5B40 D;  1P3G B;  1KX3 C;  3LZ1 B;  4J8X A;  5CPJ C;  5GT0 C;  3V9R B;  3AZI D;  1P3I B;  5FUG B;  4YM6 D;  2NZD B;  3AV1 B;  3AZJ A;  4J8U C;  1Q9C A;  5B0Z A;  3WTP D;  3AZE C;  4WU8 D;  4J8V C;  1EQZ A;  2ARO B;  1WWS A;  5F99 A;  3W99 D;  4X23 C;  3MVD A;  2PYO A;  3LJA D;  5CPK B;  1KX3 B;  1A7W A;  1M19 A;  1P3P A;  5BO0 B;  5CPJ B;  3C1B A;  4Z5T D;  5GT0 B;  1U35 C;  2FJ7 C;  4NFT A;  3LEL A;  3MGQ D;  5E5A C;  3AZL A;  4J8U B;  1P3M B;  5GT3 C;  1BH9 A;  5B0Y C;  1P34 A;  1ID3 D;  1AOI C;  4J8V B;  3AV2 C;  3KXB C;  1F66 A;  4KUD D;  4G91 C;  3MGR C;  4X23 B;  4QLC A;  3UTA C;  3VH5 T;  3WAA D;  3LZ1 A;  5B31 G;  1P3B A;  3REJ A;  3AZM C;  4Z66 C;  3REK C;  4AWL C;  4R8P B;  3A6N C;  1U35 B;  2FJ7 B;  2NZD A;  5AV5 C;  3AV1 A;  3X1U D;  5E5A B;  5GT3 B;  5B0Y B;  1R4V A;  1AOI B;  2BYM B;  1P3O D;  5GSU D;  3AV2 B;  3KXB B;  1P3L A;  4G91 B;  3MGR B;  3KUY C;  5CPK A;  3UTA B;  5B31 C;  1JFI B;  3AZM B;  4Z66 B;  5B24 C;  3C1C D;  1P3K D;  4YM6 A;  4ZBJ B;  3REK B;  5B33 C;  2F8N G;  3A6N B;  5AVC D;  5AV5 B;  1P3M A;  3B0D C;  4J8V A;  1M1A D;  5CP6 D;  4JJN D;  4NE5 A;  3MGP D;  1P3F D;  3W99 A;  4J8X C;  4ZUX B;  4KGC D;  5AY8 D;  5BNV B;  3VH5 W;  3KUY B; 
#chains in the Genus database with same CATH topology
 3LZ0 A;  3AZJ C;  3KSY A;  3R45 A;  5B0Z C;  1S32 D;  3WKJ D;  4Z5T A;  1EQZ C;  4R8P A;  5B24 B;  5F99 C;  3AZN C;  2Y2N A;  3MGQ A;  3FDD A;  3X1V D;  2ZY4 A;  5B0Y A;  3B0D B;  4Z2M G;  1TAF B;  3MVD C;  3AN2 D;  3X1T B;  2BYM A;  2PYO C;  3VH6 W;  3UTB D;  3AV2 A;  1M19 C;  3B6G C;  1BFM A;  1P3P C;  4J8X B;  3H0R C;  2Y2Q A;  4CSR A;  4XZQ C;  3MGS B;  3C1B C;  4NE6 A;  3UT9 D;  3REL C;  3LEL C;  3AZM A;  1H3O B;  4Z66 A;  3AZL C;  5B0Z B;  1HQ3 D;  1P34 C;  3REK A;  5DNN C;  2JE5 A;  1EQZ B;  3A6N A;  3AZN B;  5F99 B;  4HGA C;  3X1U A;  1F66 C;  3VH5 A;  5AVB B;  4EO5 C;  4QLC C;  3MVD B;  2HIO D;  1P3O A;  5GSU A;  1Z2C B;  3LZ1 C;  2PYO B;  3TU4 D;  1P3B C;  5B1M D;  1M19 B;  3REJ C;  3REH D;  2CV5 D;  4ZUX A;  3B6F B;  3B6G B;  3W96 D;  5BNV A;  4XZQ B;  3KUY A;  3C1B B;  3EPL A;  2NZD C;  3REL B;  3LEL B;  4LD9 D;  3MNN B;  3W98 D;  3REI D;  3VH6 A;  1P34 