1P3MD

Crystallographic studies of nucleosome core particles containing histone 'sin' mutants
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
92
structure length
92
Chain Sequence
KESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structures of histone Sin mutant nucleosomes reveal altered protein-DNA interactions
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
molecule keywords Palindromic 146bp Human Alpha-Satellite DNA fragment
total genus 33
structure length 92
sequence length 92
chains with identical sequence H
ec nomenclature
pdb deposition date 2003-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1p3mD00
3C1BB 3TU4C 2F8NB 1P3AA 1BH9B 5JRGC 5F99A 2CV5B 5BO0A 3MGSA 4G91C 5F99D 3AZEA 3MGSD 3KWQB 1P34D 5GT3B 3MGQB 3UT9C 3REHD 2YFWB 3AZIA 5AVCB 3WTPD 3WTPB 3KXBB 3KXBD 3UTAA 2F8NA 1P3GA 4H9NB 5B32B 1BH9A 5AY8B 4J8WB 1P34B 3AZFA 5B24B 4J8VC 4ZUXA 3MGSB 4KGCD 4WU8B 4H9RA 3AZIC 3AZHB 3AN2C 5B0YB 3B6GB 4DRBA 3AZNB 2CV5D 5GXQB 1U35D 4R8PD 3VH5W 4AWLB 5AV5B 2F8ND 4YM6A 3AZEC 4WV4B 3LZ1B 3LZ0D 4R8PA 1P3AC 4WNNA 3LZ0B 4QLCA 3X1VC 3TU4A 3AN2A 1KX5D 3REIC 3RELB 4JJNB 5AV5D 3UTBB 3WAAB 3AV2A 3AFAD 1P3PD 1P3GC 4ZBJC 4CAYA 5B0ZA 5JA4B 1KX4B 3UTAC 4X23C 2YFVA 5B40A 5AV5C 5AV6D 3X1SC 4LD9A 3AZJD 3UT9A 3MGPC 3W98D 3AZNC 2HUEC 4J8WD 1WWIA 3AN2D 3KWQA 3KUYC 5AVBB 3MGSC 4X23B 4Z5TD 3REHB 4UUZA 1R4VA 3WAAA 5AV8C 1P3MD 4J8VD 1KX3A 3KWQD 5DNNC 4WU9D 3UTBC 5AVCC 5AV9A 3VH5T 2AROD 2NZDC 4ZUXB 2AROC 3RELC 3AZGB 1P3KB 3AZHA 5AV9C 3WA9A 3B6GA 3LJAB 2F8NH 2NQBD 3REJA 3C1BD 5FUGB 4UUZB 4YM6D 4YM6B 2LY8A 3LELB 3MNNB 5CPKA 4J8XD 3KUYA 4Z66B 3C1BC 1AOID 4KUDD 5AV9B 1P3OB 2NQBA 1ZLAB 1P3KD 5E5AC 5BNXA 3X1SA 3WTPE 3O62B 5B40C 5CPJB 1P3FA 1KX5A 1EQZC 4LD9C 1P3ID 4H9SA 1TAFB 4WU9B 1M18C 5B24C 4J8VB 3WKJA 1P3MB 4J8WC 3AV2C 3X1UB 1P3BA 1P3MC 5BNVB 3LELA 4X23D 1M18B 4YS3D 1HQ3B 1TZYA 4XUJA 4KGCC 5B40B 4LD9B 2BYMA 5GT3C 3MGQC 4R8PC 4HGAC 1P3FD 3O62A 5AVBA 5AV6B 3X1TA 3MGPD 5B1LD 3MNNC 5G49A 3AZKA 3B6FC 3WKJB 4YM6C 5B0ZD 2CV5C 3WAAD 2HIOC 3MVDD 3X1UA 1P3BB 5BNVA 3AFAA 1TZYD 5B1MD 2L5AA 5CHLB 3A6NA 2FJ7D 3AZED 3W97B 2PYOA 5B31D 5DNND 3AZLD 3VH6W 4ZUXC 2RVQC 5B2JA 3LZ1C 4XZQB 5JRGD 3UT9D 3R45B 3NQUA 4J8XC 4KUDC 1B6WA 5CPKB 5GSUC 3AZND 4Z66A 5CPIA 1P3LC 3REKC 3A6NB 3AV2D 1M19A 3B6GD 2YFWA 5B31G 4Z2MG 3AZHD 1ZLAA 5GT0C 4H9NA 3X1SD 3REJD 5B32A 5CPJA 5AY8A 1ID3D 5JRGA 1TAFA 4WU9A 3AZFB 3B6FB 3B6FD 3WA9D 3W96B 5B32D 4XZQA 2IO5C 1M1AD 2JSSA 3AYWC 1JFIA 4H9RB 5AVCD 5B0YA 1N1JB 5GT0B 3AZMA 5AV8D 1S32C 4XUJB 1M1AC 5GT3D 3MGQD 5DNMC 5C3IB 1BH8B 1P3AB 5F99B 5BO0B 5CP6A 4NE3A 5B1LA 5JRGB 4XZQD 4XZQC 5G49B 5B33A 3C1CD 3LZ0A 5B31C 3AZLC 3VH6T 2FJ7C 5GXQC 4JJNA 2FJ7B 5E5AD 4WU8C 3B0DC 1P3BD 1AOIC 2HIOB 5B0ZB 5JA4A 1KX4A 3REID 1P34A 5B2JB 1F66A 5B1LB 4J8UC 4QLCD 5AV6C 3WTPC 3KXBC 1F66D 5B1MA 5B2ID 3R45A 1WWSA 4HGAB 1ID3C 3W98A 3AV1B 1P3GD 2BYKB 4H9QA 3B0CT 3AZGC 3AV1C 4WZSB 4YS3C 2NZDB 1HQ3D 4J8UB 2NZDD 1KU5A 1P3PA 3X1UD 3X1UC 3W96C 5B2IA 5BS7C 5BS7A 4KHAA 3REHC 3AZKC 1H3OA 3B6FA 1F66B 4WNNB 3MGRD 4QLCB 4Z5TC 3TU4B 3O62D 1EQZB 3REKB 1S32D 3W99A 1ZLAD 3AV1A 3KUYD 3LJAA 1P3OD 3AZMD 3C1CC 4J8XB 4KUDB 5B1MC 1TZYC 1BH8A 3MNND 3X1VD 3B0BA 4J8UA 2F8NG 3LELC 5CP6B 5DNMD 3V9RB 4J8WA 3MGRA 4EO5C 5B33D 5B33B 3LJAD 3LJAC 3C1CA 4G92B 1P3OA 2NQBB 5C3IC 5DNMB 3VH5A 4WU8A 1EQZA 1KX5C 3X1VB 2AROB 1P3AD 3REHA 3C1BA 3AYWB 2IO5B 5AV8B 1KX3B 1B67A 5GT0D 1EQZD 4E45A 3KSYA 3V9RA 3MGRB 3AZGA 3REJC 1P3KA 3W98C 4E44A 2F8NK 1ID3A 3WA9C 3WA9B 3W96D 3AZHC 3AN2B 3W98B 1P3IA 5AV6A 3AZMC 3REJB 3RELA 1HQ3C 1F66C 1KX4D 5AVCA 3UTAB 3UTBA 3AYWA 3AV2B 1P3PB 1P3GB 1AOIA 3AFAB 5AV8A 3AZKD 5B2IB 4CAYB 3UTBD 2CWEA 4WU9C 3NQJA 4KHAB 4M6BA 3MVDA 4JJND 1H3OB 5CPJC 4JJNC 3RELD 3UT9B 2PYOB 1ZLAC 3REIB 5BNXB 1KX5B 2HIOD 3MVDC 3KWQC 3REKA 1M19C 3W99B 4Z66C 5CPIC 4CSRB 5B31A 3LZ0C 3AZNA 3AZLA 5CPID 5B1LC 3VH6A 4J8XA 5AV5A 4KUDA 4X23A 3LZ1D 3W97D 5B0ZC 1HQ3A 5KDMA 3LZ1A 1TZYB 3B0DB 1P3IC 1F1EA 5CPIB 1M1AA 3NQJB 3W99D 3MVDB 4R8PB 3C1CB 5GXQD 1U35B 1S32A 1P3KC 3WKJD 2PYOC 5B0YD 2PYOD 3REIA 4WU8D 4KGCB 4QLCC 3X1VA 5B24D 3AFAC 3AZKB 4XUJD 5AY8D 5FUGA 5AY8C 5B32C 5B40D 3UTAD 4LD9D 3MNNA 1Q9CA 5GT0A 1M18D 5AVBC 2YFVB 3O62C 1M1AB 5GSUA 1P3LA 4H9PB 3AZFD 2HUEB 1P3OC 1ID3B 1BFMA 3MGRC 3X1SB 4KGCA 1P3IB 5CPJD 4ZBJB 5B2JC 4J8VA 3AZFC 3A6ND 1KX3D 4NE5A 1P3MA 3AYWD 5AV9D 3NQUB 5CPKD 4Z66D 1AOIB 1M18A 2RVQD 3AZID 3W99C 1M19B 3LELD 3A6NC 5GSUB 1P3LB 4Z5TA 4H9PA 4EO5B 2NQBC 2HIOA 2CV5A 5DNNB 4CSRA 5B31B 3AZLB 3W96A 5B2IC 5CP6D 1P3PC 3AZEB 3X1TD 3AZGD 3X1TC 1JFIB 4ZUXD 5B1MB 5F99C 4YS3A 4AWLC 4NFTA 5GT3A 3MGQA 5KDMB 2BYKA 4H9QB 3AZMB 3KUYB 3B6GC 3W97C 4XUJC 3REKD 1S32B 1U35A 3KXBA 3WTPA 4Z5TB 3TU4D 3MGPB 1P3BC 3AZJC 1P3FB 1P34C 5AVBD 1KX4C 4DRAA 5DNNA 3WKJC 5B24A 1KX3C 1HTAA 4Z2MH 4H9SC 3WAAC 4J8UD 3AZJB 1P3FC 4H9OB 4YS3B 5E5AA 5GXQA 2FJ7A 3AV1D 2BYMB 5BT1D 5BT1C 5CPKC 4G92C 1ULYA 3MGPA 4G91B 5B33C 3B0CW 5B32G 5B2JD 5CP6C 3X1TB 5DNMA 1A7WA 3AZJA 4NE6A 4H9OA 5E5AB 1N1JA 5GSUD 1P3LD 2AROA 1U35C 2NZDA 5B0YC 1M19D 3AZIB 3W97A
