4G91B

Ccaat-binding complex from aspergillus nidulans
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
91
structure length
91
Chain Sequence
KEQDRWLPIANVARIMKLALPENAKIAKEAKECMQECVSEFISFITSEASEKCQQEKRKTVNGEDILFAMTSLGFENYAEALKIYLSKYRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HAPB protein
publication title DNA Minor Groove Sensing and Widening by the CCAAT-Binding Complex.
pubmed doi rcsb
source organism Emericella nidulans
molecule tags Transcription
total genus 35
structure length 91
sequence length 91
ec nomenclature
pdb deposition date 2012-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00808 CBFD_NFYB_HMF Histone-like transcription factor (CBF/NF-Y) and archaeal histone
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4g91B00
1B67A 1B6WA 5DNNC 5CP6D 3AZMB 1M1AB 5DNMA 4EO5B 2LY8A 1P3FD 2HUEB 3AN2C 2NQBB 5GXQD 5E5AA 5BNXA 4X23D 1P3BD 1P3GB 3AZHC 5C3IC 1P34C 4J8UD 2F8NA 3X1TB 5AY8C 3C1BB 4J8WA 3TU4A 2AROB 2CV5C 1JFIB 3A6NA 4WU9B 3VH6W 1P3PD 3W98D 1AOIC 1P3ID 4KGCA 3WKJC 5B2JB 3AZKA 3AZFA 2FJ7D 3KXBB 5GT0C 5DNMC 4ZBJB 1ID3D 1P3AA 5JRGA 3REKA 1KX5B 3MGQC 3AFAD 3X1SD 3REJD 5B40A 3MNNB 1TZYD 1P3MB 5B1LA 3B6FD 3AZLA 2PYOC 4YS3C 3WAAC 3REHD 3UTBB 5AV5B 3AZNA 1ULYA 3WTPA 5FUGB 5DNND 5B0YB 3A6NC 4G91B 1BFMA 2BYKA 3UT9A 3UTAC 3RELA 3VH5W 4ZUXA 3AN2D 3MGSA 3KUYC 3AZFC 4WV4B 4WU8C 3MGPC 3AZHD 1P34D 1ZLAD 1HQ3B 1U35D 1P3AC 1KX3A 5AY8D 3AZIA 5E5AB 5BNXB 4CAYA 4R8PC 2IO5C 3MGRA 1M19C 2F8NB 5B33C 4J8WB 3TU4B 3AZNC 5B31C 4Z5TC 3X1UB 3WKJD 4WZSB 3AZJA 4J8VD 3UT9C 4KGCB 3AZKB 4LD9B 4AWLC 4H9RA 1P3LD 5JRGB 5AV6B 2HIOC 3LELD 3REKB 2PYOD 4YS3D 1M18C 5B40B 3AYWC 5B31G 5B1LB 4H9SC 2JSSA 3AZLB 4H9QA 5BT1C 3LJAC 4H9PA 5F99C 3WTPB 4H9NA 3UTAD 3W97A 3KUYD 4WU8D 3MGPD 2BYKB 3RELB 4ZUXB 3MGSB 5AV9C 4J8XC 1P3KC 4WU9A 4R8PD 1P3OA 3W96A 1M19D 5GSUB 3AZGA 1KX3B 1N1JA 3AZIB 4CAYB 3KSYA 3MGRB 3KXBA 2RVQD 3AZMC 1M1AC 5B31D 4Z5TD 4EO5C 4Z66A 1ID3A 5GT3B 3NQUA 5CPJD 3KWQD 2HUEC 2NQBC 4KUDD 3B0BA 3MNNA 1P3GC 4JJNA 3LZ1B 1H3OA 3AZJB 1F66A 5JA4A 1KX4A 3C1BC 3LZ0B 3W99B 2HIOD 3REHA 3WA9D 2AROC 3B6GB 4H9RB 3AYWD 5CPKA 4WU9C 5BT1D 1EQZB 5B24D 3LJAD 5F99D 5B2JC 4H9QB 3KXBC 4H9PB 4ZBJC 1HQ3A 4DRAA 1KX5C 4H9NB 5GXQB 3O62A 3W97B 1P3BB 4WNNA 3MNNC 1P3MC 5B32A 3AZEA 4J8XD 1P3KD 5AVCA 3UTBC 5AV5C 4QLCA 5B2IA 5AVBD 1S32A 3X1UA 1P3OB 5B0YC 5CPIA 5B0ZA 3W96B 3AZMD 1M1AD 3AZGB 4G91C 1N1JB 3C1CA 4XZQA 2NQBD 4LD9A 1P3GD 4Z66B 5AV6A 1ID3B 1HQ3C 3NQUB 3X1TD 3C1BD 5E5AC 3AFAB 4JJNB 5AV8A 3X1SB 5B1MA 1H3OB 2AROD 1F66B 1KU5A 5JA4B 1KX4B 3AV2D 4J8WC 3TU4C 3REHB 3MVDA 1BH9A 3X1UC 5CPKB 4NE3A 5B2JD 5CPIC 1HTAA 3R45A 4YM6A 3REIA 1KX5D 4KGCC 3AZKC 4LD9C 5GSUA 1P3MD 1ZLAB 5JRGC 5AV6C 3REKC 3B0CW 4XUJA 1U35B 3O62B 1WWSA 3UTBD 4WNNB 5AV5D 5B40C 5B1LC 4HGAB 5B32B 3AZEB 3AZLC 2CV5D 4E44A 4G92B 5AVCB 5GT3A 5B0YD 2NZDA 1AOID 3X1VA 4QLCB 5B2IB 3WTPC 1S32B 3LZ1A 3AV1A 5CPIB 3VH6T 5B0ZB 5GT0D 5DNMD 1BH8A 4J8VB 4H9OA 3LZ0A 3W99A 3RELC 3MGQD 4ZUXC 3C1CB 4XZQB 3MGSC 3WA9A 5E5AD 3B6GA 2F8ND 4Z2MG 5GSUC 1EQZA 1P3LB 1KX3C 3LELB 3WAAD 3AZIC 1A7WA 4J8WD 3TU4D 5AV8B 5B1MB 3MGRC 5CP6A 1P3FA 3A6ND 5GT3C 3MVDB 5GXQA 1BH9B 4X23A 4NE6A 1P3BA 4J8UA 3LZ1C 4KGCD 3AZFD 3AZKD 3R45B 3AZJC 4Z2MH 3VH6A 5BO0A 1P3AD 3LZ0C 5JRGD 3VH5T 4YM6B 3W99C 3REIB 3REKD 5AVBA 3B6GC 5B33D 5B1LD 3AZLD 1P3PA 3W98A 4XUJB 1EQZC 1P3IA 3AZND 2FJ7A 3WTPD 2NZDB 3X1VB 1TAFA 4CSRA 3AFAA 3KWQB 3UT9D 5GXQC 3RELD 3X1SA 3REJA 3W97C 1P3BC 1TZYA 4ZUXD 3B0DB 3AV1B 4KUDB 3B6FA 1BH8B 4H9OB 3AV2A 1KX3D 1M18D 3AZID 3WA9B 3VH5A 5DNNA 1P3OC 3MGRD 3W96C 3AZGC 4NE5A 5B24B 5G49A 3AN2A 1WWIA 5CP6B 3AZHA 4Z66C 1P34A 1ZLAA 1P3FB 1ID3C 1U35A 3AZJD 5AY8A 4X23B 3AFAC 4JJNC 5AV9D 4J8UB 3X1SC 2YFWB 1F66C 3B6FC 2CV5A 1KX4C 5BO0B 2YFVB 3REHC 5AVBB 3WKJA 5CPKC 1P3PB 3W98B 5GT0A 4J8VA 3MGQA 1P3IB 2FJ7B 5BS7A 3W97D 1P3LA 1ZLAC 3LELA 2PYOA 4YS3A 1TAFB 4CSRB 1U35C 3WAAA 3O62C 3REJB 1TZYB 3B6FB 5B32C 4HGAC 3AZEC 4G92C 4WU9D 5AVCC 1P3OD 3W96D 3AV2B 3AZGD 4QLCC 5B2IC 3UTAA 3NQJA 1S32C 5DNNB 5B0ZC 3KXBD 3KUYA 4WU8A 3MGPA 4Z66D 4J8VC 4KHAA 5G49B 2BYMA 3AN2B 3C1CC 4XZQC 2F8NG 3MNND 3AZHB 5C3IB 5B32G 4JJND 5BS7C 4R8PA 1P34B 1M19A 5B33A 1P3LC 1F66D 5AY8B 3LELC 1KX4D 5AV8C 5KDMA 5B1MC 5B31A 4Z5TA 2CV5B 5CPKD 3KWQA 3MVDC 5CPJA 1AOIB 4KUDA 4E45A 2F8NH 3WKJB 5GT0B 5DNMB 5CHLB 1HQ3D 4NFTA 2HIOA 4YM6C 3MGQB 3REIC 1M18A 3O62D 3AYWA 4H9SA 5B32D 3AZED 2PYOB 5B24A 4XUJC 5F99A 3LJAA 4YS3B 5AVCD 3WAAB 1Q9CA 4QLCD 5B2ID 