4G91B

Ccaat-binding complex from aspergillus nidulans
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
91
structure length
91
Chain Sequence
b'KEQDRWLPIANVARIMKLALPENAKIAKEAKECMQECVSEFISFITSEASEKCQQEKRKTVNGEDILFAMTSLGFENYAEALKIYLSKYRE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HAPB protein
publication title DNA Minor Groove Sensing and Widening by the CCAAT-Binding Complex.
pubmed doi rcsb
source organism Emericella nidulans
molecule tags Transcription
total genus 35
structure length 91
sequence length 91
ec nomenclature
pdb deposition date 2012-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00808 CBFD_NFYB_HMF Histone-like transcription factor (CBF/NF-Y) and archaeal histone
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4g91B00
4H9RB 3X1VB 5BO0B 3MGRA 5KDMB 5B1MA 3X1UD 5DNNB 3RELC 5B24A 1P3KA 5AVBB 3V9RA 3TU4B 3MGPD 3A6NB 4G92B 3AV2A 3AZNB 2IO5C 4XZQC 3UTBC 3AZGA 2CV5D 5AY8A 4J8VD 3VH5T 1TZYB 1P3BA 5AV6D 1AOIC 4WNNB 5GXQC 3KUYB 3B0CW 4ZUXA 2F8NA 5JRGD 3W97B 3KXBD 4JJNC 2NQBD 3AN2C 1HTAA 1WWSA 4QLCA 3AZHD 4AWLB 5BNXA 1M18C 1P3LC 1M1AD 2F8NH 3VH6W 3REJC 5B32B 5BS7C 5CPIA 1P3PB 4J8UB 5B33A 1P3IC 3O62A 3WTPC 3B0DC 1P3AC 1F66D 4NE3A 5CPJA 5GT3D 1ZLAA 3C1CB 3MNND 1EQZA 4LD9A 1S32A 4R8PA 3REKC 2PYOD 5AV5C 5GSUD 1KX5B 1P3OA 3X1TD 5B40B 3MVDA 3AZMC 3W99A 2YFWB 4KUDA 3X1UB 3REHA 5E5AA 3MGPB 1KX4C 4KGCA 5JA4B 5GT0D 4J8VB 3W96A 3X1VC 2BYMB 5B0ZD 4WU9A 3WA9A 5F99D 3REIA 4ZBJB 5DNNC 5JRGB 1H3OA 4CAYA 3MGRD 5CPKC 2NQBB 3AZLA 5B1MD 1N1JB 3A6NC 5B31B 3AZNC 3R45A 5B24D 1P3KD 1M1AB 1TZYC 1U35B 3B0CT 3AV2D 4CSRA 3AZGD 5AY8D 1P3FA 3B0BA 3X1SB 4J8WC 4ZUXD 3AZJB 5B2IC 4H9NA 2F8ND 2LY8A 5CP6C 3MNNB 4AWLC 4E45A 5AV6A 3LZ0C 2PYOB 4H9OB 4M6BA 4YS3A 5AVCB 5GSUB 4WU8D 1P3PC 3X1TB 4J8UC 2HUEB 5CPID 5B33D 3AFAB 3O62D 3C1CC 4H9PB 4E44A 1ZLAD 1EQZD 4LD9D 2BYKA 5GT0B 1KX5C 1S32D 5B40C 5B0ZB 3AZKA 5F99B 3X1UC 1P3OD 2HIOD 3C1BC 3LZ1A 3MVDD 4G91C 4HGAC 3W99D 3MGRB 4KUDD 5B1MB 4WV4B 3MGPC 4H9QA 3REHD 5E5AD 5B24B 5FUGA 4H9SC 3V9RB 3AV2B 4Z66C 4KGCD 3AZGB 1P3GA 5AY8B 1P3BB 4ZBJC 3W96D 5DNMC 4WU9D 1M19A 3WA9D 4ZUXB 2NQBC 4X23C 3MGSA 2F8NB 1HQ3C 5B31C 2FJ7A 5G49A 3AZED 3RELA 1U35C 3AZLD 5BT1D 3LELC 4QLCB 5BNXB 4KHAA 3X1SC 4XZQA 3AZJC 5CPIB 1AOIA 1P3FD 5GXQA 3B6FA 3AV1C 4WZSB 5B33B 3O62B 3MNNC 5BNVA 4XUJB 4EO5C 3NQUA 5CPJB 1P34C 3B6GC 4JJNA 1ZLAB 3AN2A 1EQZB 5AVCC 5GSUC 3X1TC 4R8PB 1M18A 4YS3D 3REJA 1P3OB 5BS7A 3AFAC 3AZIB 3W99B 3LJAD 4KUDB 3UTAA 3REHB 5E5AB 5B1LA 1P3AA 4WU8A 1P3MC 5AV8A 1WWIA 4KGCB 1BH8A 5B0ZC 5F99C 3REKA 5AV5A 4NE6A 3W96B 3AZKD 4WU9B 3MGRC 3AYWA 3WA9B 5B1MC 4YM6C 3REIB 3LZ1D 1H3OB 1ID3B 4CAYB 3AZLB 4J8XD 3VH5A 3R45B 5AY8C 2HIOA 1P3BC 3UT9C 1JFIA 4CSRB 1P3GD 5B0YC 1P3FB 1TAFB 4NE5A 5KDMA 1M19D 5C3IB 4H9NB 5B2JC 3MGSD 2FJ7D 5CPKA 2CV5B 4QLCC 5AV6B 3RELD 1BFMA 1TZYA 4DRBA 1B6WA 5CPIC 4YS3B 4XZQD 3UTBD 2F8NK 4Z2MG 1KX3A 3KXBB 5AVBC 4J8WA 3TU4C 3AZEA 1F1EA 4XUJC 5GXQD 4G92C 1AOID 5CPJC 2CWEA 3B6FD 3AZHB 1ZLAC 5B2IA 1EQZC 4R8PC 3KWQA 3KUYC 1ULYA 5CP6A 3LZ0A 2RVQC 4JJND 3AN2D 2BYKB 3W97C 3AZIC 3W99C 1M18D 1F66B 5B31G 5GT3B 3REJD 3LZ1B 3REHC 5E5AC 3UTAD 3C1CA 4H9QB 5B32C 3WTPD 4KGCC 1P3AD 5B1LD 5FUGB 5AV8D 2JSSA 3W96C 3LJAA 3WA9C 1P3GB 3REKD 3REIC 5AV5D 1ID3C 3C1BA 3AYWD 3AZLC 3MGSB 2FJ7B 5G49B 1BH9A 3RELB 4H9SA 1P3FC 4KHAB 4Z66A 2BYMA 1KX4D 3WAAA 4XZQB 4Z2MH 5AV9A 2YFVA 3WKJA 3W98A 4J8XA 3B6FB 5GXQB 2NZDA 3VH6A 3X1VD 5DNMA 2CV5C 4X23A 4J8VC 5BNVB 3MGQA 1P3KB 1HQ3A 5B31A 5AV6C 3NQUB 4JJNB 2AROA 5CPKD 3AN2B 3AZFA 5JRGC 3LELA 4Z5TA 1M18B 3KXBC 1TZYD 3REJB 3AZHC 3AZJA 1KX3D 3AV1A 4J8WD 1M1AC 3UTAB 3B0DB 5B1LB 5B2ID 4WU8B 1P3AB 1P34A 3B6GA 3UTBA 5AV8B 3KWQD 5CP6D 5AVCA 1BH8B 3LZ0D 1F66C 3REKB 5GT3C 5AV5B 1P3PD 3AYWB 4J8UD 2PYOC 1A7WA 4LD9B 1S32B 3NQJA 3C1CD 1P3MA 1P3LA 2HUEC 4DRAA 2HIOB 3MVDB 1JFIB 1P3IA 3MGSC 2FJ7C 3WTPA 5GT0C 4YM6A 3C1BD 5CPKB 4UUZA 3AZMA 3UT9A 3B6FC 4Z66D 1Q9CA 3WAAD 5AV9D 5B24C 3W98D 1KX3B 5B0YA 3WKJD 1P3KC 4J8WB 3AZEB 3AV2C 2NZDD 5B32G 5DNMD 3AZGC 5B2IB 4X23D 5B2JA 3MGQD 1HQ3D 5B31D 1KX4A 3KWQB 5CP6B 3LZ0B 2AROD 4ZUXC 1U35D 4H9RA 3X1VA 5BO0A 3AZFD 3LELD 4Z5TD 5DNNA 3X1SD 3UTAC 5AVBA 3TU4A 3AZJD 5B1LC 4XUJA 3A6NA 4WU8C 3AV1D 3AZNA 5AV8C 4WNNA 3KUYA 1P34D 3B6GD 5B33C 3O62C 5AVCD 3LJAB 3AYWC 3W97A 3AZIA 4LD9C 3C1BB 1S32C 4G91B 3AFAD 4HGAB 3KSYA 1BH9B 2HIOC 1P3OC 5B32A 3MVDC 3AZKB 1P3LD 1P3MD 4J8UA 1P3PA 4KUDC 4Z66B 3WAAB 5AV9B 3WKJB 2YFVB 3W98B 4J8XB 1P3ID 5CHLB 