chains in the Genus database with same CATH superfamily
3C1BB 3TU4C 2F8NB 1P3AA 1BH9B 5JRGC 5F99A 2CV5B 5BO0A 3MGSA 2Y2GA 4G91C 5F99D 3AZEA 2Y2JA 2UWXA 3MGSD 3KWQB 1P34D 5GT3B 3MGQB 3UT9C 3REHD 2YFWB 3AZIA 5AVCB 3WTPD 3WTPB 3KXBB 3KXBD 3UTAA 2F8NA 1P3GA 4H9NB 5B32B 1BH9A 5AY8B 4J8WB 1P34B 3AZFA 5B24B 4J8VC 4ZUXA 3MGSB 3F6TA 4KGCD 4WU8B 4H9RA 3AZIC 3AZHB 3AN2C 5B0YB 3B6GB 4DRBA 3AZNB 2CV5D 5GXQB 1U35D 4R8PD 3VH5W 4AWLB 5AV5B 2F8ND 4YM6A 3AZEC 4WV4B 3LZ1B 2Y2NA 3LZ0D 4R8PA 1P3AC 4WNNA 3LZ0B 4QLCA 3X1VC 3TU4A 3AN2A 1KX5D 3REIC 3RELB 4JJNB 2Y2HA 5AV5D 2JE5A 3UTBB 3EG5B 3WAAB 3AV2A 3AFAD 1P3PD 1P3GC 4ZBJC 4CAYA 5B0ZA 5JA4B 1KX4B 3UTAC 3EPLA 4X23C 2YFVA 2Y2QA 5B40A 5AV5C 5AV6D 3X1SC 4LD9A 3AZJD 3UT9A 3MGPC 3W98D 3AZNC 2HUEC 4J8WD 1WWIA 3AN2D 3KWQA 3KUYC 5AVBB 3MGSC 4X23B 4Z5TD 3REHB 4UUZA 1R4VA 3WAAA 5AV8C 1P3MD 4J8VD 1KX3A 3KWQD 3H0LC 5DNNC 4WU9D 3UTBC 5AVCC 5AV9A 3VH5T 2AROD 2NZDC 4ZUXB 2AROC 3RELC 3AZGB 1P3KB 2Y2LA 3AZHA 5AV9C 3WA9A 3B6GA 3LJAB 2F8NH 2NQBD 3REJA 3C1BD 5FUGB 4UUZB 4YM6D 4YM6B 2LY8A 3LELB 3MNNB 5CPKA 4J8XD 3KUYA 4Z66B 3C1BC 1AOID 4KUDD 5AV9B 1P3OB 2NQBA 1ZLAB 1P3KD 5E5AC 5BNXA 3X1SA 3WTPE 3O62B 5B40C 5CPJB 1P3FA 1KX5A 2G5IC 1EQZC 1P3ID 4H9SA 1TAFB 4WU9B 1M18C 5B24C 4J8VB 3WKJA 1P3MB 4J8WC 3AV2C 3X1UB 1P3BA 1P3MC 5BNVB 3LELA 4X23D 1M18B 4YS3D 1HQ3B 3P5JB 1TZYA 4XUJA 4KGCC 5B40B 4LD9B 2BYMA 5GT3C 3MGQC 4R8PC 4HGAC 1P3FD 3O62A 2ZY4A 5AVBA 5AV6B 4DQYB 3MGPD 3X1TA 5B1LD 3MNNC 5G49A 3AZKA 3B6FC 3WKJB 4YM6C 5B0ZD 2CV5C 3WAAD 2HIOC 3MVDD 3X1UA 1P3BB 5BNVA 3AFAA 1TZYD 2Y2OA 5B1MD 2L5AA 5CHLB 3A6NA 2FJ7D 3AZED 3W97B 1W2EA 2PYOA 5B31D 2J8PA 5DNND 3VH6W 4ZUXC 3AZLD 2RVQC 5B2JA 3LZ1C 4XZQB 5JRGD 2G5HC 3UT9D 3R45B 3NQUA 4J8XC 4KUDC 1B6WA 3EPJA 5CPKB 5GSUC 3AZND 4Z66A 5CPIA 1P3LC 3REKC 3A6NB 3AV2D 1M19A 3B6GD 2YFWA 5B31G 4Z2MG 3AZHD 1ZLAA 5GT0C 4H9NA 3KFUG 3X1SD 3REJD 5B32A 2XD1A 5CPJA 5AY8A 1ID3D 2VQRA 5JRGA 1TAFA 4WU9A 3AZFB 3B6FB 3B6FD 3WA9D 3W96B 5B32D 4XZQA 2IO5C 2ZY2A 2JSSA 1M1AD 3AYWC 1JFIA 4H9RB 5AVCD 5B0YA 2ZM5A 1N1JB 5GT0B 3AZMA 5AV8D 1S32C 4XUJB 1M1AC 5GT3D 3MGQD 4UPKA 5DNMC 5C3IB 1BH8B 1P3AB 5F99B 5BO0B 5CP6A 4NE3A 5B1LA 5JRGB 4XZQD 4XZQC 5G49B 5B33A 3H0MC 3C1CD 3LZ0A 5B31C 3AZLC 3VH6T 2FJ7C 5GXQC 4JJNA 2FJ7B 5E5AD 4WU8C 3B0DC 1P3BD 1AOIC 2HIOB 5B0ZB 4WJ3C 2Y2MA 5JA4A 1KX4A 3REID 1P34A 3A1IA 5B2JB 1F66A 5B1LB 4J8UC 4QLCD 5AV6C 3WTPC 3KXBC 1F66D 5B1MA 5B2ID 3R45A 1WWSA 4HGAB 1ID3C 3W98A 3AV1B 1P3GD 2BYKB 4H9QA 3B0CT 3AZGC 3AV1C 4WZSB 4YS3C 2NZDB 1HQ3D 4J8UB 2NZDD 1KU5A 1P3PA 3X1UD 3X1UC 3W96C 5B2IA 5BS7C 5BS7A 4KHAA 3REHC 3AZKC 1H3OA 3B6FA 1F66B 4WNNB 3MGRD 4QLCB 4Z5TC 3TU4B 3O62D 1EQZB 1PZRA 1T3UA 3REKB 1S32D 3W99A 1ZLAD 2RIQA 3AV1A 3KUYD 3LJAA 1P3OD 3AZMD 3C1CC 4J8XB 4KUDB 5B1MC 1TZYC 1BH8A 3MNND 3X1VD 3B0BA 4J8UA 2F8NG 3LELC 5CP6B 5DNMD 3V9RB 4J8WA 3MGRA 4EO5C 5B33D 5B33B 3LJAD 3LJAC 3C1CA 4G92B 1P3OA 2NQBB 5C3IC 5DNMB 3VH5A 4WU8A 1EQZA 1KX5C 3X1VB 2AROB 1P3AD 3REHA 2Y2IA 3C1BA 3AYWB 2IO5B 5AV8B 1KX3B 1B67A 5GT0D 1EQZD 4E45A 2F2AC 3KSYA 2Y2PA 3V9RA 3MGRB 3AZGA 3REJC 1P3KA 3W98C 4E44A 2F8NK 1ID3A 3WA9C 3WA9B 3IP4C 3W96D 3AZHC 3AN2B 3W98B 1P3IA 5AV6A 2ZY5A 3AZMC 3REJB 3RELA 1HQ3C 1F66C 2JCHA 1KX4D 5AVCA 3UTAB 3UTBA 3AYWA 3AV2B 1P3PB 1P3GB 1AOIA 3AFAB 5AV8A 3AZKD 5B2IB 4CAYB 3UTBD 2CWEA 4WU9C 2BG1A 3NQJA 4KHAB 4M6BA 3MVDA 4JJND 1H3OB 5CPJC 4JJNC 4LD9C 3RELD 3UT9B 2PYOB 3A1KA 1ZLAC 3REIB 5BNXB 1KX5B 2HIOD 3MVDC 3KWQC 3REKA 1M19C 3W99B 4Z66C 5CPIC 4CSRB 5B31A 3LZ0C 3AZNA 3AZLA 5CPID 5B1LC 3VH6A 4J8XA 5AV5A 4KUDA 4X23A 3LZ1D 3W97D 5B0ZC 1HQ3A 5KDMA 3LZ1A 1TZYB 3B0DB 3EPHA 1P3IC 1F1EA 5CPIB 1M1AA 3NQJB 3W99D 3MVDB 4R8PB 3C1CB 5GXQD 1U35B 1S32A 1P3KC 3WKJD 2PYOC 5B0YD 2PYOD 3REIA 4WU8D 4KGCB 4QLCC 3X1VA 5B24D 3AFAC 3AZKB 4XUJD 5AY8D 5FUGA 5AY8C 5B32C 3EPKA 5B40D 3UTAD 2Y2KA 4LD9D 3MNNA 1Q9CA 