4G91B

Ccaat-binding complex from aspergillus nidulans
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
91
structure length
91
Chain Sequence
KEQDRWLPIANVARIMKLALPENAKIAKEAKECMQECVSEFISFITSEASEKCQQEKRKTVNGEDILFAMTSLGFENYAEALKIYLSKYRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords HAPB protein
publication title DNA Minor Groove Sensing and Widening by the CCAAT-Binding Complex.
pubmed doi rcsb
source organism Emericella nidulans
total genus 35
structure length 91
sequence length 91
ec nomenclature
pdb deposition date 2012-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00808 CBFD_NFYB_HMF Histone-like transcription factor (CBF/NF-Y) and archaeal histone
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4g91B00
1P3MA 5CPKB 4X23D 4H9NA 4H9PA 1M1AB 3C1CB 5BNVA 4CSRA 1BH8B 5FUGA 3KXBC 1ID3C 2BYKB 3REIC 3MGSC 5GXQB 3LELB 5CPID 1EQZC 3MGRD 3AV1D 2F8NH 3AN2D 2AROB 3X1UC 3REHB 3B0CW 5JA4A 5AV5B 1M19A 3X1SD 4XUJC 1M18C 1P3ID 5B0ZA 1ZLAD 3MGQA 2LY8A 4J8WD 1S32B 5B2ID 3KXBA 4H9RB 1F1EA 1ID3A 3LZ0B 3REIA 4NFTA 4J8XB 4Z66D 5CPJC 2YFVB 1EQZA 1TAFB 5AV8B 3X1VD 1P3MB 2IO5B 4WZSB 3W96D 4H9NB 4H9PB 5AY8C 4J8VD 2YFWB 3O62A 4XZQC 5BNVB 4NE3A 4CSRB 5FUGB 4XUJA 1M18A 3B0DC 3LJAD 3RELA 3AZKC 5AVCC 3KUYD 3B6GD 5CP6D 4Z2MG 1P3GD 1BFMA 5B1MA 5B40D 3AZMA 1P3BA 2NQBC 5F99D 3B6FC 1M19B 2HIOC 1P3PC 3VH5T 5B0ZB 2FJ7A 3MVDC 5GT0D 2F8ND 3KWQD 3MGQB 5AY8A 1HQ3D 5KDMA 4JJNC 3WA9C 3KXBB 3UTAA 1ID3B 3REIB 1P3KD 3MGSB 1P3LC 2PYOC 3AZKA 2CV5C 1P3OD 5AVCA 1EQZB 2NZDC 2RVQD 5B2JC 3AZID 1N1JB 2BYMA 2JSSA 3AZND 5AV6D 3W99D 1P3FD 2F8NK 2NQBA 3B6FA 2HIOA 4XUJB 4KHAA 1M18B 3A6ND 4YS3D 3RELB 3WKJA 3MVDA 3X1TC 4JJNA 5B1MB 3WA9A 3AZMB 1P3BB 3AYWD 1P3LA 1AOID 1U35D 2PYOA 4AWLC 5CPJB 1B6WA 3C1CC 2CV5A 3AZGD 2NZDA 3C1BD 3REKD 1B67A 2FJ7B 1H3OA 5GT3C 5B24D 3AFAD 3TU4D 5JRGC 2CWEA 5AY8B 5KDMB 4XZQB 3AZJD 4M6BA 4Z5TC 4YM6D 1KX5D 3AZKB 5AVCB 5B0YD 3WTPD 2BYMB 5DNMA 2NQBB 3B6FB 4EO5C 4QLCA 2HIOB 4KHAB 5B32C 4WU9C 1P3PB 3WKJB 5GT3A 3MVDB 5JRGA 4JJNB 3WA9B 4Z5TA 1P3AA 5E5AD 1P3LB 3MNND 2PYOB 2CV5B 5B1LD 2NZDB 4X23C 3AZHC 1H3OB 3REJC 2HUEC 3AZFC 5B32A 4WU9A 3MGRC 4J8UA 3VH5W 5DNND 3X1TB 2AROD 3REHD 4KGCA 5DNMB 3MGQC 4AWLB 4QLCB 4Z2MH 4X23A 3AZHA 4G92C 3UT9D 4KUDD 5GT3B 5B32G 3REJA 5JRGB 3AZFA 1S32D 5CPIA 4Z5TB 3MGRA 4WU8D 3LZ0D 4J8XD 3O62C 3RELC 5AV8D 4LD9D 4EO5B 1ZLAA 1F66C 5B32B 4WU9B 4NE5A 5B1MC 3AZMC 1P3BC 3VH6W 1Q9CA 5C3IC 5B2IA 4UUZA 1KX3C 3AZLD 4Z66A 2FJ7C 4KGCB 3MGPC 4HGAC 1M19D 3W96A 4X23B 3AZHB 3UTAC 3REJB 2HUEB 3AZFB 5CHLB 5CPIB 1F66A 4DRAA 1P3GA 5JA4B 3MGRB 1ID3D 3NQUA 2RVQC 3REID 3MGSD 1P3FC 1KX4C 3W99C 1KX3A 1EQZD 4H9SC 3X1UD 3WKJC 3AZEC 3MGPA 3VH5A 3W97C 5B31C 1ZLAB 5BT1C 3KWQA 4G92B 5B2IB 4UUZB 4H9QA 1P3KA 1AOIC 1HTAA 3AZGC 4ZUXC 3UTBC 3O62B 3W96B 5CPJD 1P3FA 1KX4A 3W99A 4H9SA 1P34D 1R4VA 2F8NG 3WAAD 3AZEA 3A6NA 3W97A 4YM6C 5B31A 5AY8D 1KX5C 4XZQD 1F66B 3NQUB 5DNMC 5B33D 5C3IB 3AZKD 4QLCC 5AVBD 5AVCD 1KX3B 1AOIA 5G49A 3AZGA 5BNXA 3C1BA 3REKA 3VH6A 3MGPB 1TZYC 4ZBJC 4ZUXA 2NQBD 3UTBA 4HGAB 3B6FD 5B24A 3W98C 4R8PC 2HIOD 3LZ1D 1P3AC 1P3PD 5B31G 3UTAB 3V9RA 3B0CT 4E45A 3AZJA 3MVDD 4H9QB 4YM6A 1KX5A 4G91C 4JJND 5AV9C 5B1LC 3WA9D 1P3LD 2PYOD 1P3FB 1KX4B 3W99B 3NQJA 3R45A 4J8UC 5B2JD 3AZEB 3AV2C 3W97B 1TZYA 5B31B 5GSUC 3W98A 4R8PA 4KGCC 1AOIB 3MNNA 3X1TD 5G49B 5AV9A 5B1LA 3AZGB 5BNXB 3REKB 4ZUXB 3UT9C 4KUDC 3UTBB 5CPKD 1M1AD 5CPIC 3C1CD 3V9RB 3AV1C 3AZJB 3AN2C 3AV2A 5GXQD 1BH9A 4YM6B 3LELD 4WU8C 1KX5B 5GSUA 1WWSA 5DNNA 4Z5TD 3X1SC 5AV5D 1P3IC 3REHA 1ZLAC 3NQJB 3R45B 4J8WC 1TZYB 4ZBJB 5B2IC 3UT9A 4KUDA 3W98B 4R8PB 4Z66C 3WTPE 1P3AB 3AV1A 3AN2A 3X1VC 1JFIA 4H9RA 3W96C 3MNNB 4WU8A 3LZ0A 4J8XA 4G91B 4J8VC 5AV9B 5B1LB 3X1SA 1P3MD 3LJAC 4CAYA 1P3IA 1A7WA 4LD9A 3KUYC 3AZHD 3B6GC 5CP6C 1P3GC 2YFWA 4J8WA 4J8UB 3AV2B 1BH9B 5B40C 3REJD 5BO0A 5GSUB 3AZFD 5DNNB 5F99C 3AZLA 3X1VA 5BS7C 5GT0C 4DRBA 3KWQC 1HQ3C 4J8VA 5B0ZD 3UT9B 4KUDB 3LJAA 4NE6A 3MGQD 1P3KC 1P3OC 3KUYA 3B6GA 5CP6A 3AV1B 3KXBD 3AN2B 3AZIC 1JFIB 5B40A 4WU8B 3AZNC 5AV6C 3MGSA 5F99A 3X1SB 2L5AA 3A6NC 1P34C 4YS3C 4CAYB 3X1UA 1P3IB 3WAAC 1N1JA 4LD9B 5BS7A 3O62D 5GT0A 2F8NA 4XUJD 1M18D 4J8WB 1HQ3A 3RELD 5BO0B 5B33C 3AYWC 4WV4B 1U35C 4Z66B 5AVBC 1F66D 1P3OA 3AZLB 5B1MD 3C1BC 3REKC 3AZMD 1P3BD 1WWIA 3AZIA 3X1VB 5B24C 3AFAC 3TU4C 1KX3D 3AZNA 5AV6A 4J8VB 5CPJA 3LZ1C 3AZJC 2FJ7D 3LJAB 3MGPD 4YS3A 1P34A 3WAAA 5B0YC 3KUYB 1ULYA 3B6GB 5CP6B 1P3GB 3UTAD 3WTPC 4XZQA 