B;  5DNN B;  1ZLA D;  4HGA B;  4KHA B;  5B32 A;  1P3L C;  1F66 B;  4JJN A;  1TAF A;  5B40 C;  3X1T A;  4EO5 B;  5CPK C;  4QLC B;  3AFA D;  2JSS A;  4YS3 D;  1P3B B;  5AY8 A;  3REJ B;  3MGS A;  4G92 C;  3AZI C;  2RVQ D;  5BS7 A;  4YM6 C;  3EPK A;  1TZY D;  3B0B A;  1S32 A;  1H3O A;  1P3M C;  4WU8 C;  3WKJ A;  5B2J D;  1P3A D;  3KWQ D;  5JRG D;  2ZY5 A;  3AZN A;  3W99 C;  3O62 D;  1P3L B;  3AN2 A;  5AVB A;  3X1S B;  5B40 B;  3UTB A;  1B67 A;  3B6G A;  3LZ0 C;  3AZF D;  3B6F A;  4Z5T C;  4XZQ A;  4G92 B;  1W2E A;  4H9N B;  3UT9 A;  4R8P C;  3AZI B;  4H9O B;  4YM6 B;  3MGQ C;  3REL A;  3WTP B;  1HQ3 A;  2ZY3 A;  4WU8 B;  3MNN A;  5DNN A;  3AZE D;  4KUD C;  1KX4 D;  3W99 B;  4KHA A;  3WAA C;  3LJA B;  2BG1 A;  2F8N H;  3TU4 A;  2Y2G A;  5B1M A;  3W96 A;  2CV5 A;  3A1K A;  3LZ0 B;  3B0C T;  3R45 B;  5G49 B;  4Z5T B;  2UWX A;  4ZBJ C;  5DNM D;  3AYW D;  4LD9 A;  1N1J B;  3IP4 C;  3X1U C;  3MGQ B;  3W98 A;  5B2I D;  3REI A;  5B32 G;  1ID3 B;  3NQJ A;  1P3O C;  5GSU C;  4KUD B;  3VH6 T;  4ZUX C;  1B6W A;  1F1E A;  3X1S A;  3AZK D;  5B40 A;  2J8P A;  3WAA B;  4CSR B;  3MGR D;  4Z2M H;  1P3K C;  4H9N A;  4WU9 D;  3AZI A;  1TZY A;  4H9O A;  2YFW B;  5AVC C;  4H9P A;  3WTP A;  5B2J A;  1P3A A;  4WU8 A;  3X1U B;  5B32 C;  1M1A C;  4WNN B;  4JJN C;  5AV5 D;  3X1T C;  5AV9 D;  3WA9 D;  5CPI D;  1P3O B;  5GSU B;  5AY8 C;  1M18 D;  3WTP E;  3LJA A;  3EPH A;  3MGS C;  4E44 A;  5BS7 C;  3AZF A;  1S32 C;  3WKJ C;  3B0C W;  5G49 A;  5B31 D;  1KX5 D;  1P3K B;  1N1J A;  5AVC B;  4CAY B;  4E45 A;  4J8W D;  1ID3 A;  5B32 B;  5B33 D;  1M1A B;  5CHL B;  5AVB C;  5CP6 B;  3AN2 C;  1KX4 A;  4JJN B;  5AV6 D;  3MGP B;  3UTB C;  4KUD A;  3B6F C;  2BYK A;  4KGC B;  5AY8 B;  3WAA A;  3UT9 C;  1S32 B;  1HQ3 C;  3WKJ B;  3MNN C;  5DNM A;  3AYW A;  5B1L D;  3X1V B;  2YFW A;  3AZJ D;  5B2I A;  1EQZ D;  2F8N D;  4WNN A;  2HIO C;  4H9Q B;  3AN2 B;  5AV8 D;  5C3I C;  3TU4 C;  5B1M C;  3UTB B;  3W96 C;  2CV5 C;  3AZK A;  5GXQ D;  1P3P D;  2ZY2 A;  4XUJ D;  3UT9 B;  2NQB D;  5BT1 C;  4LD9 C;  3W98 C;  4WU9 A;  3REI C;  1HQ3 B;  3C1C A;  1P3K A;  5AVC A;  4CAY A;  3AZL D;  3AZG D;  1M1A A;  5CP6 A;  3X1S C;  3WA9 A;  3MGP A;  2HIO