5GT0A 1Z2CB 3FDDA 1M18D 5AVBC 2YFVB 3O62C 1M1AB 5GSUA 1P3LA 4H9PB 3AZFD 2HUEB 1P3OC 1ID3B 1BFMA 3MGRC 3X1SB 4KGCA 2XD5A 1P3IB 5CPJD 4ZBJB 5B2JC 4J8VA 3AZFC 3A6ND 1KX3D 4NE5A 1P3MA 2W8SA 3AYWD 5AV9D 3NQUB 5CPKD 4Z66D 1AOIB 1M18A 2RVQD 3AZID 3W99C 1M19B 3LELD 3A6NC 5GSUB 1P3LB 4Z5TA 2FFFB 4H9PA 4EO5B 2NQBC 2HIOA 2CV5A 5DNNB 4CSRA 5B31B 3AZLB 3W96A 5B2IC 5CP6D 1P3PC 3AZEB 3X1TD 3AZGD 3X1TC 1JFIB 4ZUXD 5B1MB 3AL0C 5F99C 4YS3A 4AWLC 4NFTA 5GT3A 3MGQA 5KDMB 2BYKA 4H9QB 3H0RC 3AZMB 3KUYB 3B6GC 3W97C 4XUJC 3REKD 1S32B 1U35A 3WTPA 3KXBA 4Z5TB 3TU4D 3MGPB 1P3BC 3AZJC 1P3FB 1P34C 5AVBD 1KX4C 4DRAA 5DNNA 3WKJC 5B24A 1KX3C 1HTAA 2DQNC 4Z2MH 4H9SC 3WAAC 4J8UD 3AZJB 1P3FC 4H9OB 4YS3B 5E5AA 5GXQA 2FJ7A 3AV1D 2BYMB 2ZY3A 5BT1D 5BT1C 5CPKC 4G92C 1ULYA 3MGPA 4G91B 5B33C 3B0CW 2DF4C 5B32G 5B2JD 5CP6C 3X1TB 5DNMA 1A7WA 3AZJA 4NE6A 4H9OA 5E5AB 1N1JA 5GSUD 1P3LD 2AROA 1U35C 2NZDA 5B0YC 1M19D 3AZIB 3W97A
chains in the Genus database with same CATH topology
3C1BB 3TU4C 2F8NB 1P3AA 1BH9B 5JRGC 5F99A 2CV5B 5BO0A 3MGSA 2Y2GA 4G91C 5F99D 3AZEA 2Y2JA 2UWXA 3MGSD 3KWQB 1P34D 5GT3B 3MGQB 3UT9C 3REHD 2YFWB 3AZIA 5AVCB 3WTPD 3WTPB 3KXBB 3KXBD 3UTAA 2F8NA 1P3GA 4H9NB 5B32B 1BH9A 5AY8B 4J8WB 1P34B 3AZFA 5B24B 4J8VC 4ZUXA 3MGSB 3F6TA 4KGCD 4WU8B 4H9RA 3AZIC 3AZHB 3AN2C 5B0YB 3B6GB 4DRBA 3AZNB 2CV5D 5GXQB 1U35D 4R8PD 3VH5W 4AWLB 5AV5B 2F8ND 4YM6A 3AZEC 4WV4B 3LZ1B 2Y2NA 3LZ0D 4R8PA 1P3AC 4WNNA 3LZ0B 4QLCA 3X1VC 3TU4A 3AN2A 1KX5D 3REIC 3RELB 4JJNB 2Y2HA 5AV5D 2JE5A 3UTBB 3EG5B 3WAAB 3AV2A 3AFAD 1P3PD 1P3GC 4ZBJC 4CAYA 5B0ZA 5JA4B 1KX4B 3UTAC 3EPLA 4X23C 2YFVA 2Y2QA 5B40A 5AV5C 5AV6D 3X1SC 4LD9A 3AZJD 3UT9A 3MGPC 3W98D 3AZNC 2HUEC 4J8WD 1WWIA 3AN2D 3KWQA 3KUYC 5AVBB 3MGSC 4X23B 4Z5TD 3REHB 4UUZA 1R4VA 3WAAA 5AV8C 1P3MD 4J8VD 1KX3A 3KWQD 3H0LC 5DNNC 4WU9D 3UTBC 5AVCC 5AV9A 3VH5T 2AROD 2NZDC 4ZUXB 2AROC 3RELC 3AZGB 1P3KB 2Y2LA 3AZHA 5AV9C 3WA9A 3B6GA 3LJAB 2F8NH 2NQBD 3REJA 3C1BD 5FUGB 4UUZB 4YM6D 4YM6B 2LY8A 3LELB 3MNNB 5CPKA 4J8XD 3KUYA 4Z66B 3C1BC 1AOID 4KUDD 5AV9B 1P3OB 2NQBA 1ZLAB 1P3KD 5E5AC 5BNXA 3X1SA 3WTPE 3O62B 5B40C 5CPJB 1P3FA 1KX5A 2G5IC 1EQZC 1P3ID 4H9SA 1TAFB 4WU9B 1M18C 5B24C 4J8VB 3WKJA 1P3MB 4J8WC 3AV2C 3X1UB 1P3BA 1P3MC 5BNVB 3LELA 4X23D 1M18B 4YS3D 1HQ3B 3P5JB 1TZYA 4XUJA 4KGCC 5B40B 4LD9B 2BYMA 5GT3C 3MGQC 4R8PC 4HGAC 1P3FD 3O62A 2ZY4A 5AVBA 5AV6B 4DQYB 3MGPD 3X1TA 5B1LD 3MNNC 5G49A 3AZKA 3B6FC 3WKJB 4YM6C 5B0ZD 2CV5C 3WAAD 2HIOC 3MVDD 3X1UA 1P3BB 5BNVA 3AFAA 1TZYD 2Y2OA 5B1MD 2L5AA 5CHLB 3A6NA 2FJ7D 3AZED 3W97B 1W2EA 2PYOA 5B31D 2J8PA 5DNND 3VH6W 4ZUXC 3AZLD 2RVQC 5B2JA 3LZ1C 4XZQB 5JRGD 2G5HC 3UT9D 3R45B 3NQUA 4J8XC 4KUDC 1B6WA 3EPJA 5CPKB 5GSUC 3AZND 4Z66A 5CPIA 1P3LC 3REKC 3A6NB 3AV2D 1M19A 3B6GD 2YFWA 5B31G 4Z2MG 3AZHD 1ZLAA 5GT0C 4H9NA 3KFUG 3X1SD 3REJD 5B32A 2XD1A 5CPJA 5AY8A 1ID3D 2VQRA 5JRGA 1TAFA 4WU9A 3AZFB 3B6FB 3B6FD 3WA9D 3W96B 5B32D 4XZQA 2IO5C 2ZY2A 2JSSA 1M1AD 3AYWC 1JFIA 4H9RB 5AVCD 5B0YA 2ZM5A 1N1JB 5GT0B 3AZMA 5AV8D 1S32C 4XUJB 1M1AC 5GT3D 3MGQD 4UPKA 5DNMC 5C3IB 1BH8B 1P3AB 5F99B 5BO0B 5CP6A 4NE3A 5B1LA 5JRGB 4XZQD 4XZQC 5G49B 5B33A 3H0MC 3C1CD 3LZ0A 5B31C 3AZLC 3VH6T 2FJ7C 5GXQC 4JJNA 2FJ7B 5E5AD 4WU8C 3B0DC 1P3BD 1AOIC 2HIOB 5B0ZB 4WJ3C 2Y2MA 5JA4A 1KX4A 3REID 1P34A 3A1IA 5B2JB 1F66A 5B1LB 4J8UC 4QLCD 5AV6C 3WTPC 3KXBC 1F66D 5B1MA 5B2ID 3R45A 1WWSA 4HGAB 1ID3C 3W98A 3AV1B 1P3GD 2BYKB 4H9QA 3B0CT 3AZGC 3AV1C 4WZSB 4YS3C 2NZDB 1HQ3D 4J8UB 2NZDD 1KU5A 1P3PA 3X1UD 3X1UC 3W96C 5B2IA 5BS7C 5BS7A 4KHAA 3REHC 3AZKC 1H3OA 3B6FA 1F66B 4WNNB 3MGRD 4QLCB 4Z5TC 3TU4B 3O62D 1EQZB 1PZRA 1T3UA 3REKB 1S32D 3W99A 1ZLAD 2RIQA 3AV1A 3KUYD 3LJAA 1P3OD 3AZMD 3C1CC 4J8XB 4KUDB 5B1MC 1TZYC 1BH8A 3MNND 3X1VD 3B0BA 4J8UA 2F8NG 3LELC 5CP6B 5DNMD 3V9RB 4J8WA 3MGRA 4EO5C 5B33D 5B33B 3LJAD 3LJAC 3C1CA 4G92B 1P3OA 2NQBB 5C3IC 5DNMB 3VH5A 4WU8A 1EQZA 1KX5C 3X1VB 2AROB 1P3AD 3REHA 2Y2IA 3C1BA 3AYWB 2IO5B 5AV8B 1KX3B 1B67A 5GT0D 1EQZD 4E45A 2F2AC 3KSYA 2Y2PA 3V9RA 3MGRB 3AZGA 3REJC 1P3KA 3W98C 4E44A 2F8NK 1ID3A 3WA9C 3WA9B 3IP4C 3W96D 3AZHC 3AN2B 3W98B 1P3IA 5AV6A 2ZY5A 3AZMC 3REJB 3RELA 1HQ3C 1F66C 2JCHA 1KX4D 5AVCA 3UTAB 3UTBA 3AYWA 3AV2B 1P3PB 1P3GB 1AOIA 3AFAB 5AV8A 3AZKD 5B2IB 4CAYB 3UTBD 2CWEA 4WU9C 2BG1A 3NQJA 4KHAB 4M6BA 3MVDA 4JJND 1H3OB 5CPJC 4JJNC 4LD9C 3RELD 3UT9B 2PYOB 3A1KA 1ZLAC 3REIB 5BNXB 1KX5B 2HIOD 3MVDC 3KWQC 3REKA 1M19C 3W99B 4Z66C 5CPIC 4CSRB 5B31A 3LZ0C 3AZNA 3AZLA 