1P3MD

Crystallographic studies of nucleosome core particles containing histone 'sin' mutants
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
92
structure length
92
Chain Sequence
b'KESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Palindromic 146bp Human Alpha-Satellite DNA fragment
publication title Crystal structures of histone Sin mutant nucleosomes reveal altered protein-DNA interactions
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 33
structure length 92
sequence length 92
chains with identical sequence H
ec nomenclature
pdb deposition date 2003-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1p3mD00
3X1SD 1S32C 1P3KA 3UTAD 3AZNA 4J8UC 5AV8C 4H9OB 5GT3C 3MGSB 1P3OA 4XUJA 1P34A 1WWIA 3MGPA 5CP6D 2F8NB 2NZDD 2JSSA 5B1MC 4LD9D 5B31C 4YS3C 4WU8C 2CWEA 5BS7A 1F66A 4ZUXC 4CAYB 5GT0A 3MGQB 3B0DC 3AZLB 3AV1C 4YS3B 5B32A 3KXBD 2AROA 4WU9D 2PYOA 1N1JB 5B1LC 3C1CD 3REJB 4KHAB 1U35A 1P3KD 3AZND 3AZKB 5B1LB 1KX5C 3B0CW 1M19B 5G49A 1P3LA 4XUJD 1P3OD 5DNMA 1P34D 1P3AC 3W96A 3AZMC 5B0ZC 1TZYA 5AY8A 4KGCA 3UTBB 5B2JC 1KX4C 1F66D 3B0BA 5GT0D 3REIC 3WAAA 5B32D 2AROD 3WA9C 2PYOD 5B0YC 5AV5B 1P3MA 5BNXA 1BFMA 1U35D 1P3PD 1KX3C 4J8WC 4ZBJB 1ID3C 2LY8A 4J8WB 5DNMD 2HIOA 3W96D 5CPIC 1TZYD 4HGAB 3TU4C 4H9NB 5AY8D 4KGCD 3X1SC 1AOIB 3UTAC 4H9RA 3X1UB 5JA4A 3WAAD 3RELA 5BT1D 5CP6C 3KUYB 2NZDC 3MVDB 3X1TA 1P3MD 1M18A 2F8NG 4LD9C 3WKJB 5F99A 2L5AA 2HIOD 3KXBC 3VH5A 4WU9C 3C1CC 3KWQB 1P3KC 3AZNC 4Z66A 1P3FB 4NE5A 1P3OC 4XUJC 1P34C 4WNNA 4H9PB 3LELB 3RELD 1P3IB 3MGPC 3UT9A 1M1AB 3X1TD 1M18D 3MNNA 1P34B 3MGPB 2HUEB 5BS7C 5F99D 5JRGB 1F66C 5GT0C 3W99B 5B40B 3W97A 5B32C 2AROC 3WTPE 3VH6W 2PYOC 2FJ7B 1U35C 5GSUA 4YM6A 4Z66D 5BNVA 3R45A 1P3LC 3AYWB 2NQBB 3W96C 3X1VB 3B6GA 3UT9D 3NQJA 1TZYC 3MNND 1P3LB 5AY8C 1BH9A 3AN2B 4KGCC 5CPJA 5B2IA 1H3OB 3AZEA 1JFIB 3WAAC 3W97D 3WTPB 1B67A 5BT1C 1P3MC 1EQZB 4KUDB 3AFAB 5GSUD 4YM6D 5KDMA 1P3GB 4JJNB 2HIOC 1WWSA 