B;  1P3F A;  3W97 D;  5C3I B;  3TU4 B;  3AZH D;  5B1M B;  3W96 B;  3REH B;  2CV5 B;  4KGC A;  5BNX B;  1P3G D;  3LZ1 D;  2RVQ C;  1TZY C;  4M6B A;  3WTP C;  5B2J C;  4LD9 B;  1P3A C;  5JA4 B;  3W98 B;  1P3I D;  3REI B;  3NQJ B;  3X1V A;  3AV1 D;  2NZD D;  3O62 C;  1ZLA B;  4DRA A;  4J8W A;  3F6T A;  2G5H C;  2ARO D;  4H9Q A;  5AV6 A;  3LJA C;  3AZF C;  4WJ3 C;  4YS3 B;  4H9S C;  5CPK D;  1KX3 D;  4UUZ A;  1TZY B;  5CPJ D;  4H9P B;  5B2J B;  5GT0 D;  1P3A B;  1ID3 C;  5B1L A;  3KWQ B;  5JRG B;  1KX4 C;  1P3M D;  4J8U D;  3O62 B;  2Y2J A;  2F8N A;  4J8V D;  5AV8 A;  1BH8 B;  2HIO A;  2XD5 A;  4X23 D;  5GXQ A;  2ZM5 A;  3REH A;  3AZF B;  5BNX A;  2Y2I A;  3EG5 B;  4XUJ A;  5DNM C;  3LZ0 D;  3AYW C;  2NQB A;  5B2I C;  5JA4 A;  4R8P D;  1U35 D;  2FJ7 D;  3AZE B;  1KX4 B;  1ZLA A;  2Y2K A;  5E5A D;  2F8N K;  3AZG A;  5GT3 D;  1WWI A;  5B0Y D;  1AOI D;  3AZK C;  3H0M C;  2BYK B;  3W97 A;  3AFA A;  3AZH A;  3KXB D;  3AV2 D;  2JCH A;  4YS3 A;  1P3G A;  4DQY B;  1ULY A;  3UTA D;  4WU9 C;  3C1C C;  1HTA A;  5DNM B;  3AZM D;  2YFV B;  3AYW B;  4Z66 D;  2CWE A;  3V9R A;  4WZS B;  1P3I A;  5FUG A;  5B2I B;  3KWQ A;  3REK D;  2XD1 A;  5JRG A;  5CP6 C;  5AV9 C;  3A6N D;  3WA9 C;  5CPI C;  3MGP C;  1P3F C;  3KFU G;  3O62 A;  2ARO A;  1M18 C;  4KGC C;  3AZK B;  2W8S A;  1BH8 A;  4ZUX D;  4NE3 A;  1KX3 A;  4H9S A;  3KUY D;  1KX5 C;  4WU9 B;  5BO0 A;  2VQR A;  3C1C B;  3X1V C;  5CPJ A;  4J8W C;  5GT0 A;  3NQU B;  4AWL B;  5B24 D;  2IO5 C;  5AV6 C;  4J8U A;  3AZE A;  5AV9 B;  3WA9 B;  5CPI B;  1P3F B;  2Y2L A;  5B32 D;  1M18 B;  3X1T D;  2Y2H A;  4X23 A;  4H9R B;  4J8X D;  3MGS D;  5B31 B;  5KDM B;  5B1L C;  1KX5 B;  2YFV A;  5B0Z D;  1KU5 A;  4J8W B;  2L5A A;  1U35 A;  2FJ7 A;  5B33 B;  3AZN D;  5F99 D;  5AV8 C;  2IO5 B;  5E5A A;  5AV6 B;  2HUE C;  5GT3 A;  3P5J B;  1AOI A;  5GXQ C;  3REH C;  5AVB D;  3MVD D;  2PYO D;  3KXB A;  2LY8 A;  3MGR A;  4XUJ C;  3H0L C;  1M19 D;  3B6G D;  3B6F D;  2NQB C;  4UUZ B;  3UTA A;  4XZQ D;  3C1B D;  1JFI A;  5B1L B;  3REL D;  3AZJ B;  3LEL D;  1ZLA C;  3MNN D;  3AZG C;  3NQU A;  1P34 D;  2F8N B;  5DNN D;  5AV5 A;  5AV9 A;  5AV8 B;  5CPI A;  3AFA C;  3W97 C;  3AZH C;  