1ID3A 2NZDB 5DNMB 4X23B 4YM6D 3MGQB 1HQ3B 1KX5A 4WU9C 2AROB 5B40A 2YFWA 3LELB 3AZFB 4Z5TB 3X1UA 1KX3C 1M19B 1P3BD 3AZEC 3AZMD 1TAFA 3UT9D 5BT1C 3MGPA 5B0YD 3AV1B 2CV5A 5JA4A 3KWQC 4J8VA 3VH6T 4EO5B 5B2JD 1P34B 3B6GB 2IO5B 3UTBB 4QLCD 5JRGA 5C3IC 1AOIB 3VH5W 3KXBA 2NQBA 1N1JA 5DNND 3AZHA 1M1AA 5AVBD 3TU4D 1U35A 4YS3C 4XUJD 3A6ND 5CPJD 3AZND 3NQJB 1KU5A 3LJAC 1P3LB 3X1SA 1P3MB 4R8PD 2L5AA 3KUYD 2RVQD 4NFTA 1F66A 1B67A 5GT3A 3W97D 1P3IB 3MNNA 3AZID 3WTPB 2PYOA 4H9OA 4YM6B 5GSUA 3AZKC 3X1TA 2F8NG 4UUZB 3LZ1C 5B32D 3WAAC 5AV9C 3WKJC 3W98C 3WTPE 3AZMB 3UT9B 4J8XC 3AFAA 2NZDC 4H9PA 5B0YB 3REID 3MGQC 1ID3D 5GT0A 1R4VA 2AROC 1P3GC 5B2JB 1KX4B 5B0ZA 3AZFC 4Z5TC 5F99A 1KX5D 1M19C 5B40D
chains in the Genus database with same CATH superfamily
4H9RB 3X1VB 5BO0B 3MGRA 5KDMB 5B1MA 3X1UD 5DNNB 3H0RC 3RELC 5B24A 1P3KA 5AVBB 3V9RA 3TU4B 3MGPD 3A6NB 4G92B 3AV2A 3AZNB 2IO5C 4XZQC 3UTBC 3AZGA 2CV5D 5AY8A 4J8VD 3VH5T 1TZYB 1P3BA 5AV6D 1AOIC 4WNNB 5GXQC 3KUYB 3B0CW 4ZUXA 2F8NA 5JRGD 3W97B 3KXBD 4JJNC 2NQBD 3AN2C 2Y2OA 1HTAA 1WWSA 4QLCA 3AZHD 4AWLB 5BNXA 1M18C 1P3LC 1M1AD 3KFUG 2F8NH 3VH6W 3REJC 5B32B 5BS7C 5CPIA 1P3PB 4J8UB 5B33A 1P3IC 3O62A 2BG1A 3WTPC 3B0DC 1P3AC 1F66D 4NE3A 2Y2JA 5CPJA 5GT3D 1ZLAA 3C1CB 3MNND 1EQZA 4LD9A 1S32A 4R8PA 3REKC 2PYOD 5AV5C 5GSUD 1KX5B 1P3OA 3X1TD 5B40B 3MVDA 3AZMC 3W99A 2YFWB 3FDDA 4KUDA 2XD1A 3X1UB 3REHA 5E5AA 2ZY5A 1Z2CB 3MGPB 1KX4C 4KGCA 5JA4B 5GT0D 4J8VB 3W96A 3X1VC 2BYMB 5B0ZD 4WU9A 3WA9A 5F99D 3REIA 4ZBJB 5DNNC 5JRGB 1H3OA 4CAYA 3MGRD 5CPKC 2NQBB 3AZLA 5B1MD 1N1JB 3A6NC 5B31B 3AZNC 3R45A 5B24D 3EG5B 1P3KD 1M1AB 1TZYC 1U35B 1T3UA 3B0CT 2UWXA 3AV2D 4CSRA 3AZGD 5AY8D 1P3FA 3B0BA 3X1SB 4J8WC 4ZUXD 3AZJB 5B2IC 4H9NA 2F8ND 2LY8A 5CP6C 3MNNB 4AWLC 4E45A 5AV6A 3LZ0C 2PYOB 4H9OB 3H0MC 4M6BA 4YS3A 5AVCB 5GSUB 4WU8D 1P3PC 3X1TB 4J8UC 2Y2IA 2HUEB 5CPID 5B33D 3AFAB 3O62D 3C1CC 4H9PB 4E44A 1ZLAD 1EQZD 4LD9D 2BYKA 5GT0B 1KX5C 1S32D 5B40C 5B0ZB 3AZKA 5F99B 3X1UC 1P3OD 2HIOD 3C1BC 3LZ1A 3MVDD 4G91C 4HGAC 3W99D 3MGRB 4KUDD 5B1MB 4WV4B 3MGPC 4H9QA 3REHD 5E5AD 5B24B 5FUGA 4H9SC 3V9RB 3AV2B 4Z66C 4KGCD 3AZGB 1P3GA 5AY8B 1P3BB 4ZBJC 3W96D 5DNMC 4WU9D 1M19A 3WA9D 4ZUXB 2NQBC 4X23C 3MGSA 2F8NB 1HQ3C 5B31C 2FJ7A 5G49A 2ZY4A 3EPJA 3AZED 3RELA 1U35C 3AZLD 5BT1D 3LELC 4QLCB 5BNXB 4KHAA 3X1SC 4XZQA 3AZJC 5CPIB 1AOIA 1P3FD 5GXQA 3B6FA 3AV1C 4WZSB 5B33B 3O62B 3MNNC 5BNVA 4XUJB 4EO5C 3NQUA 5CPJB 2G5HC 1P34C 3B6GC 4JJNA 1ZLAB 3AN2A 1EQZB 5AVCC 5GSUC 3X1TC 4R8PB 1M18A 2Y2GA 4YS3D 3REJA 1P3OB 5BS7A 3AFAC 3AZIB 3W99B 3LJAD 4KUDB 3UTAA 3REHB 5E5AB 5B1LA 1P3AA 4WU8A 1P3MC 5AV8A 1WWIA 3EPLA 4KGCB 1BH8A 5B0ZC 5F99C 3REKA 5AV5A 4NE6A 3W96B 3AZKD 4WU9B 3MGRC 3AYWA 3WA9B 5B1MC 4YM6C 3REIB 2JE5A 3LZ1D 1H3OB 1ID3B 4CAYB 3AZLB 4J8XD 3VH5A 3R45B 5AY8C 2HIOA 1P3BC 3UT9C 1JFIA 4CSRB 1P3GD 5B0YC 1P3FB 1TAFB 4NE5A 5KDMA 1M19D 5C3IB 4H9NB 5B2JC 3MGSD 2FJ7D 5CPKA 2CV5B 4QLCC 2Y2PA 5AV6B 3RELD 3EPKA 1BFMA 1TZYA 4DRBA 1B6WA 5CPIC 4YS3B 4XZQD 3UTBD 2F8NK 4Z2MG 1KX3A 3KXBB 5AVBC 4J8WA 3TU4C 3AZEA 1F1EA 4XUJC 5GXQD 4G92C 1AOID 5CPJC 2CWEA 3B6FD 3AZHB 1ZLAC 5B2IA 1EQZC 4R8PC 3KWQA 3KUYC 5CP6A 1ULYA 3F6TA 2RVQC 3LZ0A 4JJND 3AN2D 2BYKB 3W97C 3AZIC 3W99C 1M18D 1F66B 5B31G 5GT3B 3REJD 3LZ1B 3REHC 5E5AC 3UTAD 3C1CA 4H9QB 5B32C 3WTPD 4KGCC 2FFFB 5B1LD 1P3AD 5FUGB 5AV8D 2JSSA 3W96C 3LJAA 3WA9C 1P3GB 2DF4C 3REKD 3REIC 5AV5D 1ID3C 2RIQA 3C1BA 3AYWD 3AZLC 3MGSB 2FJ7B 5G49B 1BH9A 3RELB 3H0LC 4H9SA 1P3FC 4KHAB 4Z66A 2BYMA 1KX4D 3WAAA 4XZQB 4Z2MH 5AV9A 2YFVA 3WKJA 3W98A 4J8XA 3B6FB 5GXQB 2NZDA 3VH6A 3X1VD 5DNMA 2CV5C 4X23A 4J8VC 5BNVB 3MGQA 1P3KB 1HQ3A 5B31A 5AV6C 3NQUB 4JJNB 2AROA 5CPKD 2JCHA 3AN2B 3AZFA 5JRGC 3LELA 4Z5TA 2Y2HA 1M18B 3KXBC 1TZYD 3REJB 3AZHC 3AZJA 1KX3D 3AV1A 4J8WD 1M1AC 3UTAB 2Y2NA 3B0DB 5B1LB 5B2ID 4WU8B 2W8SA 1P3AB 1P34A 3B6GA 3UTBA 5AV8B 3KWQD 5CP6D 5AVCA 1BH8B 3LZ0D 1F66C 3REKB 5GT3C 5AV5B 2XD5A 1P3PD 3AYWB 4J8UD 2DQNC 2PYOC 1A7WA 4LD9B 1S32B 3NQJA 3C1CD 1P3MA 1P3LA 2HUEC 4DRAA 2HIOB 3MVDB 1JFIB 2ZY2A 1P3IA 3MGSC 2FJ7C 3WTPA 3IP4C 5GT0C 4YM6A 3C1BD 5CPKB 2G5IC 4UUZA 3AZMA 3UT9A 3B6FC 4Z66D 1Q9CA 3WAAD 5AV9D 5B24C 3W98D 1KX3B 5B0YA 3WKJD 1P3KC 4J8WB 3AZEB 3AV2C 2NZDD 5B32G 5DNMD 3AZGC 5B2IB 4X23D 5B2JA 3MGQD 1HQ3D 5B31D 1KX4A 3KWQB 5CP6B 3LZ0B 2AROD 4ZUXC 1U35D 4H9RA 3X1VA 5BO0A 3AZFD 3LELD 4Z5TD 5DNNA 3X1SD 3UTAC 5AVBA 3TU4A 3AZJD 5B1LC 4XUJA 3A6NA 4WU8C 3AV1D 3AZNA 5AV8C 4WNNA 2J8PA 3KUYA 1P34D 3B6GD 5B33C 