5CPID 5B1LC 3VH6A 4J8XA 5AV5A 4KUDA 4X23A 3LZ1D 3W97D 5B0ZC 1HQ3A 5KDMA 3LZ1A 1TZYB 3B0DB 3EPHA 1P3IC 1F1EA 5CPIB 1M1AA 3NQJB 3W99D 3MVDB 4R8PB 3C1CB 5GXQD 1U35B 1S32A 1P3KC 3WKJD 2PYOC 5B0YD 2PYOD 3REIA 4WU8D 4KGCB 4QLCC 3X1VA 5B24D 3AFAC 3AZKB 4XUJD 5AY8D 5FUGA 5AY8C 5B32C 3EPKA 5B40D 3UTAD 2Y2KA 4LD9D 3MNNA 1Q9CA 5GT0A 1Z2CB 3FDDA 1M18D 5AVBC 2YFVB 3O62C 1M1AB 5GSUA 1P3LA 4H9PB 3AZFD 2HUEB 1P3OC 1ID3B 1BFMA 3MGRC 3X1SB 4KGCA 2XD5A 1P3IB 5CPJD 4ZBJB 5B2JC 4J8VA 3AZFC 3A6ND 1KX3D 4NE5A 1P3MA 2W8SA 3AYWD 5AV9D 3NQUB 5CPKD 4Z66D 1AOIB 1M18A 2RVQD 3AZID 3W99C 1M19B 3LELD 3A6NC 5GSUB 1P3LB 4Z5TA 2FFFB 4H9PA 4EO5B 2NQBC 2HIOA 2CV5A 5DNNB 4CSRA 5B31B 3AZLB 3W96A 5B2IC 5CP6D 1P3PC 3AZEB 3X1TD 3AZGD 3X1TC 1JFIB 4ZUXD 5B1MB 3AL0C 5F99C 4YS3A 4AWLC 4NFTA 5GT3A 3MGQA 5KDMB 2BYKA 4H9QB 3H0RC 3AZMB 3KUYB 3B6GC 3W97C 4XUJC 3REKD 1S32B 1U35A 3WTPA 3KXBA 4Z5TB 3TU4D 3MGPB 1P3BC 3AZJC 1P3FB 1P34C 5AVBD 1KX4C 4DRAA 5DNNA 3WKJC 5B24A 1KX3C 1HTAA 2DQNC 4Z2MH 4H9SC 3WAAC 4J8UD 3AZJB 1P3FC 4H9OB 4YS3B 5E5AA 5GXQA 2FJ7A 3AV1D 2BYMB 2ZY3A 5BT1D 5BT1C 5CPKC 4G92C 1ULYA 3MGPA 4G91B 5B33C 3B0CW 2DF4C 5B32G 5B2JD 5CP6C 3X1TB 5DNMA 1A7WA 3AZJA 4NE6A 4H9OA 5E5AB 1N1JA 5GSUD 1P3LD 2AROA 1U35C 2NZDA 5B0YC 1M19D 3AZIB 3W97A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3C1B B;  3TU4 C;  2F8N B;  1P3A A;  1BH9 B;  5JRG C;  5F99 A;  2CV5 B;  5BO0 A;  3MGS A;  4G91 C;  5F99 D;  3AZE A;  3MGS D;  3KWQ B;  1P34 D;  5GT3 B;  3MGQ B;  3UT9 C;  3REH D;  2YFW B;  3AZI A;  5AVC B;  3WTP D;  3WTP B;  3KXB B;  3KXB D;  3UTA A;  2F8N A;  1P3G A;  4H9N B;  5B32 B;  1BH9 A;  5AY8 B;  4J8W B;  1P34 B;  3AZF A;  5B24 B;  4J8V C;  4ZUX A;  3MGS B;  4KGC D;  4WU8 B;  4H9R A;  3AZI C;  3AZH B;  3AN2 C;  5B0Y B;  3B6G B;  4DRB A;  3AZN B;  2CV5 D;  5GXQ B;  1U35 D;  4R8P D;  3VH5 W;  4AWL B;  5AV5 B;  2F8N D;  4YM6 A;  3AZE C;  4WV4 B;  3LZ1 B;  3LZ0 D;  4R8P A;  1P3A C;  4WNN A;  3LZ0 B;  4QLC A;  3X1V C;  3TU4 A;  3AN2 A;  1KX5 D;  3REI C;  3REL B;  4JJN B;  5AV5 D;  3UTB B;  3WAA B;  3AV2 A;  3AFA D;  1P3P D;  1P3G C;  4ZBJ C;  4CAY A;  5B0Z A;  5JA4 B;  1KX4 B;  3UTA C;  4X23 C;  2YFV A;  5B40 A;  5AV5 C;  5AV6 D;  3X1S C;  4LD9 A;  3AZJ D;  3UT9 A;  3MGP C;  3W98 D;  3AZN C;  2HUE C;  4J8W D;  1WWI A;  3AN2 D;  3KWQ A;  3KUY C;  5AVB B;  3MGS C;  4X23 B;  4Z5T D;  3REH B;  4UUZ A;  1R4V A;  3WAA A;  5AV8 C;  1P3M D;  4J8V D;  1KX3 A;  3KWQ D;  5DNN C;  4WU9 D;  3UTB C;  5AVC C;  5AV9 A;  3VH5 T;  2ARO D;  2NZD C;  4ZUX B;  2ARO C;  3REL C;  3AZG B;  1P3K B;  3AZH A;  5AV9 C;  3WA9 A;  3B6G A;  3LJA B;  2F8N H;  2NQB D;  3REJ A;  3C1B D;  5FUG B;  4UUZ B;  4YM6 D;  4YM6 B;  2LY8 A;  3LEL B;  3MNN B;  5CPK A;  4J8X D;  3KUY A;  4Z66 B;  3C1B C;  1AOI D;  4KUD D;  5AV9 B;  1P3O B;  2NQB A;  1ZLA B;  1P3K D;  5E5A C;  5BNX A;  3X1S A;  3WTP E;  3O62 B;  5B40 C;  5CPJ B;  1P3F A;  1KX5 A;  1EQZ C;  4LD9 C;  1P3I D;  4H9S A;  1TAF B;  4WU9 B;  1M18 C;  5B24 C;  4J8V B;  3WKJ A;  1P3M B;  4J8W C;  3AV2 C;  3X1U B;  1P3B A;  1P3M C;  5BNV B;  3LEL A;  4X23 D;  1M18 B;  4YS3 D;  1HQ3 B;  1TZY A;  4XUJ A;  4KGC C;  5B40 B;  4LD9 B;  2BYM A;  5GT3 C;  3MGQ C;  4R8P C;  4HGA C;  1P3F D;  3O62 A;  5AVB A;  5AV6 B;  3X1T A;  3MGP D;  5B1L D;  3MNN C;  5G49 A;  3AZK A;  3B6F C;  3WKJ B;  4YM6 C;  5B0Z D;  2CV5 C;  3WAA D;  2HIO C;  3MVD D;  3X1U A;  1P3B B;  5BNV A;  3AFA A;  1TZY D;  5B1M D;  2L5A A;  5CHL B;  3A6N A;  2FJ7 D;  3AZE D;  3W97 B;  2PYO A;  5B31 D;  5DNN D;  3AZL D;  3VH6 W;  4ZUX C;  2RVQ C;  5B2J A;  3LZ1 C;  4XZQ B;  5JRG D;  3UT9 D;  3R45 B;  3NQU A;  4J8X C;  4KUD C;  1B6W A;  5CPK B;  5GSU C;  3AZN D;  4Z66 A;  5CPI A;  1P3L C;  3REK C;  3A6N B;  3AV2 D;  1M19 A;  3B6G D;  2YFW A;  5B31 G;  4Z2M G;  3AZH D;  1ZLA A;  5GT0 C;  4H9N A;  3X1S D;  3REJ D;  5B32 A;  5CPJ A;  5AY8 A;  1ID3 D;  5JRG A;  1TAF A;  4WU9 A;  3AZF B;  3B6F B;  3B6F D;  3WA9 D;  3W96 B;  5B32 D;  4XZQ A;  2IO5 C;  1M1A D;  2JSS A;  3AYW C;  1JFI A;  4H9R B;  5AVC D;  5B0Y A;  1N1J B;  5GT0 B;  3AZM A;  5AV8 D;  1S32 C;  4XUJ B;  1M1A C;  5GT3 D;  3MGQ D;  5DNM C;  5C3I B;  1BH8 B;  1P3A B;  5F99 B;  5BO0 B;  5CP6 A;  4NE3 A;  5B1L A;  5JRG B;  4XZQ D;  4XZQ C;  5G49 B;  5B33 A;  3C1C D;  3LZ0 A;  5B31 C;  3AZL C;  3VH6 T;  2FJ7 C;  5GXQ C;  4JJN A;  2FJ7 B;  5E5A D;  4WU8 C;  3B0D C;  1P3B D;  1AOI C;  2HIO B;  5B0Z B;  