1S32D 2RVQC 3X1UD 5CPID 5B0ZD 3A6NB 2NZDC 3X1VC 2F8NK 4UUZA 3UTAB 3NQJB 3KWQC 5CPJC 5BNVA 4KUDC 2YFWA 3AV1C 3B0DC 5AV9A 4XZQD 3KUYB 3C1CD 4LD9D 3AZFB 4WU8B 4J8XA 3MGPB 1P3KA 2YFVA 5AV6D 4KHAB 3V9RA 1P3AB 2BYMB 3WTPE 3WA9C 1F1EA 5B40D 2L5AA 5AV8D 2IO5B 5B1MD 4R8PB 1M19B 5B33B 3AZMA 1M1AA 3B0CT 2CWEA 5B24C 5KDMB 3MVDD 2NQBA 5CP6C 3AZNB 5B31B 4Z5TB 1P3GA 1P3FC 3X1TA 5CPJB 3C1BA 3UT9B 4X23C 4YM6D 3MGSD 4J8UC 3REID 2AROA 4AWLB 5GSUD 1JFIA 2HIOB 4XUJD 1M18B 3AYWB 5AVBC 5B2JA 4DRBA 1P3PC 3W98C 3LJAB 5F99B 5GT3D 2NZDD 1KX5A 3X1VD 1P3IC 4M6BA 2FJ7C 3LZ1D 3AV1D 1P3MA 4UUZB 3LZ0D 3X1TC 3W99D 5BNVB 1R4VA 3REJC 3UTBA 5AV5A 1TZYC 5AV9B 1AOIA 5FUGA 3B6GD 4J8XB 1P3KB 5B0YA 3V9RB 1EQZD 3AV2C
chains in the Genus database with same CATH superfamily
1B67A 1B6WA 2RIQA 5DNNC 2F2AC 5CP6D 3AZMB 1M1AB 5DNMA 4EO5B 2Y2KA 2LY8A 1P3FD 2HUEB 3AN2C 2NQBB 5GXQD 5E5AA 5BNXA 4X23D 1P3BD 1P3GB 3AZHC 5C3IC 1P34C 4J8UD 2F8NA 2Y2QA 2VQRA 3X1TB 5AY8C 3C1BB 4J8WA 3TU4A 2AROB 2XD1A 2CV5C 1JFIB 3A6NA 4WU9B 3VH6W 2UWXA 1P3PD 3W98D 1AOIC 1P3ID 4KGCA 3WKJC 5B2JB 3AZKA 1T3UA 3AZFA 3KXBB 2FJ7D 5GT0C 5DNMC 4ZBJB 1ID3D 1P3AA 5JRGA 3REKA 1KX5B 3MGQC 3AFAD 3X1SD 3REJD 5B40A 3MNNB 1TZYD 1P3MB 5B1LA 3FDDA 3AZLA 3B6FD 2PYOC 4YS3C 4DQYB 3WAAC 3REHD 3UTBB 5AV5B 3AZNA 1ULYA 3WTPA 5FUGB 5DNND 5B0YB 3A6NC 4G91B 1BFMA 2BYKA 3UT9A 3UTAC 3RELA 2G5HC 3VH5W 4ZUXA 3AN2D 3MGSA 2JCHA 3KUYC 3AZFC 4WV4B 4WU8C 3MGPC 3AZHD 1P34D 1ZLAD 3F6TA 1HQ3B 1U35D 1P3AC 1KX3A 5AY8D 3AZIA 5E5AB 5BNXB 4CAYA 4R8PC 2IO5C 3MGRA 1M19C 2F8NB 5B33C 4J8WB 3TU4B 3AZNC 5B31C 4Z5TC 2J8PA 3X1UB 3WKJD 4WZSB 3AZJA 4J8VD 3UT9C 4KGCB 3AZKB 4LD9B 4AWLC 4H9RA 1P3LD 5JRGB 5AV6B 2HIOC 3LELD 2W8SA 3REKB 4YS3D 2PYOD 4WJ3C 1M18C 3P5JB 5B40B 3AYWC 5B31G 5B1LB 2JSSA 4H9SC 3AZLB 4H9QA 5BT1C 3LJAC 4H9PA 5F99C 3WTPB 4H9NA 3UTAD 3W97A 3KUYD 4WU8D 3MGPD 2BYKB 3RELB 4ZUXB 3MGSB 5AV9C 4J8XC 1P3KC 4WU9A 4R8PD 1P3OA 3W96A 1M19D 5GSUB 3EG5B 3AZGA 1KX3B 2FFFB 1N1JA 3AZIB 4CAYB 3KSYA 3MGRB 3KXBA 2RVQD 3AZMC 1M1AC 5B31D 4Z5TD 4EO5C 4Z66A 1ID3A 5GT3B 3EPLA 3NQUA 5CPJD 3KWQD 2HUEC 2NQBC 4KUDD 3B0BA 3MNNA 1P3GC 4JJNA 3LZ1B 3AL0C 1H3OA 3AZJB 1F66A 2Y2LA 5JA4A 1KX4A 3C1BC 3LZ0B 3W99B 2HIOD 3REHA 3WA9D 3EPJA 2AROC 3B6GB 4H9RB 3AYWD 5CPKA 4WU9C 5BT1D 1EQZB 5B24D 3LJAD 5F99D 5B2JC 4H9QB 3KXBC 4H9PB 4ZBJC 1HQ3A 4DRAA 1KX5C 2BG1A 4H9NB 5GXQB 3O62A 3W97B 1P3BB 4WNNA 3MNNC 1P3MC 5B32A 3AZEA 4J8XD 1P3KD 5AVCA 3UTBC 5AV5C 4QLCA 5B2IA 5AVBD 1S32A 3X1UA 1P3OB 5B0YC 5CPIA 5B0ZA 3W96B 3AZMD 1M1AD 3AZGB 4G91C 1N1JB 3C1CA 4XZQA 2NQBD 4LD9A 3A1KA 1P3GD 4Z66B 5AV6A 1ID3B 1HQ3C 3NQUB 3X1TD 3C1BD 5E5AC 3AFAB 4JJNB 5AV8A 3X1SB 5B1MA 1H3OB 2AROD 1F66B 2Y2IA 1KU5A 5JA4B 1KX4B 3AV2D 4J8WC 3TU4C 3REHB 3MVDA 1BH9A 2ZY2A 3X1UC 5CPKB 4NE3A 5B2JD 2Y2PA 1HTAA 5CPIC 3R45A 4YM6A 3REIA 1KX5D 4KGCC 3AZKC 4LD9C 5GSUA 1P3MD 1ZLAB 5JRGC 5AV6C 3REKC 3B0CW 4XUJA 1U35B 3O62B 1WWSA 3UTBD 4WNNB 5AV5D 5B40C 5B1LC 4HGAB 5B32B 3AZEB 3AZLC 2CV5D 4E44A 4G92B 5AVCB 5GT3A 5B0YD 4UPKA 1AOID 3X1VA 4QLCB 5B2IB 2NZDA 3WTPC 1S32B 3LZ1A 3AV1A 5CPIB 3VH6T 5B0ZB 2G5IC 5GT0D 5DNMD 1BH8A 4J8VB 4H9OA 3LZ0A 3W99A 3RELC 3MGQD 4ZUXC 3C1CB 4XZQB 3MGSC 3WA9A 2Y2GA 5E5AD 3B6GA 2ZY3A 2F8ND 4Z2MG 5GSUC 1EQZA 1P3LB 1KX3C 3LELB 3WAAD 3AZIC 1A7WA 4J8WD 3TU4D 5AV8B 5B1MB 3MGRC 5CP6A 3A1IA 1P3FA 3H0LC 1W2EA 1Z2CB 5GT3C 3A6ND 3MVDB 5GXQA 1BH9B 4X23A 4NE6A 1P3BA 4J8UA 3LZ1C 4KGCD 3AZFD 3AZKD 3R45B 3AZJC 4Z2MH 3VH6A 5BO0A 1P3AD 3LZ0C 5JRGD 3VH5T 4YM6B 3W99C 3REIB 3REKD 5AVBA 3B6GC 5B33D 5B1LD 3AZLD 1P3PA 3W98A 4XUJB 1EQZC 1P3IA 3AZND 2FJ7A 3WTPD 2NZDB 3X1VB 1TAFA 4CSRA 3AFAA 3KWQB 3UT9D 5GXQC 3RELD 3X1SA 3REJA 2Y2OA 1P3BC 1TZYA 4ZUXD 3B0DB 3AV1B 3W97C 3B6FA 1BH8B 4H9OB 3AV2A 1KX3D 1M18D 3AZID 3WA9B 3VH5A 2ZY5A 5DNNA 1P3OC 3MGRD 3W96C 3AZGC 4NE5A 5B24B 5G49A 3AN2A 1WWIA 5CP6B 3AZHA 4Z66C 1P34A 1ZLAA 2Y2JA 1P3FB 1ID3C 2JE5A 3AZJD 1U35A 5AY8A 4X23B 3AFAC 4JJNC 5AV9D 4J8UB 3X1SC 2YFWB 1F66C 3B6FC 2CV5A 1KX4C 5BO0B 2YFVB 3REHC 2XD5A 2Y2NA 5AVBB 3KFUG 3WKJA 5CPKC 1P3PB 3W98B 5GT0A 4J8VA 3MGQA 1P3IB 2FJ7B 5BS7A 3W97D 1P3LA 1ZLAC 3LELA 2PYOA 4YS3A 1TAFB 4CSRB 1U35C 3WAAA 3O62C 3REJB 1TZYB 3B6FB 5B32C 4HGAC 3AZEC 4G92C 4WU9D 5AVCC 1P3OD 3W96D 3AV2B 3AZGD 4QLCC 5B2IC 3UTAA 3NQJA 1S32C 5DNNB 5B0ZC 3KXBD 3KUYA 4WU8A 3MGPA 4Z66D 4J8VC 4KHAA 5G49B 2BYMA 3AN2B 3C1CC 4XZQC 2F8NG 3MNND 3AZHB 5C3IB 5B32G 4JJND 5BS7C 4R8PA 1P34B 1M19A 5B33A 1P3LC 1F66D 5AY8B 3LELC 1KX4D 2ZY4A 5AV8C 5KDMA 