5B40B 5B33A 3AYWA 5F99B 1U35A 5AVBA 3X1UB 4WNNA 3AFAA 5GT0B 3TU4A 3KWQB 1KX4D 2F8NB 1HQ3B 3LZ1A 3WKJD 3AZED 1P3PA 5E5AC 3W97D 5B31D 3MNNC 1P3KB 5BT1D 1P3OB 4E44A 5B0YA 3WTPA 3AZIB 5CPKC 3AZNB 5AV6B 2CV5D 2NZDD 1M1AC 3VH6T 3A6NB 1P34B 4ZUXD 4YS3B 1KU5A 3UTBD 5B2JA 3WAAB 5GXQC 5DNNC 3LELC 4H9OA 2AROC 3B0DB 3REHC 5AV5C 5B33B 5E5AA 3AYWB 1U35B 5AVBB 3C1BB 3X1TA 5DNMD 4WNNB 5B24B 3AFAB 3TU4B 4QLCD 3B0BA 5CPKA 1S32C 1M1AA 3LZ1B 3C1CA 5GT3D 1BH8A 1TZYD 2BYKA 3KSYA 5JRGD 3LZ0C 4J8XC 3W98D 4R8PD 5GXQA 3LELA 5B0YB 1P3AD 3WTPB 2AROA 5AV8C 1P3MC 4LD9C 2IO5C 5AV5A 5AV9D 5B2JB 5B32D 4WU9D 3AZLC 4H9OB 1S32A 4J8UD 3AV2D 5E5AB 5GSUD 1M19C 2YFVA 4KGCD 1TAFA 5AV8A 5B0ZC
chains in the Genus database with same CATH superfamily
1P3MA 5CPKB 4X23D 4H9NA 4H9PA 1M1AB 3C1CB 5BNVA 4CSRA 1BH8B 5FUGA 3KXBC 1ID3C 2BYKB 3REIC 3MGSC 5GXQB 3LELB 5CPID 3H0RC 1EQZC 3MGRD 3AV1D 2F8NH 3AN2D 2AROB 3X1UC 3REHB 3B0CW 5JA4A 5AV5B 1M19A 3X1SD 4XUJC 1M18C 1P3ID 5B0ZA 2ZY4A 1ZLAD 3MGQA 2LY8A 4J8WD 1S32B 5B2ID 3KXBA 1F1EA 4H9RB 1ID3A 3LZ0B 3REIA 4NFTA 4J8XB 4Z66D 5CPJC 2YFVB 2XD5A 1EQZA 1TAFB 5AV8B 3IP4C 3X1VD 1P3MB 2IO5B 4WZSB 3W96D 4H9NB 4H9PB 5AY8C 4J8VD 2YFWB 3O62A 4XZQC 5BNVB 4NE3A 4CSRB 5FUGB 4XUJA 1M18A 3B0DC 3LJAD 1W2EA 3RELA 3AZKC 5AVCC 3KUYD 3B6GD 5CP6D 4Z2MG 1P3GD 1BFMA 2J8PA 5B1MA 5B40D 3AZMA 1P3BA 2NQBC 5F99D 3B6FC 1M19B 2HIOC 1P3PC 3VH5T 5B0ZB 2FJ7A 3MVDC 5GT0D 2F8ND 3KWQD 3MGQB 5AY8A 1HQ3D 5KDMA 4JJNC 3WA9C 3KXBB 3UTAA 1ID3B 3REIB 1P3KD 3MGSB 1P3LC 2PYOC 3AZKA 2CV5C 1P3OD 5AVCA 1EQZB 2NZDC 2RVQD 5B2JC 3AZID 1N1JB 2BYMA 2JSSA 2Y2HA 5AV6D 3W99D 3AZND 1P3FD 2F8NK 2NQBA 3B6FA 2HIOA 4XUJB 4KHAA 1M18B 3A6ND 2XD1A 4YS3D 3RELB 3EPHA 2JCHA 3WKJA 3MVDA 4UPKA 3X1TC 4JJNA 5B1MB 3WA9A 3AZMB 1P3BB 3AYWD 1P3LA 1AOID 1U35D 2PYOA 2UWXA 4AWLC 5CPJB 1B6WA 3C1CC 2CV5A 3AZGD 2NZDA 3C1BD 3REKD 1B67A 2FJ7B 1H3OA 5GT3C 5B24D 3AFAD 3TU4D 5JRGC 2CWEA 5AY8B 2ZM5A 5KDMB 4XZQB 3AZJD 4M6BA 4Z5TC 4YM6D 1KX5D 3AZKB 5AVCB 5B0YD 3WTPD 2BYMB 5DNMA 2NQBB 3B6FB 4EO5C 4QLCA 2HIOB 4KHAB 5B32C 2BG1A 4WU9C 1P3PB 3WKJB 5GT3A 2ZY3A 3MVDB 5JRGA 4JJNB 3WA9B 4Z5TA 1P3AA 5E5AD 1P3LB 3MNND 2PYOB 2CV5B 5B1LD 2NZDB 4X23C 3AZHC 1H3OB 3REJC 2HUEC 3AZFC 2RIQA 5B32A 4WU9A 3MGRC 4J8UA 3VH5W 3A1KA 5DNND 3X1TB 2AROD 3REHD 4KGCA 5DNMB 3MGQC 4AWLB 4QLCB 4Z2MH 4X23A 3AZHA 4G92C 3UT9D 4KUDD 5GT3B 5B32G 3REJA 5JRGB 3AZFA 1S32D 5CPIA 4Z5TB 3MGRA 4WU8D 3LZ0D 4J8XD 3O62C 3RELC 5AV8D 3FDDA 4LD9D 1T3UA 4EO5B 1ZLAA 1F66C 5B32B 4WU9B 1Z2CB 4NE5A 5B1MC 3AZMC 2DQNC 1P3BC 3VH6W 1Q9CA 5C3IC 5B2IA 4UUZA 1KX3C 3AZLD 4Z66A 4DQYB 2FJ7C 4KGCB 3MGPC 4HGAC 1M19D 3W96A 4X23B 3AZHB 3UTAC 2Y2MA 3REJB 2HUEB 3AZFB 5CHLB 5CPIB 1F66A 4DRAA 1P3GA 5JA4B 3MGRB 1ID3D 3NQUA 2RVQC 3REID 3MGSD 2Y2KA 1P3FC 1KX4C 3W99C 1KX3A 1EQZD 4H9SC 3H0LC 3X1UD 3WKJC 3AZEC 3MGPA 3VH5A 3W97C 5B31C 1ZLAB 5BT1C 3KWQA 4G92B 5B2IB 4UUZB 4H9QA 1P3KA 1AOIC 1HTAA 3AZGC 4ZUXC 3UTBC 3O62B 3W96B 5CPJD 1P3FA 1KX4A 3W99A 4H9SA 1P34D 1R4VA 2F8NG 3WAAD 3AZEA 3A6NA 3W97A 4YM6C 5B31A 5AY8D 1KX5C 4XZQD 1F66B 3NQUB 5DNMC 5B33D 5C3IB 3AZKD 4QLCC 5AVBD 5AVCD 1KX3B 1AOIA 5G49A 3AZGA 2ZY2A 5BNXA 3C1BA 3REKA 3VH6A 3MGPB 1TZYC 4ZBJC 4ZUXA 2NQBD 3UTBA 4HGAB 3B6FD 5B24A 3W98C 4R8PC 2HIOD 3LZ1D 1P3AC 1P3PD 5B31G 3UTAB 3V9RA 3B0CT 4E45A 3AZJA 3MVDD 4H9QB 4YM6A 1KX5A 4G91C 4JJND 5AV9C 5B1LC 1PZRA 3WA9D 2W8SA 1P3LD 2PYOD 2Y2QA 1P3FB 1KX4B 3W99B 2Y2OA 3NQJA 3R45A 4J8UC 5B2JD 3AZEB 3AV2C 3W97B 1TZYA 5B31B 5GSUC 3W98A 4R8PA 2G5HC 4KGCC 3H0MC 1AOIB 3MNNA 3X1TD 5G49B 5AV9A 3P5JB 5B1LA 5BNXB 3AZGB 3REKB 4ZUXB 2Y2PA 3UT9C 3UTBB 5CPKD 4KUDC 1M1AD 5CPIC 3C1CD 2Y2NA 3V9RB 3AV1C 3AZJB 2G5IC 3AN2C 3AV2A 5GXQD 1BH9A 4YM6B 3LELD 4WU8C 1KX5B 5GSUA 1WWSA 5DNNA 4Z5TD 3X1SC 5AV5D 1P3IC 3REHA 1ZLAC 2DF4C 3NQJB 3R45B 2ZY5A 4J8WC 1TZYB 4ZBJB 5B2IC 3UT9A 4KUDA 3W98B 4R8PB 4Z66C 3WTPE 1P3AB 3AV1A 3AN2A 3X1VC 1JFIA 4H9RA 3W96C 3MNNB 4WU8A 3LZ0A 4J8XA 4G91B 2F2AC 4J8VC 5AV9B 5B1LB 3X1SA 1P3MD 3LJAC 4CAYA 1P3IA 1A7WA 4LD9A 2Y2JA 3KUYC 3AZHD 3B6GC 5CP6C 1P3GC 2YFWA 4J8WA 4J8UB 3AV2B 1BH9B 5B40C 3REJD 5BO0A 5GSUB 3EPKA 3AZFD 5DNNB 5F99C 3AZLA 3X1VA 5BS7C 5GT0C 4DRBA 3KWQC 1HQ3C 3EPJA 4J8VA 5B0ZD 3UT9B 4KUDB 3LJAA 4NE6A 3MGQD 1P3KC 1P3OC 3KUYA 3B6GA 5CP6A 3AV1B 3KXBD 3KFUG 3AN2B 3AZIC 1JFIB 5B40A 4WU8B 3AZNC 5AV6C 3MGSA 5F99A 3X1SB 2L5AA 3A6NC 1P34C 4YS3C 4CAYB 3X1UA 1P3IB 3WAAC 1N1JA 4LD9B 5BS7A 3O62D 5GT0A 2F8NA 4XUJD 1M18D 4J8WB 1HQ3A 2VQRA 3RELD 5BO0B 5B33C 