5JA4 A;  1KX4 A;  3REI D;  1P34 A;  5B2J B;  1F66 A;  5B1L B;  4J8U C;  4QLC D;  5AV6 C;  3WTP C;  3KXB C;  1F66 D;  5B1M A;  5B2I D;  3R45 A;  1WWS A;  4HGA B;  1ID3 C;  3W98 A;  3AV1 B;  1P3G D;  2BYK B;  4H9Q A;  3B0C T;  3AZG C;  3AV1 C;  4WZS B;  4YS3 C;  2NZD B;  1HQ3 D;  4J8U B;  2NZD D;  1KU5 A;  1P3P A;  3X1U D;  3X1U C;  3W96 C;  5B2I A;  5BS7 C;  5BS7 A;  4KHA A;  3REH C;  3AZK C;  1H3O A;  3B6F A;  1F66 B;  4WNN B;  3MGR D;  4QLC B;  4Z5T C;  3TU4 B;  3O62 D;  1EQZ B;  3REK B;  1S32 D;  3W99 A;  1ZLA D;  3AV1 A;  3KUY D;  3LJA A;  1P3O D;  3AZM D;  3C1C C;  4J8X B;  4KUD B;  5B1M C;  1TZY C;  1BH8 A;  3MNN D;  3X1V D;  3B0B A;  4J8U A;  2F8N G;  3LEL C;  5CP6 B;  5DNM D;  3V9R B;  4J8W A;  3MGR A;  4EO5 C;  5B33 D;  5B33 B;  3LJA D;  3LJA C;  3C1C A;  4G92 B;  1P3O A;  2NQB B;  5C3I C;  5DNM B;  3VH5 A;  4WU8 A;  1EQZ A;  1KX5 C;  3X1V B;  2ARO B;  1P3A D;  3REH A;  3C1B A;  3AYW B;  2IO5 B;  5AV8 B;  1KX3 B;  1B67 A;  5GT0 D;  1EQZ D;  4E45 A;  3KSY A;  3V9R A;  3MGR B;  3AZG A;  3REJ C;  1P3K A;  3W98 C;  4E44 A;  2F8N K;  1ID3 A;  3WA9 C;  3WA9 B;  3W96 D;  3AZH C;  3AN2 B;  3W98 B;  1P3I A;  5AV6 A;  3AZM C;  3REJ B;  3REL A;  1HQ3 C;  1F66 C;  1KX4 D;  5AVC A;  3UTA B;  3UTB A;  3AYW A;  3AV2 B;  1P3P B;  1P3G B;  1AOI A;  3AFA B;  5AV8 A;  3AZK D;  5B2I B;  4CAY B;  3UTB D;  2CWE A;  4WU9 C;  3NQJ A;  4KHA B;  4M6B A;  3MVD A;  4JJN D;  1H3O B;  5CPJ C;  4JJN C;  3REL D;  3UT9 B;  2PYO B;  1ZLA C;  3REI B;  5BNX B;  1KX5 B;  2HIO D;  3MVD C;  3KWQ C;  3REK A;  1M19 C;  3W99 B;  4Z66 C;  5CPI C;  4CSR B;  5B31 A;  3LZ0 C;  3AZN A;  3AZL A;  5CPI D;  5B1L C;  3VH6 A;  4J8X A;  5AV5 A;  4KUD A;  4X23 A;  3LZ1 D;  3W97 D;  5B0Z C;  1HQ3 A;  5KDM A;  3LZ1 A;  1TZY B;  3B0D B;  1P3I C;  1F1E A;  5CPI B;  1M1A A;  3NQJ B;  3W99 D;  3MVD B;  4R8P B;  3C1C B;  5GXQ D;  1U35 B;  1S32 A;  1P3K C;  3WKJ D;  2PYO C;  5B0Y D;  2PYO D;  3REI A;  4WU8 D;  4KGC B;  4QLC C;  3X1V A;  5B24 D;  3AFA C;  3AZK B;  4XUJ D;  5AY8 D;  5FUG A;  5AY8 C;  5B32 C;  5B40 D;  3UTA D;  4LD9 D;  3MNN A;  1Q9C A;  5GT0 A;  1M18 D;  5AVB C;  2YFV B;  3O62 C;  1M1A B;  5GSU A;  1P3L A;  4H9P B;  3AZF D;  2HUE B;  1P3O C;  1ID3 B;  1BFM A;  3MGR C;  3X1S B;  4KGC A;  1P3I B;  5CPJ D;  4ZBJ B;  5B2J C;  4J8V A;  3AZF C;  3A6N D;  1KX3 D;  4NE5 A;  1P3M A;  3AYW D;  5AV9 D;  3NQU B;  5CPK D;  4Z66 D;  1AOI B;  1M18 A;  2RVQ D;  3AZI D;  3W99 C;  1M19 B;  3LEL D;  3A6N C;  5GSU B;  1P3L B;  4Z5T A;  4H9P A;  4EO5 B;  2NQB C;  2HIO A;  2CV5 A;  5DNN B;  4CSR A;  5B31 B;  3AZL B;  3W96 A;  5B2I C;  5CP6 D;  1P3P C;  3AZE B;  3X1T D;  3AZG D;  3X1T C;  1JFI B;  4ZUX D;  5B1M B;  5F99 C;  4YS3 A;  4AWL C;  4NFT A;  5GT3 A;  3MGQ A;  5KDM B;  2BYK A;  4H9Q B;  3AZM B;  3KUY B;  3B6G C;  3W97 C;  4XUJ C;  3REK D;  1S32 B;  1U35 A;  3KXB A;  3WTP A;  4Z5T B;  3TU4 D;  3MGP B;  1P3B C;  3AZJ C;  1P3F B;  1P34 C;  5AVB D;  1KX4 C;  4DRA A;  5DNN A;  3WKJ C;  5B24 A;  1KX3 C;  1HTA A;  4Z2M H;  4H9S C;  3WAA C;  4J8U D;  3AZJ B;  1P3F C;  4H9O B;  4YS3 B;  5E5A A;  5GXQ A;  2FJ7 A;  3AV1 D;  2BYM B;  5BT1 D;  5BT1 C;  5CPK C;  4G92 C;  1ULY A;  3MGP A;  4G91 B;  5B33 C;  3B0C W;  5B32 G;  5B2J D;  5CP6 C;  3X1T B;  5DNM A;  1A7W A;  3AZJ A;  4NE6 A;  4H9O A;  5E5A B;  1N1J A;  5GSU D;  1P3L D;  2ARO A;  1U35 C;  2NZD A;  5B0Y C;  1M19 D;  3AZI B;  3W97 A; 
#chains in the Genus database with same CATH topology
 3C1B B;  3TU4 C;  2F8N B;  1P3A A;  1BH9 B;  5JRG C;  5F99 A;  2CV5 B;  5BO0 A;  3MGS A;  2Y2G A;  4G91 C;  5F99 D;  3AZE A;  2Y2J A;  2UWX A;  3MGS D;  3KWQ B;  1P34 D;  5GT3 B;  3MGQ B;  3UT9 C;  3REH D;  2YFW B;  3AZI A;  5AVC B;  3WTP D;  3WTP B;  3KXB B;  3KXB D;  3UTA A;  2F8N A;  1P3G A;  4H9N B;  5B32 B;  1BH9 A;  5AY8 B;  4J8W B;  1P34 B;  3AZF A;  5B24 B;  4J8V C;  4ZUX A;  3MGS B;  3F6T A;  4KGC D;  4WU8 B;  4H9R A;  3AZI C;  3AZH B;  3AN2 C;  5B0Y B;  3B6G B;  4DRB A;  3AZN B;  2CV5 D;  5GXQ B;  1U35 D;  4R8P D;  3VH5 W;  4AWL B;  5AV5 B;  2F8N D;  4YM6 A;  3AZE C;  4WV4 B;  3LZ1 B;  2Y2N A;  3LZ0 D;  4R8P A;  1P3A C;  4WNN A;  3LZ0 B;  4QLC A;  3X1V C;  3TU4 A;  3AN2 A;  1KX5 D;  3REI C;  3REL B;  4JJN B;  2Y2H A;  5AV5 D;  2JE5 A;  3UTB B;  3EG5 B;  3WAA B;  3AV2 A;  3AFA D;  1P3P D;  1P3G C;  4ZBJ C;  4CAY A;  5B0Z A;  5JA4 B;  1KX4 B;  3UTA C;  3EPL A;  4X23 C;  2YFV A;  