1F66 D;  2HUE B;  4YS3 C;  1M18 A;  5GXQ B;  1P3G C;  4QLC D;  4H9R A;  1P3P B;  1P3B D;  4XUJ B;  3REJ D;  2NQB B;  4WV4 B;  1P3I C;  5KDM A;  5B31 A;  3KWQ C;  1KX5 A;  5JRG C;  3AV1 C;  5BT1 D;  4UPK A;  3AZL B;  1BH9 B;  2ARO C;  5B24 A;  3AZG B;  5B33 A;  3W97 B;  3AFA B;  3AZH B;  4DRB A;  2RIQ A;  1P3L D;  3X1S D;  5B40 D;  1P3G B;  1KX3 C;  3LZ1 B;  4J8X A;  5CPJ C;  3AL0 C;  5GT0 C;  3V9R B;  3AZI D;  1P3I B;  5FUG B;  4YM6 D;  2NZD B;  3AV1 B;  3AZJ A;  4J8U C;  1Q9C A;  5B0Z A;  3WTP D;  3AZE C;  4WU8 D;  4J8V C;  1EQZ A;  2ARO B;  1WWS A;  5F99 A;  2FFF B;  3W99 D;  4X23 C;  3MVD A;  2PYO A;  3LJA D;  5CPK B;  1KX3 B;  1A7W A;  1M19 A;  1P3P A;  5BO0 B;  5CPJ B;  3C1B A;  4Z5T D;  5GT0 B;  1U35 C;  2FJ7 C;  4NFT A;  3LEL A;  3MGQ D;  5E5A C;  3AZL A;  4J8U B;  1P3M B;  5GT3 C;  1BH9 A;  5B0Y C;  1P34 A;  1ID3 D;  1AOI C;  4J8V B;  3EPJ A;  3AV2 C;  3KXB C;  1F66 A;  4KUD D;  4G91 C;  3MGR C;  4X23 B;  4QLC A;  3UTA C;  3VH5 T;  3WAA D;  3LZ1 A;  5B31 G;  1P3B A;  3REJ A;  3A1I A;  3AZM C;  4Z66 C;  3REK C;  4AWL C;  4R8P B;  1PZR A;  3A6N C;  1U35 B;  2FJ7 B;  5AV5 C;  3AV1 A;  2NZD A;  1T3U A;  3X1U D;  5E5A B;  5GT3 B;  5B0Y B;  1R4V A;  1AOI B;  2BYM B;  2G5I C;  1P3O D;  5GSU D;  3AV2 B;  3KXB B;  1P3L A;  2F2A C;  4G91 B;  3MGR B;  3KUY C;  2DQN C;  5CPK A;  3UTA B;  5B31 C;  1JFI B;  3AZM B;  4Z66 B;  2DF4 C;  2Y2P A;  2Y2O A;  5B24 C;  3C1C D;  1P3K D;  4YM6 A;  4ZBJ B;  3REK B;  5B33 C;  2F8N G;  3A6N B;  5AVC D;  5AV5 B;  1P3M A;  2Y2M A;  3B0D C;  4J8V A;  1M1A D;  5CP6 D;  4JJN D;  4NE5 A;  3MGP D;  1P3F D;  3W99 A;  4J8X C;  4ZUX B;  4KGC D;  5AY8 D;  5BNV B;  3VH5 W;  3KUY B; 
#chains in the Genus database with same CATH homology
 3LZ0 A;  3AZJ C;  3KSY A;  3R45 A;  5B0Z C;  1S32 D;  3WKJ D;  4Z5T A;  1EQZ C;  4R8P A;  5B24 B;  5F99 C;  3AZN C;  2Y2N A;  3MGQ A;  3FDD A;  3X1V D;  2ZY4 A;  5B0Y A;  3B0D B;  4Z2M G;  1TAF B;  3MVD C;  3AN2 D;  3X1T B;  2BYM A;  2PYO C;  3VH6 W;  3UTB D;  3AV2 A;  1M19 C;  3B6G C;  1BFM A;  1P3P C;  4J8X B;  3H0R C;  2Y2Q A;  4CSR A;  4XZQ C;  3MGS B;  3C1B C;  4NE6 A;  3UT9 D;  3REL C;  3LEL C;  3AZM A;  1H3O B;  4Z66 A;  3AZL