5B1MC

The mouse nucleosome structure containing h3.1
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
108
structure length
108
Chain Sequence
RAKAKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords Histone H3.1
publication title Testis-Specific Histone Variant H3t Gene Is Essential for Entry into Spermatogenesis
pubmed doi rcsb
source organism Mus musculus
total genus 31
structure length 108
sequence length 108
chains with identical sequence G
ec nomenclature
pdb deposition date 2015-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5b1mC00
1P3ID 5CPID 1A7WA 1P34B 4YM6C 1U35B 5CPKB 3B6GD 1P3PB 5AVBC 5B1MA 3UT9B 3R45A 5B32G 3AZFB 5B2JC 3AYWD 2YFWB 4WU8C 3WTPB 3C1CD 4XUJC 3O62C 3LZ1A 1P3FB 3KXBB 3B0CT 5AVBA 5F99B 1P3KC 4J8WA 1P3MB 5B40D 4KUDC 3LZ0D 1KX5B 4J8VB 4CSRB 1AOID 5B2JA 1F66D 3AZGD 5DNNB 1U35C 4KGCB 3AZED 1ZLAB 3AZNB 3NQJB 3X1TB 3W96B 3MGRD 1KX3A 5JRGD 3AN2D 3MVDA 4UUZB 4KUDA 4YS3C 5GT3D 1P3BA 1P3LD 1HQ3B 3A6ND 3MGQB 3WTPC 1P34A 1ID3C 3MNNC 1U35A 2L5AA 5CPKA 3W99C 3KXBC 3VH5A 4J8XD 1P3PA 5AV8C 5F99C 1P3MC 3UT9A 2AROC 3REKB 4J8VC 3AZFA 2YFWA 5B2IC 1P3OD 5DNNC 5E5AD 3TU4D 3WKJA 3WTPA 5BO0B 1TZYB 3W98D 3W96C 3AZNC 1P3FA 1KX4C 5AV6D 1P3MA 5F99A 3KUYD 3AZMB 1HQ3C 1M19D 1KX5A 4J8VA 4CSRA 3REHB 5DNNA 3AZIB 3WA9B 3AV2B 5B24B 4KGCA 3X1UB 5CHLB 3W96A 4X23D 3NQJA 3AZNA 3X1TA 4NFTA 1ZLAA 3LJAC 4UUZA 3REKC 1HQ3A 2HIOC 1P3AD 3MGQA 4AWLC 2CV5B 3X1VD 3REJA 3B0DB 3MGPD 4H9SC 5CP6D 5AV9D 4LD9D 3LELB 5BT1D 3NQUB 3REID 5BNXB 4Z66D 1JFIB 3RELD 3REKA 3B6FB 2PYOD 5B0ZB 3WA9C 1M1AD 5BO0A 5B24C 5GT0B 3WTPE 1TZYA 4JJND 5GXQB 3AZHD 5AY8B 3X1UC 5DNMC 4ZUXD 4H9SA 1BH8B 5B32C 4H9OB 4Z5TD 4WU9C 2RVQC 3AZMA 3W97B 3C1BC 3REHA 2CV5C 2IO5C 3AZIA 4XZQD 3WA9A 3AV2A 5B24A 3B0DC 3AZKD 4QLCB 1P3GC 2FJ7D 1S32B 3X1SB 5B1MD 3VH6A 2NZDB 5B0ZC 5GT0C 1BFMA 5GXQC 5CPJA 5AY8C 5B0YB 3WAAB 4YM6D 3LELA 3NQUA 1M18B 5BNXA 1JFIA 3W97C 3B6FA 3AZLB 5B0ZA 5B2JD 4H9QA 4WV4B 5AV5B 5GT0A 4WU8D 4NE3A 5BNVB 5GXQA 5AY8A 1BH8A 4XUJD 4H9OA 4CAYB 5B33B 2BYMB 3O62D 4J8UB 3W97A 3UTBB 1P3KD 2NZDC 4KUDD 3LZ1C 1WWSA 4J8WC 5GSUB 1TAFB 4QLCA 1U35D 1P3IB 5CPIB 4NE6A 3WKJB 1S32A 3X1SA 2NZDA 4YS3D 3VH5T 1KX3C 3MVDC 1P3BC 3WTPD 3VH6W 5B0YA 3WAAA 1ID3D 3MNND 3KWQB 2HUEB 1M18A 1P34C 3W99D 3KXBD 4J8UC 5AV8D 5F99D 1P3MD 5CPKC 3AZLA 2AROD 1P3PC 4J8VD 2F8ND 5AV5A 5B2ID 3UT9C 5GSUC 5DNND 5BNVA 5B40B 3AZFC 4CAYA 1AOIB 5B33A 3WKJC 1F66B 3W96D 2BYMA 3AZND 3AZGB 1KX4D 4J8UA 5B31B 3REJB 3UTBA 1P3FC 1HQ3D 1B67A 5GSUA 3MGRB 4G91B 5JRGB 3MGSB 3AN2B 1KX5C 1TAFA 5GT3B 3KWQC 1P3LB 1P3IA 5CPIA 3A6NB 5AVCB 3LJAD 4KGCC 3REKD 1ZLAC 3X1TC 4DRBA 2HIOD 4J8XB 1B6WA 3KWQA 4NE5A 3MGQC 1P3OB 5E5AB 5B31C 3REJC 3W98B 5BS7A 5AV6B 4G91C 3MGSC 4H9RB 3KUYB 5B40A 3WA9D 4Z2MH 1M19B 1AOIA 3X1UD 1F66A 5DNMD 3AZGA 5B32D 5AVCC 1TZYC 4WNNB 5B31A 4WU9D 5CPJB 2RVQD 2NQBB 3C1BD 2CV5D 3AZMC 1KU5A 5C3IB 5JRGA 3MGSA 3MGRA 3AN2A 5FUGB 5GT3A 3REHC 1P3LA 1EQZB 3AZIC 3A6NA 5JA4B 1P3GD 4H9QB 3AV2C 5AVCA 3X1VB 4WZSB 3MGPB 5CP6B 4LD9B 5AV9B 5B0ZD 4J8XA 3REIB 4Z66B 5GT0D 2JSSA 5GXQD 5AY8D 4EO5B 1P3OA 2PYOB 5E5AA 3KSYA 5CPJC 5G49B 2NQBC 4JJNB 3W98A 3LELC 4R8PB 2CWEA 5AV6A 4H9RA 1R4VA 3B0CW 3KUYA 3B6FC 1M19A 1EQZC 3AZJB 1ULYA 5B31G 4WNNA 4XZQB 3AZKB 2NQBA 2NZDD 3AFAB 3LZ1D 2FJ7B 4HGAB 5AVBD 4J8WD 5FUGA 1EQZA 5JA4A 1P3AA 3X1VA 3AV1B 4QLCC 4R8PC 3MGPA 5CP6A 4LD9A 5AV9A 4YM6B 3X1SC 1S32C 3REIA 4Z66A 1KX3D 5B1LB 3MVDD 1BH9B 3AZJC 1P3BD 2PYOA 5G49A 3UTAB 1P34D 5B0YC 3WAAC 4WU8B 4J8UD 4JJNA 3AFAC 5CPKD 1M18C 4R8PA 4XUJB 1P3PD 3O62B 3UT9D 5GSUD 3AZLC 1P3KB 3AZJA 3AZFD 3B6GB 5AV5C 4XZQA 3WKJD 3AV1C 2F8NK 3AZKA 3AFAA 5B33C 3AYWB 1F1EA 1P3FD 2FJ7A 3UTBC 5B1LC 3C1CB 1KX5D 4KHAB 4YS3B 3KWQD 3UTAC 3AV1A 1N1JB 4M6BA 3LZ0B 1P3IC 4KGCD 5CPIC 1ID3B 3MNNB 4YM6A 1ZLAD 3X1TD 3W99B 5B1LA 5AV8B 1BH9A 4ZBJB 3B6GC 3AZEB 4E45A 2AROB 3MGQD 2F8NB 5B2IB 3UTAA 5B31D 4WU8A 3REJD 4H9PB 2HUEC 3AYWC 4XUJA 4DRAA 3C1CC 3O62A 1KX4B 5KDMB 3MGSD 2LY8A 1P3KA 3V9RB 5BS7C 3B6GA 1WWIA 5B40C 3LZ0C 5AVCD 1TZYD 4H9NB 1AOIC 3AYWA 1F66C 3AZGC 3TU4B 1Q9CA 3C1CA 3AZMD 4ZBJC 3LJAB 3AZEC 4KHAA 3B0BA 4YS3A 3REHD 3AZID 3MGRC 5JRGC 2HIOB 3AN2C 1N1JA 4AWLB 5GT3C 3AV2D 5B24D 3LZ0A 1P3LC 3A6NC 1ID3A 3MNNA 3KXBA 3W99A 4G92B 5AV8A 3AZEA 2F8NH 2AROA 4J8XC 4X23B 2F8NA 5B2IA 3VH6T 5CPJD 4H9PA 1P3OC 2NQBD 5E5AC 1P3AB 3LELD 3TU4C 5DNMB 1KX4A 5KDMA 5B32B 4WU9B 3W98C 3V9RA 3B6FD 1EQZD 3C1BB 5AV6C 3KUYC 2IO5B 3RELB 1M19C 4H9NA 2YFVB 3TU4A 1P3GB 4G92C 1M1AB 2BYKB 3LJAA 3AZHB 3W97D 4X23C 4ZUXB 4Z5TB 5C3IC 2HIOA 3VH5W 4Z2MG 4QLCD 1H3OB 1P3AC 4R8PD 3X1VC 1S32D 3X1SD 1HTAA 3MGPC 2F8NG 5CP6C 4LD9C 5AV9C 4X23A 3AZJD 5BT1C 3REIC 4Z66C 3RELC 5B1MB 4EO5C 5B0YD 3R45B 2PYOC 3WAAD 3AFAD 3X1UA 5DNMA 1M18D 1M1AC 5B32A 4JJNC 4WU9A 3AZHC 3AZLD 4ZUXC 4Z5TC 3C1BA 3LZ1B 5AV5D 2CV5A 3RELA 5AVBB 4J8WB 3AV1D 2YFVA 4XZQC 5B33D 5B2JB 1P3GA 1M1AA 2BYKA 3AZKC 3AZHA 3UTBD 5B1LD 4ZUXA 4HGAC 2FJ7C 4Z5TA 5B1MC 3UTAD 1KX3B 4E44A 3MVDB 4KUDB 1P3BB 1H3OA