5B1MC 5B31A 4Z5TA 2CV5B 5CPKD 3KWQA 3MVDC 5CPJA 1AOIB 4KUDA 4E45A 2F8NH 3WKJB 5GT0B 5DNMB 5CHLB 1HQ3D 4NFTA 4KUDB 2HIOA 4YM6C 3EPHA 3MGQB 3REIC 1PZRA 1M18A 3O62D 3AYWA 4H9SA 5B32D 3AZED 2PYOB 5B24A 4XUJC 5F99A 3LJAA 4YS3B 5AVCD 3WAAB 1Q9CA 4QLCD 5B2ID 1S32D 2RVQC 3X1UD 5CPID 5B0ZD 3A6NB 2NZDC 3X1VC 2F8NK 4UUZA 3UTAB 3NQJB 3KWQC 5CPJC 3H0MC 2Y2MA 5BNVA 4KUDC 2YFWA 3AV1C 3B0DC 5AV9A 4XZQD 3KUYB 3C1CD 4LD9D 3AZFB 4WU8B 4J8XA 3MGPB 2Y2HA 1P3KA 2YFVA 5AV6D 4KHAB 3V9RA 1P3AB 2BYMB 3WTPE 3WA9C 1F1EA 5B40D 2L5AA 3IP4C 5AV8D 2IO5B 5B1MD 4R8PB 1M19B 5B33B 3AZMA 1M1AA 3B0CT 2CWEA 5B24C 5KDMB 3MVDD 2NQBA 5CP6C 3AZNB 5B31B 4Z5TB 1P3GA 1P3FC 3X1TA 5CPJB 3C1BA 3UT9B 4X23C 4YM6D 3MGSD 4J8UC 3REID 2AROA 4AWLB 5GSUD 1JFIA 2HIOB 4XUJD 1M18B 3AYWB 5AVBC 5B2JA 4DRBA 2ZM5A 1P3PC 3W98C 3LJAB 5F99B 5GT3D 2NZDD 1KX5A 3X1VD 1P3IC 3EPKA 4M6BA 2FJ7C 3LZ1D 3AV1D 1P3MA 4UUZB 3LZ0D 3X1TC 3W99D 5BNVB 1R4VA 3H0RC 3REJC 5AV5A 1TZYC 2DQNC 3UTBA 5AV9B 1AOIA 5FUGA 3B6GD 4J8XB 2DF4C 1P3KB 5B0YA 3V9RB 1EQZD 3AV2C
chains in the Genus database with same CATH topology
1B67A 1B6WA 2RIQA 5DNNC 2F2AC 5CP6D 3AZMB 1M1AB 5DNMA 4EO5B 2Y2KA 2LY8A 1P3FD 2HUEB 3AN2C 2NQBB 5GXQD 5E5AA 5BNXA 4X23D 1P3BD 1P3GB 3AZHC 5C3IC 1P34C 4J8UD 2F8NA 2Y2QA 2VQRA 3X1TB 5AY8C 3C1BB 4J8WA 3TU4A 2AROB 2XD1A 2CV5C 1JFIB 3A6NA 4WU9B 3VH6W 2UWXA 1P3PD 3W98D 1AOIC 1P3ID 4KGCA 3WKJC 5B2JB 3AZKA 1T3UA 3AZFA 3KXBB 2FJ7D 5GT0C 5DNMC 4ZBJB 1ID3D 1P3AA 5JRGA 3REKA 1KX5B 3MGQC 3AFAD 3X1SD 3REJD 5B40A 3MNNB 1TZYD 1P3MB 5B1LA 3FDDA 3AZLA 3B6FD 2PYOC 4YS3C 4DQYB 3WAAC 3REHD 3UTBB 5AV5B 3AZNA 1ULYA 3WTPA 5FUGB 5DNND 5B0YB 3A6NC 4G91B 1BFMA 2BYKA 3UT9A 3UTAC 3RELA 2G5HC 3VH5W 4ZUXA 3AN2D 3MGSA 2JCHA 3KUYC 3AZFC 4WV4B 4WU8C 3MGPC 3AZHD 1P34D 1ZLAD 3F6TA 1HQ3B 1U35D 1P3AC 1KX3A 5AY8D 3AZIA 5E5AB 5BNXB 4CAYA 4R8PC 2IO5C 3MGRA 1M19C 2F8NB 5B33C 4J8WB 3TU4B 3AZNC 5B31C 4Z5TC 2J8PA 3X1UB 3WKJD 4WZSB 3AZJA 4J8VD 3UT9C 4KGCB 3AZKB 4LD9B 4AWLC 4H9RA 1P3LD 5JRGB 5AV6B 2HIOC 3LELD 2W8SA 3REKB 4YS3D 2PYOD 4WJ3C 1M18C 3P5JB 5B40B 3AYWC 5B31G 5B1LB 2JSSA 4H9SC 3AZLB 4H9QA 5BT1C 3LJAC 4H9PA 5F99C 3WTPB 4H9NA 3UTAD 3W97A 3KUYD 4WU8D 3MGPD 2BYKB 3RELB 4ZUXB 3MGSB 5AV9C 4J8XC 1P3KC 4WU9A 4R8PD 1P3OA 3W96A 1M19D 5GSUB 3EG5B 3AZGA 1KX3B 2FFFB 1N1JA 3AZIB 4CAYB 3KSYA 3MGRB 3KXBA 2RVQD 3AZMC 1M1AC 5B31D 4Z5TD 4EO5C 4Z66A 1ID3A 5GT3B 3EPLA 3NQUA 5CPJD 3KWQD 2HUEC 2NQBC 4KUDD 3B0BA 3MNNA 1P3GC 4JJNA 3LZ1B 3AL0C 1H3OA 3AZJB 1F66A 2Y2LA 5JA4A 1KX4A 3C1BC 3LZ0B 3W99B 2HIOD 3REHA 3WA9D 3EPJA 2AROC 3B6GB 4H9RB 3AYWD 5CPKA 4WU9C 5BT1D 1EQZB 5B24D 3LJAD 5F99D 5B2JC 4H9QB 3KXBC 4H9PB 4ZBJC 1HQ3A 4DRAA 1KX5C 2BG1A 4H9NB 5GXQB 3O62A 3W97B 1P3BB 4WNNA 3MNNC 1P3MC 5B32A 3AZEA 4J8XD 1P3KD 5AVCA 3UTBC 5AV5C 4QLCA 5B2IA 5AVBD 1S32A 3X1UA 1P3OB 5B0YC 5CPIA 5B0ZA 3W96B 3AZMD 1M1AD 3AZGB 4G91C 1N1JB 3C1CA 4XZQA 2NQBD 4LD9A 3A1KA 1P3GD 4Z66B 5AV6A 1ID3B 1HQ3C 3NQUB 3X1TD 3C1BD 5E5AC 3AFAB 4JJNB 5AV8A 3X1SB 5B1MA 1H3OB 2AROD 1F66B 2Y2IA 1KU5A 5JA4B 1KX4B 3AV2D 4J8WC 3TU4C 3REHB 3MVDA 1BH9A 2ZY2A 3X1UC 5CPKB 4NE3A 5B2JD 2Y2PA 1HTAA 5CPIC 3R45A 4YM6A 3REIA 1KX5D 4KGCC 3AZKC 4LD9C 5GSUA 1P3MD 1ZLAB 5JRGC 5AV6C 3REKC 3B0CW 4XUJA 1U35B 3O62B 1WWSA 3UTBD 4WNNB 5AV5D 5B40C 5B1LC 4HGAB 5B32B 3AZEB 3AZLC 2CV5D 4E44A 4G92B 5AVCB 5GT3A 5B0YD 4UPKA 1AOID 3X1VA 4QLCB 5B2IB 2NZDA 3WTPC 1S32B 3LZ1A 3AV1A 5CPIB 3VH6T 5B0ZB 2G5IC 5GT0D 5DNMD 1BH8A 4J8VB 4H9OA 3LZ0A 3W99A 3RELC 3MGQD 4ZUXC 3C1CB 4XZQB 3MGSC 3WA9A 2Y2GA 5E5AD 3B6GA 2ZY3A 2F8ND 4Z2MG 5GSUC 1EQZA 1P3LB 1KX3C 3LELB 3WAAD 3AZIC 1A7WA 4J8WD 3TU4D 5AV8B 5B1MB 3MGRC 5CP6A 3A1IA 1P3FA 3H0LC 1W2EA 1Z2CB 5GT3C 3A6ND 3MVDB 5GXQA 1BH9B 4X23A 4NE6A 1P3BA 4J8UA 3LZ1C 4KGCD 3AZFD 3AZKD 3R45B 3AZJC 4Z2MH 3VH6A 5BO0A 1P3AD 3LZ0C 5JRGD 3VH5T 4YM6B 3W99C 3REIB 3REKD 5AVBA 3B6GC 5B33D 5B1LD 3AZLD 1P3PA 3W98A 4XUJB 1EQZC 1P3IA 3AZND 2FJ7A 3WTPD 2NZDB 3X1VB 1TAFA 4CSRA 3AFAA 3KWQB 3UT9D 5GXQC 3RELD 3X1SA 3REJA 2Y2OA 1P3BC 1TZYA 4ZUXD 3B0DB 3AV1B 3W97C 3B6FA 1BH8B 4H9OB 3AV2A 1KX3D 1M18D 3AZID 3WA9B 3VH5A 2ZY5A 5DNNA 1P3OC 3MGRD 3W96C 3AZGC 4NE5A 5B24B 5G49A 3AN2A 1WWIA 5CP6B 3AZHA 4Z66C 1P34A 1ZLAA 2Y2JA 1P3FB 1ID3C 2JE5A 3AZJD 1U35A 5AY8A 4X23B 3AFAC 4JJNC 5AV9D 4J8UB 3X1SC 2YFWB 1F66C 3B6FC 2CV5A 1KX4C 5BO0B 2YFVB 3REHC 2XD5A 2Y2NA 5AVBB 3KFUG 3WKJA 5CPKC 1P3PB 3W98B 5GT0A 4J8VA 3MGQA 1P3IB 2FJ7B 5BS7A 3W97D 1P3LA 1ZLAC 3LELA 2PYOA 4YS3A 1TAFB 4CSRB 1U35C 3WAAA 3O62C 3REJB 