3O62C 5AVCD 3LJAB 3AYWC 3W97A 3AZIA 4LD9C 3C1BB 1S32C 4G91B 3AFAD 4HGAB 3KSYA 2F2AC 1BH9B 2HIOC 1P3OC 3A1IA 5B32A 2Y2KA 3MVDC 3AZKB 1P3LD 1P3MD 4J8UA 1P3PA 4KUDC 3AL0C 4Z66B 3WAAB 5AV9B 3WKJB 2YFVB 3W98B 4J8XB 1P3ID 5CHLB 1ID3A 2NZDB 5DNMB 4X23B 4YM6D 3MGQB 1HQ3B 4WJ3C 3P5JB 1KX5A 4WU9C 2AROB 5B40A 2ZM5A 2YFWA 3LELB 3AZFB 4Z5TB 3X1UA 1KX3C 1M19B 1P3BD 3AZEC 3AZMD 1TAFA 3UT9D 5BT1C 3MGPA 5B0YD 2VQRA 3AV1B 3A1KA 2CV5A 5JA4A 3KWQC 4J8VA 3VH6T 4EO5B 5B2JD 1P34B 3B6GB 2IO5B 3UTBB 4QLCD 5JRGA 5C3IC 1AOIB 3VH5W 3KXBA 4UPKA 2NQBA 1N1JA 5DNND 2Y2LA 3AZHA 1M1AA 5AVBD 3TU4D 1U35A 4YS3C 4XUJD 3A6ND 5CPJD 3AZND 3NQJB 1KU5A 3EPHA 3LJAC 1P3LB 3X1SA 1P3MB 4R8PD 2L5AA 3KUYD 2RVQD 4NFTA 1F66A 1B67A 5GT3A 3W97D 1P3IB 3MNNA 3AZID 3WTPB 4DQYB 2PYOA 4H9OA 4YM6B 5GSUA 2Y2MA 3AZKC 3X1TA 2F8NG 4UUZB 3LZ1C 5B32D 3WAAC 1PZRA 5AV9C 3W98C 3WKJC 3WTPE 3AZMB 3UT9B 4J8XC 3AFAA 2NZDC 4H9PA 5B0YB 3REID 3MGQC 2Y2QA 1ID3D 5GT0A 1R4VA 2AROC 1P3GC 5B2JB 1KX4B 5B0ZA 3AZFC 1W2EA 4Z5TC 5F99A 1KX5D 1M19C 5B40D 2ZY3A
chains in the Genus database with same CATH topology
4H9RB 3X1VB 5BO0B 3MGRA 5KDMB 5B1MA 3X1UD 5DNNB 3H0RC 3RELC 5B24A 1P3KA 5AVBB 3V9RA 3TU4B 3MGPD 3A6NB 4G92B 3AV2A 3AZNB 2IO5C 4XZQC 3UTBC 3AZGA 2CV5D 5AY8A 4J8VD 3VH5T 1TZYB 1P3BA 5AV6D 1AOIC 4WNNB 5GXQC 3KUYB 3B0CW 4ZUXA 2F8NA 5JRGD 3W97B 3KXBD 4JJNC 2NQBD 3AN2C 2Y2OA 1HTAA 1WWSA 4QLCA 3AZHD 4AWLB 5BNXA 1M18C 1P3LC 1M1AD 3KFUG 2F8NH 3VH6W 3REJC 5B32B 5BS7C 5CPIA 1P3PB 4J8UB 5B33A 1P3IC 3O62A 2BG1A 3WTPC 3B0DC 1P3AC 1F66D 4NE3A 2Y2JA 5CPJA 5GT3D 1ZLAA 3C1CB 3MNND 1EQZA 4LD9A 1S32A 4R8PA 3REKC 2PYOD 5AV5C 5GSUD 1KX5B 1P3OA 3X1TD 5B40B 3MVDA 3AZMC 3W99A 2YFWB 3FDDA 4KUDA 2XD1A 3X1UB 3REHA 5E5AA 2ZY5A 1Z2CB 3MGPB 1KX4C 4KGCA 5JA4B 5GT0D 4J8VB 3W96A 3X1VC 2BYMB 5B0ZD 4WU9A 3WA9A 5F99D 3REIA 4ZBJB 5DNNC 5JRGB 1H3OA 4CAYA 3MGRD 5CPKC 2NQBB 3AZLA 5B1MD 1N1JB 3A6NC 5B31B 3AZNC 3R45A 5B24D 3EG5B 1P3KD 1M1AB 1TZYC 1U35B 1T3UA 3B0CT 2UWXA 3AV2D 4CSRA 3AZGD 5AY8D 1P3FA 3B0BA 3X1SB 4J8WC 4ZUXD 3AZJB 5B2IC 4H9NA 2F8ND 2LY8A 5CP6C 3MNNB 4AWLC 4E45A 5AV6A 3LZ0C 2PYOB 4H9OB 3H0MC 4M6BA 4YS3A 5AVCB 5GSUB 4WU8D 1P3PC 3X1TB 4J8UC 2Y2IA 2HUEB 5CPID 5B33D 3AFAB 3O62D 3C1CC 4H9PB 4E44A 1ZLAD 1EQZD 4LD9D 2BYKA 5GT0B 1KX5C 1S32D 5B40C 5B0ZB 3AZKA 5F99B 3X1UC 1P3OD 2HIOD 3C1BC 3LZ1A 3MVDD 4G91C 4HGAC 3W99D 3MGRB 4KUDD 5B1MB 4WV4B 3MGPC 4H9QA 3REHD 5E5AD 5B24B 5FUGA 4H9SC 3V9RB 3AV2B 4Z66C 4KGCD 3AZGB 1P3GA 5AY8B 1P3BB 4ZBJC 3W96D 5DNMC 4WU9D 1M19A 3WA9D 4ZUXB 2NQBC 4X23C 3MGSA 2F8NB 1HQ3C 5B31C 2FJ7A 5G49A 2ZY4A 3EPJA 3AZED 3RELA 1U35C 3AZLD 5BT1D 3LELC 4QLCB 5BNXB 4KHAA 3X1SC 4XZQA 3AZJC 5CPIB 1AOIA 1P3FD 5GXQA 3B6FA 3AV1C 4WZSB 5B33B 3O62B 3MNNC 5BNVA 4XUJB 4EO5C 3NQUA 5CPJB 2G5HC 1P34C 3B6GC 4JJNA 1ZLAB 3AN2A 1EQZB 5AVCC 5GSUC 3X1TC 4R8PB 1M18A 2Y2GA 4YS3D 3REJA 1P3OB 5BS7A 3AFAC 3AZIB 3W99B 3LJAD 4KUDB 3UTAA 3REHB 5E5AB 5B1LA 1P3AA 4WU8A 1P3MC 5AV8A 1WWIA 3EPLA 4KGCB 1BH8A 5B0ZC 5F99C 3REKA 5AV5A 4NE6A 3W96B 3AZKD 4WU9B 3MGRC 3AYWA 3WA9B 5B1MC 4YM6C 3REIB 2JE5A 3LZ1D 1H3OB 1ID3B 4CAYB 3AZLB 4J8XD 3VH5A 3R45B 5AY8C 2HIOA 1P3BC 3UT9C 1JFIA 4CSRB 1P3GD 5B0YC 1P3FB 1TAFB 4NE5A 5KDMA 1M19D 5C3IB 4H9NB 5B2JC 3MGSD 2FJ7D 5CPKA 2CV5B 4QLCC 2Y2PA 5AV6B 3RELD 3EPKA 1BFMA 1TZYA 4DRBA 1B6WA 5CPIC 4YS3B 4XZQD 3UTBD 2F8NK 4Z2MG 1KX3A 3KXBB 5AVBC 4J8WA 3TU4C 3AZEA 1F1EA 4XUJC 5GXQD 4G92C 1AOID 5CPJC 2CWEA 3B6FD 3AZHB 1ZLAC 5B2IA 1EQZC 4R8PC 3KWQA 3KUYC 5CP6A 1ULYA 3F6TA 2RVQC 3LZ0A 4JJND 3AN2D 2BYKB 3W97C 3AZIC 3W99C 1M18D 1F66B 5B31G 5GT3B 3REJD 3LZ1B 3REHC 5E5AC 3UTAD 3C1CA 4H9QB 5B32C 3WTPD 4KGCC 2FFFB 5B1LD 1P3AD 5FUGB 5AV8D 2JSSA 3W96C 3LJAA 3WA9C 1P3GB 2DF4C 3REKD 3REIC 5AV5D 1ID3C 2RIQA 3C1BA 3AYWD 3AZLC 3MGSB 2FJ7B 5G49B 1BH9A 3RELB 3H0LC 4H9SA 1P3FC 4KHAB 4Z66A 2BYMA 1KX4D 3WAAA 4XZQB 4Z2MH 5AV9A 2YFVA 3WKJA 3W98A 4J8XA 3B6FB 5GXQB 2NZDA 3VH6A 3X1VD 5DNMA 2CV5C 4X23A 4J8VC 5BNVB 3MGQA 1P3KB 1HQ3A 5B31A 5AV6C 3NQUB 4JJNB 2AROA 5CPKD 2JCHA 3AN2B 3AZFA 5JRGC 3LELA 4Z5TA 2Y2HA 1M18B 3KXBC 1TZYD 3REJB 3AZHC 3AZJA 1KX3D 3AV1A 4J8WD 1M1AC 3UTAB 2Y2NA 3B0DB 5B1LB 5B2ID 4WU8B 2W8SA 1P3AB 1P34A 3B6GA 3UTBA 5AV8B 3KWQD 5CP6D 5AVCA 1BH8B 3LZ0D 1F66C 3REKB 5GT3C 5AV5B 2XD5A 1P3PD 3AYWB 4J8UD 2DQNC 2PYOC 1A7WA 4LD9B 1S32B 3NQJA 3C1CD 1P3MA 1P3LA 2HUEC 4DRAA 2HIOB 3MVDB 1JFIB 2ZY2A 1P3IA 3MGSC 2FJ7C 3WTPA 3IP4C 5GT0C 4YM6A 3C1BD 5CPKB 2G5IC 4UUZA 3AZMA 3UT9A 3B6FC 4Z66D 1Q9CA 3WAAD 5AV9D 5B24C 