chains in the Genus database with same CATH superfamily
1P3ID 5CPID 3AL0C 1A7WA 1P34B 4YM6C 1U35B 5CPKB 3B6GD 2JE5A 1P3PB 5AVBC 5B1MA 3UT9B 3R45A 3H0MC 5B32G 3AZFB 5B2JC 3AYWD 2YFWB 4WU8C 3WTPB 3C1CD 3FDDA 4XUJC 3O62C 3LZ1A 1P3FB 3KXBB 3B0CT 5AVBA 5F99B 1P3KC 4J8WA 1P3MB 3F6TA 5B40D 2Y2OA 4KUDC 3LZ0D 2VQRA 1KX5B 4J8VB 4CSRB 2BG1A 5B2JA 1AOID 1F66D 3AZGD 5DNNB 1U35C 4KGCB 3AZED 1ZLAB 3AZNB 3NQJB 3X1TB 3W96B 3MGRD 1KX3A 5JRGD 3AN2D 3MVDA 4UUZB 4KUDA 4YS3C 5GT3D 1P3BA 1P3LD 1HQ3B 3A6ND 3MGQB 3WTPC 1P34A 1ID3C 3MNNC 1U35A 2DF4C 2L5AA 5CPKA 3W99C 3KXBC 3VH5A 4J8XD 1P3PA 5AV8C 5F99C 1P3MC 3UT9A 2AROC 3REKB 4J8VC 3AZFA 2YFWA 5B2IC 1P3OD 5DNNC 5E5AD 3TU4D 3WKJA 3WTPA 5BO0B 1TZYB 3W98D 3P5JB 3W96C 3AZNC 1P3FA 1KX4C 2Y2IA 5AV6D 1P3MA 5F99A 3KUYD 3AZMB 1HQ3C 1M19D 1KX5A 4J8VA 4CSRA 3REHB 5DNNA 3AZIB 3WA9B 3AV2B 5B24B 4KGCA 3X1UB 5CHLB 3W96A 4X23D 3NQJA 1W2EA 3AZNA 4NFTA 3X1TA 1ZLAA 3LJAC 4UUZA 3REKC 1HQ3A 2HIOC 1P3AD 3MGQA 4AWLC 2CV5B 3X1VD 2ZY4A 3REJA 3B0DB 3MGPD 4H9SC 5CP6D 5AV9D 4LD9D 3LELB 5BT1D 3NQUB 3REID 5BNXB 4Z66D 1JFIB 3RELD 3REKA 3B6FB 2PYOD 5B0ZB 3WA9C 1M1AD 5BO0A 5B24C 5GT0B 1TZYA 3WTPE 4JJND 5GXQB 2Y2GA 3AZHD 5AY8B 3X1UC 5DNMC 4ZUXD 4H9SA 1BH8B 5B32C 4H9OB 4Z5TD 4WU9C 2RVQC 3AZMA 3EPHA 3W97B 3C1BC 3REHA 2CV5C 2IO5C 3AZIA 4XZQD 3WA9A 3AV2A 5B24A 3B0DC 3AZKD 4QLCB 1P3GC 2FJ7D 1S32B 3X1SB 5B1MD 3VH6A 2NZDB 5B0ZC 5GT0C 1BFMA 5GXQC 5CPJA 5AY8C 5B0YB 3WAAB 4YM6D 3LELA 3NQUA 1M18B 5BNXA 1JFIA 3W97C 3B6FA 3AZLB 5B0ZA 5B2JD 4H9QA 4WV4B 5AV5B 5GT0A 4WU8D 4NE3A 5BNVB 5GXQA 5AY8A 3H0RC 1BH8A 4XUJD 4H9OA 4CAYB 5B33B 2BYMB 3O62D 4J8UB 3W97A 3UTBB 1P3KD 2NZDC 4KUDD 3LZ1C 1WWSA 4J8WC 5GSUB 1TAFB 4QLCA 4WJ3C 1U35D 1P3IB 5CPIB 4NE6A 3WKJB 1S32A 3X1SA 2NZDA 4YS3D 3VH5T 1KX3C 3MVDC 1P3BC 3WTPD 3VH6W 5B0YA 3WAAA 1ID3D 3MNND 3KWQB 2HUEB 1M18A 1P34C 3W99D 3KXBD 4J8UC 5AV8D 5F99D 1P3MD 5CPKC 3AZLA 2AROD 1P3PC 4J8VD 2F8ND 5AV5A 5B2ID 3UT9C 5GSUC 5DNND 5BNVA 5B40B 3AZFC 4CAYA 1AOIB 5B33A 3WKJC 1F66B 3W96D 2BYMA 3AZND 3AZGB 1KX4D 4J8UA 5B31B 3H0LC 3REJB 3UTBA 1P3FC 1HQ3D 2F2AC 1B67A 5GSUA 3MGRB 4G91B 5JRGB 3MGSB 3AN2B 1KX5C 1TAFA 5GT3B 3KWQC 1P3LB 1P3IA 5CPIA 3A6NB 5AVCB 3LJAD 4KGCC 3REKD 1ZLAC 3X1TC 4DRBA 2HIOD 4J8XB 1B6WA 3KWQA 4NE5A 3MGQC 1P3OB 5E5AB 5B31C 3REJC 1Z2CB 3W98B 5BS7A 5AV6B 4G91C 3MGSC 4H9RB 3KUYB 5B40A 3EPLA 3WA9D 4Z2MH 2DQNC 1M19B 1AOIA 3X1UD 1F66A 5DNMD 3AZGA 5B32D 5AVCC 1TZYC 4WNNB 5B31A 4WU9D 5CPJB 2RVQD 2NQBB 3C1BD 2CV5D 3AZMC 1KU5A 5C3IB 5JRGA 3MGSA 3MGRA 3AN2A 5FUGB 5GT3A 3REHC 1P3LA 1EQZB 3AZIC 3A6NA 2ZY5A 3IP4C 5JA4B 1P3GD 4H9QB 3AV2C 5AVCA 3X1VB 4WZSB 3MGPB 5CP6B 4LD9B 5AV9B 2UWXA 5B0ZD 4J8XA 3REIB 4Z66B 3EPKA 3KFUG 5GT0D 2JSSA 5GXQD 5AY8D 4EO5B 1P3OA 2PYOB 5E5AA 1PZRA 3KSYA 5CPJC 5G49B 4UPKA 2NQBC 4JJNB 3W98A 3LELC 4R8PB 2CWEA 5AV6A 4H9RA 1R4VA 3B0CW 3KUYA 3B6FC 1M19A 1EQZC 3AZJB 1ULYA 5B31G 2Y2LA 4WNNA 4XZQB 2G5IC 2JCHA 3AZKB 4DQYB 2NQBA 2NZDD 3AFAB 3LZ1D 2Y2JA 4HGAB 2FJ7B 5AVBD 2W8SA 4J8WD 5FUGA 1EQZA 5JA4A 1P3AA 2Y2PA 3X1VA 3AV1B 4QLCC 4R8PC 3MGPA 5CP6A 4LD9A 5AV9A 4YM6B 3X1SC 1S32C 3REIA 4Z66A 1KX3D 5B1LB 3MVDD 1BH9B 3AZJC 1P3BD 2PYOA 2RIQA 5G49A 3UTAB 1P34D 5B0YC 3WAAC 4WU8B 4J8UD 4JJNA 3AFAC 5CPKD 1M18C 4R8PA 4XUJB 1P3PD 3O62B 3UT9D 5GSUD 3AZLC 1P3KB 3AZJA 3AZFD 3B6GB 5AV5C 4XZQA 3WKJD 3AV1C 2F8NK 3AZKA 3AFAA 5B33C 3AYWB 1F1EA 1P3FD 2FJ7A 3A1IA 3UTBC 5B1LC 3C1CB 1KX5D 4KHAB 4YS3B 3KWQD 3UTAC 3AV1A 1N1JB 4M6BA 3LZ0B 1P3IC 4KGCD 5CPIC 1ID3B 3MNNB 4YM6A 1ZLAD 3X1TD 1T3UA 3W99B 5B1LA 5AV8B 1BH9A 4ZBJB 3B6GC 3AZEB 4E45A 2AROB 3MGQD 2F8NB 5B2IB 3UTAA 5B31D 4WU8A 3REJD 4H9PB 2HUEC 3AYWC 4XUJA 4DRAA 3C1CC 3O62A 1KX4B 5KDMB 3MGSD 2LY8A 1P3KA 3V9RB 5BS7C 3B6GA 3A1KA 1WWIA 5B40C 3LZ0C 5AVCD 1TZYD 4H9NB 1AOIC 3AYWA 1F66C 3AZGC 3TU4B 1Q9CA 3C1CA 3AZMD 4ZBJC 3LJAB 3AZEC 4KHAA 3B0BA 2J8PA 3EPJA 4YS3A 3REHD 3AZID 3MGRC 5JRGC 2HIOB 3AN2C 1N1JA 4AWLB 5GT3C 3AV2D 