3AYWC 4WV4B 1U35C 2JE5A 4Z66B 5AVBC 1F66D 1P3OA 3AL0C 3AZLB 5B1MD 3C1BC 3REKC 3AZMD 1P3BD 1WWIA 2Y2GA 3AZIA 3X1VB 5B24C 3AFAC 3TU4C 1KX3D 3AZNA 5AV6A 4J8VB 4WJ3C 5CPJA 3LZ1C 3AZJC 2FJ7D 3F6TA 3LJAB 3MGPD 4YS3A 1P34A 3WAAA 5B0YC 3KUYB 1ULYA 3B6GB 5CP6B 1P3GB 3UTAD 3WTPC 4XZQA 3EPLA 5B40B 5B33A 3AYWA 5F99B 1U35A 5AVBA 3X1UB 4WNNA 3AFAA 5GT0B 3TU4A 3KWQB 1KX4D 2F8NB 1HQ3B 3LZ1A 3WKJD 3AZED 1P3PA 5E5AC 3W97D 5B31D 3MNNC 1P3KB 5BT1D 1P3OB 4E44A 5B0YA 3WTPA 3AZIB 2Y2LA 5CPKC 3AZNB 5AV6B 2CV5D 2NZDD 3A1IA 1M1AC 3VH6T 3A6NB 1P34B 4ZUXD 4YS3B 1KU5A 3UTBD 5B2JA 3WAAB 5GXQC 5DNNC 3LELC 2FFFB 4H9OA 2AROC 3B0DB 3REHC 5AV5C 5B33B 5E5AA 3AYWB 1U35B 5AVBB 2Y2IA 3C1BB 3X1TA 5DNMD 4WNNB 5B24B 3AFAB 3TU4B 4QLCD 3B0BA 5CPKA 1S32C 1M1AA 3LZ1B 3C1CA 5GT3D 1BH8A 1TZYD 2BYKA 3KSYA 5JRGD 3LZ0C 4J8XC 3W98D 4R8PD 5GXQA 3LELA 5B0YB 1P3AD 3WTPB 2AROA 5AV8C 1P3MC 4LD9C 2IO5C 5AV5A 5AV9D 5B2JB 5B32D 4WU9D 3AZLC 4H9OB 1S32A 4J8UD 3AV2D 5E5AB 5GSUD 3EG5B 1M19C 2YFVA 4KGCD 1TAFA 5AV8A 5B0ZC
chains in the Genus database with same CATH topology
1P3MA 5CPKB 4X23D 4H9NA 4H9PA 1M1AB 3C1CB 5BNVA 4CSRA 1BH8B 5FUGA 3KXBC 1ID3C 2BYKB 3REIC 3MGSC 5GXQB 3LELB 5CPID 3H0RC 1EQZC 3MGRD 3AV1D 2F8NH 3AN2D 2AROB 3X1UC 3REHB 3B0CW 5JA4A 5AV5B 1M19A 3X1SD 4XUJC 1M18C 1P3ID 5B0ZA 2ZY4A 1ZLAD 3MGQA 2LY8A 4J8WD 1S32B 5B2ID 3KXBA 1F1EA 4H9RB 1ID3A 3LZ0B 3REIA 4NFTA 4J8XB 4Z66D 5CPJC 2YFVB 2XD5A 1EQZA 1TAFB 5AV8B 3IP4C 3X1VD 1P3MB 2IO5B 4WZSB 3W96D 4H9NB 4H9PB 5AY8C 4J8VD 2YFWB 3O62A 4XZQC 5BNVB 4NE3A 4CSRB 5FUGB 4XUJA 1M18A 3B0DC 3LJAD 1W2EA 3RELA 3AZKC 5AVCC 3KUYD 3B6GD 5CP6D 4Z2MG 1P3GD 1BFMA 2J8PA 5B1MA 5B40D 3AZMA 1P3BA 2NQBC 5F99D 3B6FC 1M19B 2HIOC 1P3PC 3VH5T 5B0ZB 2FJ7A 3MVDC 5GT0D 2F8ND 3KWQD 3MGQB 5AY8A 1HQ3D 5KDMA 4JJNC 3WA9C 3KXBB 3UTAA 1ID3B 3REIB 1P3KD 3MGSB 1P3LC 2PYOC 3AZKA 2CV5C 1P3OD 5AVCA 1EQZB 2NZDC 2RVQD 5B2JC 3AZID 1N1JB 2BYMA 2JSSA 2Y2HA 5AV6D 3W99D 3AZND 1P3FD 2F8NK 2NQBA 3B6FA 2HIOA 4XUJB 4KHAA 1M18B 3A6ND 2XD1A 4YS3D 3RELB 3EPHA 2JCHA 3WKJA 3MVDA 4UPKA 3X1TC 4JJNA 5B1MB 3WA9A 3AZMB 1P3BB 3AYWD 1P3LA 1AOID 1U35D 2PYOA 2UWXA 4AWLC 5CPJB 1B6WA 3C1CC 2CV5A 3AZGD 2NZDA 3C1BD 3REKD 1B67A 2FJ7B 1H3OA 5GT3C 5B24D 3AFAD 3TU4D 5JRGC 2CWEA 5AY8B 2ZM5A 5KDMB 4XZQB 3AZJD 4M6BA 4Z5TC 4YM6D 1KX5D 3AZKB 5AVCB 5B0YD 3WTPD 2BYMB 5DNMA 2NQBB 3B6FB 4EO5C 4QLCA 2HIOB 4KHAB 5B32C 2BG1A 4WU9C 1P3PB 3WKJB 5GT3A 2ZY3A 3MVDB 5JRGA 4JJNB 3WA9B 4Z5TA 1P3AA 5E5AD 1P3LB 3MNND 2PYOB 2CV5B 5B1LD 2NZDB 4X23C 3AZHC 1H3OB 3REJC 2HUEC 3AZFC 2RIQA 5B32A 4WU9A 3MGRC 4J8UA 3VH5W 3A1KA 5DNND 3X1TB 2AROD 3REHD 4KGCA 5DNMB 3MGQC 4AWLB 4QLCB 4Z2MH 4X23A 3AZHA 4G92C 3UT9D 4KUDD 5GT3B 5B32G 3REJA 5JRGB 3AZFA 1S32D 5CPIA 4Z5TB 3MGRA 4WU8D 3LZ0D 4J8XD 3O62C 3RELC 5AV8D 3FDDA 4LD9D 1T3UA 4EO5B 1ZLAA 1F66C 5B32B 4WU9B 1Z2CB 4NE5A 5B1MC 3AZMC 2DQNC 1P3BC 3VH6W 1Q9CA 5C3IC 5B2IA 4UUZA 1KX3C 3AZLD 4Z66A 4DQYB 2FJ7C 4KGCB 3MGPC 4HGAC 1M19D 3W96A 4X23B 3AZHB 3UTAC 2Y2MA 3REJB 2HUEB 3AZFB 5CHLB 5CPIB 1F66A 4DRAA 1P3GA 5JA4B 3MGRB 1ID3D 3NQUA 2RVQC 3REID 3MGSD 2Y2KA 1P3FC 1KX4C 3W99C 1KX3A 1EQZD 4H9SC 3H0LC 3X1UD 3WKJC 3AZEC 3MGPA 3VH5A 3W97C 5B31C 1ZLAB 5BT1C 3KWQA 4G92B 5B2IB 4UUZB 4H9QA 1P3KA 1AOIC 1HTAA 3AZGC 4ZUXC 3UTBC 3O62B 3W96B 5CPJD 1P3FA 1KX4A 3W99A 4H9SA 1P34D 1R4VA 2F8NG 3WAAD 3AZEA 3A6NA 3W97A 4YM6C 5B31A 5AY8D 1KX5C 4XZQD 1F66B 3NQUB 5DNMC 5B33D 5C3IB 3AZKD 4QLCC 5AVBD 5AVCD 1KX3B 1AOIA 5G49A 3AZGA 2ZY2A 5BNXA 3C1BA 3REKA 3VH6A 3MGPB 1TZYC 4ZBJC 4ZUXA 2NQBD 3UTBA 4HGAB 3B6FD 5B24A 3W98C 4R8PC 2HIOD 3LZ1D 1P3AC 1P3PD 5B31G 3UTAB 3V9RA 3B0CT 4E45A 3AZJA 3MVDD 4H9QB 4YM6A 1KX5A 4G91C 4JJND 5AV9C 5B1LC 1PZRA 3WA9D 2W8SA 1P3LD 2PYOD 2Y2QA 1P3FB 1KX4B 3W99B 2Y2OA 3NQJA 3R45A 4J8UC 5B2JD 3AZEB 3AV2C 3W97B 1TZYA 5B31B 5GSUC 3W98A 4R8PA 2G5HC 4KGCC 3H0MC 1AOIB 3MNNA 3X1TD 5G49B 5AV9A 3P5JB 5B1LA 5BNXB 3AZGB 3REKB 4ZUXB 2Y2PA 3UT9C 3UTBB 5CPKD 4KUDC 1M1AD 5CPIC 3C1CD 2Y2NA 3V9RB 3AV1C 3AZJB 2G5IC 3AN2C 3AV2A 5GXQD 1BH9A 4YM6B 3LELD 4WU8C 1KX5B 5GSUA 1WWSA 5DNNA 4Z5TD 3X1SC 5AV5D 1P3IC 3REHA 1ZLAC 2DF4C 3NQJB 3R45B 2ZY5A 4J8WC 1TZYB 4ZBJB 5B2IC 3UT9A 4KUDA 3W98B 4R8PB 4Z66C 3WTPE 1P3AB 3AV1A 3AN2A 3X1VC 1JFIA 4H9RA 3W96C 3MNNB 4WU8A 3LZ0A 4J8XA 4G91B 2F2AC 4J8VC 5AV9B 5B1LB 3X1SA 1P3MD 3LJAC 4CAYA 1P3IA 1A7WA 4LD9A 2Y2JA 3KUYC 3AZHD 3B6GC 5CP6C 1P3GC 2YFWA 4J8WA 4J8UB 3AV2B 1BH9B 5B40C 3REJD 5BO0A 5GSUB 3EPKA 3AZFD 5DNNB 5F99C 3AZLA 3X1VA 5BS7C 5GT0C 4DRBA 