3MGRA 3B6GD 3AV2A 5DNNA 4G92B 5GXQA 5CPJD 5B2ID 3A6ND 3AZED 3AZJA 2BYMA 4M6BA 3AZHB 2F8NH 4J8XA 3RELC 5B33B 3VH6A 4X23A 5AVCB 3B6FA 1ZLAA 3X1TC 1S32B 1M18C 4J8UB 5AV8B 4J8VA 5GT3B 1F1EA 5CPKA 4QLCA 5F99C 4G91C 5B1MB 3MGRD 3AV2D 5DNND 4H9SA 5GXQD 5E5AA 3NQUB 5B31B 4WU8B 1HQ3C 1P3BA 4Z66C 4ZUXB 3B0DB 3AZJD 3AV1B 1P3PA 1HQ3B 4J8XD 4AWLC 3UT9C 4X23D 3B6FD 1ZLAD 3MNNC 3REKD 5C3IC 4J8VD 1KX5B 5CPKD 3AZGA 4QLCD 3W98A 2YFVB 1P3AB 3W97C 4R8PA 3AZMB 3REHA 5B0ZB 5E5AD 5B2JB 5GSUC 4YM6C 1P3BD 1KX4B 3REIB 4UUZA 4XZQA 5AV9D 2CV5A 3WA9B 5B0YB 3B6GC 3AZIA 1KX3B 1ID3B 5CPJC 1TAFA 3LJAA 5BO0A 5B2IC 3AZGD 4Z2MG 3W98D 5B24A 3C1BA 3AZEC 2BYKB 5AVBA 5FUGA 4Z5TA 4R8PD 3REHD 5CPIB 3TU4B 3O62A 3VH5T 4CSRB 3X1SB 3LZ0A 5CHLB 3UTAB 1R4VA 4XZQD 4H9QA 4WV4B 2CV5D 3AZFA 5CP6B 2NZDB 3MGRC 3AZID 3LZ1A 3AV2C 5DNNC 4LD9B 5GXQC 1KU5A 3LJAD 5AV6A 5B24D 3C1BD 5B31G 3AZJC 5AVBD 4Z5TD 3KXBB 4WU9B 4J8XC 3C1CB 4X23C 3O62D 3B6FC 4H9OA 1ZLAC 3LZ0D 3MGSA 1P3KB 3AZNB 4J8VC 5CPKC 4QLCC 2F8NA 1P3OB 4XUJB 2IO5C 3AZFD 1HTAA 3LZ1D 1B6WA 4H9SC 5E5AC 4CAYA 3MGQA 3AZLA 1P3BC 1F66B 5AV6D 5GT0B 1N1JA 4DRAA 3REJA 1BH8A 1P3PC 5B32B 2AROB 4KHAA 2PYOB 3AZKA 1U35B 3MGSD 1P3PB 1M19A 5DNMC 3AZGC 5G49B 2F8ND 3W98C 5DNMB 3W96B 4R8PC 3UTBA 3REHC 1TZYB 3A6NA 5AY8B 4KGCB 3MGQD 3AZLD 2RVQD 4YS3D 5AV5A 4XZQC 3REJD 3WAAB 2CV5C 3AZKD 5B1LD 1P3MB 5BNXB 3VH6T 3AZIC 4WZSB 1M19D 4E44A 3LJAC 5B24C 3C1BC 2HIOB 4H9NA 5AVBC 4Z5TC 3UTBD 5BO0B 1AOIA 3X1UA 3O62C 4E45A 3LZ0C 4H9RB 5JA4B 3KUYA 5AV5D 3MVDA 1A7WA 3REKA 3RELB 3AZFC 3WKJA 4EO5C 3X1TB 1M18B 3LZ1C 4J8WD 3AZFB 4NFTA 5F99B 2YFWA 5AV6C 4G91B 3KWQA 1AOID 3X1UD 1P3FA 5B32G 5AV9A 3MGSC 4Z66B 4H9PA 3LELA 1P3IA 3KUYD 3V9RA 1M1AA 3MVDD 4WNNB 4AWLB 3UT9B 3WKJD 3MNNB 5C3IB 5JRGA 3MGQC 5B40A 3W99A 3AZLC 2RVQC 3REJC 2FJ7A 3W97B 3KWQD 3AZKC 1P3FD 1BH8B 1M19C 5GSUB 4YM6B 4NE6A 3AYWA 3LELD 5BNVB 3X1VA 2NQBA 1P3ID 3R45B 1M1AD 3AN2A 3UTBC 3B6GB 3NQJB 3MGPD 3VH5W 1H3OA 3B0CT 3A6NC 