5B24D 3LZ0A 1P3LC 3A6NC 1ID3A 3MNNA 3KXBA 3W99A 4G92B 5AV8A 3AZEA 2F8NH 2AROA 4J8XC 4X23B 2F8NA 5B2IA 3VH6T 5CPJD 2XD5A 4H9PA 1P3OC 2NQBD 5E5AC 1P3AB 3LELD 3TU4C 5DNMB 1KX4A 5KDMA 5B32B 4WU9B 3W98C 3V9RA 2Y2KA 3B6FD 1EQZD 3C1BB 5AV6C 3KUYC 2IO5B 3RELB 1M19C 4H9NA 2YFVB 3TU4A 1P3GB 4G92C 1M1AB 2Y2NA 2BYKB 3LJAA 3AZHB 3W97D 2G5HC 2FFFB 4X23C 4ZUXB 4Z5TB 5C3IC 2HIOA 3VH5W 4Z2MG 3EG5B 4QLCD 1H3OB 1P3AC 4R8PD 3X1VC 1S32D 3X1SD 1HTAA 2ZY3A 3MGPC 2XD1A 5CP6C 5AV9C 2F8NG 4X23A 3AZJD 4LD9C 5BT1C 3REIC 4Z66C 3RELC 5B1MB 4EO5C 5B0YD 3R45B 2PYOC 3WAAD 3AFAD 3X1UA 5DNMA 1M18D 1M1AC 5B32A 2Y2QA 4JJNC 4WU9A 3AZHC 3AZLD 4ZUXC 4Z5TC 2ZY2A 3C1BA 3LZ1B 5AV5D 2CV5A 3RELA 5AVBB 2Y2HA 4J8WB 3AV1D 2YFVA 4XZQC 5B33D 5B2JB 1P3GA 2ZM5A 1M1AA 2BYKA 3AZKC 3AZHA 3UTBD 5B1LD 4ZUXA 4HGAC 2FJ7C 4Z5TA 5B1MC 3UTAD 2Y2MA 4E44A 3MVDB 1KX3B 4KUDB 1P3BB 1H3OA
chains in the Genus database with same CATH topology
1P3ID 5CPID 3AL0C 1A7WA 1P34B 4YM6C 1U35B 5CPKB 3B6GD 2JE5A 1P3PB 5AVBC 5B1MA 3UT9B 3R45A 3H0MC 5B32G 3AZFB 5B2JC 3AYWD 2YFWB 4WU8C 3WTPB 3C1CD 3FDDA 4XUJC 3O62C 3LZ1A 1P3FB 3KXBB 3B0CT 5AVBA 5F99B 1P3KC 4J8WA 1P3MB 3F6TA 5B40D 2Y2OA 4KUDC 3LZ0D 2VQRA 1KX5B 4J8VB 4CSRB 2BG1A 5B2JA 1AOID 1F66D 3AZGD 5DNNB 1U35C 4KGCB 3AZED 1ZLAB 3AZNB 3NQJB 3X1TB 3W96B 3MGRD 1KX3A 5JRGD 3AN2D 3MVDA 4UUZB 4KUDA 4YS3C 5GT3D 1P3BA 1P3LD 1HQ3B 3A6ND 3MGQB 3WTPC 1P34A 1ID3C 3MNNC 1U35A 2DF4C 2L5AA 5CPKA 3W99C 3KXBC 3VH5A 4J8XD 1P3PA 5AV8C 5F99C 1P3MC 3UT9A 2AROC 3REKB 4J8VC 3AZFA 2YFWA 5B2IC 1P3OD 5DNNC 5E5AD 3TU4D 3WKJA 3WTPA 5BO0B 1TZYB 3W98D 3P5JB 3W96C 3AZNC 1P3FA 1KX4C 2Y2IA 5AV6D 1P3MA 5F99A 3KUYD 3AZMB 1HQ3C 1M19D 1KX5A 4J8VA 4CSRA 3REHB 5DNNA 3AZIB 3WA9B 3AV2B 5B24B 4KGCA 3X1UB 5CHLB 3W96A 4X23D 3NQJA 1W2EA 3AZNA 4NFTA 3X1TA 1ZLAA 3LJAC 4UUZA 3REKC 1HQ3A 2HIOC 1P3AD 3MGQA 4AWLC 2CV5B 3X1VD 2ZY4A 3REJA 3B0DB 3MGPD 4H9SC 5CP6D 5AV9D 4LD9D 3LELB 5BT1D 3NQUB 3REID 5BNXB 4Z66D 1JFIB 3RELD 3REKA 3B6FB 2PYOD 5B0ZB 3WA9C 1M1AD 5BO0A 5B24C 5GT0B 1TZYA 3WTPE 4JJND 5GXQB 2Y2GA 3AZHD 5AY8B 3X1UC 5DNMC 4ZUXD 4H9SA 1BH8B 5B32C 4H9OB 4Z5TD 4WU9C 2RVQC 3AZMA 3EPHA 3W97B 3C1BC 3REHA 2CV5C 2IO5C 3AZIA 4XZQD 3WA9A 3AV2A 5B24A 3B0DC 3AZKD 4QLCB 1P3GC 2FJ7D 1S32B 3X1SB 5B1MD 3VH6A 2NZDB 5B0ZC 5GT0C 1BFMA 5GXQC 5CPJA 5AY8C 5B0YB 3WAAB 4YM6D 3LELA 3NQUA 1M18B 5BNXA 1JFIA 3W97C 3B6FA 3AZLB 5B0ZA 5B2JD 4H9QA 4WV4B 5AV5B 5GT0A 4WU8D 4NE3A 5BNVB 5GXQA 5AY8A 3H0RC 1BH8A 4XUJD 4H9OA 4CAYB 5B33B 2BYMB 3O62D 4J8UB 3W97A 3UTBB 1P3KD 2NZDC 4KUDD 3LZ1C 1WWSA 4J8WC 5GSUB 1TAFB 4QLCA 4WJ3C 1U35D 1P3IB 5CPIB 4NE6A 3WKJB 1S32A 3X1SA 2NZDA 4YS3D 3VH5T 1KX3C 3MVDC 1P3BC 3WTPD 3VH6W 5B0YA 3WAAA 1ID3D 3MNND 3KWQB 2HUEB 1M18A 1P34C 3W99D 3KXBD 4J8UC 5AV8D 5F99D 1P3MD 5CPKC 3AZLA 2AROD 1P3PC 4J8VD 2F8ND 5AV5A 5B2ID 3UT9C 5GSUC 5DNND 5BNVA 5B40B 3AZFC 4CAYA 1AOIB 5B33A 3WKJC 1F66B 3W96D 2BYMA 3AZND 3AZGB 1KX4D 4J8UA 5B31B 3H0LC 3REJB 3UTBA 1P3FC 1HQ3D 2F2AC 1B67A 5GSUA 3MGRB 4G91B 5JRGB 3MGSB 3AN2B 1KX5C 1TAFA 5GT3B 3KWQC 1P3LB 1P3IA 5CPIA 3A6NB 5AVCB 3LJAD 4KGCC 3REKD 1ZLAC 3X1TC 4DRBA 2HIOD 4J8XB 1B6WA 3KWQA 4NE5A 3MGQC 1P3OB 5E5AB 5B31C 3REJC 1Z2CB 3W98B 5BS7A 5AV6B 4G91C 3MGSC 4H9RB 3KUYB 5B40A 3EPLA 3WA9D 4Z2MH 2DQNC 1M19B 1AOIA 3X1UD 1F66A 5DNMD 3AZGA 5B32D 5AVCC 1TZYC 4WNNB 5B31A 4WU9D 5CPJB 2RVQD 2NQBB 3C1BD 2CV5D 3AZMC 1KU5A 5C3IB 5JRGA 3MGSA 3MGRA 3AN2A 5FUGB 5GT3A 3REHC 1P3LA 1EQZB 3AZIC 3A6NA 2ZY5A 3IP4C 5JA4B 1P3GD 4H9QB 3AV2C 5AVCA 3X1VB 4WZSB 3MGPB 5CP6B 4LD9B 5AV9B 2UWXA 5B0ZD 4J8XA 3REIB 4Z66B 3EPKA 3KFUG 5GT0D 2JSSA 5GXQD 5AY8D 4EO5B 1P3OA 2PYOB 5E5AA 1PZRA 3KSYA 5CPJC 5G49B 4UPKA 2NQBC 4JJNB 3W98A 3LELC 4R8PB 2CWEA 5AV6A 4H9RA 1R4VA 3B0CW 3KUYA 3B6FC 1M19A 1EQZC 3AZJB 1ULYA 5B31G 2Y2LA 4WNNA 4XZQB 2G5IC 2JCHA 3AZKB 4DQYB 2NQBA 2NZDD 3AFAB 3LZ1D 2Y2JA 4HGAB 2FJ7B 5AVBD 2W8SA 4J8WD 5FUGA 1EQZA 5JA4A 1P3AA 2Y2PA 3X1VA 3AV1B 4QLCC 4R8PC 3MGPA 5CP6A 4LD9A 5AV9A 4YM6B 3X1SC 1S32C 3REIA 4Z66A 1KX3D 5B1LB 3MVDD 1BH9B 3AZJC 1P3BD 2PYOA 2RIQA 5G49A 3UTAB 1P34D 5B0YC 3WAAC 4WU8B 4J8UD 4JJNA 3AFAC 5CPKD 1M18C 4R8PA 4XUJB 1P3PD 3O62B 3UT9D 5GSUD 3AZLC 1P3KB 3AZJA 3AZFD 3B6GB 5AV5C 4XZQA 3WKJD 3AV1C 2F8NK 3AZKA 3AFAA 5B33C 3AYWB 1F1EA 1P3FD 2FJ7A 3A1IA 3UTBC 5B1LC 3C1CB 1KX5D 4KHAB 4YS3B 3KWQD 3UTAC 3AV1A 1N1JB 4M6BA 3LZ0B 1P3IC 4KGCD 5CPIC 1ID3B 3MNNB 4YM6A 1ZLAD 3X1TD 1T3UA 3W99B 5B1LA 5AV8B 1BH9A 4ZBJB 3B6GC 3AZEB 4E45A 2AROB 