3KWQC 1HQ3C 3EPJA 4J8VA 5B0ZD 3UT9B 4KUDB 3LJAA 4NE6A 3MGQD 1P3KC 1P3OC 3KUYA 3B6GA 5CP6A 3AV1B 3KXBD 3KFUG 3AN2B 3AZIC 1JFIB 5B40A 4WU8B 3AZNC 5AV6C 3MGSA 5F99A 3X1SB 2L5AA 3A6NC 1P34C 4YS3C 4CAYB 3X1UA 1P3IB 3WAAC 1N1JA 4LD9B 5BS7A 3O62D 5GT0A 2F8NA 4XUJD 1M18D 4J8WB 1HQ3A 2VQRA 3RELD 5BO0B 5B33C 3AYWC 4WV4B 1U35C 2JE5A 4Z66B 5AVBC 1F66D 1P3OA 3AL0C 3AZLB 5B1MD 3C1BC 3REKC 3AZMD 1P3BD 1WWIA 2Y2GA 3AZIA 3X1VB 5B24C 3AFAC 3TU4C 1KX3D 3AZNA 5AV6A 4J8VB 4WJ3C 5CPJA 3LZ1C 3AZJC 2FJ7D 3F6TA 3LJAB 3MGPD 4YS3A 1P34A 3WAAA 5B0YC 3KUYB 1ULYA 3B6GB 5CP6B 1P3GB 3UTAD 3WTPC 4XZQA 3EPLA 5B40B 5B33A 3AYWA 5F99B 1U35A 5AVBA 3X1UB 4WNNA 3AFAA 5GT0B 3TU4A 3KWQB 1KX4D 2F8NB 1HQ3B 3LZ1A 3WKJD 3AZED 1P3PA 5E5AC 3W97D 5B31D 3MNNC 1P3KB 5BT1D 1P3OB 4E44A 5B0YA 3WTPA 3AZIB 2Y2LA 5CPKC 3AZNB 5AV6B 2CV5D 2NZDD 3A1IA 1M1AC 3VH6T 3A6NB 1P34B 4ZUXD 4YS3B 1KU5A 3UTBD 5B2JA 3WAAB 5GXQC 5DNNC 3LELC 2FFFB 4H9OA 2AROC 3B0DB 3REHC 5AV5C 5B33B 5E5AA 3AYWB 1U35B 5AVBB 2Y2IA 3C1BB 3X1TA 5DNMD 4WNNB 5B24B 3AFAB 3TU4B 4QLCD 3B0BA 5CPKA 1S32C 1M1AA 3LZ1B 3C1CA 5GT3D 1BH8A 1TZYD 2BYKA 3KSYA 5JRGD 3LZ0C 4J8XC 3W98D 4R8PD 5GXQA 3LELA 5B0YB 1P3AD 3WTPB 2AROA 5AV8C 1P3MC 4LD9C 2IO5C 5AV5A 5AV9D 5B2JB 5B32D 4WU9D 3AZLC 4H9OB 1S32A 4J8UD 3AV2D 5E5AB 5GSUD 3EG5B 1M19C 2YFVA 4KGCD 1TAFA 5AV8A 5B0ZC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1P3M A;  5CPK B;  4X23 D;  4H9N A;  4H9P A;  1M1A B;  3C1C B;  5BNV A;  4CSR A;  1BH8 B;  5FUG A;  3KXB C;  1ID3 C;  2BYK B;  3REI C;  3MGS C;  5GXQ B;  3LEL B;  5CPI D;  1EQZ C;  3MGR D;  3AV1 D;  2F8N H;  3AN2 D;  2ARO B;  3X1U C;  3REH B;  3B0C W;  5JA4 A;  5AV5 B;  1M19 A;  3X1S D;  4XUJ C;  1M18 C;  1P3I D;  5B0Z A;  1ZLA D;  3MGQ A;  2LY8 A;  4J8W D;  1S32 B;  5B2I D;  3KXB A;  4H9R B;  1F1E A;  1ID3 A;  3LZ0 B;  3REI A;  4NFT A;  4J8X B;  4Z66 D;  5CPJ C;  2YFV B;  1EQZ A;  1TAF B;  5AV8 B;  3X1V D;  1P3M B;  2IO5 B;  4WZS B;  3W96 D;  4H9N B;  4H9P B;  5AY8 C;  4J8V D;  2YFW B;  3O62 A;  4XZQ C;  5BNV B;  4NE3 A;  4CSR B;  5FUG B;  4XUJ A;  1M18 A;  3B0D C;  3LJA D;  3REL A;  3AZK C;  5AVC C;  3KUY D;  3B6G D;  5CP6 D;  4Z2M G;  1P3G D;  1BFM A;  5B1M A;  5B40 D;  3AZM A;  1P3B A;  2NQB C;  5F99 D;  3B6F C;  1M19 B;  2HIO C;  1P3P C;  3VH5 T;  5B0Z B;  2FJ7 A;  3MVD C;  5GT0 D;  2F8N D;  3KWQ D;  3MGQ B;  5AY8 A;  1HQ3 D;  5KDM A;  4JJN C;  3WA9 C;  3KXB B;  3UTA A;  1ID3 B;  3REI B;  1P3K D;  3MGS B;  1P3L C;  2PYO C;  3AZK A;  2CV5 C;  1P3O D;  5AVC A;  1EQZ B;  2NZD C;  2RVQ D;  5B2J C;  3AZI D;  1N1J B;  2BYM A;  2JSS A;  3AZN D;  5AV6 D;  3W99 D;  1P3F D;  2F8N K;  2NQB A;  3B6F A;  2HIO A;  4XUJ B;  4KHA A;  1M18 B;  3A6N D;  4YS3 D;  3REL B;  3WKJ A;  3MVD A;  3X1T C;  4JJN A;  5B1M B;  3WA9 A;  3AZM B;  1P3B B;  3AYW D;  1P3L A;  1AOI D;  1U35 D;  2PYO A;  4AWL C;  5CPJ B;  1B6W A;  3C1C C;  2CV5 A;  3AZG D;  2NZD A;  3C1B D;  3REK D;  1B67 A;  2FJ7 B;  1H3O A;  5GT3 C;  5B24 D;  3AFA D;  3TU4 D;  5JRG C;  2CWE A;  5AY8 B;  5KDM B;  4XZQ B;  3AZJ D;  4M6B A;  4Z5T C;  4YM6 D;  1KX5 D;  3AZK B;  5AVC B;  5B0Y D;  3WTP D;  2BYM B;  5DNM A;  2NQB B;  3B6F B;  4EO5 C;  4QLC A;  2HIO B;  4KHA B;  5B32 C;  4WU9 C;  1P3P B;  3WKJ B;  5GT3 A;  3MVD B;  5JRG A;  4JJN B;  3WA9 B;  4Z5T A;  1P3A A;  5E5A D;  1P3L B;  3MNN D;  2PYO B;  2CV5 B;  5B1L D;  2NZD B;  4X23 C;  3AZH C;  1H3O B;  3REJ C;  2HUE C;  3AZF C;  5B32 A;  4WU9 A;  3MGR C;  4J8U A;  3VH5 W;  5DNN D;  3X1T B;  2ARO D;  3REH D;  4KGC A;  5DNM B;  3MGQ C;  4AWL B;  4QLC B;  4Z2M H;  4X23 A;  3AZH A;  4G92 C;  3UT9 D;  4KUD D;  5GT3 B;  5B32 G;  3REJ A;  5JRG B;  3AZF A;  1S32 D;  5CPI A;  4Z5T B;  3MGR A;  4WU8 D;  3LZ0 D;  4J8X D;  3O62 C;  3REL C;  5AV8 D;  4LD9 D;  4EO5 B;  1ZLA A;  1F66 C;  5B32 B;  4WU9 B;  4NE5 A;  5B1M C;  3AZM C;  1P3B C;  3VH6 W;  1Q9C A;  5C3I C;  5B2I A;  4UUZ A;  1KX3 C;  3AZL D;  4Z66 A;  2FJ7 C;  4KGC B;  3MGP C;  4HGA C;  1M19 D;  3W96 A;  4X23 B;  3AZH B;  3UTA C;  3REJ B;  2HUE B;  3AZF B;  5CHL B;  5CPI B;  1F66 A;  4DRA A;  1P3G A;  5JA4 B;  3MGR B;  1ID3 D;  3NQU A;  2RVQ C;  3REI D;  3MGS D;  1P3F C;  1KX4 C;  3W99 C;  1KX3 A;  1EQZ D;  4H9S C;  3X1U D;  3WKJ C;  3AZE C;  3MGP A;  3VH5 A;  3W97 C;  5B31 C;  1ZLA B;  5BT1 C;  3KWQ A;  4G92 B;  5B2I B;  4UUZ B;  4H9Q A;  1P3K A;  1AOI C;  1HTA A;  3AZG C;  4ZUX C;  3UTB C;  3O62 B;  3W96 B;  5CPJ D;  1P3F A;  1KX4 