1BH9B 5JRGD 5CPJB 3W99D 5B40D 5B2IB 1JFIA 3A6NB 3WTPA 3AZEB 5AV5C 2FJ7D 1EQZA 4KUDA 3AFAA 4ZBJC 1P3GA 5KDMB 3AYWD 4JJNA 2NQBD 3X1VD 4HGAC 1P3LD 3MGRB 3AN2D 1AOIC 3X1UC 3AV2B 5DNNB 5GXQB 3AZHA 3WTPD 3AZJB 5B33A 2BYMB 3KUYC 3KSYA 5AVCA 3MVDC 3REKC 1ULYA 1S32A 4J8XB 1EQZD 4KUDD 3AFAD 4J8UA 5AV8A 4X23B 3B6FB 5GT3A 1ZLAB 3WKJC 4NE3A 1P3GD 1Q9CA 3REKB 4J8VB 5CPKB 4JJND 4QLCB 5B1MA 2IO5B 3KWQC 5B31A 3NQUA 4YS3A 2YFWB 4WU8A 1P3FC 5E5AB 4ZUXA 5AV9C 3AV1A 1P3BB 4DRBA 3AZHD 1HQ3A 3LELC 5B1LA 5B33D 1P3IC 5AV9B 5AVCD 1M1AC 1S32D 4J8UD 5AV8D 1KX5A 5GT3D 3V9RB 2HUEC 2YFVA 5JRGC 1P3AA 3W99C 5B40C 3AZGB 3AZMA 3W98B 5B1MD 5B0ZA 2FJ7C 4R8PB 3REHB 5B31D 5B2JA 4WU8D 1KX4A 4ZUXD 3REIA 3AV1D 3WA9A 1HQ3D 5B0YA 4Z2MH 3AYWC 4UUZB 4XZQB 3X1VC 2NQBC 2CV5B 1KX3A 4J8WA 3AN2C 1ID3A 1KX5D 3AZIB 2BYKA 1TAFB 1P3AD 3LJAB 3AZMD 5CPIA 5B24B 5B0ZD 3WTPC 3C1BB 3TU4A 5AVBB 5FUGB 4Z5TB 4CSRA 3X1SA 1EQZC 5B2JD 3UTAA 4KUDC 3AFAC 3O62B 1KX4D 1P3GC 3LZ0B 3REID 3WA9D 5B0YD 4JJNC 5CP6A 2NZDA 4H9QB 1KX3D 4G92C 4LD9A 1ID3D 4EO5B 2F8NK 3LZ1B 3KXBA 3AZHC 5CPID 5AV6B 4WU9A 3C1CA 5B33C 3TU4D 5AVCC
chains in the Genus database with same CATH superfamily
3X1SD 1S32C 1P3KA 3UTAD 3AZNA 2XD5A 4J8UC 5AV8C 4H9OB 5GT3C 2FFFB 3MGSB 1P3OA 4XUJA 1P34A 3H0LC 1WWIA 3MGPA 5CP6D 2F8NB 2NZDD 2JSSA 5B1MC 4LD9D 5B31C 4YS3C 4WU8C 2CWEA 5BS7A 1F66A 4ZUXC 4CAYB 5GT0A 3MGQB 3B0DC 3AZLB 3AV1C 2RIQA 4UPKA 4YS3B 5B32A 3KXBD 2Y2OA 2AROA 4WU9D 2PYOA 1N1JB 5B1LC 3C1CD 3REJB 4KHAB 1U35A 3H0MC 3AZND 1P3KD 3AZKB 5B1LB 1KX5C 3B0CW 1M19B 5G49A 2ZM5A 1P3LA 4XUJD 1P3OD 5DNMA 1P34D 1P3AC 3W96A 3AZMC 5B0ZC 1TZYA 5AY8A 4KGCA 3UTBB 5B2JC 1KX4C 1F66D 3B0BA 2Y2GA 5GT0D 3REIC 3WAAA 5B32D 2AROD 3WA9C 2PYOD 5B0YC 5AV5B 1P3MA 5BNXA 1BFMA 1U35D 1P3PD 1KX3C 4J8WC 4ZBJB 1ID3C 2LY8A 3EPJA 4J8WB 5DNMD 2HIOA 3W96D 3F6TA 5CPIC 2Y2PA 1TZYD 4HGAB 3TU4C 4H9NB 5AY8D 4KGCD 3X1SC 1AOIB 3UTAC 4H9RA 3X1UB 5JA4A 3WAAD 3RELA 5BT1D 5CP6C 3KUYB 2NZDC 3MVDB 