2Y2Q A;  5B40 A;  5AV5 C;  5AV6 D;  3X1S C;  4LD9 A;  3AZJ D;  3UT9 A;  3MGP C;  3W98 D;  3AZN C;  2HUE C;  4J8W D;  1WWI A;  3AN2 D;  3KWQ A;  3KUY C;  5AVB B;  3MGS C;  4X23 B;  4Z5T D;  3REH B;  4UUZ A;  1R4V A;  3WAA A;  5AV8 C;  1P3M D;  4J8V D;  1KX3 A;  3KWQ D;  3H0L C;  5DNN C;  4WU9 D;  3UTB C;  5AVC C;  5AV9 A;  3VH5 T;  2ARO D;  2NZD C;  4ZUX B;  2ARO C;  3REL C;  3AZG B;  1P3K B;  2Y2L A;  3AZH A;  5AV9 C;  3WA9 A;  3B6G A;  3LJA B;  2F8N H;  2NQB D;  3REJ A;  3C1B D;  5FUG B;  4UUZ B;  4YM6 D;  4YM6 B;  2LY8 A;  3LEL B;  3MNN B;  5CPK A;  4J8X D;  3KUY A;  4Z66 B;  3C1B C;  1AOI D;  4KUD D;  5AV9 B;  1P3O B;  2NQB A;  1ZLA B;  1P3K D;  5E5A C;  5BNX A;  3X1S A;  3WTP E;  3O62 B;  5B40 C;  5CPJ B;  1P3F A;  1KX5 A;  2G5I C;  1EQZ C;  1P3I D;  4H9S A;  1TAF B;  4WU9 B;  1M18 C;  5B24 C;  4J8V B;  3WKJ A;  1P3M B;  4J8W C;  3AV2 C;  3X1U B;  1P3B A;  1P3M C;  5BNV B;  3LEL A;  4X23 D;  1M18 B;  4YS3 D;  1HQ3 B;  3P5J B;  1TZY A;  4XUJ A;  4KGC C;  5B40 B;  4LD9 B;  2BYM A;  5GT3 C;  3MGQ C;  4R8P C;  4HGA C;  1P3F D;  3O62 A;  2ZY4 A;  5AVB A;  5AV6 B;  4DQY B;  3MGP D;  3X1T A;  5B1L D;  3MNN C;  5G49 A;  3AZK A;  3B6F C;  3WKJ B;  4YM6 C;  5B0Z D;  2CV5 C;  3WAA D;  2HIO C;  3MVD D;  3X1U A;  1P3B B;  5BNV A;  3AFA A;  1TZY D;  2Y2O A;  5B1M D;  2L5A A;  5CHL B;  3A6N A;  2FJ7 D;  3AZE D;  3W97 B;  1W2E A;  2PYO A;  5B31 D;  2J8P A;  5DNN D;  3VH6 W;  4ZUX C;  3AZL D;  2RVQ C;  5B2J A;  3LZ1 C;  4XZQ B;  5JRG D;  2G5H C;  3UT9 D;  3R45 B;  3NQU A;  4J8X C;  4KUD C;  1B6W A;  3EPJ A;  5CPK B;  5GSU C;  3AZN D;  4Z66 A;  5CPI A;  1P3L C;  3REK C;  3A6N B;  3AV2 D;  1M19 A;  3B6G D;  2YFW A;  5B31 G;  4Z2M G;  3AZH D;  1ZLA A;  5GT0 C;  4H9N A;  3KFU G;  3X1S D;  3REJ D;  5B32 A;  2XD1 A;  5CPJ A;  5AY8 A;  1ID3 D;  2VQR A;  5JRG A;  1TAF A;  4WU9 A;  3AZF B;  3B6F B;  3B6F D;  3WA9 D;  3W96 B;  5B32 D;  4XZQ A;  2IO5 C;  2ZY2 A;  2JSS A;  1M1A D;  3AYW C;  1JFI A;  4H9R B;  5AVC D;  5B0Y A;  2ZM5 A;  1N1J B;  5GT0 B;  3AZM A;  5AV8 D;  1S32 C;  4XUJ B;  1M1A C;  5GT3 D;  3MGQ D;  4UPK A;  5DNM C;  5C3I B;  1BH8 B;  1P3A B;  5F99 B;  5BO0 B;  5CP6 A;  4NE3 A;  5B1L A;  5JRG B;  4XZQ D;  4XZQ C;  5G49 B;  5B33 A;  3H0M C;  3C1C D;  3LZ0 A;  5B31 C;  3AZL C;  3VH6 T;  2FJ7 C;  5GXQ C;  4JJN A;  2FJ7 B;  5E5A D;  4WU8 C;  3B0D C;  1P3B D;  1AOI C;  2HIO B;  5B0Z B;  4WJ3 C;  2Y2M A;  5JA4 A;  1KX4 A;  3REI D;  1P34 A;  3A1I A;  5B2J B;  1F66 A;  5B1L B;  4J8U C;  4QLC D;  5AV6 C;  3WTP C;  3KXB C;  1F66 D;  5B1M A;  5B2I D;  3R45 A;  1WWS A;  4HGA B;  1ID3 C;  3W98 A;  3AV1 B;  1P3G D;  2BYK B;  4H9Q A;  3B0C T;  3AZG C;  3AV1 C;  4WZS B;  4YS3 C;  2NZD B;  1HQ3 D;  4J8U B;  2NZD D;  1KU5 A;  1P3P A;  3X1U D;  3X1U C;  3W96 C;  5B2I A;  5BS7 C;  5BS7 A;  4KHA A;  3REH C;  3AZK C;  1H3O A;  3B6F A;  1F66 B;  4WNN B;  3MGR D;  4QLC B;  4Z5T C;  3TU4 B;  3O62 D;  1EQZ B;  1PZR A;  1T3U A;  3REK B;  1S32 D;  3W99 A;  1ZLA D;  2RIQ A;  3AV1 A;  3KUY D;  3LJA A;  1P3O D;  3AZM D;  3C1C C;  4J8X B;  4KUD B;  5B1M C;  1TZY C;  1BH8 A;  3MNN D;  3X1V D;  3B0B A;  4J8U A;  2F8N G;  3LEL C;  5CP6 B;  5DNM D;  3V9R B;  4J8W A;  3MGR A;  4EO5 C;  5B33 D;  5B33 B;  3LJA D;  3LJA C;  3C1C A;  4G92 B;  1P3O A;  2NQB B;  5C3I C;  5DNM B;  3VH5 A;  4WU8 A;  1EQZ A;  1KX5 C;  3X1V B;  2ARO B;  1P3A D;  3REH A;  2Y2I A;  3C1B A;  3AYW B;  2IO5 B;  5AV8 B;  1KX3 B;  1B67 A;  5GT0 D;  1EQZ D;  4E45 A;  2F2A C;  3KSY A;  2Y2P A;  3V9R A;  3MGR B;  3AZG A;  3REJ C;  1P3K A;  3W98 C;  4E44 A;  2F8N K;  1ID3 A;  3WA9 C;  3WA9 B;  3IP4 C;  3W96 D;  3AZH C;  3AN2 B;  3W98 B;  1P3I A;  5AV6 A;  2ZY5 A;  3AZM C;  3REJ B;  3REL A;  1HQ3 C;  1F66 C;  2JCH A;  1KX4 D;  5AVC A;  3UTA B;  3UTB A;  3AYW A;  3AV2 B;  1P3P B;  1P3G B;  1AOI A;  3AFA B;  5AV8 A;  3AZK D;  5B2I B;  4CAY B;  3UTB D;  2CWE A;  4WU9 C;  2BG1 A;  3NQJ A;  4KHA B;  4M6B A;  3MVD A;  4JJN D;  1H3O B;  5CPJ C;  4JJN C;  4LD9 C;  3REL D;  3UT9 B;  2PYO B;  3A1K A;  1ZLA C;  3REI B;  5BNX B;  1KX5 B;  2HIO D;  3MVD C;  3KWQ C;  3REK A;  1M19 C;  3W99 B;  4Z66 C;  5CPI C;  4CSR B;  5B31 A;  3LZ0 C;  3AZN A;  3AZL A;  5CPI D;  5B1L C;  3VH6 A;  4J8X A;  5AV5 A;  4KUD A;  4X23 A;  3LZ1 D;  3W97 D;  5B0Z C;  1HQ3 A;  5KDM A;  3LZ1 A;  1TZY B;  3B0D B;  3EPH A;  1P3I C;  1F1E A;  5CPI B;  1M1A A;  3NQJ B;  3W99 D;  3MVD B;  4R8P B;  3C1C B;  5GXQ D;  1U35 B;  1S32 A;  1P3K C;  3WKJ D;  2PYO C;  5B0Y D;  2PYO D;  3REI A;  4WU8 D;  4KGC B;  4QLC C;  3X1V A;  5B24 D;  3AFA C;  3AZK B;  4XUJ D;  5AY8 D;  5FUG A;  5AY8 C;  5B32 C;  3EPK A;  5B40 D;  3UTA D;  2Y2K A;  4LD9 D;  3MNN A;  1Q9C A;  5GT0 A;  1Z2C B;  3FDD A;  1M18 D;  5AVB C;  2YFV B;  3O62 C;  1M1A B;  5GSU A;  1P3L A;  4H9P B;  3AZF D;  2HUE B;  1P3O C;  1ID3 B;  1BFM A;  3MGR C;  3X1S B;  4KGC A;  2XD5 A;  1P3I B;  5CPJ D;  4ZBJ B;  5B2J C;  4J8V A;  3AZF C;  3A6N D;  1KX3 D;  4NE5 A;  1P3M A;  2W8S A;  3AYW D;  5AV9 D;  3NQU B;  5CPK D;  4Z66 D;  1AOI B;  1M18 A;  2RVQ D;  3AZI D;  3W99 C;  1M19 B;  3LEL D;  3A6N C;  5GSU B;  1P3L B;  4Z5T A;  2FFF B;  4H9P A;  4EO5 B;  2NQB C;  2HIO A;  2CV5 A;  5DNN B;  4CSR A;  5B31 B;  3AZL B;  3W96 A;  5B2I C;  5CP6 D;  1P3P C;  3AZE B;  3X1T D;  3AZG D;  3X1T C;  1JFI B;  4ZUX D;  5B1M B;  3AL0 C;  5F99 C;  4YS3 A;  4AWL C;  4NFT A;  5GT3 A;  3MGQ A;  5KDM B;  2BYK A;  4H9Q B;  3H0R C;  3AZM B;  3KUY B;  3B6G C;  3W97 C;  4XUJ C;  3REK D;  1S32 B;  1U35 A;  3WTP A;  3KXB A;  4Z5T B;  3TU4 D;  3MGP B;  1P3B C;  3AZJ C;  1P3F B;  1P34 C;  5AVB D;  1KX4 C;  4DRA A;  5DNN A;  3WKJ C;  5B24 A;  1KX3 C;  1HTA A;  2DQN C;  4Z2M H;  4H9S C;  3WAA C;  4J8U D;  3AZJ B;  1P3F C;  4H9O B;  4YS3 B;  5E5A A;  5GXQ A;  2FJ7 A;  3AV1 D;  2BYM B;  2ZY3 A;  5BT1 D;  5BT1 C;  5CPK C;  4G92 C;  1ULY A;  3MGP A;  4G91 B;  5B33 C;  3B0C W;  2DF4 C;  5B32 G;  5B2J D;  5CP6 C;  3X1T B;  5DNM A;  1A7W A;  3AZJ A;  4NE6 A;  4H9O A;  5E5A B;  1N1J A;  5GSU D;  1P3L D;  2ARO A;  1U35 C;  2NZD A;  5B0Y C;  1M19 D;  3AZI B;  3W97 A; 
#chains in the Genus database with same CATH homology
 3C1B B;  3TU4 C;  2F8N B;  1P3A A;  1BH9 B;  5JRG C;  5F99 A;  2CV5 B;  5BO0 A;  3MGS A;  2Y2G A;  4G91 C;  5F99 D;  3AZE A;  2Y2J A;  2UWX A;  3MGS D;  3KWQ B;  1P34 D;  5GT3 B;  3MGQ B;  3UT9 C;  3REH D;  2YFW B;  3AZI A;  5AVC B;  3WTP D;  3WTP B;  3KXB B;  3KXB D;  3UTA A;  2F8N A;  1P3G A;  4H9N B;  5B32 B;  1BH9 A;  5AY8 B;  4J8W B;  1P34 B;  3AZF A;  5B24 B;  4J8V C;  4ZUX A;  3MGS B;  3F6T A;  4KGC D;  4WU8 B;  4H9R A;  3AZI C;  3AZH B;  3AN2 C;  5B0Y B;  3B6G B;  4DRB A;  3AZN B;  2CV5 D;  5GXQ B;  1U35 D;  4R8P D;  3VH5 W;  4AWL B;  5AV5 B;  2F8N D;  4YM6 A;  3AZE C;  4WV4 B;  3LZ1 B;  2Y2N A;  3LZ0 D;  4R8P A;  1P3A C;  4WNN A;  3LZ0 B;  4QLC A;  3X1V C;  3TU4 A;  3AN2 A;  1KX5 D;  3REI C;  3REL B;  4JJN B;  2Y2H A;  5AV5 D;  2JE5 A;  3UTB B;  3EG5 B;  3WAA B;  3AV2 A;  3AFA D;  1P3P D;  1P3G C;  4ZBJ C;  4CAY A;  5B0Z A;  5JA4 B;  1KX4 B;  3UTA C;  3EPL A;  4X23 C;  2YFV A;  2Y2Q A;  5B40 A;  5AV5 C;  5AV6 D;  3X1S C;  4LD9 A;  3AZJ D;  3UT9 A;  3MGP C;  3W98 D;  3AZN C;  2HUE C;  4J8W D;  1WWI A;  3AN2 D;  3KWQ A;  3KUY C;  5AVB B;  3MGS C;  4X23 B;  4Z5T D;  3REH B;  4UUZ A;  1R4V A;  3WAA A;  5AV8 C;  1P3M D;  4J8V D;  1KX3 A;  3KWQ D;  3H0L C;  5DNN C;  4WU9 D;  3UTB C;  5AVC C;  5AV9 A;  3VH5 T;  2ARO D;  2NZD C;  4ZUX B;  2ARO C;  3REL C;  3AZG B;  1P3K B;  2Y2L A;  3AZH A;  5AV9 C;  3WA9 A;  3B6G A;  3LJA B;  2F8N H;  2NQB D;  3REJ A;  3C1B D;  5FUG B;  4UUZ B;  4YM6 D;  4YM6 B;  2LY8 A;  3LEL B;  3MNN B;  5CPK A;  4J8X D;  3KUY A;  4Z66 B;  3C1B C;  1AOI D;  4KUD D;  5AV9 B;  1P3O B;  2NQB A;  1ZLA B;  1P3K D;  5E5A C;  5BNX A;  3X1S A;  3WTP E;  3O62 B;  5B40 C;  5CPJ B;  1P3F A;  1KX5 A;  2G5I C;  1EQZ C;  1P3I D;  4H9S A;  1TAF B;  4WU9 B;  1M18 C;  5B24 C;  4J8V B;  3WKJ A;  1P3M B;  4J8W C;  3AV2 C;  3X1U B;  1P3B A;  1P3M C;  5BNV B;  3LEL A;  4X23 D;  1M18 B;  4YS3 D;  1HQ3 B;  3P5J B;  1TZY A;  4XUJ A;  4KGC C;  5B40 B;  4LD9 B;  2BYM A;  5GT3 C;  3MGQ C;  4R8P C;  4HGA C;  1P3F D;  3O62 A;  2ZY4 A;  5AVB A;  5AV6 B;  4DQY B;  3MGP D;  3X1T A;  5B1L D;  3MNN C;  5G49 A;  3AZK A;  3B6F C;  3WKJ B;  4YM6 C;  5B0Z D;  2CV5 C;  3WAA D;  2HIO C;  3MVD D;  3X1U A;  1P3B B;  5BNV A;  3AFA A;  1TZY D;  2Y2O A;  5B1M D;  2L5A A;  5CHL B;  3A6N A;  2FJ7 D;  3AZE D;  3W97 B;  1W2E A;  2PYO A;  5B31 D;  2J8P A;  5DNN D;  3VH6 W;  4ZUX C;  3AZL D;  2RVQ C;  5B2J A;  3LZ1 C;  4XZQ B;  5JRG D;  2G5H C;  3UT9 D;  3R45 B;  3NQU A;  4J8X C;  4KUD C;  1B6W A;  3EPJ A;  5CPK B;  5GSU C;  3AZN D;  4Z66 A;  5CPI A;  1P3L C;  3REK C;  3A6N B;  3AV2 D;  1M19 A;  3B6G D;  2YFW A;  5B31 G;  4Z2M G;  3AZH D;  1ZLA A;  