A;  3W99 A;  4H9S A;  1P34 D;  1R4V A;  2F8N G;  3WAA D;  3AZE A;  3A6N A;  3W97 A;  4YM6 C;  5B31 A;  5AY8 D;  1KX5 C;  4XZQ D;  1F66 B;  3NQU B;  5DNM C;  5B33 D;  5C3I B;  3AZK D;  4QLC C;  5AVB D;  5AVC D;  1KX3 B;  1AOI A;  5G49 A;  3AZG A;  5BNX A;  3C1B A;  3REK A;  3VH6 A;  3MGP B;  1TZY C;  4ZBJ C;  4ZUX A;  2NQB D;  3UTB A;  4HGA B;  3B6F D;  5B24 A;  3W98 C;  4R8P C;  2HIO D;  3LZ1 D;  1P3A C;  1P3P D;  5B31 G;  3UTA B;  3V9R A;  3B0C T;  4E45 A;  3AZJ A;  3MVD D;  4H9Q B;  4YM6 A;  1KX5 A;  4G91 C;  4JJN D;  5AV9 C;  5B1L C;  3WA9 D;  1P3L D;  2PYO D;  1P3F B;  1KX4 B;  3W99 B;  3NQJ A;  3R45 A;  4J8U C;  5B2J D;  3AZE B;  3AV2 C;  3W97 B;  1TZY A;  5B31 B;  5GSU C;  3W98 A;  4R8P A;  4KGC C;  1AOI B;  3MNN A;  3X1T D;  5G49 B;  5AV9 A;  5B1L A;  3AZG B;  5BNX B;  3REK B;  4ZUX B;  3UT9 C;  4KUD C;  3UTB B;  5CPK D;  1M1A D;  5CPI C;  3C1C D;  3V9R B;  3AV1 C;  3AZJ B;  3AN2 C;  3AV2 A;  5GXQ D;  1BH9 A;  4YM6 B;  3LEL D;  4WU8 C;  1KX5 B;  5GSU A;  1WWS A;  5DNN A;  4Z5T D;  3X1S C;  5AV5 D;  1P3I C;  3REH A;  1ZLA C;  3NQJ B;  3R45 B;  4J8W C;  1TZY B;  4ZBJ B;  5B2I C;  3UT9 A;  4KUD A;  3W98 B;  4R8P B;  4Z66 C;  3WTP E;  1P3A B;  3AV1 A;  3AN2 A;  3X1V C;  1JFI A;  4H9R A;  3W96 C;  3MNN B;  4WU8 A;  3LZ0 A;  4J8X A;  4G91 B;  4J8V C;  5AV9 B;  5B1L B;  3X1S A;  1P3M D;  3LJA C;  4CAY A;  1P3I A;  1A7W A;  4LD9 A;  3KUY C;  3AZH D;  3B6G C;  5CP6 C;  1P3G C;  2YFW A;  4J8W A;  4J8U B;  3AV2 B;  1BH9 B;  5B40 C;  3REJ D;  5BO0 A;  5GSU B;  3AZF D;  5DNN B;  5F99 C;  3AZL A;  3X1V A;  5BS7 C;  5GT0 C;  4DRB A;  3KWQ C;  1HQ3 C;  4J8V A;  5B0Z D;  3UT9 B;  4KUD B;  3LJA A;  4NE6 A;  3MGQ D;  1P3K C;  1P3O C;  3KUY A;  3B6G A;  5CP6 A;  3AV1 B;  3KXB D;  3AN2 B;  3AZI C;  1JFI B;  5B40 A;  4WU8 B;  3AZN C;  5AV6 C;  3MGS A;  5F99 A;  3X1S B;  2L5A A;  3A6N C;  1P34 C;  4YS3 C;  4CAY B;  3X1U A;  1P3I B;  3WAA C;  1N1J A;  4LD9 B;  5BS7 A;  3O62 D;  5GT0 A;  2F8N A;  4XUJ D;  1M18 D;  4J8W B;  1HQ3 A;  3REL D;  5BO0 B;  5B33 C;  3AYW C;  4WV4 B;  1U35 C;  4Z66 B;  5AVB C;  1F66 D;  1P3O A;  3AZL B;  5B1M D;  3C1B C;  3REK C;  3AZM D;  1P3B D;  1WWI A;  3AZI A;  3X1V B;  5B24 C;  3AFA C;  3TU4 C;  1KX3 D;  3AZN A;  5AV6 A;  4J8V B;  5CPJ A;  3LZ1 C;  3AZJ C;  2FJ7 D;  3LJA B;  3MGP D;  4YS3 A;  1P34 A;  3WAA A;  5B0Y C;  3KUY B;  1ULY A;  3B6G B;  5CP6 B;  1P3G B;  3UTA D;  3WTP C;  4XZQ A;  5B40 B;  5B33 A;  3AYW A;  5F99 B;  1U35 A;  5AVB A;  3X1U B;  4WNN A;  3AFA A;  5GT0 B;  3TU4 A;  3KWQ B;  1KX4 D;  2F8N B;  1HQ3 B;  3LZ1 A;  3WKJ D;  3AZE D;  1P3P A;  5E5A C;  3W97 D;  5B31 D;  3MNN C;  1P3K B;  5BT1 D;  1P3O B;  4E44 A;  5B0Y A;  3WTP A;  3AZI B;  5CPK C;  3AZN B;  5AV6 B;  2CV5 D;  2NZD D;  1M1A C;  3VH6 T;  3A6N B;  1P34 B;  4ZUX D;  4YS3 B;  1KU5 A;  3UTB D;  5B2J A;  3WAA B;  5GXQ C;  5DNN C;  3LEL C;  4H9O A;  2ARO C;  3B0D B;  3REH C;  5AV5 C;  5B33 B;  5E5A A;  3AYW B;  1U35 B;  5AVB B;  3C1B B;  3X1T A;  5DNM D;  4WNN B;  5B24 B;  3AFA B;  3TU4 B;  4QLC D;  3B0B A;  5CPK A;  1S32 C;  1M1A A;  3LZ1 B;  3C1C A;  5GT3 D;  1BH8 A;  1TZY D;  2BYK A;  3KSY A;  5JRG D;  3LZ0 C;  4J8X C;  3W98 D;  4R8P D;  5GXQ A;  3LEL A;  5B0Y B;  1P3A D;  3WTP B;  2ARO A;  5AV8 C;  1P3M C;  4LD9 C;  2IO5 C;  5AV5 A;  5AV9 D;  5B2J B;  5B32 D;  4WU9 D;  3AZL C;  4H9O B;  1S32 A;  4J8U D;  3AV2 D;  5E5A B;  5GSU D;  1M19 C;  2YFV A;  4KGC D;  1TAF A;  5AV8 A;  5B0Z C; 
#chains in the Genus database with same CATH topology
 1P3M A;  5CPK B;  4X23 D;  4H9N A;  4H9P A;  1M1A B;  3C1C B;  5BNV A;  4CSR A;  1BH8 B;  5FUG A;  3KXB C;  1ID3 C;  2BYK B;  3REI C;  3MGS C;  5GXQ B;  3LEL B;  5CPI D;  3H0R C;  1EQZ C;  3MGR D;  3AV1 D;  2F8N H;  3AN2 D;  2ARO B;  3X1U C;  3REH B;  3B0C W;  5JA4 A;  5AV5 B;  1M19 A;  3X1S D;  4XUJ C;  1M18 C;  1P3I D;  5B0Z A;  2ZY4 A;  1ZLA D;  3MGQ A;  2LY8 A;  4J8W D;  1S32 B;  5B2I D;  3KXB A;  1F1E A;  4H9R B;  1ID3 A;  3LZ0 B;  3REI A;  4NFT A;  4J8X B;  4Z66 D;  5CPJ C;  2YFV B;  2XD5 A;  1EQZ A;  1TAF B;  5AV8 B;  3IP4 C;  3X1V D;  1P3M B;  2IO5 B;  4WZS B;  3W96 D;  4H9N B;  4H9P B;  5AY8 C;  4J8V D;  2YFW B;  3O62 A;  4XZQ C;  5BNV B;  4NE3 A;  4CSR B;  5FUG B;  4XUJ A;  1M18 A;  3B0D C;  3LJA D;  1W2E A;  3REL A;  3AZK C;  5AVC C;  3KUY D;  3B6G D;  5CP6 D;  4Z2M G;  1P3G D;  1BFM A;  2J8P A;  5B1M A;  5B40 D;  3AZM A;  1P3B A;  2NQB