3X1TA 1P3MD 1M18A 2F8NG 4LD9C 3WKJB 2Y2MA 5F99A 2L5AA 2HIOD 3KXBC 3VH5A 4WU9C 3C1CC 3KWQB 1P3KC 3AZNC 4Z66A 1P3FB 4NE5A 1P3OC 4XUJC 1P34C 4WNNA 4H9PB 3LELB 3RELD 2W8SA 1P3IB 3MGPC 3UT9A 1M1AB 3X1TD 1M18D 3MNNA 1P34B 3MGPB 2HUEB 5BS7C 5F99D 5JRGB 1F66C 5GT0C 3W99B 5B40B 3W97A 2G5HC 2Y2LA 2AROC 5B32C 3VH6W 3WTPE 2PYOC 2FJ7B 1U35C 2XD1A 5GSUA 4YM6A 4Z66D 5BNVA 3R45A 1P3LC 3AYWB 2NQBB 3W96C 3X1VB 3B6GA 3UT9D 3NQJA 1TZYC 3MNND 1P3LB 5AY8C 1BH9A 3AN2B 4KGCC 5CPJA 5B2IA 1H3OB 3AZEA 1JFIB 3WAAC 3W97D 3WTPB 1B67A 2UWXA 5BT1C 1P3MC 1EQZB 4KUDB 3AFAB 5GSUD 4YM6D 2ZY3A 5KDMA 1P3GB 4JJNB 2HIOC 1WWSA 3MGRA 3B6GD 3AV2A 5DNNA 4G92B 5GXQA 5CPJD 5B2ID 3A6ND 3AZED 3AZJA 2BYMA 4M6BA 3AZHB 2F8NH 4J8XA 3RELC 5B33B 3VH6A 4X23A 5AVCB 3B6FA 1ZLAA 3X1TC 1S32B 1M18C 4J8UB 5AV8B 4J8VA 5GT3B 1F1EA 5CPKA 4QLCA 5F99C 4G91C 5B1MB 3MGRD 4DQYB 3AV2D 5DNND 4H9SA 2J8PA 5GXQD 3NQUB 5E5AA 5B31B 4WU8B 1HQ3C 1P3BA 4Z66C 4ZUXB 3B0DB 3AZJD 3AV1B 1P3PA 2DQNC 1HQ3B 4J8XD 4AWLC 3UT9C 4X23D 3B6FD 1ZLAD 3MNNC 3REKD 5C3IC 4J8VD 1KX5B 5CPKD 3AZGA 4QLCD 3W98A 2YFVB 1P3AB 3W97C 4R8PA 3AZMB 3REHA 5B0ZB 5E5AD 2ZY4A 5B2JB 3EPHA 5GSUC 4YM6C 3EPLA 1P3BD 1KX4B 3REIB 4XZQA 4UUZA 5AV9D 2Y2QA 2CV5A 3WA9B 5B0YB 3B6GC 3AZIA 1KX3B 3EPKA 1ID3B 5CPJC 1TAFA 3LJAA 5BO0A 5B2IC 3AZGD 4Z2MG 3W98D 5B24A 3C1BA 3AZEC 2BYKB 5AVBA 5FUGA 4Z5TA 4R8PD 3REHD 5CPIB 3TU4B 3KFUG 3O62A 3VH5T 4WJ3C 4CSRB 3X1SB 3LZ0A 5CHLB 3UTAB 1R4VA 2G5IC 4XZQD 4H9QA 4WV4B 2CV5D 3AZFA 5CP6B 2NZDB 3MGRC 3AZID 2F2AC 3LZ1A 3AV2C 5DNNC 4LD9B 5GXQC 1KU5A 3LJAD 3A1IA 3P5JB 5AV6A 5B24D 3C1BD 5B31G 3AZJC 5AVBD 4Z5TD 3KXBB 4WU9B 4J8XC 3C1CB 4X23C 3O62D 3B6FC 4H9OA 1ZLAC 3LZ0D 3MGSA 1P3KB 3AZNB 4J8VC 5CPKC 4QLCC 2F8NA 1P3OB 4XUJB 2IO5C 1T3UA 3AZFD 1HTAA 3LZ1D 3FDDA 1B6WA 4H9SC 5E5AC 4CAYA 3MGQA 3AZLA 1P3BC 1F66B 5AV6D 5GT0B 1N1JA 4DRAA 3REJA 1BH8A 1P3PC 5B32B 2AROB 4KHAA 2PYOB 3AZKA 1U35B 3MGSD 1P3PB 1M19A 5DNMC 2VQRA 3AZGC 5G49B 2F8ND 3W98C 5DNMB 3W96B 