C;  5B0Z B;  1HQ3 D;  1P34 C;  3REK A;  5DNN C;  2JE5 A;  1EQZ B;  3A6N A;  3AZN B;  5F99 B;  4HGA C;  3X1U A;  1F66 C;  3VH5 A;  5AVB B;  4EO5 C;  4QLC C;  3MVD B;  2HIO D;  1P3O A;  5GSU A;  1Z2C B;  3LZ1 C;  2PYO B;  3TU4 D;  1P3B C;  5B1M D;  1M19 B;  3REJ C;  3REH D;  2CV5 D;  4ZUX A;  3B6F B;  3B6G B;  3W96 D;  5BNV A;  4XZQ B;  3KUY A;  3C1B B;  3EPL A;  2NZD C;  3REL B;  3LEL B;  4LD9 D;  3MNN B;  3W98 D;  3REI D;  3VH6 A;  1P34 B;  5DNN B;  1ZLA D;  4HGA B;  4KHA B;  5B32 A;  1P3L C;  1F66 B;  4JJN A;  1TAF A;  5B40 C;  3X1T A;  4EO5 B;  5CPK C;  4QLC B;  3AFA D;  2JSS A;  4YS3 D;  1P3B B;  5AY8 A;  3REJ B;  3MGS A;  4G92 C;  3AZI C;  2RVQ D;  5BS7 A;  4YM6 C;  3EPK A;  1TZY D;  3B0B A;  1S32 A;  1H3O A;  1P3M C;  4WU8 C;  3WKJ A;  5B2J D;  1P3A D;  3KWQ D;  5JRG D;  2ZY5 A;  3AZN A;  3W99 C;  3O62 D;  1P3L B;  3AN2 A;  5AVB A;  3X1S B;  5B40 B;  3UTB A;  1B67 A;  3B6G A;  3LZ0 C;  3AZF D;  3B6F A;  4Z5T C;  4XZQ A;  4G92 B;  1W2E A;  4H9N B;  3UT9 A;  4R8P C;  3AZI B;  4H9O B;  4YM6 B;  3MGQ C;  3REL A;  3WTP B;  1HQ3 A;  2ZY3 A;  4WU8 B;  3MNN A;  5DNN A;  3AZE D;  4KUD C;  1KX4 D;  3W99 B;  4KHA A;  3WAA C;  3LJA B;  2BG1 A;  2F8N H;  3TU4 A;  2Y2G A;  5B1M A;  3W96 A;  2CV5 A;  3A1K A;  3LZ0 B;  3B0C T;  3R45 B;  5G49 B;  4Z5T B;  2UWX A;  4ZBJ C;  5DNM D;  3AYW D;  4LD9 A;  1N1J B;  3IP4 C;  3X1U C;  3MGQ B;  3W98 A;  5B2I D;  3REI A;  5B32 G;  1ID3 B;  3NQJ A;  1P3O C;  5GSU C;  4KUD B;  3VH6 T;  4ZUX C;  1B6W A;  1F1E A;  3X1S A;  3AZK D;  5B40 A;  2J8P A;  3WAA B;  4CSR B;  3MGR D;  4Z2M H;  1P3K C;  4H9N A;  4WU9 D;  3AZI A;  1TZY A;  4H9O A;  2YFW B;  5AVC C;  4H9P A;  3WTP A;  5B2J A;  1P3A A;  4WU8 A;  3X1U B;  5B32 C;  1M1A C;  4WNN B;  4JJN C;  5AV5 D;  3X1T C;  5AV9 D;  3WA9 D;  5CPI D;  1P3O B;  5GSU B;  5AY8 C;  1M18 D;  3WTP E;  3LJA A;  3EPH A;  3MGS C;  4E44 A;  5BS7 C;  3AZF A;  1S32 C;  3WKJ C;  3B0C W;  5G49 A;  5B31 D;  1KX5 D;  1P3K B;  1N1J A;  5AVC B;  4CAY B;  4E45 A;  4J8W D;  1ID3 A;  5B32 B;  5B33 D;  1M1A B;  5CHL B;  5AVB C;  5CP6 B;  3AN2 C;  1KX4 A;  4JJN B;  5AV6 D;  3MGP B;  3UTB C;  4KUD A;  3B6F C;  2BYK A;  4KGC B;  5AY8 B;  3WAA A;  3UT9 