3W98D 1KX3B 5B0YA 3WKJD 1P3KC 4J8WB 3AZEB 3AV2C 2NZDD 5B32G 5DNMD 3AZGC 5B2IB 4X23D 5B2JA 3MGQD 1HQ3D 5B31D 1KX4A 3KWQB 5CP6B 3LZ0B 2AROD 4ZUXC 1U35D 4H9RA 3X1VA 5BO0A 3AZFD 3LELD 4Z5TD 5DNNA 3X1SD 3UTAC 5AVBA 3TU4A 3AZJD 5B1LC 4XUJA 3A6NA 4WU8C 3AV1D 3AZNA 5AV8C 4WNNA 2J8PA 3KUYA 1P34D 3B6GD 5B33C 3O62C 5AVCD 3LJAB 3AYWC 3W97A 3AZIA 4LD9C 3C1BB 1S32C 4G91B 3AFAD 4HGAB 3KSYA 2F2AC 1BH9B 2HIOC 1P3OC 3A1IA 5B32A 2Y2KA 3MVDC 3AZKB 1P3LD 1P3MD 4J8UA 1P3PA 4KUDC 3AL0C 4Z66B 3WAAB 5AV9B 3WKJB 2YFVB 3W98B 4J8XB 1P3ID 5CHLB 1ID3A 2NZDB 5DNMB 4X23B 4YM6D 3MGQB 1HQ3B 4WJ3C 3P5JB 1KX5A 4WU9C 2AROB 5B40A 2ZM5A 2YFWA 3LELB 3AZFB 4Z5TB 3X1UA 1KX3C 1M19B 1P3BD 3AZEC 3AZMD 1TAFA 3UT9D 5BT1C 3MGPA 5B0YD 2VQRA 3AV1B 3A1KA 2CV5A 5JA4A 3KWQC 4J8VA 3VH6T 4EO5B 5B2JD 1P34B 3B6GB 2IO5B 3UTBB 4QLCD 5JRGA 5C3IC 1AOIB 3VH5W 3KXBA 4UPKA 2NQBA 1N1JA 5DNND 2Y2LA 3AZHA 1M1AA 5AVBD 3TU4D 1U35A 4YS3C 4XUJD 3A6ND 5CPJD 3AZND 3NQJB 1KU5A 3EPHA 3LJAC 1P3LB 3X1SA 1P3MB 4R8PD 2L5AA 3KUYD 2RVQD 4NFTA 1F66A 1B67A 5GT3A 3W97D 1P3IB 3MNNA 3AZID 3WTPB 4DQYB 2PYOA 4H9OA 4YM6B 5GSUA 2Y2MA 3AZKC 3X1TA 2F8NG 4UUZB 3LZ1C 5B32D 3WAAC 1PZRA 5AV9C 3W98C 3WKJC 3WTPE 3AZMB 3UT9B 4J8XC 3AFAA 2NZDC 4H9PA 5B0YB 3REID 3MGQC 2Y2QA 1ID3D 5GT0A 1R4VA 2AROC 1P3GC 5B2JB 1KX4B 5B0ZA 3AZFC 1W2EA 4Z5TC 5F99A 1KX5D 1M19C 5B40D 2ZY3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4H9R B;  3X1V B;  5BO0 B;  3MGR A;  5KDM B;  5B1M A;  3X1U D;  5DNN B;  3REL C;  5B24 A;  1P3K A;  5AVB B;  3V9R A;  3TU4 B;  3MGP D;  3A6N B;  4G92 B;  3AV2 A;  3AZN B;  2IO5 C;  4XZQ C;  3UTB C;  3AZG A;  2CV5 D;  5AY8 A;  4J8V D;  3VH5 T;  1TZY B;  1P3B A;  5AV6 D;  1AOI C;  4WNN B;  5GXQ C;  3KUY B;  3B0C W;  4ZUX A;  2F8N A;  5JRG D;  3W97 B;  3KXB D;  4JJN C;  2NQB D;  3AN2 C;  1HTA A;  1WWS A;  4QLC A;  3AZH D;  4AWL B;  5BNX A;  1M18 C;  1P3L C;  1M1A D;  2F8N H;  3VH6 W;  3REJ C;  5B32 B;  5BS7 C;  5CPI A;  1P3P B;  4J8U B;  5B33 A;  1P3I C;  3O62 A;  3WTP C;  3B0D C;  1P3A C;  1F66 D;  4NE3 A;  5CPJ A;  5GT3 D;  1ZLA A;  3C1C B;  3MNN D;  1EQZ A;  4LD9 A;  1S32 A;  4R8P A;  3REK C;  2PYO D;  5AV5 C;  5GSU D;  1KX5 B;  1P3O A;  3X1T D;  5B40 B;  3MVD A;  3AZM C;  3W99 A;  2YFW B;  4KUD A;  3X1U B;  3REH A;  5E5A A;  3MGP B;  1KX4 C;  4KGC A;  5JA4 B;  5GT0 D;  4J8V B;  3W96 A;  3X1V C;  2BYM B;  5B0Z D;  4WU9 A;  3WA9 A;  5F99 D;  3REI A;  4ZBJ B;  5DNN C;  5JRG B;  1H3O A;  4CAY A;  3MGR D;  5CPK C;  2NQB B;  3AZL A;  5B1M D;  1N1J B;  3A6N C;  5B31 B;  3AZN C;  3R45 A;  5B24 D;  1P3K D;  1M1A B;  1TZY C;  1U35 B;  3B0C T;  3AV2 D;  4CSR A;  3AZG D;  5AY8 D;  1P3F A;  3B0B A;  3X1S B;  4J8W C;  4ZUX D;  3AZJ B;  5B2I C;  4H9N A;  2F8N D;  2LY8 A;  5CP6 C;  3MNN B;  4AWL C;  4E45 A;  5AV6 A;  3LZ0 C;  2PYO B;  4H9O B;  4M6B A;  4YS3 A;  5AVC B;  5GSU B;  4WU8 D;  1P3P C;  3X1T B;  4J8U C;  2HUE B;  5CPI D;  5B33 D;  3AFA B;  3O62 D;  3C1C C;  4H9P B;  4E44 A;  1ZLA D;  1EQZ D;  4LD9 D;  2BYK A;  5GT0 B;  1KX5 C;  1S32 D;  5B40 C;  5B0Z B;  3AZK A;  5F99 B;  3X1U C;  1P3O D;  2HIO D;  3C1B C;  3LZ1 A;  3MVD D;  4G91 C;  4HGA C;  3W99 D;  3MGR B;  4KUD D;  5B1M B;  4WV4 B;  3MGP C;  4H9Q A;  3REH D;  5E5A D;  5B24 B;  5FUG A;  4H9S C;  3V9R B;  3AV2 B;  4Z66 C;  4KGC D;  3AZG B;  1P3G A;  5AY8 B;  1P3B B;  4ZBJ C;  3W96 D;  5DNM C;  4WU9 D;  1M19 A;  3WA9 D;  4ZUX B;  2NQB C;  4X23 C;  3MGS A;  2F8N B;  1HQ3 C;  5B31 C;  2FJ7 A;  5G49 A;  3AZE D;  3REL A;  1U35 C;  3AZL D;  5BT1 D;  3LEL C;  4QLC B;  5BNX B;  4KHA A;  3X1S C;  4XZQ A;  3AZJ C;  5CPI B;  1AOI A;  1P3F D;  5GXQ A;  3B6F A;  3AV1 C;  4WZS B;  5B33 B;  3O62 B;  3MNN C;  5BNV A;  4XUJ B;  4EO5 C;  3NQU A;  5CPJ B;  1P34 C;  3B6G C;  4JJN A;  1ZLA B;  3AN2 A;  1EQZ B;  5AVC C;  5GSU C;  3X1T C;  4R8P B;  1M18 A;  4YS3 D;  3REJ A;  1P3O B;  5BS7 A;  3AFA C;  3AZI B;  3W99 B;  3LJA D;  4KUD B;  3UTA A;  3REH B;  5E5A B;  5B1L A;  1P3A A;  4WU8 A;  1P3M C;  5AV8 A;  1WWI A;  4KGC B;  1BH8 A;  5B0Z C;  5F99 C;  3REK A;  5AV5 A;  4NE6 A;  3W96 B;  3AZK D;  4WU9 B;  3MGR C;  3AYW A;  3WA9 B;  5B1M C;  4YM6 C;  3REI B;  3LZ1 D;  1H3O B;  1ID3 B;  4CAY B;  3AZL B;  4J8X D;  3VH5 A;  3R45 B;  5AY8 C;  2HIO A;  1P3B C;  3UT9 C;  1JFI A;  4CSR B;  1P3G D;  5B0Y C;  1P3F B;  1TAF B;  4NE5 A;  5KDM A;  1M19 D;  5C3I B;  4H9N B;  5B2J C;  3MGS D;  2FJ7 D;  5CPK A;  2CV5 B;  4QLC C;  5AV6 B;  3REL D;  