3MGQD 2F8NB 5B2IB 3UTAA 5B31D 4WU8A 3REJD 4H9PB 2HUEC 3AYWC 4XUJA 4DRAA 3C1CC 3O62A 1KX4B 5KDMB 3MGSD 2LY8A 1P3KA 3V9RB 5BS7C 3B6GA 3A1KA 1WWIA 5B40C 3LZ0C 5AVCD 1TZYD 4H9NB 1AOIC 3AYWA 1F66C 3AZGC 3TU4B 1Q9CA 3C1CA 3AZMD 4ZBJC 3LJAB 3AZEC 4KHAA 3B0BA 2J8PA 3EPJA 4YS3A 3REHD 3AZID 3MGRC 5JRGC 2HIOB 3AN2C 1N1JA 4AWLB 5GT3C 3AV2D 5B24D 3LZ0A 1P3LC 3A6NC 1ID3A 3MNNA 3KXBA 3W99A 4G92B 5AV8A 3AZEA 2F8NH 2AROA 4J8XC 4X23B 2F8NA 5B2IA 3VH6T 5CPJD 2XD5A 4H9PA 1P3OC 2NQBD 5E5AC 1P3AB 3LELD 3TU4C 5DNMB 1KX4A 5KDMA 5B32B 4WU9B 3W98C 3V9RA 2Y2KA 3B6FD 1EQZD 3C1BB 5AV6C 3KUYC 2IO5B 3RELB 1M19C 4H9NA 2YFVB 3TU4A 1P3GB 4G92C 1M1AB 2Y2NA 2BYKB 3LJAA 3AZHB 3W97D 2G5HC 2FFFB 4X23C 4ZUXB 4Z5TB 5C3IC 2HIOA 3VH5W 4Z2MG 3EG5B 4QLCD 1H3OB 1P3AC 4R8PD 3X1VC 1S32D 3X1SD 1HTAA 2ZY3A 3MGPC 2XD1A 5CP6C 5AV9C 2F8NG 4X23A 3AZJD 4LD9C 5BT1C 3REIC 4Z66C 3RELC 5B1MB 4EO5C 5B0YD 3R45B 2PYOC 3WAAD 3AFAD 3X1UA 5DNMA 1M18D 1M1AC 5B32A 2Y2QA 4JJNC 4WU9A 3AZHC 3AZLD 4ZUXC 4Z5TC 2ZY2A 3C1BA 3LZ1B 5AV5D 2CV5A 3RELA 5AVBB 2Y2HA 4J8WB 3AV1D 2YFVA 4XZQC 5B33D 5B2JB 1P3GA 2ZM5A 1M1AA 2BYKA 3AZKC 3AZHA 3UTBD 5B1LD 4ZUXA 4HGAC 2FJ7C 4Z5TA 5B1MC 3UTAD 2Y2MA 4E44A 3MVDB 1KX3B 4KUDB 1P3BB 1H3OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1P3I D;  5CPI D;  1A7W A;  1P34 B;  4YM6 C;  1U35 B;  5CPK B;  3B6G D;  1P3P B;  5AVB C;  5B1M A;  3UT9 B;  3R45 A;  5B32 G;  3AZF B;  5B2J C;  3AYW D;  2YFW B;  4WU8 C;  3WTP B;  3C1C D;  4XUJ C;  3O62 C;  3LZ1 A;  1P3F B;  3KXB B;  3B0C T;  5AVB A;  5F99 B;  1P3K C;  4J8W A;  1P3M B;  5B40 D;  4KUD C;  3LZ0 D;  1KX5 B;  4J8V B;  4CSR B;  1AOI D;  5B2J A;  1F66 D;  3AZG D;  5DNN B;  1U35 C;  4KGC B;  3AZE D;  1ZLA B;  3AZN B;  3NQJ B;  3X1T B;  3W96 B;  3MGR D;  1KX3 A;  5JRG D;  3AN2 D;  3MVD A;  4UUZ B;  4KUD A;  4YS3 C;  5GT3 D;  1P3B A;  1P3L D;  1HQ3 B;  3A6N D;  3MGQ B;  3WTP C;  1P34 A;  1ID3 C;  3MNN C;  1U35 A;  2L5A A;  5CPK A;  3W99 C;  3KXB C;  3VH5 A;  4J8X D;  1P3P A;  5AV8 C;  5F99 C;  1P3M C;  3UT9 A;  2ARO C;  3REK B;  4J8V C;  3AZF A;  2YFW A;  5B2I C;  1P3O D;  5DNN C;  5E5A D;  3TU4 D;  3WKJ A;  3WTP A;  5BO0 B;  1TZY B;  3W98 D;  3W96 C;  3AZN C;  1P3F A;  1KX4 C;  5AV6 D;  1P3M A;  5F99 A;  3KUY D;  3AZM B;  1HQ3 C;  1M19 D;  1KX5 A;  4J8V A;  4CSR A;  3REH B;  5DNN A;  3AZI B;  3WA9 B;  3AV2 B;  5B24 B;  4KGC A;  3X1U B;  5CHL B;  3W96 A;  4X23 D;  3NQJ A;  3AZN A;  3X1T A;  4NFT A;  1ZLA A;  3LJA C;  4UUZ A;  3REK C;  1HQ3 A;  2HIO C;  1P3A D;  3MGQ A;  4AWL C;  2CV5 B;  3X1V D;  3REJ A;  3B0D B;  3MGP D;  4H9S C;  5CP6 D;  5AV9 D;  4LD9 D;  3LEL B;  5BT1 D;  3NQU B;  3REI D;  5BNX B;  4Z66 D;  1JFI B;  3REL D;  3REK A;  3B6F B;  2PYO D;  5B0Z B;  3WA9 C;  1M1A D;  5BO0 A;  5B24 C;  5GT0 B;  3WTP E;  1TZY A;  4JJN D;  5GXQ B;  3AZH D;  5AY8 B;  3X1U C;  5DNM C;  4ZUX D;  4H9S A;  1BH8 B;  5B32 C;  4H9O B;  4Z5T D;  4WU9 C;  2RVQ C;  3AZM A;  3W97 B;  3C1B C;  3REH A;  2CV5 C;  2IO5 C;  3AZI A;  4XZQ D;  3WA9 A;  3AV2 A;  5B24 A;  3B0D C;  3AZK D;  4QLC B;  1P3G C;  2FJ7 D;  1S32 B;  3X1S B;  5B1M D;  3VH6 A;  2NZD B;  5B0Z C;  5GT0 C;  1BFM A;  5GXQ C;  5CPJ A;  5AY8 C;  5B0Y B;  3WAA B;  4YM6 D;  3LEL A;  3NQU A;  1M18 B;  5BNX A;  1JFI A;  3W97 C;  3B6F A;  3AZL B;  5B0Z A;  5B2J D;  4H9Q A;  4WV4 B;  5AV5 B;  5GT0 A;  4WU8 D;  4NE3 A;  5BNV B;  5GXQ A;  5AY8 A;  1BH8 A;  4XUJ D;  4H9O A;  4CAY B;  5B33 B;  2BYM B;  3O62 D;  4J8U B;  3W97 A;  3UTB B;  1P3K D;  2NZD C;  4KUD D;  3LZ1 C;  1WWS A;  4J8W C;  5GSU B;  1TAF B;  4QLC A;  1U35 D;  1P3I B;  5CPI B;  4NE6 A;  3WKJ B;  1S32 A;  3X1S A;  2NZD A;  4YS3 D;  3VH5 T;  1KX3 C;  3MVD C;  1P3B C;  3WTP D;  3VH6 W;  5B0Y A;  3WAA A;  1ID3 D;  3MNN D;  3KWQ B;  2HUE B;  1M18 A;  1P34 C;  3W99 D;  3KXB D;  4J8U C;  5AV8 D;  5F99 D;  1P3M D;  5CPK C;  3AZL A;  2ARO D;  1P3P C;  4J8V D;  2F8N D;  5AV5 A;  5B2I D;  3UT9 C;  5GSU C;  5DNN D;  5BNV A;  5B40 B;  3AZF C;  4CAY A;  1AOI B;  5B33 A;  3WKJ C;  1F66 B;  3W96 D;  2BYM A;  3AZN D;  3AZG B;  1KX4 D;  4J8U A;  5B31 B;  3REJ B;  3UTB A;  1P3F C;  1HQ3 D;  1B67 A;  5GSU A;  3MGR B;  4G91 B;  5JRG B;  3MGS B;  3AN2 B;  1KX5 C;  1TAF A;  5GT3 B;  3KWQ C;  1P3L B;  1P3I A;  5CPI A;  3A6N B;  5AVC B;  3LJA D;  4KGC C;  3REK D;  1ZLA C;  3X1T C;  4DRB A;  2HIO D;  4J8X B;  1B6W A;  3KWQ A;  4NE5 A;  3MGQ C;  1P3O B;  5E5A B;  5B31 C;  3REJ C;  3W98 B;  5BS7 A;  5AV6 B;  4G91 C;  3MGS C;  4H9R B;  3KUY B;  5B40 A;  3WA9 D;  4Z2M H;  1M19 B;  1AOI A;  3X1U D;  1F66 A;  5DNM D;  3AZG A;  5B32 D;  5AVC C;  1TZY C;  4WNN B;  5B31 A;  4WU9 D;  5CPJ B;  2RVQ D;  2NQB B;  3C1B D;  2CV5 D;  3AZM C;  1KU5 A;  5C3I B;  5JRG A;  3MGS A;  3MGR A;  3AN2 A;  5FUG B;  5GT3 A;  3REH C;  1P3L A;  1EQZ B;  3AZI C;  3A6N A;  5JA4 B;  1P3G D;  4H9Q B;  3AV2 C;  5AVC A;  3X1V B;  4WZS B;  3MGP B;  5CP6 B;  4LD9 B;  5AV9 B;  5B0Z D;  4J8X A;  3REI B;  4Z66 B;  5GT0 D;  2JSS A;  5GXQ D;  5AY8 D;  4EO5 B;  1P3O A;  2PYO B;  5E5A A;  3KSY A;  5CPJ C;  5G49 B;  2NQB C;  4JJN B;  3W98 A;  3LEL C;  4R8P B;  2CWE A;  5AV6 A;  4H9R A;  1R4V A;  3B0C W;  3KUY A;  3B6F C;  1M19 A;  1EQZ C;  3AZJ B;  1ULY A;  5B31 G;  4WNN A;  4XZQ B;  3AZK B;  2NQB A;  2NZD D;  3AFA B;  3LZ1 D;  2FJ7 B;  4HGA B;  5AVB D;  4J8W D;  5FUG A;  1EQZ A;  5JA4 A;  1P3A A;  3X1V A;  3AV1 B;  4QLC C;  4R8P C;  3MGP A;  5CP6 A;  4LD9 A;  5AV9 A;  4YM6 B;  3X1S C;  1S32 C;  3REI A;  4Z66 A;  1KX3 D;  5B1L B;  3MVD D;  1BH9 B;  3AZJ C;  1P3B D;  2PYO A;  5G49 A;  3UTA B;  1P34 D;  5B0Y C;  3WAA C;  4WU8 B;  4J8U D;  4JJN A;  3AFA C;  5CPK D;  1M18 C;  4R8P A;  4XUJ B;  1P3P D;  3O62 B;  3UT9 D;  5GSU D;  3AZL C;  1P3K B;  3AZJ A;  3AZF D;  3B6G B;  5AV5 C;  4XZQ A;  3WKJ D;  3AV1 C;  2F8N K;  3AZK A;  3AFA A;  5B33 C;  3AYW B;  1F1E A;  1P3F D;  2FJ7 A;  3UTB C;  5B1L C;  3C1C B;  1KX5 D;  4KHA B;  4YS3 B;  3KWQ D;  3UTA C;  3AV1 A;  1N1J B;  4M6B A;  3LZ0 B;  1P3I C;  4KGC D;  5CPI C;  1ID3 B;  3MNN B;  4YM6 A;  1ZLA D;  3X1T D;  3W99 B;  5B1L A;  5AV8 B;  1BH9 A;  4ZBJ B;  3B6G C;  3AZE B;  4E45 A;  2ARO B;  3MGQ D;  2F8N B;  5B2I B;  3UTA A;  5B31 D;  4WU8 A;  3REJ D;  4H9P B;  2HUE C;  3AYW C;  4XUJ A;  4DRA A;  3C1C C;  3O62 A;  1KX4 B;  5KDM B;  3MGS D;  2LY8 A;  1P3K A;  3V9R B;  5BS7 C;  3B6G A;  1WWI A;  5B40 C;  3LZ0 C;  5AVC D;  1TZY D;  4H9N B;  1AOI C;  3AYW A;  1F66 C;  3AZG C;  3TU4 B;  1Q9C A;  3C1C A;  3AZM D;  4ZBJ C;  3LJA B;  3AZE C;  4KHA A;  3B0B A;  4YS3 A;  3REH D;  3AZI D;  3MGR C;  5JRG C;  2HIO B;  3AN2 C;  1N1J A;  4AWL B;  5GT3 C;  3AV2 D;  5B24 D;  3LZ0 A;  1P3L C;  3A6N C;  1ID3 A;  3MNN A;  3KXB A;  3W99 A;  4G92 B;  5AV8 A;  3AZE A;  2F8N H;  2ARO A;  4J8X C;  4X23 B;  2F8N A;  5B2I A;  3VH6 T;  5CPJ D;  4H9P A;  1P3O C;  2NQB D;  5E5A C;  1P3A B;  3LEL D;  3TU4 C;  5DNM B;  1KX4 A;  5KDM A;  5B32 B;  4WU9 B;  3W98 C;  3V9R A;  3B6F D;  1EQZ D;  3C1B B;  5AV6 C;  3KUY C;  2IO5 B;  3REL B;  1M19 C;  4H9N A;  2YFV B;  3TU4 A;  1P3G B;  4G92 C;  1M1A B;  2BYK B;  3LJA A;  3AZH B;  3W97 D;  4X23 C;  4ZUX B;  4Z5T B;  5C3I C;  2HIO A;  3VH5 W;  4Z2M G;  4QLC D;  1H3O B;  1P3A C;  4R8P D;  3X1V C;  1S32 D;  3X1S D;  1HTA A;  3MGP C;  2F8N G;  5CP6 C;  4LD9 C;  5AV9 C;  4X23 A;  3AZJ D;  5BT1 C;  3REI C;  4Z66 C;  3REL C;  5B1M B;  4EO5 C;  5B0Y D;  3R45 B;  2PYO C;  3WAA D;  3AFA D;  3X1U A;  5DNM A;  1M18 D;  1M1A C;  5B32 A;  4JJN C;  4WU9 A;  3AZH C;  3AZL D;  4ZUX C;  4Z5T C;  3C1B A;  3LZ1 B;  5AV5 D;  2CV5 A;  3REL A;  5AVB B;  4J8W B;  3AV1 D;  2YFV A;  4XZQ C;  5B33 D;  5B2J B;  1P3G A;  1M1A A;  2BYK A;  3AZK C;  3AZH A;  3UTB D;  5B1L D;  4ZUX A;  4HGA C;  2FJ7 C;  4Z5T A;  5B1M C;  3UTA D;  1KX3 B;  4E44 A;  3MVD B;  4KUD B;  1P3B B;  1H3O A; 
#chains in the Genus database with same CATH topology
 1P3I D;  5CPI D;  3AL0 C;  1A7W A;  1P34 B;  4YM6 C;  1U35 B;  5CPK B;  3B6G D;  2JE5 A;  1P3P B;  5AVB C;  5B1M A;  3UT9 B;  3R45 A;  3H0M C;  5B32 G;  3AZF B;  5B2J C;  3AYW D;  2YFW B;  4WU8 C;  3WTP B;  3C1C D;  3FDD A;  4XUJ C;  3O62 C;  3LZ1 A;  1P3F B;  3KXB B;  3B0C T;  5AVB A;  5F99 B;  1P3K C;  4J8W A;  1P3M B;  3F6T A;  5B40 D;  2Y2O A;  4KUD C;  3LZ0 D;  2VQR A;  1KX5 B;  4J8V B;  4CSR B;  2BG1 A;  5B2J A;  1AOI D;  1F66 D;  3AZG D;  5DNN B;  1U35 C;  4KGC B;  3AZE D;  1ZLA B;  3AZN B;  3NQJ B;  3X1T B;  3W96 B;  3MGR D;  1KX3 A;  5JRG D;  3AN2 D;  3MVD A;  4UUZ B;  4KUD A;  4YS3 C;  5GT3 D;  1P3B A;  1P3L D;  1HQ3 B;  3A6N D;  3MGQ B;  3WTP C;  1P34 A;  1ID3 C;  3MNN C;  1U35 A;  2DF4 C;  2L5A A;  5CPK A;  3W99 C;  3KXB C;  3VH5 A;  4J8X D;  1P3P A;  5AV8 C;  5F99 C;  1P3M C;  3UT9 A;  2ARO C;  3REK B;  4J8V C;  3AZF A;  2YFW A;  5B2I C;  1P3O D;  5DNN C;  5E5A D;  3TU4 D;  3WKJ A;  3WTP A;  5BO0 B;  