C;  1S32 B;  1HQ3 C;  3WKJ B;  3MNN C;  5DNM A;  3AYW A;  5B1L D;  3X1V B;  2YFW A;  3AZJ D;  5B2I A;  1EQZ D;  2F8N D;  4WNN A;  2HIO C;  4H9Q B;  3AN2 B;  5AV8 D;  5C3I C;  3TU4 C;  5B1M C;  3UTB B;  3W96 C;  2CV5 C;  3AZK A;  5GXQ D;  1P3P D;  2ZY2 A;  4XUJ D;  3UT9 B;  2NQB D;  5BT1 C;  4LD9 C;  3W98 C;  4WU9 A;  3REI C;  1HQ3 B;  3C1C A;  1P3K A;  5AVC A;  4CAY A;  3AZL D;  3AZG D;  1M1A A;  5CP6 A;  3X1S C;  3WA9 A;  3MGP A;  2HIO B;  1P3F A;  3W97 D;  5C3I B;  3TU4 B;  3AZH D;  5B1M B;  3W96 B;  3REH B;  2CV5 B;  4KGC A;  5BNX B;  1P3G D;  3LZ1 D;  2RVQ C;  1TZY C;  4M6B A;  3WTP C;  5B2J C;  4LD9 B;  1P3A C;  5JA4 B;  3W98 B;  1P3I D;  3REI B;  3NQJ B;  3X1V A;  3AV1 D;  2NZD D;  3O62 C;  1ZLA B;  4DRA A;  4J8W A;  3F6T A;  2G5H C;  2ARO D;  4H9Q A;  5AV6 A;  3LJA C;  3AZF C;  4WJ3 C;  4YS3 B;  4H9S C;  5CPK D;  1KX3 D;  4UUZ A;  1TZY B;  5CPJ D;  4H9P B;  5B2J B;  5GT0 D;  1P3A B;  1ID3 C;  5B1L A;  3KWQ B;  5JRG B;  1KX4 C;  1P3M D;  4J8U D;  3O62 B;  2Y2J A;  2F8N A;  4J8V D;  5AV8 A;  1BH8 B;  2HIO A;  2XD5 A;  4X23 D;  5GXQ A;  2ZM5 A;  3REH A;  3AZF B;  5BNX A;  2Y2I A;  3EG5 B;  4XUJ A;  5DNM C;  3LZ0 D;  3AYW C;  2NQB A;  5B2I C;  5JA4 A;  4R8P D;  1U35 D;  2FJ7 D;  3AZE B;  1KX4 B;  1ZLA A;  2Y2K A;  5E5A D;  2F8N K;  3AZG A;  5GT3 D;  1WWI A;  5B0Y D;  1AOI D;  3AZK C;  3H0M C;  2BYK B;  3W97 A;  3AFA A;  3AZH A;  3KXB D;  3AV2 D;  2JCH A;  4YS3 A;  1P3G A;  4DQY B;  1ULY A;  3UTA D;  4WU9 C;  3C1C C;  1HTA A;  5DNM B;  3AZM D;  2YFV B;  3AYW B;  4Z66 D;  2CWE A;  3V9R A;  4WZS B;  1P3I A;  5FUG A;  5B2I B;  3KWQ A;  3REK D;  2XD1 A;  5JRG A;  5CP6 C;  5AV9 C;  3A6N D;  3WA9 C;  5CPI C;  3MGP C;  1P3F C;  3KFU G;  3O62 A;  2ARO A;  1M18 C;  4KGC C;  3AZK B;  2W8S A;  1BH8 A;  4ZUX D;  4NE3 A;  1KX3 A;  4H9S A;  3KUY D;  1KX5 C;  4WU9 B;  5BO0 A;  2VQR A;  3C1C B;  3X1V C;  5CPJ A;  4J8W C;  5GT0 A;  3NQU B;  4AWL B;  5B24 D;  2IO5 C;  5AV6 C;  4J8U A;  3AZE A;  5AV9 B;  3WA9 B;  5CPI B;  1P3F B;  2Y2L A;  5B32 D;  1M18 B;  3X1T D;  2Y2H A;  4X23 A;  4H9R B;  4J8X D;  3MGS D;  5B31 B;  5KDM B;  5B1L C;  1KX5 B;  2YFV A;  5B0Z D;  1KU5 A;  4J8W B;  2L5A A;  1U35 A;  