1BFM A;  1TZY A;  4DRB A;  1B6W A;  5CPI C;  4YS3 B;  4XZQ D;  3UTB D;  2F8N K;  4Z2M G;  1KX3 A;  3KXB B;  5AVB C;  4J8W A;  3TU4 C;  3AZE A;  1F1E A;  4XUJ C;  5GXQ D;  4G92 C;  1AOI D;  5CPJ C;  2CWE A;  3B6F D;  3AZH B;  1ZLA C;  5B2I A;  1EQZ C;  4R8P C;  3KWQ A;  3KUY C;  1ULY A;  5CP6 A;  3LZ0 A;  2RVQ C;  4JJN D;  3AN2 D;  2BYK B;  3W97 C;  3AZI C;  3W99 C;  1M18 D;  1F66 B;  5B31 G;  5GT3 B;  3REJ D;  3LZ1 B;  3REH C;  5E5A C;  3UTA D;  3C1C A;  4H9Q B;  5B32 C;  3WTP D;  4KGC C;  1P3A D;  5B1L D;  5FUG B;  5AV8 D;  2JSS A;  3W96 C;  3LJA A;  3WA9 C;  1P3G B;  3REK D;  3REI C;  5AV5 D;  1ID3 C;  3C1B A;  3AYW D;  3AZL C;  3MGS B;  2FJ7 B;  5G49 B;  1BH9 A;  3REL B;  4H9S A;  1P3F C;  4KHA B;  4Z66 A;  2BYM A;  1KX4 D;  3WAA A;  4XZQ B;  4Z2M H;  5AV9 A;  2YFV A;  3WKJ A;  3W98 A;  4J8X A;  3B6F B;  5GXQ B;  2NZD A;  3VH6 A;  3X1V D;  5DNM A;  2CV5 C;  4X23 A;  4J8V C;  5BNV B;  3MGQ A;  1P3K B;  1HQ3 A;  5B31 A;  5AV6 C;  3NQU B;  4JJN B;  2ARO A;  5CPK D;  3AN2 B;  3AZF A;  5JRG C;  3LEL A;  4Z5T A;  1M18 B;  3KXB C;  1TZY D;  3REJ B;  3AZH C;  3AZJ A;  1KX3 D;  3AV1 A;  4J8W D;  1M1A C;  3UTA B;  3B0D B;  5B1L B;  5B2I D;  4WU8 B;  1P3A B;  1P34 A;  3B6G A;  3UTB A;  5AV8 B;  3KWQ D;  5CP6 D;  5AVC A;  1BH8 B;  3LZ0 D;  1F66 C;  3REK B;  5GT3 C;  5AV5 B;  1P3P D;  3AYW B;  4J8U D;  2PYO C;  1A7W A;  4LD9 B;  1S32 B;  3NQJ A;  3C1C D;  1P3M A;  1P3L A;  2HUE C;  4DRA A;  2HIO B;  3MVD B;  1JFI B;  1P3I A;  3MGS C;  2FJ7 C;  3WTP A;  5GT0 C;  4YM6 A;  3C1B D;  5CPK B;  4UUZ A;  3AZM A;  3UT9 A;  3B6F C;  4Z66 D;  1Q9C A;  3WAA D;  5AV9 D;  5B24 C;  3W98 D;  1KX3 B;  5B0Y A;  3WKJ D;  1P3K C;  4J8W B;  3AZE B;  3AV2 C;  2NZD D;  5B32 G;  5DNM D;  3AZG C;  5B2I B;  4X23 D;  5B2J A;  3MGQ D;  1HQ3 D;  5B31 D;  1KX4 A;  3KWQ B;  5CP6 B;  3LZ0 B;  2ARO D;  4ZUX C;  1U35 D;  4H9R A;  3X1V A;  5BO0 A;  3AZF D;  3LEL D;  4Z5T D;  5DNN A;  3X1S D;  3UTA C;  5AVB A;  3TU4 A;  3AZJ D;  5B1L C;  4XUJ A;  3A6N A;  4WU8 C;  3AV1 D;  3AZN A;  5AV8 C;  4WNN A;  3KUY A;  1P34 D;  3B6G D;  5B33 C;  3O62 C;  5AVC D;  3LJA B;  3AYW C;  3W97 A;  3AZI A;  4LD9 C;  3C1B B;  1S32 C;  4G91 B;  3AFA D;  4HGA B;  3KSY A;  1BH9 B;  2HIO C;  1P3O C;  5B32 A;  3MVD C;  3AZK B;  1P3L D;  1P3M D;  4J8U A;  1P3P A;  4KUD C;  4Z66 B;  3WAA B;  5AV9 B;  3WKJ B;  2YFV B;  3W98 B;  4J8X B;  1P3I D;  5CHL B;  1ID3 A;  2NZD B;  5DNM B;  4X23 B;  4YM6 D;  3MGQ B;  1HQ3 B;  1KX5 A;  4WU9 C;  2ARO B;  5B40 A;  2YFW A;  3LEL B;  3AZF B;  4Z5T B;  3X1U A;  1KX3 C;  1M19 B;  1P3B D;  3AZE C;  3AZM D;  1TAF A;  3UT9 D;  5BT1 C;  3MGP A;  5B0Y D;  3AV1 B;  2CV5 A;  5JA4 A;  3KWQ C;  4J8V A;  3VH6 T;  4EO5 B;  5B2J D;  1P34 B;  3B6G B;  2IO5 B;  3UTB B;  4QLC D;  5JRG A;  5C3I C;  1AOI B;  3VH5 W;  3KXB A;  2NQB A;  1N1J A;  5DNN D;  3AZH A;  1M1A A;  5AVB D;  3TU4 D;  1U35 A;  4YS3 C;  4XUJ D;  3A6N D;  5CPJ D;  3AZN D;  3NQJ B;  1KU5 A;  3LJA C;  1P3L B;  3X1S A;  1P3M B;  4R8P D;  2L5A A;  3KUY D;  2RVQ D;  4NFT A;  1F66 A;  1B67 A;  5GT3 A;  3W97 D;  1P3I B;  3MNN A;  3AZI D;  3WTP B;  2PYO A;  4H9O A;  4YM6 B;  5GSU A;  3AZK C;  3X1T A;  2F8N G;  4UUZ B;  3LZ1 C;  5B32 D;  3WAA C;  5AV9 C;  3WKJ C;  3W98 C;  3WTP E;  3AZM B;  3UT9 B;  4J8X C;  3AFA A;  2NZD C;  4H9P A;  5B0Y B;  3REI D;  3MGQ C;  1ID3 D;  5GT0 A;  1R4V A;  2ARO C;  1P3G C;  5B2J B;  1KX4 B;  5B0Z A;  3AZF C;  4Z5T C;  5F99 A;  1KX5 D;  1M19 C;  5B40 D; 
#chains in the Genus database with same CATH topology
 4H9R B;  3X1V B;  5BO0 B;  3MGR A;  5KDM B;  5B1M A;  3X1U D;  5DNN B;  3H0R C;  3REL C;  5B24 A;  1P3K A;  5AVB B;  3V9R A;  3TU4 B;  3MGP D;  3A6N B;  4G92 B;  3AV2 A;  3AZN B;  2IO5 C;  4XZQ C;  3UTB C;  3AZG A;  2CV5 D;  5AY8 A;  4J8V D;  3VH5 T;  1TZY B;  1P3B A;  5AV6 D;  1AOI C;  4WNN B;  5GXQ C;  3KUY B;  3B0C W;  4ZUX A;  2F8N A;  5JRG D;  3W97 B;  3KXB D;  4JJN C;  2NQB D;  3AN2 C;  2Y2O A;  1HTA A;  1WWS A;  4QLC A;  3AZH D;  4AWL B;  5BNX A;  1M18 C;  1P3L C;  1M1A D;  3KFU G;  2F8N H;  3VH6 W;  3REJ C;  5B32 B;  5BS7 C;  5CPI A;  1P3P B;  4J8U B;  5B33 A;  1P3I C;  3O62 A;  2BG1 A;  3WTP C;  3B0D C;  1P3A C;  1F66 D;  4NE3 A;  2Y2J A;  5CPJ A;  5GT3 D;  1ZLA A;  3C1C B;  3MNN D;  1EQZ A;  4LD9 A;  1S32 A;  4R8P A;  3REK C;  2PYO D;  5AV5 C;  5GSU D;  1KX5 B;  1P3O A;  3X1T D;  5B40 B;  3MVD A;  3AZM C;  3W99 A;  2YFW B;  3FDD