1TZYB 3B6FB 5B32C 4HGAC 3AZEC 4G92C 4WU9D 5AVCC 1P3OD 3W96D 3AV2B 3AZGD 4QLCC 5B2IC 3UTAA 3NQJA 1S32C 5DNNB 5B0ZC 3KXBD 3KUYA 4WU8A 3MGPA 4Z66D 4J8VC 4KHAA 5G49B 2BYMA 3AN2B 3C1CC 4XZQC 2F8NG 3MNND 3AZHB 5C3IB 5B32G 4JJND 5BS7C 4R8PA 1P34B 1M19A 5B33A 1P3LC 1F66D 5AY8B 3LELC 1KX4D 2ZY4A 5AV8C 5KDMA 5B1MC 5B31A 4Z5TA 2CV5B 5CPKD 3KWQA 3MVDC 5CPJA 1AOIB 4KUDA 4E45A 2F8NH 3WKJB 5GT0B 5DNMB 5CHLB 1HQ3D 4NFTA 4KUDB 2HIOA 4YM6C 3EPHA 3MGQB 3REIC 1PZRA 1M18A 3O62D 3AYWA 4H9SA 5B32D 3AZED 2PYOB 5B24A 4XUJC 5F99A 3LJAA 4YS3B 5AVCD 3WAAB 1Q9CA 4QLCD 5B2ID 1S32D 2RVQC 3X1UD 5CPID 5B0ZD 3A6NB 2NZDC 3X1VC 2F8NK 4UUZA 3UTAB 3NQJB 3KWQC 5CPJC 3H0MC 2Y2MA 5BNVA 4KUDC 2YFWA 3AV1C 3B0DC 5AV9A 4XZQD 3KUYB 3C1CD 4LD9D 3AZFB 4WU8B 4J8XA 3MGPB 2Y2HA 1P3KA 2YFVA 5AV6D 4KHAB 3V9RA 1P3AB 2BYMB 3WTPE 3WA9C 1F1EA 5B40D 2L5AA 3IP4C 5AV8D 2IO5B 5B1MD 4R8PB 1M19B 5B33B 3AZMA 1M1AA 3B0CT 2CWEA 5B24C 5KDMB 3MVDD 2NQBA 5CP6C 3AZNB 5B31B 4Z5TB 1P3GA 1P3FC 3X1TA 5CPJB 3C1BA 3UT9B 4X23C 4YM6D 3MGSD 4J8UC 3REID 2AROA 4AWLB 5GSUD 1JFIA 2HIOB 4XUJD 1M18B 3AYWB 5AVBC 5B2JA 4DRBA 2ZM5A 1P3PC 3W98C 3LJAB 5F99B 5GT3D 2NZDD 1KX5A 3X1VD 1P3IC 3EPKA 4M6BA 2FJ7C 3LZ1D 3AV1D 1P3MA 4UUZB 3LZ0D 3X1TC 3W99D 5BNVB 1R4VA 3H0RC 3REJC 5AV5A 1TZYC 2DQNC 3UTBA 5AV9B 1AOIA 5FUGA 3B6GD 4J8XB 2DF4C 1P3KB 5B0YA 3V9RB 1EQZD 3AV2C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1B67 A;  1B6W A;  5DNN C;  5CP6 D;  3AZM B;  1M1A B;  5DNM A;  4EO5 B;  2LY8 A;  1P3F D;  2HUE B;  3AN2 C;  2NQB B;  5GXQ D;  5E5A A;  5BNX A;  4X23 D;  1P3B D;  1P3G B;  3AZH C;  5C3I C;  1P34 C;  4J8U D;  2F8N A;  3X1T B;  5AY8 C;  3C1B B;  4J8W A;  3TU4 A;  2ARO B;  2CV5 C;  1JFI B;  3A6N A;  4WU9 B;  3VH6 W;  1P3P D;  3W98 D;  1AOI C;  1P3I D;  4KGC A;  3WKJ C;  5B2J B;  3AZK A;  3AZF A;  2FJ7 D;  3KXB B;  5GT0 C;  5DNM C;  4ZBJ B;  1ID3 D;  1P3A A;  5JRG A;  3REK A;  1KX5 B;  3MGQ C;  3AFA D;  3X1S D;  3REJ D;  5B40 A;  3MNN B;  1TZY D;  1P3M B;  5B1L A;  3B6F D;  3AZL A;  2PYO C;  4YS3 C;  3WAA C;  3REH D;  3UTB B;  5AV5 B;  3AZN A;  1ULY A;  3WTP A;  5FUG B;  5DNN D;  5B0Y B;  3A6N C;  4G91 B;  1BFM A;  2BYK A;  3UT9 A;  3UTA C;  3REL A;  3VH5 W;  4ZUX A;  3AN2 D;  3MGS A;  3KUY C;  3AZF C;  4WV4 B;  4WU8 C;  3MGP C;  3AZH D;  1P34 D;  1ZLA D;  1HQ3 B;  1U35 D;  1P3A C;  1KX3 A;  5AY8 D;  3AZI A;  5E5A B;  5BNX B;  4CAY A;  4R8P C;  2IO5 C;  3MGR A;  1M19 C;  2F8N B;  5B33 C;  4J8W B;  3TU4 B;  3AZN C;  5B31 C;  4Z5T C;  3X1U B;  3WKJ D;  4WZS B;  3AZJ A;  4J8V D;  3UT9 C;  4KGC B;  3AZK B;  4LD9 B;  4AWL C;  4H9R A;  1P3L D;  5JRG B;  5AV6 B;  2HIO C;  3LEL D;  3REK B;  2PYO D;  4YS3 D;  1M18 C;  5B40 B;  3AYW C;  5B31 G;  5B1L B;  4H9S C;  2JSS A;  3AZL B;  4H9Q A;  5BT1 C;  3LJA C;  4H9P A;  5F99 C;  3WTP B;  4H9N A;  3UTA D;  3W97 A;  3KUY D;  4WU8 D;  3MGP D;  2BYK B;  3REL B;  4ZUX B;  3MGS B;  5AV9 C;  4J8X C;  1P3K C;  4WU9 A;  4R8P D;  1P3O A;  3W96 A;  1M19 D;  5GSU B;  3AZG A;  1KX3 B;  1N1J A;  3AZI B;  4CAY B;  3KSY A;  3MGR B;  3KXB A;  2RVQ D;  3AZM C;  1M1A C;  5B31 D;  4Z5T D;  4EO5 C;  4Z66 A;  1ID3 A;  5GT3 B;  3NQU A;  5CPJ D;  3KWQ D;  2HUE C;  2NQB C;  4KUD D;  3B0B A;  3MNN A;  1P3G C;  4JJN A;  3LZ1 B;  1H3O A;  3AZJ B;  1F66 A;  5JA4 A;  1KX4 A;  3C1B C;  3LZ0 B;  3W99 B;  2HIO D;  3REH A;  3WA9 D;  2ARO C;  3B6G B;  4H9R B;  3AYW D;  5CPK A;  4WU9 C;  5BT1 D;  1EQZ B;  5B24 D;  3LJA D;  5F99 D;  5B2J C;  4H9Q B;  3KXB C;  4H9P B;  4ZBJ C;  1HQ3 A;  4DRA A;  1KX5 C;  4H9N B;  5GXQ B;  3O62 A;  3W97 B;  1P3B B;  4WNN A;  3MNN C;  1P3M C;  5B32 A;  3AZE A;  4J8X D;  1P3K D;  5AVC A;  3UTB C;  5AV5 C;  4QLC A;  5B2I A;  5AVB D;  1S32 A;  3X1U A;  1P3O B;  5B0Y C;  5CPI A;  5B0Z A;  3W96 B;  3AZM D;  1M1A D;  3AZG B;  4G91 C;  1N1J B;  3C1C A;  4XZQ A;  2NQB D;  4LD9 A;  1P3G D;  4Z66 B;  5AV6 A;  1ID3 B;  1HQ3 C;  3NQU B;  3X1T D;  3C1B D;  5E5A C;  3AFA B;  4JJN B;  5AV8 A;  3X1S B;  5B1M A;  1H3O B;  2ARO D;  1F66 B;  1KU5 A;  5JA4 B;  1KX4 B;  3AV2 D;  4J8W C;  3TU4 C;  3REH B;  3MVD A;  1BH9 A;  3X1U C;  5CPK B;  4NE3 A;  5B2J D;  5CPI C;  1HTA A;  3R45 A;  4YM6 A;  3REI A;  1KX5 D;  4KGC C;  3AZK C;  4LD9 C;  5GSU A;  1P3M D;  1ZLA B;  5JRG C;  5AV6 C;  3REK C;  3B0C W;  4XUJ A;  1U35 B;  3O62 B;  1WWS A;  3UTB D;  4WNN B;  5AV5 D;  5B40 C;  5B1L C;  4HGA B;  5B32 B;  3AZE B;  3AZL C;  2CV5 D;  4E44 A;  4G92 B;  5AVC B;  5GT3 