1TZY B;  3W98 D;  3P5J B;  3W96 C;  3AZN C;  1P3F A;  1KX4 C;  2Y2I A;  5AV6 D;  1P3M A;  5F99 A;  3KUY D;  3AZM B;  1HQ3 C;  1M19 D;  1KX5 A;  4J8V A;  4CSR A;  3REH B;  5DNN A;  3AZI B;  3WA9 B;  3AV2 B;  5B24 B;  4KGC A;  3X1U B;  5CHL B;  3W96 A;  4X23 D;  3NQJ A;  1W2E A;  3AZN A;  4NFT A;  3X1T A;  1ZLA A;  3LJA C;  4UUZ A;  3REK C;  1HQ3 A;  2HIO C;  1P3A D;  3MGQ A;  4AWL C;  2CV5 B;  3X1V D;  2ZY4 A;  3REJ A;  3B0D B;  3MGP D;  4H9S C;  5CP6 D;  5AV9 D;  4LD9 D;  3LEL B;  5BT1 D;  3NQU B;  3REI D;  5BNX B;  4Z66 D;  1JFI B;  3REL D;  3REK A;  3B6F B;  2PYO D;  5B0Z B;  3WA9 C;  1M1A D;  5BO0 A;  5B24 C;  5GT0 B;  1TZY A;  3WTP E;  4JJN D;  5GXQ B;  2Y2G A;  3AZH D;  5AY8 B;  3X1U C;  5DNM C;  4ZUX D;  4H9S A;  1BH8 B;  5B32 C;  4H9O B;  4Z5T D;  4WU9 C;  2RVQ C;  3AZM A;  3EPH A;  3W97 B;  3C1B C;  3REH A;  2CV5 C;  2IO5 C;  3AZI A;  4XZQ D;  3WA9 A;  3AV2 A;  5B24 A;  3B0D C;  3AZK D;  4QLC B;  1P3G C;  2FJ7 D;  1S32 B;  3X1S B;  5B1M D;  3VH6 A;  2NZD B;  5B0Z C;  5GT0 C;  1BFM A;  5GXQ C;  5CPJ A;  5AY8 C;  5B0Y B;  3WAA B;  4YM6 D;  3LEL A;  3NQU A;  1M18 B;  5BNX A;  1JFI A;  3W97 C;  3B6F A;  3AZL B;  5B0Z A;  5B2J D;  4H9Q A;  4WV4 B;  5AV5 B;  5GT0 A;  4WU8 D;  4NE3 A;  5BNV B;  5GXQ A;  5AY8 A;  3H0R C;  1BH8 A;  4XUJ D;  4H9O A;  4CAY B;  5B33 B;  2BYM B;  3O62 D;  4J8U B;  3W97 A;  3UTB B;  1P3K D;  2NZD C;  4KUD D;  3LZ1 C;  1WWS A;  4J8W C;  5GSU B;  1TAF B;  4QLC A;  4WJ3 C;  1U35 D;  1P3I B;  5CPI B;  4NE6 A;  3WKJ B;  1S32 A;  3X1S A;  2NZD A;  4YS3 D;  3VH5 T;  1KX3 C;  3MVD C;  1P3B C;  3WTP D;  3VH6 W;  5B0Y A;  3WAA A;  1ID3 D;  3MNN D;  3KWQ B;  2HUE B;  1M18 A;  1P34 C;  3W99 D;  3KXB D;  4J8U C;  5AV8 D;  5F99 D;  1P3M D;  5CPK C;  3AZL A;  2ARO D;  1P3P C;  4J8V D;  2F8N D;  5AV5 A;  5B2I D;  3UT9 C;  5GSU C;  5DNN D;  5BNV A;  5B40 B;  3AZF C;  4CAY A;  1AOI B;  5B33 A;  3WKJ C;  1F66 B;  3W96 D;  2BYM A;  3AZN D;  3AZG B;  1KX4 D;  4J8U A;  5B31 B;  3H0L C;  3REJ B;  3UTB A;  1P3F C;  1HQ3 D;  2F2A C;  1B67 A;  5GSU A;  3MGR B;  4G91 B;  5JRG B;  3MGS B;  3AN2 B;  1KX5 C;  1TAF A;  5GT3 B;  3KWQ C;  1P3L B;  1P3I A;  5CPI A;  3A6N B;  5AVC B;  3LJA D;  4KGC C;  3REK D;  1ZLA C;  3X1T C;  4DRB A;  2HIO D;  4J8X B;  1B6W A;  3KWQ A;  4NE5 A;  3MGQ C;  1P3O B;  5E5A B;  5B31 C;  3REJ C;  1Z2C B;  3W98 B;  5BS7 A;  5AV6 B;  4G91 C;  3MGS C;  4H9R B;  3KUY B;  5B40 A;  3EPL A;  3WA9 D;  4Z2M H;  2DQN C;  1M19 B;  1AOI A;  3X1U D;  1F66 A;  5DNM D;  3AZG A;  5B32 D;  5AVC C;  1TZY C;  4WNN B;  5B31 A;  4WU9 D;  5CPJ B;  2RVQ D;  2NQB B;  3C1B D;  2CV5 D;  3AZM C;  1KU5 A;  5C3I B;  5JRG A;  3MGS A;  3MGR A;  3AN2 A;  5FUG B;  5GT3 A;  3REH C;  1P3L A;  1EQZ B;  3AZI C;  3A6N A;  2ZY5 A;  3IP4 C;  5JA4 B;  1P3G D;  4H9Q B;  3AV2 C;  5AVC A;  3X1V B;  4WZS B;  3MGP B;  5CP6 B;  4LD9 B;  5AV9 B;  2UWX A;  5B0Z D;  4J8X A;  3REI B;  4Z66 B;  3EPK A;  3KFU G;  5GT0 D;  2JSS A;  5GXQ D;  5AY8 D;  4EO5 B;  1P3O A;  2PYO B;  5E5A A;  1PZR A;  3KSY A;  5CPJ C;  5G49 B;  4UPK A;  2NQB C;  4JJN B;  3W98 A;  3LEL C;  4R8P B;  2CWE A;  5AV6 A;  4H9R A;  1R4V A;  3B0C W;  3KUY A;  3B6F C;  1M19 A;  1EQZ C;  3AZJ B;  1ULY A;  5B31 G;  2Y2L A;  4WNN A;  4XZQ B;  2G5I C;  2JCH A;  3AZK B;  4DQY B;  2NQB A;  2NZD D;  3AFA B;  3LZ1 D;  2Y2J A;  4HGA B;  2FJ7 B;  5AVB D;  2W8S A;  4J8W D;  5FUG A;  1EQZ A;  5JA4 A;  1P3A A;  2Y2P A;  3X1V A;  3AV1 B;  4QLC C;  4R8P C;  3MGP A;  5CP6 A;  4LD9 A;  5AV9 A;  4YM6 B;  3X1S C;  1S32 C;  3REI A;  4Z66 A;  1KX3 D;  5B1L B;  3MVD D;  1BH9 B;  3AZJ C;  1P3B D;  2PYO A;  2RIQ A;  5G49 A;  3UTA B;  1P34 D;  5B0Y C;  3WAA C;  4WU8 B;  4J8U D;  4JJN A;  3AFA C;  5CPK D;  1M18 C;  4R8P A;  4XUJ B;  1P3P D;  3O62 B;  3UT9 D;  5GSU D;  3AZL C;  1P3K B;  3AZJ A;  3AZF D;  3B6G B;  5AV5 C;  4XZQ A;  3WKJ D;  3AV1 C;  2F8N K;  3AZK A;  3AFA A;  5B33 C;  3AYW B;  1F1E A;  1P3F D;  2FJ7 A;  3A1I A;  3UTB C;  5B1L C;  3C1C B;  1KX5 D;  4KHA B;  4YS3 B;  3KWQ D;  3UTA C;  3AV1 A;  1N1J B;  4M6B A;  3LZ0 B;  1P3I C;  4KGC D;  5CPI C;  1ID3 B;  3MNN B;  4YM6 A;  1ZLA D;  3X1T D;  1T3U A;  3W99 B;  5B1L A;  5AV8 B;  1BH9 A;  4ZBJ B;  3B6G C;  3AZE B;  4E45 A;  2ARO B;  3MGQ D;  2F8N B;  5B2I B;  3UTA A;  5B31 D;  4WU8 A;  3REJ D;  4H9P B;  2HUE C;  3AYW C;  4XUJ A;  4DRA A;  3C1C C;  3O62 A;  1KX4 B;  5KDM B;  3MGS