A;  4KUD A;  2XD1 A;  3X1U B;  3REH A;  5E5A A;  2ZY5 A;  1Z2C B;  3MGP B;  1KX4 C;  4KGC A;  5JA4 B;  5GT0 D;  4J8V B;  3W96 A;  3X1V C;  2BYM B;  5B0Z D;  4WU9 A;  3WA9 A;  5F99 D;  3REI A;  4ZBJ B;  5DNN C;  5JRG B;  1H3O A;  4CAY A;  3MGR D;  5CPK C;  2NQB B;  3AZL A;  5B1M D;  1N1J B;  3A6N C;  5B31 B;  3AZN C;  3R45 A;  5B24 D;  3EG5 B;  1P3K D;  1M1A B;  1TZY C;  1U35 B;  1T3U A;  3B0C T;  2UWX A;  3AV2 D;  4CSR A;  3AZG D;  5AY8 D;  1P3F A;  3B0B A;  3X1S B;  4J8W C;  4ZUX D;  3AZJ B;  5B2I C;  4H9N A;  2F8N D;  2LY8 A;  5CP6 C;  3MNN B;  4AWL C;  4E45 A;  5AV6 A;  3LZ0 C;  2PYO B;  4H9O B;  3H0M C;  4M6B A;  4YS3 A;  5AVC B;  5GSU B;  4WU8 D;  1P3P C;  3X1T B;  4J8U C;  2Y2I A;  2HUE B;  5CPI D;  5B33 D;  3AFA B;  3O62 D;  3C1C C;  4H9P B;  4E44 A;  1ZLA D;  1EQZ D;  4LD9 D;  2BYK A;  5GT0 B;  1KX5 C;  1S32 D;  5B40 C;  5B0Z B;  3AZK A;  5F99 B;  3X1U C;  1P3O D;  2HIO D;  3C1B C;  3LZ1 A;  3MVD D;  4G91 C;  4HGA C;  3W99 D;  3MGR B;  4KUD D;  5B1M B;  4WV4 B;  3MGP C;  4H9Q A;  3REH D;  5E5A D;  5B24 B;  5FUG A;  4H9S C;  3V9R B;  3AV2 B;  4Z66 C;  4KGC D;  3AZG B;  1P3G A;  5AY8 B;  1P3B B;  4ZBJ C;  3W96 D;  5DNM C;  4WU9 D;  1M19 A;  3WA9 D;  4ZUX B;  2NQB C;  4X23 C;  3MGS A;  2F8N B;  1HQ3 C;  5B31 C;  2FJ7 A;  5G49 A;  2ZY4 A;  3EPJ A;  3AZE D;  3REL A;  1U35 C;  3AZL D;  5BT1 D;  3LEL C;  4QLC B;  5BNX B;  4KHA A;  3X1S C;  4XZQ A;  3AZJ C;  5CPI B;  1AOI A;  1P3F D;  5GXQ A;  3B6F A;  3AV1 C;  4WZS B;  5B33 B;  3O62 B;  3MNN C;  5BNV A;  4XUJ B;  4EO5 C;  3NQU A;  5CPJ B;  2G5H C;  1P34 C;  3B6G C;  4JJN A;  1ZLA B;  3AN2 A;  1EQZ B;  5AVC C;  5GSU C;  3X1T C;  4R8P B;  1M18 A;  2Y2G A;  4YS3 D;  3REJ A;  1P3O B;  5BS7 A;  3AFA C;  3AZI B;  3W99 B;  3LJA D;  4KUD B;  3UTA A;  3REH B;  5E5A B;  5B1L A;  1P3A A;  4WU8 A;  1P3M C;  5AV8 A;  1WWI A;  3EPL A;  4KGC B;  1BH8 A;  5B0Z C;  5F99 C;  3REK A;  5AV5 A;  4NE6 A;  3W96 B;  3AZK D;  4WU9 B;  3MGR C;  3AYW A;  3WA9 B;  5B1M C;  4YM6 C;  3REI B;  2JE5 A;  3LZ1 D;  1H3O B;  1ID3 B;  4CAY B;  3AZL B;  4J8X D;  3VH5 A;  3R45 B;  5AY8 C;  2HIO A;  1P3B C;  3UT9 C;  1JFI A;  4CSR B;  1P3G D;  5B0Y C;  1P3F B;  1TAF B;  4NE5 A;  5KDM A;  1M19 D;  5C3I B;  4H9N B;  5B2J C;  3MGS D;  2FJ7 D;  5CPK A;  2CV5 B;  4QLC C;  2Y2P A;  5AV6 B;  3REL D;  3EPK A;  1BFM A;  1TZY A;  4DRB A;  1B6W A;  5CPI C;  4YS3 B;  4XZQ D;  3UTB D;  2F8N K;  4Z2M G;  1KX3 A;  3KXB B;  5AVB C;  4J8W A;  3TU4 C;  3AZE A;  1F1E A;  4XUJ C;  5GXQ D;  4G92 C;  1AOI D;  5CPJ C;  2CWE A;  3B6F D;  3AZH B;  1ZLA C;  5B2I A;  1EQZ C;  4R8P C;  3KWQ A;  3KUY C;  5CP6 A;  1ULY A;  3F6T A;  2RVQ C;  3LZ0 A;  4JJN D;  3AN2 D;  2BYK B;  3W97 C;  3AZI C;  3W99 C;  1M18 D;  1F66 B;  5B31 G;  5GT3 B;  3REJ D;  3LZ1 B;  3REH C;  5E5A C;  3UTA D;  3C1C A;  4H9Q B;  5B32 C;  3WTP D;  4KGC C;  2FFF B;  5B1L D;  1P3A D;  5FUG B;  5AV8 D;  2JSS A;  3W96 C;  3LJA A;  3WA9 C;  1P3G B;  2DF4 C;  3REK D;  3REI C;  5AV5 D;  1ID3 C;  2RIQ A;  3C1B A;  3AYW D;  3AZL C;  3MGS B;  2FJ7 B;  5G49 B;  1BH9 A;  3REL B;  3H0L C;  4H9S A;  1P3F C;  4KHA B;  4Z66 A;  2BYM A;  1KX4 D;  3WAA A;  4XZQ B;  4Z2M H;  5AV9 A;  2YFV A;  3WKJ A;  3W98 A;  4J8X A;  3B6F B;  5GXQ B;  2NZD A;  3VH6 A;  3X1V D;  5DNM A;  2CV5 C;  4X23 A;  4J8V C;  5BNV B;  3MGQ A;  1P3K B;  1HQ3 A;  5B31 A;  5AV6 C;  3NQU B;  4JJN B;  2ARO A;  5CPK D;  2JCH A;  3AN2 B;  3AZF A;  5JRG C;  3LEL A;  4Z5T A;  2Y2H A;  1M18 B;  3KXB C;  1TZY D;  3REJ B;  3AZH C;  3AZJ A;  1KX3 D;  3AV1 A;  4J8W D;  1M1A C;  3UTA B;  2Y2N A;  3B0D B;  5B1L B;  5B2I D;  4WU8 B;  2W8S A;  1P3A B;  1P34 A;  3B6G A;  3UTB A;  5AV8 B;  3KWQ D;  5CP6 D;  5AVC A;  1BH8 B;  3LZ0 D;  1F66 C;  3REK B;  5GT3 C;  5AV5 B;  2XD5 A;  1P3P D;  3AYW B;  4J8U D;  2DQN C;  2PYO C;  1A7W A;  4LD9 B;  1S32 B;  3NQJ A;  3C1C D;  1P3M A;  1P3L A;  2HUE C;  4DRA A;  2HIO B;  3MVD B;  1JFI B;  2ZY2 A;  1P3I A;  3MGS C;  2FJ7 C;  3WTP A;  3IP4 C;  5GT0 C;  4YM6 A;  3C1B D;  5CPK B;  2G5I C;  4UUZ A;  3AZM A;  3UT9 A;  3B6F C;  4Z66 D;  1Q9C A;  3WAA D;  5AV9 D;  5B24 C;  3W98 D;  1KX3 B;  5B0Y A;  3WKJ D;  1P3K C;  4J8W B;  3AZE B;  3AV2 C;  2NZD D;  5B32 G;  5DNM D;  3AZG C;  5B2I B;  4X23 D;  5B2J A;  3MGQ D;  1HQ3 D;  5B31 D;  1KX4 A;  3KWQ B;  5CP6 B;  3LZ0 B;  2ARO D;  4ZUX C;  1U35 D;  4H9R A;  3X1V A;  5BO0 A;  3AZF D;  3LEL D;  4Z5T D;  5DNN A;  