A;  5B0Y D;  2NZD A;  1AOI D;  3X1V A;  4QLC B;  5B2I B;  3WTP C;  1S32 B;  3LZ1 A;  3AV1 A;  5CPI B;  3VH6 T;  5B0Z B;  5GT0 D;  5DNM D;  1BH8 A;  4J8V B;  4H9O A;  3LZ0 A;  3W99 A;  3REL C;  3MGQ D;  4ZUX C;  3C1C B;  4XZQ B;  3MGS C;  3WA9 A;  5E5A D;  3B6G A;  2F8N D;  4Z2M G;  5GSU C;  1EQZ A;  1P3L B;  1KX3 C;  3LEL B;  3WAA D;  3AZI C;  1A7W A;  4J8W D;  3TU4 D;  5AV8 B;  5B1M B;  3MGR C;  5CP6 A;  1P3F A;  3A6N D;  5GT3 C;  3MVD B;  5GXQ A;  1BH9 B;  4X23 A;  4NE6 A;  1P3B A;  4J8U A;  3LZ1 C;  4KGC D;  3AZF D;  3AZK D;  3R45 B;  3AZJ C;  4Z2M H;  3VH6 A;  5BO0 A;  1P3A D;  3LZ0 C;  5JRG D;  3VH5 T;  4YM6 B;  3W99 C;  3REI B;  3REK D;  5AVB A;  3B6G C;  5B33 D;  5B1L D;  3AZL D;  1P3P A;  3W98 A;  4XUJ B;  1EQZ C;  1P3I A;  3AZN D;  2FJ7 A;  3WTP D;  2NZD B;  3X1V B;  1TAF A;  4CSR A;  3AFA A;  3KWQ B;  3UT9 D;  5GXQ C;  3REL D;  3X1S A;  3REJ A;  3W97 C;  1P3B C;  1TZY A;  4ZUX D;  3B0D B;  3AV1 B;  4KUD B;  3B6F A;  1BH8 B;  4H9O B;  3AV2 A;  1KX3 D;  1M18 D;  3AZI D;  3WA9 B;  3VH5 A;  5DNN A;  1P3O C;  3MGR D;  3W96 C;  3AZG C;  4NE5 A;  5B24 B;  5G49 A;  3AN2 A;  1WWI A;  5CP6 B;  3AZH A;  4Z66 C;  1P34 A;  1ZLA A;  1P3F B;  1ID3 C;  1U35 A;  3AZJ D;  5AY8 A;  4X23 B;  3AFA C;  4JJN C;  5AV9 D;  4J8U B;  3X1S C;  2YFW B;  1F66 C;  3B6F C;  2CV5 A;  1KX4 C;  5BO0 B;  2YFV B;  3REH C;  5AVB B;  3WKJ A;  5CPK C;  1P3P B;  3W98 B;  5GT0 A;  4J8V A;  3MGQ A;  1P3I B;  2FJ7 B;  5BS7 A;  3W97 D;  1P3L A;  1ZLA C;  3LEL A;  2PYO A;  4YS3 A;  1TAF B;  4CSR B;  1U35 C;  3WAA A;  3O62 C;  3REJ B;  1TZY B;  3B6F B;  5B32 C;  4HGA C;  3AZE C;  4G92 C;  4WU9 D;  5AVC C;  1P3O D;  3W96 D;  3AV2 B;  3AZG D;  4QLC C;  5B2I C;  3UTA A;  3NQJ A;  1S32 C;  5DNN B;  5B0Z C;  3KXB D;  3KUY A;  4WU8 A;  3MGP A;  4Z66 D;  4J8V C;  4KHA A;  5G49 B;  2BYM A;  3AN2 B;  3C1C C;  4XZQ C;  2F8N G;  3MNN D;  3AZH B;  5C3I B;  5B32 G;  4JJN D;  5BS7 C;  4R8P A;  1P34 B;  1M19 A;  5B33 A;  1P3L C;  1F66 D;  5AY8 B;  3LEL C;  1KX4 D;  5AV8 C;  5KDM A;  5B1M C;  5B31 A;  4Z5T A;  2CV5 B;  5CPK D;  3KWQ A;  3MVD C;  5CPJ A;  1AOI B;  4KUD A;  4E45 A;  2F8N H;  3WKJ B;  5GT0 B;  5DNM B;  5CHL B;  1HQ3 D;  4NFT A;  2HIO A;  4YM6 C;  3MGQ B;  3REI C;  1M18 A;  3O62 D;  3AYW A;  4H9S A;  5B32 D;  3AZE D;  2PYO B;  5B24 A;  4XUJ C;  5F99 A;  3LJA A;  4YS3 B;  5AVC D;  3WAA B;  1Q9C A;  4QLC D;  5B2I D;  1S32 D;  2RVQ C;  3X1U D;  5CPI D;  5B0Z D;  3A6N B;  2NZD C;  3X1V C;  2F8N K;  4UUZ A;  3UTA B;  3NQJ B;  3KWQ C;  5CPJ C;  5BNV A;  4KUD C;  2YFW A;  3AV1 C;  3B0D C;  5AV9 A;  4XZQ D;  3KUY B;  3C1C D;  4LD9 D;  3AZF B;  4WU8 B;  4J8X A;  3MGP B;  1P3K A;  2YFV A;  5AV6 D;  4KHA B;  3V9R A;  1P3A B;  2BYM B;  3WTP E;  3WA9 C;  1F1E A;  5B40 D;  2L5A A;  5AV8 D;  2IO5 B;  5B1M D;  4R8P B;  1M19 B;  5B33 B;  3AZM A;  1M1A A;  3B0C T;  2CWE A;  5B24 C;  5KDM B;  3MVD D;  2NQB A;  5CP6 C;  3AZN B;  5B31 B;  4Z5T B;  1P3G A;  1P3F C;  3X1T A;  5CPJ B;  3C1B A;  3UT9 B;  4X23 C;  4YM6 D;  3MGS D;  4J8U C;  3REI D;  2ARO A;  4AWL B;  5GSU D;  1JFI A;  2HIO B;  4XUJ D;  1M18 B;  3AYW B;  5AVB C;  5B2J A;  4DRB A;  1P3P C;  3W98 C;  3LJA B;  5F99 B;  5GT3 D;  2NZD D;  1KX5 A;  3X1V D;  1P3I C;  4M6B A;  2FJ7 C;  3LZ1 D;  3AV1 D;  1P3M A;  4UUZ B;  3LZ0 D;  3X1T C;  3W99 D;  5BNV B;  1R4V A;  3REJ C;  3UTB A;  5AV5 A;  1TZY C;  5AV9 B;  1AOI A;  5FUG A;  3B6G D;  4J8X B;  1P3K B;  5B0Y A;  3V9R B;  1EQZ D;  3AV2 C; 
#chains in the Genus database with same CATH topology
 1B67 A;  1B6W A;  2RIQ A;  5DNN C;  2F2A C;  5CP6 D;  3AZM B;  1M1A B;  5DNM A;  4EO5 B;  2Y2K A;  2LY8 A;  1P3F D;  2HUE B;  3AN2 C;  2NQB B;  5GXQ D;  5E5A A;  5BNX A;  4X23 D;  1P3B D;  1P3G B;  3AZH C;  5C3I C;  1P34 C;  4J8U D;  2F8N A;  2Y2Q A;  2VQR A;  3X1T B;  5AY8 C;  3C1B B;  4J8W A;  3TU4 A;  2ARO B;  2XD1 A;  2CV5 C;  1JFI B;  3A6N A;  4WU9 B;  3VH6 W;  2UWX A;  1P3P D;  3W98 D;  1AOI C;  1P3I D;  4KGC A;  3WKJ C;  5B2J B;  3AZK A;  1T3U A;  3AZF A;  3KXB B;  2FJ7 D;  5GT0 C;  5DNM C;  4ZBJ B;  1ID3 D;  1P3A A;  5JRG A;  3REK A;  1KX5 B;  3MGQ C;  3AFA D;  3X1S D;  3REJ D;  5B40 A;  3MNN B;  1TZY D;  1P3M B;  5B1L A;  3FDD A;  3AZL A;  3B6F D;  2PYO C;  4YS3 C;  4DQY B;  3WAA C;  3REH D;  3UTB B;  5AV5 B;  3AZN A;  1ULY A;  3WTP A;  5FUG B;  5DNN D;  5B0Y B;  3A6N C;  4G91 B;  1BFM A;  2BYK A;  3UT9 A;  3UTA C;  3REL A;  2G5H