5GT0 C;  4H9N A;  3KFU G;  3X1S D;  3REJ D;  5B32 A;  2XD1 A;  5CPJ A;  5AY8 A;  1ID3 D;  2VQR A;  5JRG A;  1TAF A;  4WU9 A;  3AZF B;  3B6F B;  3B6F D;  3WA9 D;  3W96 B;  5B32 D;  4XZQ A;  2IO5 C;  2ZY2 A;  2JSS A;  1M1A D;  3AYW C;  1JFI A;  4H9R B;  5AVC D;  5B0Y A;  2ZM5 A;  1N1J B;  5GT0 B;  3AZM A;  5AV8 D;  1S32 C;  4XUJ B;  1M1A C;  5GT3 D;  3MGQ D;  4UPK A;  5DNM C;  5C3I B;  1BH8 B;  1P3A B;  5F99 B;  5BO0 B;  5CP6 A;  4NE3 A;  5B1L A;  5JRG B;  4XZQ D;  4XZQ C;  5G49 B;  5B33 A;  3H0M C;  3C1C D;  3LZ0 A;  5B31 C;  3AZL C;  3VH6 T;  2FJ7 C;  5GXQ C;  4JJN A;  2FJ7 B;  5E5A D;  4WU8 C;  3B0D C;  1P3B D;  1AOI C;  2HIO B;  5B0Z B;  4WJ3 C;  2Y2M A;  5JA4 A;  1KX4 A;  3REI D;  1P34 A;  3A1I A;  5B2J B;  1F66 A;  5B1L B;  4J8U C;  4QLC D;  5AV6 C;  3WTP C;  3KXB C;  1F66 D;  5B1M A;  5B2I D;  3R45 A;  1WWS A;  4HGA B;  1ID3 C;  3W98 A;  3AV1 B;  1P3G D;  2BYK B;  4H9Q A;  3B0C T;  3AZG C;  3AV1 C;  4WZS B;  4YS3 C;  2NZD B;  1HQ3 D;  4J8U B;  2NZD D;  1KU5 A;  1P3P A;  3X1U D;  3X1U C;  3W96 C;  5B2I A;  5BS7 C;  5BS7 A;  4KHA A;  3REH C;  3AZK C;  1H3O A;  3B6F A;  1F66 B;  4WNN B;  3MGR D;  4QLC B;  4Z5T C;  3TU4 B;  3O62 D;  1EQZ B;  1PZR A;  1T3U A;  3REK B;  1S32 D;  3W99 A;  1ZLA D;  2RIQ A;  3AV1 A;  3KUY D;  3LJA A;  1P3O D;  3AZM D;  3C1C C;  4J8X B;  4KUD B;  5B1M C;  1TZY C;  1BH8 A;  3MNN D;  3X1V D;  3B0B A;  4J8U A;  2F8N G;  3LEL C;  5CP6 B;  5DNM D;  3V9R B;  4J8W A;  3MGR A;  4EO5 C;  5B33 D;  5B33 B;  3LJA D;  3LJA C;  3C1C A;  4G92 B;  1P3O A;  2NQB B;  5C3I C;  5DNM B;  3VH5 A;  4WU8 A;  1EQZ A;  1KX5 C;  3X1V B;  2ARO B;  1P3A D;  3REH A;  2Y2I A;  3C1B A;  3AYW B;  2IO5 B;  5AV8 B;  1KX3 B;  1B67 A;  5GT0 D;  1EQZ D;  4E45 A;  2F2A C;  3KSY A;  2Y2P A;  3V9R A;  3MGR B;  3AZG A;  3REJ C;  1P3K A;  3W98 C;  4E44 A;  2F8N K;  1ID3 A;  3WA9 C;  3WA9 B;  3IP4 C;  3W96 D;  3AZH C;  3AN2 B;  3W98 B;  1P3I A;  5AV6 A;  2ZY5 A;  3AZM C;  3REJ B;  3REL A;  1HQ3 C;  1F66 C;  2JCH A;  1KX4 D;  5AVC A;  3UTA B;  3UTB A;  3AYW A;  3AV2 B;  1P3P B;  1P3G B;  1AOI A;  3AFA B;  5AV8 A;  3AZK D;  5B2I B;  4CAY B;  3UTB D;  2CWE A;  4WU9 C;  2BG1 A;  3NQJ A;  4KHA B;  4M6B A;  3MVD A;  4JJN D;  1H3O B;  5CPJ C;  4JJN C;  4LD9 C;  3REL D;  3UT9 B;  2PYO B;  3A1K A;  1ZLA C;  3REI B;  5BNX B;  1KX5 B;  2HIO D;  3MVD C;  3KWQ C;  3REK A;  1M19 C;  3W99 B;  4Z66 C;  5CPI C;  4CSR B;  5B31 A;  3LZ0 C;  3AZN A;  3AZL A;  5CPI D;  5B1L C;  3VH6 A;  4J8X A;  5AV5 A;  4KUD A;  4X23 A;  3LZ1 D;  3W97 D;  5B0Z C;  1HQ3 A;  5KDM A;  3LZ1 A;  1TZY B;  3B0D B;  3EPH A;  1P3I C;  1F1E A;  5CPI B;  1M1A A;  3NQJ B;  3W99 D;  3MVD B;  4R8P B;  3C1C B;  5GXQ D;  1U35 B;  1S32 A;  1P3K C;  3WKJ D;  2PYO C;  5B0Y D;  2PYO D;  3REI A;  4WU8 D;  4KGC B;  4QLC C;  3X1V A;  5B24 D;  3AFA C;  3AZK B;  4XUJ D;  5AY8 D;  5FUG A;  5AY8 C;  5B32 C;  3EPK A;  5B40 D;  3UTA D;  2Y2K A;  4LD9 D;  3MNN A;  1Q9C A;  5GT0 A;  1Z2C B;  3FDD A;  1M18 D;  5AVB C;  2YFV B;  3O62 C;  1M1A B;  5GSU A;  1P3L A;  4H9P B;  3AZF D;  2HUE B;  1P3O C;  1ID3 B;  1BFM A;  3MGR C;  3X1S B;  4KGC A;  2XD5 A;  1P3I B;  5CPJ D;  4ZBJ B;  5B2J C;  4J8V A;  3AZF C;  3A6N D;  1KX3 D;  4NE5 A;  1P3M A;  2W8S A;  3AYW D;  5AV9 D;  3NQU B;  5CPK D;  4Z66 D;  1AOI B;  1M18 A;  2RVQ D;  3AZI D;  3W99 C;  1M19 B;  3LEL D;  3A6N C;  5GSU B;  1P3L B;  4Z5T A;  2FFF B;  4H9P A;  4EO5 B;  2NQB C;  2HIO A;  2CV5 A;  5DNN B;  4CSR A;  5B31 B;  3AZL B;  3W96 A;  5B2I C;  5CP6 D;  1P3P C;  3AZE B;  3X1T D;  3AZG D;  3X1T C;  1JFI B;  4ZUX D;  5B1M B;  3AL0 C;  5F99 C;  4YS3 A;  4AWL C;  4NFT A;  5GT3 A;  3MGQ A;  5KDM B;  2BYK A;  4H9Q B;  3H0R C;  3AZM B;  3KUY B;  3B6G C;  3W97 C;  4XUJ C;  3REK D;  1S32 B;  1U35 A;  3WTP A;  3KXB A;  4Z5T B;  3TU4 D;  3MGP B;  1P3B C;  3AZJ C;  1P3F B;  1P34 C;  5AVB D;  1KX4 C;  4DRA A;  5DNN A;  3WKJ C;  5B24 A;  1KX3 C;  1HTA A;  2DQN C;  4Z2M H;  4H9S C;  3WAA C;  4J8U D;  3AZJ B;  1P3F C;  4H9O B;  4YS3 B;  5E5A A;  5GXQ A;  2FJ7 A;  3AV1 D;  2BYM B;  2ZY3 A;  5BT1 D;  5BT1 C;  5CPK C;  4G92 C;  1ULY A;  3MGP A;  4G91 B;  5B33 C;  3B0C W;  2DF4 C;  5B32 G;  5B2J D;  5CP6 C;  3X1T B;  5DNM A;  1A7W A;  3AZJ A;  4NE6 A;  4H9O A;  5E5A B;  1N1J A;  5GSU D;  1P3L D;  2ARO A;  1U35 C;  2NZD A;  5B0Y C;  1M19 D;  3AZI B;  3W97 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...