3X1S D;  3UTA C;  5AVB A;  3TU4 A;  3AZJ D;  5B1L C;  4XUJ A;  3A6N A;  4WU8 C;  3AV1 D;  3AZN A;  5AV8 C;  4WNN A;  2J8P A;  3KUY A;  1P34 D;  3B6G D;  5B33 C;  3O62 C;  5AVC D;  3LJA B;  3AYW C;  3W97 A;  3AZI A;  4LD9 C;  3C1B B;  1S32 C;  4G91 B;  3AFA D;  4HGA B;  3KSY A;  2F2A C;  1BH9 B;  2HIO C;  1P3O C;  3A1I A;  5B32 A;  2Y2K A;  3MVD C;  3AZK B;  1P3L D;  1P3M D;  4J8U A;  1P3P A;  4KUD C;  3AL0 C;  4Z66 B;  3WAA B;  5AV9 B;  3WKJ B;  2YFV B;  3W98 B;  4J8X B;  1P3I D;  5CHL B;  1ID3 A;  2NZD B;  5DNM B;  4X23 B;  4YM6 D;  3MGQ B;  1HQ3 B;  4WJ3 C;  3P5J B;  1KX5 A;  4WU9 C;  2ARO B;  5B40 A;  2ZM5 A;  2YFW A;  3LEL B;  3AZF B;  4Z5T B;  3X1U A;  1KX3 C;  1M19 B;  1P3B D;  3AZE C;  3AZM D;  1TAF A;  3UT9 D;  5BT1 C;  3MGP A;  5B0Y D;  2VQR A;  3AV1 B;  3A1K A;  2CV5 A;  5JA4 A;  3KWQ C;  4J8V A;  3VH6 T;  4EO5 B;  5B2J D;  1P34 B;  3B6G B;  2IO5 B;  3UTB B;  4QLC D;  5JRG A;  5C3I C;  1AOI B;  3VH5 W;  3KXB A;  4UPK A;  2NQB A;  1N1J A;  5DNN D;  2Y2L A;  3AZH A;  1M1A A;  5AVB D;  3TU4 D;  1U35 A;  4YS3 C;  4XUJ D;  3A6N D;  5CPJ D;  3AZN D;  3NQJ B;  1KU5 A;  3EPH A;  3LJA C;  1P3L B;  3X1S A;  1P3M B;  4R8P D;  2L5A A;  3KUY D;  2RVQ D;  4NFT A;  1F66 A;  1B67 A;  5GT3 A;  3W97 D;  1P3I B;  3MNN A;  3AZI D;  3WTP B;  4DQY B;  2PYO A;  4H9O A;  4YM6 B;  5GSU A;  2Y2M A;  3AZK C;  3X1T A;  2F8N G;  4UUZ B;  3LZ1 C;  5B32 D;  3WAA C;  1PZR A;  5AV9 C;  3W98 C;  3WKJ C;  3WTP E;  3AZM B;  3UT9 B;  4J8X C;  3AFA A;  2NZD C;  4H9P A;  5B0Y B;  3REI D;  3MGQ C;  2Y2Q A;  1ID3 D;  5GT0 A;  1R4V A;  2ARO C;  1P3G C;  5B2J B;  1KX4 B;  5B0Z A;  3AZF C;  1W2E A;  4Z5T C;  5F99 A;  1KX5 D;  1M19 C;  5B40 D;  2ZY3 A; 
#chains in the Genus database with same CATH homology
 4H9R B;  3X1V B;  5BO0 B;  3MGR A;  5KDM B;  5B1M A;  3X1U D;  5DNN B;  3H0R C;  3REL C;  5B24 A;  1P3K A;  5AVB B;  3V9R A;  3TU4 B;  3MGP D;  3A6N B;  4G92 B;  3AV2 A;  3AZN B;  2IO5 C;  4XZQ C;  3UTB C;  3AZG A;  2CV5 D;  5AY8 A;  4J8V D;  3VH5 T;  1TZY B;  1P3B A;  5AV6 D;  1AOI C;  4WNN B;  5GXQ C;  3KUY B;  3B0C W;  4ZUX A;  2F8N A;  5JRG D;  3W97 B;  3KXB D;  4JJN C;  2NQB D;  3AN2 C;  2Y2O A;  1HTA A;  1WWS A;  4QLC A;  3AZH D;  4AWL B;  5BNX A;  1M18 C;  1P3L C;  1M1A D;  3KFU G;  2F8N H;  3VH6 W;  3REJ C;  5B32 B;  5BS7 C;  5CPI A;  1P3P B;  4J8U B;  5B33 A;  1P3I C;  3O62 A;  2BG1 A;  3WTP C;  3B0D C;  1P3A C;  1F66 D;  4NE3 A;  2Y2J A;  5CPJ A;  5GT3 D;  1ZLA A;  3C1C B;  3MNN D;  1EQZ A;  4LD9 A;  1S32 A;  4R8P A;  3REK C;  2PYO D;  5AV5 C;  5GSU D;  1KX5 B;  1P3O A;  3X1T D;  5B40 B;  3MVD A;  3AZM C;  3W99 A;  2YFW B;  3FDD A;  4KUD A;  2XD1 A;  3X1U B;  3REH A;  5E5A A;  2ZY5 A;  1Z2C B;  3MGP B;  1KX4 C;  4KGC A;  5JA4 B;  5GT0 D;  4J8V B;  3W96 A;  3X1V C;  2BYM B;  5B0Z D;  4WU9 A;  3WA9 A;  5F99 D;  3REI A;  4ZBJ B;  5DNN C;  5JRG B;  1H3O A;  4CAY A;  3MGR D;  5CPK C;  2NQB B;  3AZL A;  5B1M D;  1N1J B;  3A6N C;  5B31 B;  3AZN C;  3R45 A;  5B24 D;  3EG5 B;  1P3K D;  1M1A B;  1TZY C;  1U35 B;  1T3U A;  3B0C T;  2UWX A;  3AV2 D;  4CSR A;  3AZG D;  5AY8 D;  1P3F A;  3B0B A;  3X1S B;  4J8W C;  4ZUX D;  3AZJ B;  5B2I C;  4H9N A;  2F8N D;  2LY8 A;  5CP6 C;  3MNN B;  4AWL C;  4E45 A;  5AV6 A;  3LZ0 C;  2PYO B;  4H9O B;  3H0M C;  4M6B A;  4YS3 A;  5AVC B;  5GSU B;  4WU8 D;  1P3P C;  3X1T B;  4J8U C;  2Y2I A;  2HUE B;  5CPI D;  5B33 D;  3AFA B;  3O62 D;  3C1C C;  4H9P B;  4E44 A;  1ZLA D;  1EQZ D;  4LD9 D;  2BYK A;  5GT0 B;  1KX5 C;  1S32 D;  5B40 C;  5B0Z B;  3AZK A;  5F99 B;  3X1U C;  1P3O D;  2HIO D;  3C1B C;  3LZ1 A;  3MVD D;  4G91 C;  4HGA C;  3W99 D;  3MGR B;  4KUD D;  5B1M B;  4WV4 B;  3MGP C;  4H9Q A;  3REH D;  5E5A D;  5B24 B;  5FUG A;  4H9S C;  3V9R B;  3AV2 B;  4Z66 C;  4KGC D;  3AZG B;  1P3G A;  5AY8 B;  1P3B B;  4ZBJ C;  3W96 D;  5DNM C;  4WU9 D;  1M19 A;  3WA9 D;  4ZUX B;  2NQB C;  4X23 C;  3MGS A;  2F8N B;  1HQ3 C;  5B31 C;  2FJ7 A;  5G49 A;  2ZY4 A;  3EPJ A;  3AZE D;  3REL A;  1U35 C;  3AZL D;  5BT1 D;  3LEL C;  4QLC B;  5BNX B;  4KHA A;  3X1S C;  4XZQ A;  3AZJ C;  5CPI B;  1AOI A;  1P3F D;  5GXQ A;  3B6F A;  3AV1 C;  4WZS B;  5B33 B;  3O62 B;  3MNN C;  5BNV A;  4XUJ B;  4EO5 C;  3NQU A;  5CPJ B;  2G5H C;  1P34 C;  3B6G C;  4JJN A;  1ZLA B;  3AN2 A;  1EQZ B;  5AVC C;  5GSU C;  3X1T C;  4R8P B;  1M18 A;  2Y2G A;  4YS3 D;  3REJ A;  1P3O B;  5BS7 A;  3AFA C;  3AZI B;  3W99 B;  