C;  3VH5 W;  4ZUX A;  3AN2 D;  3MGS A;  2JCH A;  3KUY C;  3AZF C;  4WV4 B;  4WU8 C;  3MGP C;  3AZH D;  1P34 D;  1ZLA D;  3F6T A;  1HQ3 B;  1U35 D;  1P3A C;  1KX3 A;  5AY8 D;  3AZI A;  5E5A B;  5BNX B;  4CAY A;  4R8P C;  2IO5 C;  3MGR A;  1M19 C;  2F8N B;  5B33 C;  4J8W B;  3TU4 B;  3AZN C;  5B31 C;  4Z5T C;  2J8P A;  3X1U B;  3WKJ D;  4WZS B;  3AZJ A;  4J8V D;  3UT9 C;  4KGC B;  3AZK B;  4LD9 B;  4AWL C;  4H9R A;  1P3L D;  5JRG B;  5AV6 B;  2HIO C;  3LEL D;  2W8S A;  3REK B;  4YS3 D;  2PYO D;  4WJ3 C;  1M18 C;  3P5J B;  5B40 B;  3AYW C;  5B31 G;  5B1L B;  2JSS A;  4H9S C;  3AZL B;  4H9Q A;  5BT1 C;  3LJA C;  4H9P A;  5F99 C;  3WTP B;  4H9N A;  3UTA D;  3W97 A;  3KUY D;  4WU8 D;  3MGP D;  2BYK B;  3REL B;  4ZUX B;  3MGS B;  5AV9 C;  4J8X C;  1P3K C;  4WU9 A;  4R8P D;  1P3O A;  3W96 A;  1M19 D;  5GSU B;  3EG5 B;  3AZG A;  1KX3 B;  2FFF B;  1N1J A;  3AZI B;  4CAY B;  3KSY A;  3MGR B;  3KXB A;  2RVQ D;  3AZM C;  1M1A C;  5B31 D;  4Z5T D;  4EO5 C;  4Z66 A;  1ID3 A;  5GT3 B;  3EPL A;  3NQU A;  5CPJ D;  3KWQ D;  2HUE C;  2NQB C;  4KUD D;  3B0B A;  3MNN A;  1P3G C;  4JJN A;  3LZ1 B;  3AL0 C;  1H3O A;  3AZJ B;  1F66 A;  2Y2L A;  5JA4 A;  1KX4 A;  3C1B C;  3LZ0 B;  3W99 B;  2HIO D;  3REH A;  3WA9 D;  3EPJ A;  2ARO C;  3B6G B;  4H9R B;  3AYW D;  5CPK A;  4WU9 C;  5BT1 D;  1EQZ B;  5B24 D;  3LJA D;  5F99 D;  5B2J C;  4H9Q B;  3KXB C;  4H9P B;  4ZBJ C;  1HQ3 A;  4DRA A;  1KX5 C;  2BG1 A;  4H9N B;  5GXQ B;  3O62 A;  3W97 B;  1P3B B;  4WNN A;  3MNN C;  1P3M C;  5B32 A;  3AZE A;  4J8X D;  1P3K D;  5AVC A;  3UTB C;  5AV5 C;  4QLC A;  5B2I A;  5AVB D;  1S32 A;  3X1U A;  1P3O B;  5B0Y C;  5CPI A;  5B0Z A;  3W96 B;  3AZM D;  1M1A D;  3AZG B;  4G91 C;  1N1J B;  3C1C A;  4XZQ A;  2NQB D;  4LD9 A;  3A1K A;  1P3G D;  4Z66 B;  5AV6 A;  1ID3 B;  1HQ3 C;  3NQU B;  3X1T D;  3C1B D;  5E5A C;  3AFA B;  4JJN B;  5AV8 A;  3X1S B;  5B1M A;  1H3O B;  2ARO D;  1F66 B;  2Y2I A;  1KU5 A;  5JA4 B;  1KX4 B;  3AV2 D;  4J8W C;  3TU4 C;  3REH B;  3MVD A;  1BH9 A;  2ZY2 A;  3X1U C;  5CPK B;  4NE3 A;  5B2J D;  2Y2P A;  1HTA A;  5CPI C;  3R45 A;  4YM6 A;  3REI A;  1KX5 D;  4KGC C;  3AZK C;  4LD9 C;  5GSU A;  1P3M D;  1ZLA B;  5JRG C;  5AV6 C;  3REK C;  3B0C W;  4XUJ A;  1U35 B;  3O62 B;  1WWS A;  3UTB D;  4WNN B;  5AV5 D;  5B40 C;  5B1L C;  4HGA B;  5B32 B;  3AZE B;  3AZL C;  2CV5 D;  4E44 A;  4G92 B;  5AVC B;  5GT3 A;  5B0Y D;  4UPK A;  1AOI D;  3X1V A;  4QLC B;  5B2I B;  2NZD A;  3WTP C;  1S32 B;  3LZ1 A;  3AV1 A;  5CPI B;  3VH6 T;  5B0Z B;  2G5I C;  5GT0 D;  5DNM D;  1BH8 A;  4J8V B;  4H9O A;  3LZ0 A;  3W99 A;  3REL C;  3MGQ D;  4ZUX C;  3C1C B;  4XZQ B;  3MGS C;  3WA9 A;  2Y2G A;  5E5A D;  3B6G A;  2ZY3 A;  2F8N D;  4Z2M G;  5GSU C;  1EQZ A;  1P3L B;  1KX3 C;  3LEL B;  3WAA D;  3AZI C;  1A7W A;  4J8W D;  3TU4 D;  5AV8 B;  5B1M B;  3MGR C;  5CP6 A;  3A1I A;  1P3F A;  3H0L C;  1W2E A;  1Z2C B;  5GT3 C;  3A6N D;  3MVD B;  5GXQ A;  1BH9 B;  4X23 A;  4NE6 A;  1P3B A;  4J8U A;  3LZ1 C;  4KGC D;  3AZF D;  3AZK D;  3R45 B;  3AZJ C;  4Z2M H;  3VH6 A;  5BO0 A;  1P3A D;  3LZ0 C;  5JRG D;  3VH5 T;  4YM6 B;  3W99 C;  3REI B;  3REK D;  5AVB A;  3B6G C;  5B33 D;  5B1L D;  3AZL D;  1P3P A;  3W98 A;  4XUJ B;  1EQZ C;  1P3I A;  3AZN D;  2FJ7 A;  3WTP D;  2NZD B;  3X1V B;  1TAF A;  4CSR A;  3AFA A;  3KWQ B;  3UT9 D;  5GXQ C;  3REL D;  3X1S A;  3REJ A;  2Y2O A;  1P3B C;  1TZY A;  4ZUX D;  3B0D B;  3AV1 B;  3W97 C;  3B6F A;  1BH8 B;  4H9O B;  3AV2 A;  1KX3 D;  1M18 D;  3AZI D;  3WA9 B;  3VH5 A;  2ZY5 A;  5DNN A;  1P3O C;  3MGR D;  3W96 C;  3AZG C;  4NE5 A;  5B24 B;  5G49 A;  3AN2 A;  1WWI A;  5CP6 B;  3AZH A;  4Z66 C;  1P34 A;  1ZLA A;  2Y2J A;  1P3F B;  1ID3 C;  2JE5 A;  3AZJ D;  1U35 A;  5AY8 A;  4X23 B;  3AFA C;  4JJN C;  5AV9 D;  4J8U B;  3X1S C;  2YFW B;  1F66 C;  3B6F C;  2CV5 A;  1KX4 C;  5BO0 B;  2YFV B;  3REH C;  2XD5 A;  2Y2N A;  5AVB B;  3KFU G;  3WKJ A;  5CPK C;  1P3P B;  3W98 B;  5GT0 A;  4J8V A;  3MGQ A;  1P3I B;  2FJ7 B;  5BS7 A;  3W97 D;  1P3L A;  1ZLA C;  3LEL A;  2PYO A;  4YS3 A;  1TAF B;  4CSR B;  1U35 C;  3WAA A;  3O62 C;  3REJ B;  1TZY B;  3B6F B;  5B32 C;  4HGA C;  3AZE C;  4G92 C;  4WU9 D;  5AVC C;  1P3O D;  3W96 D;  3AV2 B;  3AZG D;  4QLC C;  5B2I C;  3UTA A;  3NQJ A;  1S32 C;  5DNN B;  5B0Z C;  3KXB D;  3KUY A;  4WU8 A;  3MGP A;  4Z66 D;  4J8V C;  4KHA A;  5G49 B;  2BYM A;  3AN2 B;  3C1C C;  4XZQ C;  2F8N G;  