D;  2LY8 A;  1P3K A;  3V9R B;  5BS7 C;  3B6G A;  3A1K A;  1WWI A;  5B40 C;  3LZ0 C;  5AVC D;  1TZY D;  4H9N B;  1AOI C;  3AYW A;  1F66 C;  3AZG C;  3TU4 B;  1Q9C A;  3C1C A;  3AZM D;  4ZBJ C;  3LJA B;  3AZE C;  4KHA A;  3B0B A;  2J8P A;  3EPJ A;  4YS3 A;  3REH D;  3AZI D;  3MGR C;  5JRG C;  2HIO B;  3AN2 C;  1N1J A;  4AWL B;  5GT3 C;  3AV2 D;  5B24 D;  3LZ0 A;  1P3L C;  3A6N C;  1ID3 A;  3MNN A;  3KXB A;  3W99 A;  4G92 B;  5AV8 A;  3AZE A;  2F8N H;  2ARO A;  4J8X C;  4X23 B;  2F8N A;  5B2I A;  3VH6 T;  5CPJ D;  2XD5 A;  4H9P A;  1P3O C;  2NQB D;  5E5A C;  1P3A B;  3LEL D;  3TU4 C;  5DNM B;  1KX4 A;  5KDM A;  5B32 B;  4WU9 B;  3W98 C;  3V9R A;  2Y2K A;  3B6F D;  1EQZ D;  3C1B B;  5AV6 C;  3KUY C;  2IO5 B;  3REL B;  1M19 C;  4H9N A;  2YFV B;  3TU4 A;  1P3G B;  4G92 C;  1M1A B;  2Y2N A;  2BYK B;  3LJA A;  3AZH B;  3W97 D;  2G5H C;  2FFF B;  4X23 C;  4ZUX B;  4Z5T B;  5C3I C;  2HIO A;  3VH5 W;  4Z2M G;  3EG5 B;  4QLC D;  1H3O B;  1P3A C;  4R8P D;  3X1V C;  1S32 D;  3X1S D;  1HTA A;  2ZY3 A;  3MGP C;  2XD1 A;  5CP6 C;  5AV9 C;  2F8N G;  4X23 A;  3AZJ D;  4LD9 C;  5BT1 C;  3REI C;  4Z66 C;  3REL C;  5B1M B;  4EO5 C;  5B0Y D;  3R45 B;  2PYO C;  3WAA D;  3AFA D;  3X1U A;  5DNM A;  1M18 D;  1M1A C;  5B32 A;  2Y2Q A;  4JJN C;  4WU9 A;  3AZH C;  3AZL D;  4ZUX C;  4Z5T C;  2ZY2 A;  3C1B A;  3LZ1 B;  5AV5 D;  2CV5 A;  3REL A;  5AVB B;  2Y2H A;  4J8W B;  3AV1 D;  2YFV A;  4XZQ C;  5B33 D;  5B2J B;  1P3G A;  2ZM5 A;  1M1A A;  2BYK A;  3AZK C;  3AZH A;  3UTB D;  5B1L D;  4ZUX A;  4HGA C;  2FJ7 C;  4Z5T A;  5B1M C;  3UTA D;  2Y2M A;  4E44 A;  3MVD B;  1KX3 B;  4KUD B;  1P3B B;  1H3O A; 
#chains in the Genus database with same CATH homology
 1P3I D;  5CPI D;  3AL0 C;  1A7W A;  1P34 B;  4YM6 C;  1U35 B;  5CPK B;  3B6G D;  2JE5 A;  1P3P B;  5AVB C;  5B1M A;  3UT9 B;  3R45 A;  3H0M C;  5B32 G;  3AZF B;  5B2J C;  3AYW D;  2YFW B;  4WU8 C;  3WTP B;  3C1C D;  3FDD A;  4XUJ C;  3O62 C;  3LZ1 A;  1P3F B;  3KXB B;  3B0C T;  5AVB A;  5F99 B;  1P3K C;  4J8W A;  1P3M B;  3F6T A;  5B40 D;  2Y2O A;  4KUD C;  3LZ0 D;  2VQR A;  1KX5 B;  4J8V B;  4CSR B;  2BG1 A;  5B2J A;  1AOI D;  1F66 D;  3AZG D;  5DNN B;  1U35 C;  4KGC B;  3AZE D;  1ZLA B;  3AZN B;  3NQJ B;  3X1T B;  3W96 B;  3MGR D;  1KX3 A;  5JRG D;  3AN2 D;  3MVD A;  4UUZ B;  4KUD A;  4YS3 C;  5GT3 D;  1P3B A;  1P3L D;  1HQ3 B;  3A6N D;  3MGQ B;  3WTP C;  1P34 A;  1ID3 C;  3MNN C;  1U35 A;  2DF4 C;  2L5A A;  5CPK A;  3W99 C;  3KXB C;  3VH5 A;  4J8X D;  1P3P A;  5AV8 C;  5F99 C;  1P3M C;  3UT9 A;  2ARO C;  3REK B;  4J8V C;  3AZF A;  2YFW A;  5B2I C;  1P3O D;  5DNN C;  5E5A D;  3TU4 D;  3WKJ A;  3WTP A;  5BO0 B;  1TZY B;  3W98 D;  3P5J B;  3W96 C;  3AZN C;  1P3F A;  1KX4 C;  2Y2I A;  5AV6 D;  1P3M A;  5F99 A;  3KUY D;  3AZM B;  1HQ3 C;  1M19 D;  1KX5 A;  4J8V A;  4CSR A;  3REH B;  5DNN A;  3AZI B;  3WA9 B;  3AV2 B;  5B24 B;  4KGC A;  3X1U B;  5CHL B;  3W96 A;  4X23 D;  3NQJ A;  1W2E A;  3AZN A;  4NFT A;  3X1T A;  1ZLA A;  3LJA C;  4UUZ A;  3REK C;  1HQ3 A;  2HIO C;  1P3A D;  3MGQ A;  4AWL C;  2CV5 B;  3X1V D;  2ZY4 A;  3REJ A;  3B0D B;  3MGP D;  4H9S C;  5CP6 D;  5AV9 D;  4LD9 D;  3LEL B;  5BT1 D;  3NQU B;  3REI D;  5BNX B;  4Z66 D;  1JFI B;  3REL D;  3REK A;  3B6F B;  2PYO D;  5B0Z B;  3WA9 C;  1M1A D;  5BO0 A;  5B24 C;  5GT0 B;  1TZY A;  3WTP E;  4JJN D;  5GXQ B;  2Y2G A;  3AZH D;  5AY8 B;  3X1U C;  5DNM C;  4ZUX D;  4H9S A;  1BH8 B;  5B32 C;  4H9O B;  4Z5T D;  4WU9 C;  2RVQ C;  3AZM A;  3EPH A;  3W97 B;  3C1B C;  3REH A;  2CV5 C;  2IO5 C;  3AZI A;  4XZQ D;  3WA9 A;  3AV2 A;  5B24 A;  3B0D C;  3AZK D;  4QLC B;  1P3G C;  2FJ7 D;  1S32 B;  3X1S B;  5B1M D;  3VH6 A;  2NZD B;  5B0Z C;  5GT0 C;  1BFM A;  5GXQ C;  5CPJ A;  5AY8 C;  5B0Y B;  3WAA B;  4YM6 D;  3LEL A;  3NQU A;  1M18 B;  5BNX A;  1JFI A;  3W97 C;  3B6F A;  3AZL B;  5B0Z A;  5B2J D;  4H9Q A;  4WV4 B;  5AV5 B;  5GT0 A;  4WU8 D;  4NE3 A;  5BNV B;  5GXQ A;  5AY8 A;  3H0R C;  1BH8 A;  4XUJ D;  4H9O A;  4CAY B;  5B33 B;  2BYM B;  3O62 D;  4J8U B;  3W97 A;  3UTB B;  1P3K D;  2NZD C;  4KUD D;  3LZ1 C;  1WWS A;  4J8W C;  5GSU B;  1TAF B;  4QLC A;  4WJ3 C;  1U35 D;  1P3I B;  5CPI B;  4NE6 A;  3WKJ B;  1S32 A;  3X1S A;  2NZD A;  4YS3 D;  3VH5 T;  1KX3 C;  3MVD C;  1P3B C;  3WTP D;  3VH6 W;  5B0Y A;  3WAA A;  1ID3 D;  3MNN D;  3KWQ B;  2HUE B;  1M18 A;  1P34 C;  3W99 D;  3KXB D;  