C;  5F99 D;  3B6F C;  1M19 B;  2HIO C;  1P3P C;  3VH5 T;  5B0Z B;  2FJ7 A;  3MVD C;  5GT0 D;  2F8N D;  3KWQ D;  3MGQ B;  5AY8 A;  1HQ3 D;  5KDM A;  4JJN C;  3WA9 C;  3KXB B;  3UTA A;  1ID3 B;  3REI B;  1P3K D;  3MGS B;  1P3L C;  2PYO C;  3AZK A;  2CV5 C;  1P3O D;  5AVC A;  1EQZ B;  2NZD C;  2RVQ D;  5B2J C;  3AZI D;  1N1J B;  2BYM A;  2JSS A;  2Y2H A;  5AV6 D;  3W99 D;  3AZN D;  1P3F D;  2F8N K;  2NQB A;  3B6F A;  2HIO A;  4XUJ B;  4KHA A;  1M18 B;  3A6N D;  2XD1 A;  4YS3 D;  3REL B;  3EPH A;  2JCH A;  3WKJ A;  3MVD A;  4UPK A;  3X1T C;  4JJN A;  5B1M B;  3WA9 A;  3AZM B;  1P3B B;  3AYW D;  1P3L A;  1AOI D;  1U35 D;  2PYO A;  2UWX A;  4AWL C;  5CPJ B;  1B6W A;  3C1C C;  2CV5 A;  3AZG D;  2NZD A;  3C1B D;  3REK D;  1B67 A;  2FJ7 B;  1H3O A;  5GT3 C;  5B24 D;  3AFA D;  3TU4 D;  5JRG C;  2CWE A;  5AY8 B;  2ZM5 A;  5KDM B;  4XZQ B;  3AZJ D;  4M6B A;  4Z5T C;  4YM6 D;  1KX5 D;  3AZK B;  5AVC B;  5B0Y D;  3WTP D;  2BYM B;  5DNM A;  2NQB B;  3B6F B;  4EO5 C;  4QLC A;  2HIO B;  4KHA B;  5B32 C;  2BG1 A;  4WU9 C;  1P3P B;  3WKJ B;  5GT3 A;  2ZY3 A;  3MVD B;  5JRG A;  4JJN B;  3WA9 B;  4Z5T A;  1P3A A;  5E5A D;  1P3L B;  3MNN D;  2PYO B;  2CV5 B;  5B1L D;  2NZD B;  4X23 C;  3AZH C;  1H3O B;  3REJ C;  2HUE C;  3AZF C;  2RIQ A;  5B32 A;  4WU9 A;  3MGR C;  4J8U A;  3VH5 W;  3A1K A;  5DNN D;  3X1T B;  2ARO D;  3REH D;  4KGC A;  5DNM B;  3MGQ C;  4AWL B;  4QLC B;  4Z2M H;  4X23 A;  3AZH A;  4G92 C;  3UT9 D;  4KUD D;  5GT3 B;  5B32 G;  3REJ A;  5JRG B;  3AZF A;  1S32 D;  5CPI A;  4Z5T B;  3MGR A;  4WU8 D;  3LZ0 D;  4J8X D;  3O62 C;  3REL C;  5AV8 D;  3FDD A;  4LD9 D;  1T3U A;  4EO5 B;  1ZLA A;  1F66 C;  5B32 B;  4WU9 B;  1Z2C B;  4NE5 A;  5B1M C;  3AZM C;  2DQN C;  1P3B C;  3VH6 W;  1Q9C A;  5C3I C;  5B2I A;  4UUZ A;  1KX3 C;  3AZL D;  4Z66 A;  4DQY B;  2FJ7 C;  4KGC B;  3MGP C;  4HGA C;  1M19 D;  3W96 A;  4X23 B;  3AZH B;  3UTA C;  2Y2M A;  3REJ B;  2HUE B;  3AZF B;  5CHL B;  5CPI B;  1F66 A;  4DRA A;  1P3G A;  5JA4 B;  3MGR B;  1ID3 D;  3NQU A;  2RVQ C;  3REI D;  3MGS D;  2Y2K A;  1P3F C;  1KX4 C;  3W99 C;  1KX3 A;  1EQZ D;  4H9S C;  3H0L C;  3X1U D;  3WKJ C;  3AZE C;  3MGP A;  3VH5 A;  3W97 C;  5B31 C;  1ZLA B;  5BT1 C;  3KWQ A;  4G92 B;  5B2I B;  4UUZ B;  4H9Q A;  1P3K A;  1AOI C;  1HTA A;  3AZG C;  4ZUX C;  3UTB C;  3O62 B;  3W96 B;  5CPJ D;  1P3F A;  1KX4 A;  3W99 A;  4H9S A;  1P34 D;  1R4V A;  2F8N G;  3WAA D;  3AZE A;  3A6N A;  3W97 A;  4YM6 C;  5B31 A;  5AY8 D;  1KX5 C;  4XZQ D;  1F66 B;  3NQU B;  5DNM C;  5B33 D;  5C3I B;  3AZK D;  4QLC C;  5AVB D;  5AVC D;  1KX3 B;  1AOI A;  5G49 A;  3AZG A;  2ZY2 A;  5BNX A;  3C1B A;  3REK A;  3VH6 A;  3MGP B;  1TZY C;  4ZBJ C;  4ZUX A;  2NQB D;  3UTB A;  4HGA B;  3B6F D;  5B24 A;  3W98 C;  4R8P C;  2HIO D;  3LZ1 D;  1P3A C;  1P3P D;  5B31 G;  3UTA B;  3V9R A;  3B0C T;  4E45 A;  3AZJ A;  3MVD D;  4H9Q B;  4YM6 A;  1KX5 A;  4G91 C;  4JJN D;  5AV9 C;  5B1L C;  1PZR A;  3WA9 D;  2W8S A;  1P3L D;  2PYO D;  2Y2Q A;  1P3F B;  1KX4 B;  3W99 B;  2Y2O A;  3NQJ A;  3R45 A;  4J8U C;  5B2J D;  3AZE B;  3AV2 C;  3W97 B;  1TZY A;  5B31 B;  5GSU C;  3W98 A;  4R8P A;  2G5H C;  4KGC C;  3H0M C;  1AOI B;  3MNN A;  3X1T D;  5G49 B;  5AV9 A;  3P5J B;  5B1L A;  5BNX B;  3AZG B;  3REK B;  4ZUX B;  2Y2P A;  3UT9 C;  3UTB B;  5CPK D;  4KUD C;  1M1A D;  5CPI C;  3C1C D;  2Y2N A;  3V9R B;  3AV1 C;  3AZJ B;  2G5I C;  3AN2 C;  3AV2 A;  5GXQ D;  1BH9 A;  4YM6 B;  3LEL D;  4WU8 C;  1KX5 B;  5GSU A;  1WWS A;  5DNN A;  4Z5T D;  3X1S C;  5AV5 D;  1P3I C;  3REH A;  1ZLA C;  2DF4 C;  3NQJ B;  3R45 B;  2ZY5 A;  4J8W C;  1TZY B;  4ZBJ B;  5B2I C;  3UT9 A;  4KUD A;  3W98 B;  4R8P B;  4Z66 C;  3WTP E;  1P3A B;  3AV1 A;  3AN2 A;  3X1V C;  1JFI A;  4H9R A;  3W96 C;  3MNN B;  4WU8 A;  3LZ0 A;  4J8X A;  4G91 B;  2F2A C;  4J8V C;  5AV9 B;  5B1L B;  3X1S A;  1P3M D;  3LJA C;  4CAY A;  1P3I A;  1A7W A;  4LD9 A;  2Y2J A;  3KUY C;  3AZH D;  3B6G C;  5CP6 C;  1P3G C;  2YFW A;  4J8W A;  4J8U B;  3AV2 B;  1BH9 B;  5B40 C;  3REJ D;  5BO0 A;  5GSU B;  3EPK A;  3AZF D;  5DNN B;  5F99 C;  3AZL A;  3X1V A;  5BS7 C;  5GT0 C;  4DRB A;  3KWQ C;  1HQ3 C;  3EPJ A;  4J8V A;  5B0Z D;  3UT9 B;  4KUD B;  3LJA A;  4NE6 A;  3MGQ D;  1P3K C;  1P3O C;  3KUY A;  3B6G A;  5CP6 A;  3AV1 B;  3KXB D;  3KFU G;  3AN2 B;  3AZI C;  1JFI B;  5B40 A;  4WU8 B;  3AZN C;  5AV6 C;  3MGS A;  5F99 A;  3X1S B;  2L5A A;  3A6N C;  