3MNN D;  3AZH B;  5C3I B;  5B32 G;  4JJN D;  5BS7 C;  4R8P A;  1P34 B;  1M19 A;  5B33 A;  1P3L C;  1F66 D;  5AY8 B;  3LEL C;  1KX4 D;  2ZY4 A;  5AV8 C;  5KDM A;  5B1M C;  5B31 A;  4Z5T A;  2CV5 B;  5CPK D;  3KWQ A;  3MVD C;  5CPJ A;  1AOI B;  4KUD A;  4E45 A;  2F8N H;  3WKJ B;  5GT0 B;  5DNM B;  5CHL B;  1HQ3 D;  4NFT A;  4KUD B;  2HIO A;  4YM6 C;  3EPH A;  3MGQ B;  3REI C;  1PZR A;  1M18 A;  3O62 D;  3AYW A;  4H9S A;  5B32 D;  3AZE D;  2PYO B;  5B24 A;  4XUJ C;  5F99 A;  3LJA A;  4YS3 B;  5AVC D;  3WAA B;  1Q9C A;  4QLC D;  5B2I D;  1S32 D;  2RVQ C;  3X1U D;  5CPI D;  5B0Z D;  3A6N B;  2NZD C;  3X1V C;  2F8N K;  4UUZ A;  3UTA B;  3NQJ B;  3KWQ C;  5CPJ C;  3H0M C;  2Y2M A;  5BNV A;  4KUD C;  2YFW A;  3AV1 C;  3B0D C;  5AV9 A;  4XZQ D;  3KUY B;  3C1C D;  4LD9 D;  3AZF B;  4WU8 B;  4J8X A;  3MGP B;  2Y2H A;  1P3K A;  2YFV A;  5AV6 D;  4KHA B;  3V9R A;  1P3A B;  2BYM B;  3WTP E;  3WA9 C;  1F1E A;  5B40 D;  2L5A A;  3IP4 C;  5AV8 D;  2IO5 B;  5B1M D;  4R8P B;  1M19 B;  5B33 B;  3AZM A;  1M1A A;  3B0C T;  2CWE A;  5B24 C;  5KDM B;  3MVD D;  2NQB A;  5CP6 C;  3AZN B;  5B31 B;  4Z5T B;  1P3G A;  1P3F C;  3X1T A;  5CPJ B;  3C1B A;  3UT9 B;  4X23 C;  4YM6 D;  3MGS D;  4J8U C;  3REI D;  2ARO A;  4AWL B;  5GSU D;  1JFI A;  2HIO B;  4XUJ D;  1M18 B;  3AYW B;  5AVB C;  5B2J A;  4DRB A;  2ZM5 A;  1P3P C;  3W98 C;  3LJA B;  5F99 B;  5GT3 D;  2NZD D;  1KX5 A;  3X1V D;  1P3I C;  3EPK A;  4M6B A;  2FJ7 C;  3LZ1 D;  3AV1 D;  1P3M A;  4UUZ B;  3LZ0 D;  3X1T C;  3W99 D;  5BNV B;  1R4V A;  3H0R C;  3REJ C;  5AV5 A;  1TZY C;  2DQN C;  3UTB A;  5AV9 B;  1AOI A;  5FUG A;  3B6G D;  4J8X B;  2DF4 C;  1P3K B;  5B0Y A;  3V9R B;  1EQZ D;  3AV2 C; 
#chains in the Genus database with same CATH homology
 1B67 A;  1B6W A;  2RIQ A;  5DNN C;  2F2A C;  5CP6 D;  3AZM B;  1M1A B;  5DNM A;  4EO5 B;  2Y2K A;  2LY8 A;  1P3F D;  2HUE B;  3AN2 C;  2NQB B;  5GXQ D;  5E5A A;  5BNX A;  4X23 D;  1P3B D;  1P3G B;  3AZH C;  5C3I C;  1P34 C;  4J8U D;  2F8N A;  2Y2Q A;  2VQR A;  3X1T B;  5AY8 C;  3C1B B;  4J8W A;  3TU4 A;  2ARO B;  2XD1 A;  2CV5 C;  1JFI B;  3A6N A;  4WU9 B;  3VH6 W;  2UWX A;  1P3P D;  3W98 D;  1AOI C;  1P3I D;  4KGC A;  3WKJ C;  5B2J B;  3AZK A;  1T3U A;  3AZF A;  3KXB B;  2FJ7 D;  5GT0 C;  5DNM C;  4ZBJ B;  1ID3 D;  1P3A A;  5JRG A;  3REK A;  1KX5 B;  3MGQ C;  3AFA D;  3X1S D;  3REJ D;  5B40 A;  3MNN B;  1TZY D;  1P3M B;  5B1L A;  3FDD A;  3AZL A;  3B6F D;  2PYO C;  4YS3 C;  4DQY B;  3WAA C;  3REH D;  3UTB B;  5AV5 B;  3AZN A;  1ULY A;  3WTP A;  5FUG B;  5DNN D;  5B0Y B;  3A6N C;  4G91 B;  1BFM A;  2BYK A;  3UT9 A;  3UTA C;  3REL A;  2G5H C;  3VH5 W;  4ZUX A;  3AN2 D;  3MGS A;  2JCH A;  3KUY C;  3AZF C;  4WV4 B;  4WU8 C;  3MGP C;  3AZH D;  1P34 D;  1ZLA D;  3F6T A;  1HQ3 B;  1U35 D;  1P3A C;  1KX3 A;  5AY8 D;  3AZI A;  5E5A B;  5BNX B;  4CAY A;  4R8P C;  2IO5 C;  3MGR A;  1M19 C;  2F8N B;  5B33 C;  4J8W B;  3TU4 B;  3AZN C;  5B31 C;  4Z5T C;  2J8P A;  3X1U B;  3WKJ D;  4WZS B;  3AZJ A;  4J8V D;  3UT9 C;  4KGC B;  3AZK B;  4LD9 B;  4AWL C;  4H9R A;  1P3L D;  5JRG B;  5AV6 B;  2HIO C;  3LEL D;  2W8S A;  3REK B;  4YS3 D;  2PYO D;  4WJ3 C;  1M18 C;  3P5J B;  5B40 B;  3AYW C;  5B31 G;  5B1L B;  2JSS A;  4H9S C;  3AZL B;  4H9Q A;  5BT1 C;  3LJA C;  4H9P A;  5F99 C;  3WTP B;  4H9N A;  3UTA D;  3W97 A;  3KUY D;  4WU8 D;  3MGP D;  2BYK B;  3REL B;  4ZUX B;  3MGS B;  5AV9 C;  4J8X C;  1P3K C;  4WU9 A;  4R8P D;  1P3O A;  3W96 A;  1M19 D;  5GSU B;  3EG5 B;  3AZG A;  1KX3 B;  2FFF B;  1N1J A;  3AZI B;  4CAY B;  3KSY A;  3MGR B;  3KXB A;  2RVQ D;  3AZM C;  1M1A C;  5B31 D;  4Z5T D;  4EO5 C;  4Z66 A;  1ID3 A;  5GT3 B;  3EPL A;  3NQU A;  5CPJ D;  3KWQ D;  2HUE C;  2NQB C;  4KUD D;  3B0B A;  3MNN A;  1P3G C;  4JJN A;  3LZ1 B;  3AL0 C;  1H3O A;  3AZJ B;  1F66 A;  2Y2L A;  5JA4 A;  1KX4 A;  3C1B C;  3LZ0 B;  3W99 B;  2HIO D;  3REH A;  3WA9 D;  3EPJ A;  2ARO C;  3B6G B;  4H9R B;  3AYW D;  5CPK A;  4WU9 C;  5BT1 D;  1EQZ B;  5B24 D;  3LJA D;  5F99 D;  5B2J C;  4H9Q B;  3KXB C;  4H9P B;  4ZBJ C;  1HQ3 A;  4DRA A;  1KX5 C;  2BG1 A;  4H9N B;  5GXQ B;  3O62 A;  3W97 B;  1P3B B;  4WNN A;  3MNN C;  1P3M C;  5B32 A;  3AZE A;  4J8X D;  1P3K D;  5AVC A;  3UTB C;  5AV5 C;  4QLC A;  5B2I A;  5AVB D;  1S32 A;  3X1U A;  1P3O B;  5B0Y C;  5CPI A;  5B0Z A;  3W96 B;  3AZM D;  1M1A D;  3AZG B;  4G91 C;  1N1J B;  3C1C A;  4XZQ A;  2NQB D;  4LD9 