2FJ7 A;  5B33 B;  3AZN D;  5F99 D;  5AV8 C;  2IO5 B;  5E5A A;  5AV6 B;  2HUE C;  5GT3 A;  3P5J B;  1AOI A;  5GXQ C;  3REH C;  5AVB D;  3MVD D;  2PYO D;  3KXB A;  2LY8 A;  3MGR A;  4XUJ C;  3H0L C;  1M19 D;  3B6G D;  3B6F D;  2NQB C;  4UUZ B;  3UTA A;  4XZQ D;  3C1B D;  1JFI A;  5B1L B;  3REL D;  3AZJ B;  3LEL D;  1ZLA C;  3MNN D;  3AZG C;  3NQU A;  1P34 D;  2F8N B;  5DNN D;  5AV5 A;  5AV9 A;  5AV8 B;  5CPI A;  3AFA C;  3W97 C;  3AZH C;  1F66 D;  2HUE B;  4YS3 C;  1M18 A;  5GXQ B;  1P3G C;  4QLC D;  4H9R A;  1P3P B;  1P3B D;  4XUJ B;  3REJ D;  2NQB B;  4WV4 B;  1P3I C;  5KDM A;  5B31 A;  3KWQ C;  1KX5 A;  5JRG C;  3AV1 C;  5BT1 D;  4UPK A;  3AZL B;  1BH9 B;  2ARO C;  5B24 A;  3AZG B;  5B33 A;  3W97 B;  3AFA B;  3AZH B;  4DRB A;  2RIQ A;  1P3L D;  3X1S D;  5B40 D;  1P3G B;  1KX3 C;  3LZ1 B;  4J8X A;  5CPJ C;  3AL0 C;  5GT0 C;  3V9R B;  3AZI D;  1P3I B;  5FUG B;  4YM6 D;  2NZD B;  3AV1 B;  3AZJ A;  4J8U C;  1Q9C A;  5B0Z A;  3WTP D;  3AZE C;  4WU8 D;  4J8V C;  1EQZ A;  2ARO B;  1WWS A;  5F99 A;  2FFF B;  3W99 D;  4X23 C;  3MVD A;  2PYO A;  3LJA D;  5CPK B;  1KX3 B;  1A7W A;  1M19 A;  1P3P A;  5BO0 B;  5CPJ B;  3C1B A;  4Z5T D;  5GT0 B;  1U35 C;  2FJ7 C;  4NFT A;  3LEL A;  3MGQ D;  5E5A C;  3AZL A;  4J8U B;  1P3M B;  5GT3 C;  1BH9 A;  5B0Y C;  1P34 A;  1ID3 D;  1AOI C;  4J8V B;  3EPJ A;  3AV2 C;  3KXB C;  1F66 A;  4KUD D;  4G91 C;  3MGR C;  4X23 B;  4QLC A;  3UTA C;  3VH5 T;  3WAA D;  3LZ1 A;  5B31 G;  1P3B A;  3REJ A;  3A1I A;  3AZM C;  4Z66 C;  3REK C;  4AWL C;  4R8P B;  1PZR A;  3A6N C;  1U35 B;  2FJ7 B;  5AV5 C;  3AV1 A;  2NZD A;  1T3U A;  3X1U D;  5E5A B;  5GT3 B;  5B0Y B;  1R4V A;  1AOI B;  2BYM B;  2G5I C;  1P3O D;  5GSU D;  3AV2 B;  3KXB B;  1P3L A;  2F2A C;  4G91 B;  3MGR B;  3KUY C;  2DQN C;  5CPK A;  3UTA B;  5B31 C;  1JFI B;  3AZM B;  4Z66 B;  2DF4 C;  2Y2P A;  2Y2O A;  5B24 C;  3C1C D;  1P3K D;  4YM6 A;  4ZBJ B;  3REK B;  5B33 C;  2F8N G;  3A6N B;  5AVC D;  5AV5 B;  1P3M A;  2Y2M A;  3B0D C;  4J8V A;  1M1A D;  5CP6 D;  4JJN D;  4NE5 A;  3MGP D;  1P3F D;  3W99 A;  4J8X C;  4ZUX B;  4KGC D;  5AY8 D;  5BNV B;  3VH5 W;  3KUY B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...