1P34 C;  4YS3 C;  4CAY B;  3X1U A;  1P3I B;  3WAA C;  1N1J A;  4LD9 B;  5BS7 A;  3O62 D;  5GT0 A;  2F8N A;  4XUJ D;  1M18 D;  4J8W B;  1HQ3 A;  2VQR A;  3REL D;  5BO0 B;  5B33 C;  3AYW C;  4WV4 B;  1U35 C;  2JE5 A;  4Z66 B;  5AVB C;  1F66 D;  1P3O A;  3AL0 C;  3AZL B;  5B1M D;  3C1B C;  3REK C;  3AZM D;  1P3B D;  1WWI A;  2Y2G A;  3AZI A;  3X1V B;  5B24 C;  3AFA C;  3TU4 C;  1KX3 D;  3AZN A;  5AV6 A;  4J8V B;  4WJ3 C;  5CPJ A;  3LZ1 C;  3AZJ C;  2FJ7 D;  3F6T A;  3LJA B;  3MGP D;  4YS3 A;  1P34 A;  3WAA A;  5B0Y C;  3KUY B;  1ULY A;  3B6G B;  5CP6 B;  1P3G B;  3UTA D;  3WTP C;  4XZQ A;  3EPL A;  5B40 B;  5B33 A;  3AYW A;  5F99 B;  1U35 A;  5AVB A;  3X1U B;  4WNN A;  3AFA A;  5GT0 B;  3TU4 A;  3KWQ B;  1KX4 D;  2F8N B;  1HQ3 B;  3LZ1 A;  3WKJ D;  3AZE D;  1P3P A;  5E5A C;  3W97 D;  5B31 D;  3MNN C;  1P3K B;  5BT1 D;  1P3O B;  4E44 A;  5B0Y A;  3WTP A;  3AZI B;  2Y2L A;  5CPK C;  3AZN B;  5AV6 B;  2CV5 D;  2NZD D;  3A1I A;  1M1A C;  3VH6 T;  3A6N B;  1P34 B;  4ZUX D;  4YS3 B;  1KU5 A;  3UTB D;  5B2J A;  3WAA B;  5GXQ C;  5DNN C;  3LEL C;  2FFF B;  4H9O A;  2ARO C;  3B0D B;  3REH C;  5AV5 C;  5B33 B;  5E5A A;  3AYW B;  1U35 B;  5AVB B;  2Y2I A;  3C1B B;  3X1T A;  5DNM D;  4WNN B;  5B24 B;  3AFA B;  3TU4 B;  4QLC D;  3B0B A;  5CPK A;  1S32 C;  1M1A A;  3LZ1 B;  3C1C A;  5GT3 D;  1BH8 A;  1TZY D;  2BYK A;  3KSY A;  5JRG D;  3LZ0 C;  4J8X C;  3W98 D;  4R8P D;  5GXQ A;  3LEL A;  5B0Y B;  1P3A D;  3WTP B;  2ARO A;  5AV8 C;  1P3M C;  4LD9 C;  2IO5 C;  5AV5 A;  5AV9 D;  5B2J B;  5B32 D;  4WU9 D;  3AZL C;  4H9O B;  1S32 A;  4J8U D;  3AV2 D;  5E5A B;  5GSU D;  3EG5 B;  1M19 C;  2YFV A;  4KGC D;  1TAF A;  5AV8 A;  5B0Z C; 
#chains in the Genus database with same CATH homology
 1P3M A;  5CPK B;  4X23 D;  4H9N A;  4H9P A;  1M1A B;  3C1C B;  5BNV A;  4CSR A;  1BH8 B;  5FUG A;  3KXB C;  1ID3 C;  2BYK B;  3REI C;  3MGS C;  5GXQ B;  3LEL B;  5CPI D;  3H0R C;  1EQZ C;  3MGR D;  3AV1 D;  2F8N H;  3AN2 D;  2ARO B;  3X1U C;  3REH B;  3B0C W;  5JA4 A;  5AV5 B;  1M19 A;  3X1S D;  4XUJ C;  1M18 C;  1P3I D;  5B0Z A;  2ZY4 A;  1ZLA D;  3MGQ A;  2LY8 A;  4J8W D;  1S32 B;  5B2I D;  3KXB A;  1F1E A;  4H9R B;  1ID3 A;  3LZ0 B;  3REI A;  4NFT A;  4J8X B;  4Z66 D;  5CPJ C;  2YFV B;  2XD5 A;  1EQZ A;  1TAF B;  5AV8 B;  3IP4 C;  3X1V D;  1P3M B;  2IO5 B;  4WZS B;  3W96 D;  4H9N B;  4H9P B;  5AY8 C;  4J8V D;  2YFW B;  3O62 A;  4XZQ C;  5BNV B;  4NE3 A;  4CSR B;  5FUG B;  4XUJ A;  1M18 A;  3B0D C;  3LJA D;  1W2E A;  3REL A;  3AZK C;  5AVC C;  3KUY D;  3B6G D;  5CP6 D;  4Z2M G;  1P3G D;  1BFM A;  2J8P A;  5B1M A;  5B40 D;  3AZM A;  1P3B A;  2NQB C;  5F99 D;  3B6F C;  1M19 B;  2HIO C;  1P3P C;  3VH5 T;  5B0Z B;  2FJ7 A;  3MVD C;  5GT0 D;  2F8N D;  3KWQ D;  3MGQ B;  5AY8 A;  1HQ3 D;  5KDM A;  4JJN C;  3WA9 C;  3KXB B;  3UTA A;  1ID3 B;  3REI B;  1P3K D;  3MGS B;  1P3L C;  2PYO C;  3AZK A;  2CV5 C;  1P3O D;  5AVC A;  1EQZ B;  2NZD C;  2RVQ D;  5B2J C;  3AZI D;  1N1J B;  2BYM A;  2JSS A;  2Y2H A;  5AV6 D;  3W99 D;  3AZN D;  1P3F D;  2F8N K;  2NQB A;  3B6F A;  2HIO A;  4XUJ B;  4KHA A;  1M18 B;  3A6N D;  2XD1 A;  4YS3 D;  3REL B;  3EPH A;  2JCH A;  3WKJ A;  3MVD A;  4UPK A;  3X1T C;  4JJN A;  5B1M B;  3WA9 A;  3AZM B;  1P3B B;  3AYW D;  1P3L A;  1AOI D;  1U35 D;  2PYO A;  2UWX A;  4AWL C;  5CPJ B;  1B6W A;  3C1C C;  2CV5 A;  3AZG D;  2NZD A;  3C1B D;  3REK D;  1B67 A;  2FJ7 B;  1H3O A;  5GT3 C;  5B24 D;  3AFA D;  3TU4 D;  5JRG C;  2CWE A;  5AY8 B;  2ZM5 A;  5KDM B;  4XZQ B;  3AZJ D;  4M6B A;  4Z5T C;  4YM6 D;  1KX5 D;  3AZK B;  5AVC B;  5B0Y D;  3WTP D;  2BYM B;  5DNM A;  2NQB B;  3B6F B;  4EO5 C;  4QLC A;  2HIO B;  4KHA B;  5B32 C;  2BG1 A;  4WU9 C;  1P3P B;  3WKJ B;  5GT3 A;  2ZY3 A;  3MVD B;  5JRG A;  4JJN B;  3WA9 B;  4Z5T A;  1P3A A;  5E5A D;  1P3L B;  3MNN D;  2PYO B;  2CV5 B;  5B1L D;  2NZD B;  4X23 C;  3AZH C;  1H3O B;  3REJ C;  2HUE C;  3AZF C;  2RIQ A;  5B32 A;  4WU9 A;  3MGR C;  4J8U A;  3VH5 W;  3A1K A;  5DNN D;  3X1T B;  2ARO D;  3REH D;  4KGC A;  5DNM B;  3MGQ C;  4AWL B;  4QLC B;  4Z2M H;  4X23 A;  3AZH A;  4G92 C;  3UT9 D;  4KUD D;  5GT3 B;  5B32 G;  3REJ A;  5JRG B;  3AZF A;  1S32 D;  5CPI A;  4Z5T B;  3MGR A;  4WU8 D;  3LZ0 D;  4J8X D;  3O62 C;  3REL C;  5AV8 D;  3FDD A;  4LD9 D;  1T3U A;  4EO5 B;  1ZLA A;  1F66 C;  5B32 B;  4WU9 B;  1Z2C B;  4NE5 A;  5B1M C;  3AZM C;  2DQN C;  1P3B C;  3VH6 W;  