A;  3A1K A;  1P3G D;  4Z66 B;  5AV6 A;  1ID3 B;  1HQ3 C;  3NQU B;  3X1T D;  3C1B D;  5E5A C;  3AFA B;  4JJN B;  5AV8 A;  3X1S B;  5B1M A;  1H3O B;  2ARO D;  1F66 B;  2Y2I A;  1KU5 A;  5JA4 B;  1KX4 B;  3AV2 D;  4J8W C;  3TU4 C;  3REH B;  3MVD A;  1BH9 A;  2ZY2 A;  3X1U C;  5CPK B;  4NE3 A;  5B2J D;  2Y2P A;  1HTA A;  5CPI C;  3R45 A;  4YM6 A;  3REI A;  1KX5 D;  4KGC C;  3AZK C;  4LD9 C;  5GSU A;  1P3M D;  1ZLA B;  5JRG C;  5AV6 C;  3REK C;  3B0C W;  4XUJ A;  1U35 B;  3O62 B;  1WWS A;  3UTB D;  4WNN B;  5AV5 D;  5B40 C;  5B1L C;  4HGA B;  5B32 B;  3AZE B;  3AZL C;  2CV5 D;  4E44 A;  4G92 B;  5AVC B;  5GT3 A;  5B0Y D;  4UPK A;  1AOI D;  3X1V A;  4QLC B;  5B2I B;  2NZD A;  3WTP C;  1S32 B;  3LZ1 A;  3AV1 A;  5CPI B;  3VH6 T;  5B0Z B;  2G5I C;  5GT0 D;  5DNM D;  1BH8 A;  4J8V B;  4H9O A;  3LZ0 A;  3W99 A;  3REL C;  3MGQ D;  4ZUX C;  3C1C B;  4XZQ B;  3MGS C;  3WA9 A;  2Y2G A;  5E5A D;  3B6G A;  2ZY3 A;  2F8N D;  4Z2M G;  5GSU C;  1EQZ A;  1P3L B;  1KX3 C;  3LEL B;  3WAA D;  3AZI C;  1A7W A;  4J8W D;  3TU4 D;  5AV8 B;  5B1M B;  3MGR C;  5CP6 A;  3A1I A;  1P3F A;  3H0L C;  1W2E A;  1Z2C B;  5GT3 C;  3A6N D;  3MVD B;  5GXQ A;  1BH9 B;  4X23 A;  4NE6 A;  1P3B A;  4J8U A;  3LZ1 C;  4KGC D;  3AZF D;  3AZK D;  3R45 B;  3AZJ C;  4Z2M H;  3VH6 A;  5BO0 A;  1P3A D;  3LZ0 C;  5JRG D;  3VH5 T;  4YM6 B;  3W99 C;  3REI B;  3REK D;  5AVB A;  3B6G C;  5B33 D;  5B1L D;  3AZL D;  1P3P A;  3W98 A;  4XUJ B;  1EQZ C;  1P3I A;  3AZN D;  2FJ7 A;  3WTP D;  2NZD B;  3X1V B;  1TAF A;  4CSR A;  3AFA A;  3KWQ B;  3UT9 D;  5GXQ C;  3REL D;  3X1S A;  3REJ A;  2Y2O A;  1P3B C;  1TZY A;  4ZUX D;  3B0D B;  3AV1 B;  3W97 C;  3B6F A;  1BH8 B;  4H9O B;  3AV2 A;  1KX3 D;  1M18 D;  3AZI D;  3WA9 B;  3VH5 A;  2ZY5 A;  5DNN A;  1P3O C;  3MGR D;  3W96 C;  3AZG C;  4NE5 A;  5B24 B;  5G49 A;  3AN2 A;  1WWI A;  5CP6 B;  3AZH A;  4Z66 C;  1P34 A;  1ZLA A;  2Y2J A;  1P3F B;  1ID3 C;  2JE5 A;  3AZJ D;  1U35 A;  5AY8 A;  4X23 B;  3AFA C;  4JJN C;  5AV9 D;  4J8U B;  3X1S C;  2YFW B;  1F66 C;  3B6F C;  2CV5 A;  1KX4 C;  5BO0 B;  2YFV B;  3REH C;  2XD5 A;  2Y2N A;  5AVB B;  3KFU G;  3WKJ A;  5CPK C;  1P3P B;  3W98 B;  5GT0 A;  4J8V A;  3MGQ A;  1P3I B;  2FJ7 B;  5BS7 A;  3W97 D;  1P3L A;  1ZLA C;  3LEL A;  2PYO A;  4YS3 A;  1TAF B;  4CSR B;  1U35 C;  3WAA A;  3O62 C;  3REJ B;  1TZY B;  3B6F B;  5B32 C;  4HGA C;  3AZE C;  4G92 C;  4WU9 D;  5AVC C;  1P3O D;  3W96 D;  3AV2 B;  3AZG D;  4QLC C;  5B2I C;  3UTA A;  3NQJ A;  1S32 C;  5DNN B;  5B0Z C;  3KXB D;  3KUY A;  4WU8 A;  3MGP A;  4Z66 D;  4J8V C;  4KHA A;  5G49 B;  2BYM A;  3AN2 B;  3C1C C;  4XZQ C;  2F8N G;  3MNN D;  3AZH B;  5C3I B;  5B32 G;  4JJN D;  5BS7 C;  4R8P A;  1P34 B;  1M19 A;  5B33 A;  1P3L C;  1F66 D;  5AY8 B;  3LEL C;  1KX4 D;  2ZY4 A;  5AV8 C;  5KDM A;  5B1M C;  5B31 A;  4Z5T A;  2CV5 B;  5CPK D;  3KWQ A;  3MVD C;  5CPJ A;  1AOI B;  4KUD A;  4E45 A;  2F8N H;  3WKJ B;  5GT0 B;  5DNM B;  5CHL B;  1HQ3 D;  4NFT A;  4KUD B;  2HIO A;  4YM6 C;  3EPH A;  3MGQ B;  3REI C;  1PZR A;  1M18 A;  3O62 D;  3AYW A;  4H9S A;  5B32 D;  3AZE D;  2PYO B;  5B24 A;  4XUJ C;  5F99 A;  3LJA A;  4YS3 B;  5AVC D;  3WAA B;  1Q9C A;  4QLC D;  5B2I D;  1S32 D;  2RVQ C;  3X1U D;  5CPI D;  5B0Z D;  3A6N B;  2NZD C;  3X1V C;  2F8N K;  4UUZ A;  3UTA B;  3NQJ B;  3KWQ C;  5CPJ C;  3H0M C;  2Y2M A;  5BNV A;  4KUD C;  2YFW A;  3AV1 C;  3B0D C;  5AV9 A;  4XZQ D;  3KUY B;  3C1C D;  4LD9 D;  3AZF B;  4WU8 B;  4J8X A;  3MGP B;  2Y2H A;  1P3K A;  2YFV A;  5AV6 D;  4KHA B;  3V9R A;  1P3A B;  2BYM B;  3WTP E;  3WA9 C;  1F1E A;  5B40 D;  2L5A A;  3IP4 C;  5AV8 D;  2IO5 B;  5B1M D;  4R8P B;  1M19 B;  5B33 B;  3AZM A;  1M1A A;  3B0C T;  2CWE A;  5B24 C;  5KDM B;  3MVD D;  2NQB A;  5CP6 C;  3AZN B;  5B31 B;  4Z5T B;  1P3G A;  1P3F C;  3X1T A;  5CPJ B;  3C1B A;  3UT9 B;  4X23 C;  4YM6 D;  3MGS D;  4J8U C;  3REI D;  2ARO A;  4AWL B;  5GSU D;  1JFI A;  2HIO B;  4XUJ D;  1M18 B;  3AYW B;  5AVB C;  5B2J A;  4DRB A;  2ZM5 A;  1P3P C;  3W98 C;  3LJA B;  5F99 B;  5GT3 D;  2NZD D;  1KX5 A;  3X1V D;  1P3I C;  3EPK A;  4M6B A;  2FJ7 C;  3LZ1 D;  3AV1 D;  1P3M A;  4UUZ B;  3LZ0 D;  3X1T C;  3W99 D;  5BNV B;  1R4V A;  3H0R C;  3REJ C;  5AV5 A;  1TZY C;  2DQN C;  3UTB A;  5AV9 B;  1AOI A;  5FUG A;  3B6G D;  4J8X B;  2DF4 C;  1P3K B;  5B0Y A;  3V9R B;  1EQZ D;  3AV2 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...