4J8U C;  5AV8 D;  5F99 D;  1P3M D;  5CPK C;  3AZL A;  2ARO D;  1P3P C;  4J8V D;  2F8N D;  5AV5 A;  5B2I D;  3UT9 C;  5GSU C;  5DNN D;  5BNV A;  5B40 B;  3AZF C;  4CAY A;  1AOI B;  5B33 A;  3WKJ C;  1F66 B;  3W96 D;  2BYM A;  3AZN D;  3AZG B;  1KX4 D;  4J8U A;  5B31 B;  3H0L C;  3REJ B;  3UTB A;  1P3F C;  1HQ3 D;  2F2A C;  1B67 A;  5GSU A;  3MGR B;  4G91 B;  5JRG B;  3MGS B;  3AN2 B;  1KX5 C;  1TAF A;  5GT3 B;  3KWQ C;  1P3L B;  1P3I A;  5CPI A;  3A6N B;  5AVC B;  3LJA D;  4KGC C;  3REK D;  1ZLA C;  3X1T C;  4DRB A;  2HIO D;  4J8X B;  1B6W A;  3KWQ A;  4NE5 A;  3MGQ C;  1P3O B;  5E5A B;  5B31 C;  3REJ C;  1Z2C B;  3W98 B;  5BS7 A;  5AV6 B;  4G91 C;  3MGS C;  4H9R B;  3KUY B;  5B40 A;  3EPL A;  3WA9 D;  4Z2M H;  2DQN C;  1M19 B;  1AOI A;  3X1U D;  1F66 A;  5DNM D;  3AZG A;  5B32 D;  5AVC C;  1TZY C;  4WNN B;  5B31 A;  4WU9 D;  5CPJ B;  2RVQ D;  2NQB B;  3C1B D;  2CV5 D;  3AZM C;  1KU5 A;  5C3I B;  5JRG A;  3MGS A;  3MGR A;  3AN2 A;  5FUG B;  5GT3 A;  3REH C;  1P3L A;  1EQZ B;  3AZI C;  3A6N A;  2ZY5 A;  3IP4 C;  5JA4 B;  1P3G D;  4H9Q B;  3AV2 C;  5AVC A;  3X1V B;  4WZS B;  3MGP B;  5CP6 B;  4LD9 B;  5AV9 B;  2UWX A;  5B0Z D;  4J8X A;  3REI B;  4Z66 B;  3EPK A;  3KFU G;  5GT0 D;  2JSS A;  5GXQ D;  5AY8 D;  4EO5 B;  1P3O A;  2PYO B;  5E5A A;  1PZR A;  3KSY A;  5CPJ C;  5G49 B;  4UPK A;  2NQB C;  4JJN B;  3W98 A;  3LEL C;  4R8P B;  2CWE A;  5AV6 A;  4H9R A;  1R4V A;  3B0C W;  3KUY A;  3B6F C;  1M19 A;  1EQZ C;  3AZJ B;  1ULY A;  5B31 G;  2Y2L A;  4WNN A;  4XZQ B;  2G5I C;  2JCH A;  3AZK B;  4DQY B;  2NQB A;  2NZD D;  3AFA B;  3LZ1 D;  2Y2J A;  4HGA B;  2FJ7 B;  5AVB D;  2W8S A;  4J8W D;  5FUG A;  1EQZ A;  5JA4 A;  1P3A A;  2Y2P A;  3X1V A;  3AV1 B;  4QLC C;  4R8P C;  3MGP A;  5CP6 A;  4LD9 A;  5AV9 A;  4YM6 B;  3X1S C;  1S32 C;  3REI A;  4Z66 A;  1KX3 D;  5B1L B;  3MVD D;  1BH9 B;  3AZJ C;  1P3B D;  2PYO A;  2RIQ A;  5G49 A;  3UTA B;  1P34 D;  5B0Y C;  3WAA C;  4WU8 B;  4J8U D;  4JJN A;  3AFA C;  5CPK D;  1M18 C;  4R8P A;  4XUJ B;  1P3P D;  3O62 B;  3UT9 D;  5GSU D;  3AZL C;  1P3K B;  3AZJ A;  3AZF D;  3B6G B;  5AV5 C;  4XZQ A;  3WKJ D;  3AV1 C;  2F8N K;  3AZK A;  3AFA A;  5B33 C;  3AYW B;  1F1E A;  1P3F D;  2FJ7 A;  3A1I A;  3UTB C;  5B1L C;  3C1C B;  1KX5 D;  4KHA B;  4YS3 B;  3KWQ D;  3UTA C;  3AV1 A;  1N1J B;  4M6B A;  3LZ0 B;  1P3I C;  4KGC D;  5CPI C;  1ID3 B;  3MNN B;  4YM6 A;  1ZLA D;  3X1T D;  1T3U A;  3W99 B;  5B1L A;  5AV8 B;  1BH9 A;  4ZBJ B;  3B6G C;  3AZE B;  4E45 A;  2ARO B;  3MGQ D;  2F8N B;  5B2I B;  3UTA A;  5B31 D;  4WU8 A;  3REJ D;  4H9P B;  2HUE C;  3AYW C;  4XUJ A;  4DRA A;  3C1C C;  3O62 A;  1KX4 B;  5KDM B;  3MGS D;  2LY8 A;  1P3K A;  3V9R B;  5BS7 C;  3B6G A;  3A1K A;  1WWI A;  5B40 C;  3LZ0 C;  5AVC D;  1TZY D;  4H9N B;  1AOI C;  3AYW A;  1F66 C;  3AZG C;  3TU4 B;  1Q9C A;  3C1C A;  3AZM D;  4ZBJ C;  3LJA B;  3AZE C;  4KHA A;  3B0B A;  2J8P A;  3EPJ A;  4YS3 A;  3REH D;  3AZI D;  3MGR C;  5JRG C;  2HIO B;  3AN2 C;  1N1J A;  4AWL B;  5GT3 C;  3AV2 D;  5B24 D;  3LZ0 A;  1P3L C;  3A6N C;  1ID3 A;  3MNN A;  3KXB A;  3W99 A;  4G92 B;  5AV8 A;  3AZE A;  2F8N H;  2ARO A;  4J8X C;  4X23 B;  2F8N A;  5B2I A;  3VH6 T;  5CPJ D;  2XD5 A;  4H9P A;  1P3O C;  2NQB D;  5E5A C;  1P3A B;  3LEL D;  3TU4 C;  5DNM B;  1KX4 A;  5KDM A;  5B32 B;  4WU9 B;  3W98 C;  3V9R A;  2Y2K A;  3B6F D;  1EQZ D;  3C1B B;  5AV6 C;  3KUY C;  2IO5 B;  3REL B;  1M19 C;  4H9N A;  2YFV B;  3TU4 A;  1P3G B;  4G92 C;  1M1A B;  2Y2N A;  2BYK B;  3LJA A;  3AZH B;  3W97 D;  2G5H C;  2FFF B;  4X23 C;  4ZUX B;  4Z5T B;  5C3I C;  2HIO A;  3VH5 W;  4Z2M G;  3EG5 B;  4QLC D;  1H3O B;  1P3A C;  4R8P D;  3X1V C;  1S32 D;  3X1S D;  1HTA A;  2ZY3 A;  3MGP C;  2XD1 A;  5CP6 C;  5AV9 C;  2F8N G;  4X23 A;  3AZJ D;  4LD9 C;  5BT1 C;  3REI C;  4Z66 C;  3REL C;  5B1M B;  4EO5 C;  5B0Y D;  3R45 B;  2PYO C;  3WAA D;  3AFA D;  3X1U A;  5DNM A;  1M18 D;  1M1A C;  5B32 A;  2Y2Q A;  4JJN C;  4WU9 A;  3AZH C;  3AZL D;  4ZUX C;  4Z5T C;  2ZY2 A;  3C1B A;  3LZ1 B;  5AV5 D;  2CV5 A;  3REL A;  5AVB B;  2Y2H A;  4J8W B;  3AV1 D;  2YFV A;  4XZQ C;  5B33 D;  5B2J B;  1P3G A;  2ZM5 A;  1M1A A;  2BYK A;  3AZK C;  3AZH A;  3UTB D;  5B1L D;  4ZUX A;  4HGA C;  2FJ7 C;  4Z5T A;  5B1M C;  3UTA D;  2Y2M A;  4E44 A;  3MVD B;  1KX3 B;  4KUD B;  1P3B B;  1H3O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...