3LJA D;  4KUD B;  3UTA A;  3REH B;  5E5A B;  5B1L A;  1P3A A;  4WU8 A;  1P3M C;  5AV8 A;  1WWI A;  3EPL A;  4KGC B;  1BH8 A;  5B0Z C;  5F99 C;  3REK A;  5AV5 A;  4NE6 A;  3W96 B;  3AZK D;  4WU9 B;  3MGR C;  3AYW A;  3WA9 B;  5B1M C;  4YM6 C;  3REI B;  2JE5 A;  3LZ1 D;  1H3O B;  1ID3 B;  4CAY B;  3AZL B;  4J8X D;  3VH5 A;  3R45 B;  5AY8 C;  2HIO A;  1P3B C;  3UT9 C;  1JFI A;  4CSR B;  1P3G D;  5B0Y C;  1P3F B;  1TAF B;  4NE5 A;  5KDM A;  1M19 D;  5C3I B;  4H9N B;  5B2J C;  3MGS D;  2FJ7 D;  5CPK A;  2CV5 B;  4QLC C;  2Y2P A;  5AV6 B;  3REL D;  3EPK A;  1BFM A;  1TZY A;  4DRB A;  1B6W A;  5CPI C;  4YS3 B;  4XZQ D;  3UTB D;  2F8N K;  4Z2M G;  1KX3 A;  3KXB B;  5AVB C;  4J8W A;  3TU4 C;  3AZE A;  1F1E A;  4XUJ C;  5GXQ D;  4G92 C;  1AOI D;  5CPJ C;  2CWE A;  3B6F D;  3AZH B;  1ZLA C;  5B2I A;  1EQZ C;  4R8P C;  3KWQ A;  3KUY C;  5CP6 A;  1ULY A;  3F6T A;  2RVQ C;  3LZ0 A;  4JJN D;  3AN2 D;  2BYK B;  3W97 C;  3AZI C;  3W99 C;  1M18 D;  1F66 B;  5B31 G;  5GT3 B;  3REJ D;  3LZ1 B;  3REH C;  5E5A C;  3UTA D;  3C1C A;  4H9Q B;  5B32 C;  3WTP D;  4KGC C;  2FFF B;  5B1L D;  1P3A D;  5FUG B;  5AV8 D;  2JSS A;  3W96 C;  3LJA A;  3WA9 C;  1P3G B;  2DF4 C;  3REK D;  3REI C;  5AV5 D;  1ID3 C;  2RIQ A;  3C1B A;  3AYW D;  3AZL C;  3MGS B;  2FJ7 B;  5G49 B;  1BH9 A;  3REL B;  3H0L C;  4H9S A;  1P3F C;  4KHA B;  4Z66 A;  2BYM A;  1KX4 D;  3WAA A;  4XZQ B;  4Z2M H;  5AV9 A;  2YFV A;  3WKJ A;  3W98 A;  4J8X A;  3B6F B;  5GXQ B;  2NZD A;  3VH6 A;  3X1V D;  5DNM A;  2CV5 C;  4X23 A;  4J8V C;  5BNV B;  3MGQ A;  1P3K B;  1HQ3 A;  5B31 A;  5AV6 C;  3NQU B;  4JJN B;  2ARO A;  5CPK D;  2JCH A;  3AN2 B;  3AZF A;  5JRG C;  3LEL A;  4Z5T A;  2Y2H A;  1M18 B;  3KXB C;  1TZY D;  3REJ B;  3AZH C;  3AZJ A;  1KX3 D;  3AV1 A;  4J8W D;  1M1A C;  3UTA B;  2Y2N A;  3B0D B;  5B1L B;  5B2I D;  4WU8 B;  2W8S A;  1P3A B;  1P34 A;  3B6G A;  3UTB A;  5AV8 B;  3KWQ D;  5CP6 D;  5AVC A;  1BH8 B;  3LZ0 D;  1F66 C;  3REK B;  5GT3 C;  5AV5 B;  2XD5 A;  1P3P D;  3AYW B;  4J8U D;  2DQN C;  2PYO C;  1A7W A;  4LD9 B;  1S32 B;  3NQJ A;  3C1C D;  1P3M A;  1P3L A;  2HUE C;  4DRA A;  2HIO B;  3MVD B;  1JFI B;  2ZY2 A;  1P3I A;  3MGS C;  2FJ7 C;  3WTP A;  3IP4 C;  5GT0 C;  4YM6 A;  3C1B D;  5CPK B;  2G5I C;  4UUZ A;  3AZM A;  3UT9 A;  3B6F C;  4Z66 D;  1Q9C A;  3WAA D;  5AV9 D;  5B24 C;  3W98 D;  1KX3 B;  5B0Y A;  3WKJ D;  1P3K C;  4J8W B;  3AZE B;  3AV2 C;  2NZD D;  5B32 G;  5DNM D;  3AZG C;  5B2I B;  4X23 D;  5B2J A;  3MGQ D;  1HQ3 D;  5B31 D;  1KX4 A;  3KWQ B;  5CP6 B;  3LZ0 B;  2ARO D;  4ZUX C;  1U35 D;  4H9R A;  3X1V A;  5BO0 A;  3AZF D;  3LEL D;  4Z5T D;  5DNN A;  3X1S D;  3UTA C;  5AVB A;  3TU4 A;  3AZJ D;  5B1L C;  4XUJ A;  3A6N A;  4WU8 C;  3AV1 D;  3AZN A;  5AV8 C;  4WNN A;  2J8P A;  3KUY A;  1P34 D;  3B6G D;  5B33 C;  3O62 C;  5AVC D;  3LJA B;  3AYW C;  3W97 A;  3AZI A;  4LD9 C;  3C1B B;  1S32 C;  4G91 B;  3AFA D;  4HGA B;  3KSY A;  2F2A C;  1BH9 B;  2HIO C;  1P3O C;  3A1I A;  5B32 A;  2Y2K A;  3MVD C;  3AZK B;  1P3L D;  1P3M D;  4J8U A;  1P3P A;  4KUD C;  3AL0 C;  4Z66 B;  3WAA B;  5AV9 B;  3WKJ B;  2YFV B;  3W98 B;  4J8X B;  1P3I D;  5CHL B;  1ID3 A;  2NZD B;  5DNM B;  4X23 B;  4YM6 D;  3MGQ B;  1HQ3 B;  4WJ3 C;  3P5J B;  1KX5 A;  4WU9 C;  2ARO B;  5B40 A;  2ZM5 A;  2YFW A;  3LEL B;  3AZF B;  4Z5T B;  3X1U A;  1KX3 C;  1M19 B;  1P3B D;  3AZE C;  3AZM D;  1TAF A;  3UT9 D;  5BT1 C;  3MGP A;  5B0Y D;  2VQR A;  3AV1 B;  3A1K A;  2CV5 A;  5JA4 A;  3KWQ C;  4J8V A;  3VH6 T;  4EO5 B;  5B2J D;  1P34 B;  3B6G B;  2IO5 B;  3UTB B;  4QLC D;  5JRG A;  5C3I C;  1AOI B;  3VH5 W;  3KXB A;  4UPK A;  2NQB A;  1N1J A;  5DNN D;  2Y2L A;  3AZH A;  1M1A A;  5AVB D;  3TU4 D;  1U35 A;  4YS3 C;  4XUJ D;  3A6N D;  5CPJ D;  3AZN D;  3NQJ B;  1KU5 A;  3EPH A;  3LJA C;  1P3L B;  3X1S A;  1P3M B;  4R8P D;  2L5A A;  3KUY D;  2RVQ D;  4NFT A;  1F66 A;  1B67 A;  5GT3 A;  3W97 D;  1P3I B;  3MNN A;  3AZI D;  3WTP B;  4DQY B;  2PYO A;  4H9O A;  4YM6 B;  5GSU A;  2Y2M A;  3AZK C;  3X1T A;  2F8N G;  4UUZ B;  3LZ1 C;  5B32 D;  3WAA C;  1PZR A;  5AV9 C;  3W98 C;  3WKJ C;  3WTP E;  3AZM B;  3UT9 B;  4J8X C;  3AFA A;  2NZD C;  4H9P A;  5B0Y B;  3REI D;  3MGQ C;  2Y2Q A;  1ID3 D;  5GT0 A;  1R4V A;  2ARO C;  1P3G C;  5B2J B;  1KX4 B;  5B0Z A;  3AZF C;  1W2E A;  4Z5T C;  5F99 A;  1KX5 D;  1M19 C;  5B40 D;  2ZY3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...