1Q9C A;  5C3I C;  5B2I A;  4UUZ A;  1KX3 C;  3AZL D;  4Z66 A;  4DQY B;  2FJ7 C;  4KGC B;  3MGP C;  4HGA C;  1M19 D;  3W96 A;  4X23 B;  3AZH B;  3UTA C;  2Y2M A;  3REJ B;  2HUE B;  3AZF B;  5CHL B;  5CPI B;  1F66 A;  4DRA A;  1P3G A;  5JA4 B;  3MGR B;  1ID3 D;  3NQU A;  2RVQ C;  3REI D;  3MGS D;  2Y2K A;  1P3F C;  1KX4 C;  3W99 C;  1KX3 A;  1EQZ D;  4H9S C;  3H0L C;  3X1U D;  3WKJ C;  3AZE C;  3MGP A;  3VH5 A;  3W97 C;  5B31 C;  1ZLA B;  5BT1 C;  3KWQ A;  4G92 B;  5B2I B;  4UUZ B;  4H9Q A;  1P3K A;  1AOI C;  1HTA A;  3AZG C;  4ZUX C;  3UTB C;  3O62 B;  3W96 B;  5CPJ D;  1P3F A;  1KX4 A;  3W99 A;  4H9S A;  1P34 D;  1R4V A;  2F8N G;  3WAA D;  3AZE A;  3A6N A;  3W97 A;  4YM6 C;  5B31 A;  5AY8 D;  1KX5 C;  4XZQ D;  1F66 B;  3NQU B;  5DNM C;  5B33 D;  5C3I B;  3AZK D;  4QLC C;  5AVB D;  5AVC D;  1KX3 B;  1AOI A;  5G49 A;  3AZG A;  2ZY2 A;  5BNX A;  3C1B A;  3REK A;  3VH6 A;  3MGP B;  1TZY C;  4ZBJ C;  4ZUX A;  2NQB D;  3UTB A;  4HGA B;  3B6F D;  5B24 A;  3W98 C;  4R8P C;  2HIO D;  3LZ1 D;  1P3A C;  1P3P D;  5B31 G;  3UTA B;  3V9R A;  3B0C T;  4E45 A;  3AZJ A;  3MVD D;  4H9Q B;  4YM6 A;  1KX5 A;  4G91 C;  4JJN D;  5AV9 C;  5B1L C;  1PZR A;  3WA9 D;  2W8S A;  1P3L D;  2PYO D;  2Y2Q A;  1P3F B;  1KX4 B;  3W99 B;  2Y2O A;  3NQJ A;  3R45 A;  4J8U C;  5B2J D;  3AZE B;  3AV2 C;  3W97 B;  1TZY A;  5B31 B;  5GSU C;  3W98 A;  4R8P A;  2G5H C;  4KGC C;  3H0M C;  1AOI B;  3MNN A;  3X1T D;  5G49 B;  5AV9 A;  3P5J B;  5B1L A;  5BNX B;  3AZG B;  3REK B;  4ZUX B;  2Y2P A;  3UT9 C;  3UTB B;  5CPK D;  4KUD C;  1M1A D;  5CPI C;  3C1C D;  2Y2N A;  3V9R B;  3AV1 C;  3AZJ B;  2G5I C;  3AN2 C;  3AV2 A;  5GXQ D;  1BH9 A;  4YM6 B;  3LEL D;  4WU8 C;  1KX5 B;  5GSU A;  1WWS A;  5DNN A;  4Z5T D;  3X1S C;  5AV5 D;  1P3I C;  3REH A;  1ZLA C;  2DF4 C;  3NQJ B;  3R45 B;  2ZY5 A;  4J8W C;  1TZY B;  4ZBJ B;  5B2I C;  3UT9 A;  4KUD A;  3W98 B;  4R8P B;  4Z66 C;  3WTP E;  1P3A B;  3AV1 A;  3AN2 A;  3X1V C;  1JFI A;  4H9R A;  3W96 C;  3MNN B;  4WU8 A;  3LZ0 A;  4J8X A;  4G91 B;  2F2A C;  4J8V C;  5AV9 B;  5B1L B;  3X1S A;  1P3M D;  3LJA C;  4CAY A;  1P3I A;  1A7W A;  4LD9 A;  2Y2J A;  3KUY C;  3AZH D;  3B6G C;  5CP6 C;  1P3G C;  2YFW A;  4J8W A;  4J8U B;  3AV2 B;  1BH9 B;  5B40 C;  3REJ D;  5BO0 A;  5GSU B;  3EPK A;  3AZF D;  5DNN B;  5F99 C;  3AZL A;  3X1V A;  5BS7 C;  5GT0 C;  4DRB A;  3KWQ C;  1HQ3 C;  3EPJ A;  4J8V A;  5B0Z D;  3UT9 B;  4KUD B;  3LJA A;  4NE6 A;  3MGQ D;  1P3K C;  1P3O C;  3KUY A;  3B6G A;  5CP6 A;  3AV1 B;  3KXB D;  3KFU G;  3AN2 B;  3AZI C;  1JFI B;  5B40 A;  4WU8 B;  3AZN C;  5AV6 C;  3MGS A;  5F99 A;  3X1S B;  2L5A A;  3A6N C;  1P34 C;  4YS3 C;  4CAY B;  3X1U A;  1P3I B;  3WAA C;  1N1J A;  4LD9 B;  5BS7 A;  3O62 D;  5GT0 A;  2F8N A;  4XUJ D;  1M18 D;  4J8W B;  1HQ3 A;  2VQR A;  3REL D;  5BO0 B;  5B33 C;  3AYW C;  4WV4 B;  1U35 C;  2JE5 A;  4Z66 B;  5AVB C;  1F66 D;  1P3O A;  3AL0 C;  3AZL B;  5B1M D;  3C1B C;  3REK C;  3AZM D;  1P3B D;  1WWI A;  2Y2G A;  3AZI A;  3X1V B;  5B24 C;  3AFA C;  3TU4 C;  1KX3 D;  3AZN A;  5AV6 A;  4J8V B;  4WJ3 C;  5CPJ A;  3LZ1 C;  3AZJ C;  2FJ7 D;  3F6T A;  3LJA B;  3MGP D;  4YS3 A;  1P34 A;  3WAA A;  5B0Y C;  3KUY B;  1ULY A;  3B6G B;  5CP6 B;  1P3G B;  3UTA D;  3WTP C;  4XZQ A;  3EPL A;  5B40 B;  5B33 A;  3AYW A;  5F99 B;  1U35 A;  5AVB A;  3X1U B;  4WNN A;  3AFA A;  5GT0 B;  3TU4 A;  3KWQ B;  1KX4 D;  2F8N B;  1HQ3 B;  3LZ1 A;  3WKJ D;  3AZE D;  1P3P A;  5E5A C;  3W97 D;  5B31 D;  3MNN C;  1P3K B;  5BT1 D;  1P3O B;  4E44 A;  5B0Y A;  3WTP A;  3AZI B;  2Y2L A;  5CPK C;  3AZN B;  5AV6 B;  2CV5 D;  2NZD D;  3A1I A;  1M1A C;  3VH6 T;  3A6N B;  1P34 B;  4ZUX D;  4YS3 B;  1KU5 A;  3UTB D;  5B2J A;  3WAA B;  5GXQ C;  5DNN C;  3LEL C;  2FFF B;  4H9O A;  2ARO C;  3B0D B;  3REH C;  5AV5 C;  5B33 B;  5E5A A;  3AYW B;  1U35 B;  5AVB B;  2Y2I A;  3C1B B;  3X1T A;  5DNM D;  4WNN B;  5B24 B;  3AFA B;  3TU4 B;  4QLC D;  3B0B A;  5CPK A;  1S32 C;  1M1A A;  3LZ1 B;  3C1C A;  5GT3 D;  1BH8 A;  1TZY D;  2BYK A;  3KSY A;  5JRG D;  3LZ0 C;  4J8X C;  3W98 D;  4R8P D;  5GXQ A;  3LEL A;  5B0Y B;  1P3A D;  3WTP B;  2ARO A;  5AV8 C;  1P3M C;  4LD9 C;  2IO5 C;  5AV5 A;  5AV9 D;  5B2J B;  5B32 D;  4WU9 D;  3AZL C;  4H9O B;  1S32 A;  4J8U D;  3AV2 D;  5E5A B;  5GSU D;  3EG5 B;  1M19 C;  2YFV A;  4KGC D;  1TAF A;  5AV8 A;  5B0Z C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...