4R8PC 3UTBA 3REHC 1TZYB 3A6NA 5AY8B 4KGCB 3MGQD 3AZLD 2RVQD 4YS3D 5AV5A 4XZQC 3REJD 3WAAB 2CV5C 3AZKD 5B1LD 1P3MB 5BNXB 3VH6T 3AZIC 4WZSB 1M19D 4E44A 3LJAC 5B24C 3C1BC 2HIOB 4H9NA 5AVBC 4Z5TC 3UTBD 5BO0B 1AOIA 3X1UA 3O62C 4E45A 3LZ0C 4H9RB 5JA4B 3KUYA 5AV5D 2ZY5A 3MVDA 1A7WA 3REKA 3RELB 3AZFC 3WKJA 4EO5C 3X1TB 1M18B 3LZ1C 4J8WD 3AZFB 4NFTA 3IP4C 5F99B 2YFWA 5AV6C 4G91B 3KWQA 1AOID 3X1UD 1P3FA 5B32G 5AV9A 3MGSC 4Z66B 4H9PA 3LELA 1P3IA 3KUYD 3V9RA 1M1AA 3MVDD 4WNNB 4AWLB 3UT9B 3WKJD 3MNNB 5C3IB 5JRGA 3MGQC 5B40A 3W99A 3AZLC 2RVQC 2DF4C 3AL0C 2ZY2A 3REJC 2FJ7A 3W97B 3KWQD 3AZKC 1P3FD 1BH8B 1M19C 5GSUB 4YM6B 4NE6A 3AYWA 3LELD 5BNVB 3X1VA 2NQBA 1P3ID 3R45B 1M1AD 3AN2A 3UTBC 3B6GB 3NQJB 3MGPD 3VH5W 1H3OA 3B0CT 3A6NC 1BH9B 5JRGD 5CPJB 3W99D 5B40D 5B2IB 1JFIA 1PZRA 3A6NB 3WTPA 3AZEB 5AV5C 2FJ7D 1EQZA 4KUDA 3AFAA 4ZBJC 1P3GA 2Y2JA 5KDMB 3AYWD 4JJNA 2NQBD 3X1VD 4HGAC 1P3LD 3MGRB 3AN2D 2Y2NA 1AOIC 2Y2KA 3X1UC 3AV2B 5DNNB 5GXQB 3AZHA 3WTPD 3AZJB 5B33A 2BYMB 3KUYC 3KSYA 5AVCA 3MVDC 3REKC 1ULYA 1S32A 4J8XB 1EQZD 4KUDD 3AFAD 4J8UA 5AV8A 4X23B 3B6FB 5GT3A 1ZLAB 3WKJC 4NE3A 1P3GD 1Q9CA 3REKB 4J8VB 3H0RC 5CPKB 3EG5B 4JJND 4QLCB 5B1MA 2IO5B 3KWQC 5B31A 3NQUA 4YS3A 2YFWB 4WU8A 1P3FC 5E5AB 4ZUXA 2JCHA 5AV9C 3AV1A 1P3BB 4DRBA 3AZHD 1HQ3A 3LELC 5B1LA 5B33D 1P3IC 3A1KA 5AV9B 5AVCD 1M1AC 1S32D 4J8UD 5AV8D 1KX5A 5GT3D 3V9RB 2HUEC 2YFVA 5JRGC 1P3AA 3W99C 5B40C 3AZGB 3AZMA 3W98B 5B1MD 5B0ZA 2FJ7C 4R8PB 3REHB 5B31D 5B2JA 4WU8D 1KX4A 4ZUXD 3REIA 3AV1D 2Y2IA 3WA9A 1HQ3D 5B0YA 4Z2MH 2JE5A 4UUZB 4XZQB 3X1VC 3AYWC 2NQBC 1Z2CB 2CV5B 1KX3A 4J8WA 3AN2C 1ID3A 1KX5D 1W2EA 3AZIB 2BYKA 1TAFB 1P3AD 3LJAB 3AZMD 5CPIA 5B24B 5B0ZD 3WTPC 3C1BB 3TU4A 5AVBB 5FUGB 4Z5TB 4CSRA 3X1SA 1EQZC 5B2JD 3UTAA 4KUDC 3AFAC 3O62B 1KX4D 1P3GC 3LZ0B 3REID 3WA9D 5B0YD 4JJNC 5CP6A 2NZDA 2BG1A 4H9QB 1KX3D 4G92C 4LD9A 1ID3D 4EO5B 2Y2HA 2F8NK 3LZ1B 3KXBA 3AZHC 5CPID 5AV6B 4WU9A 3C1CA 5B33C 3TU4D 5AVCC
chains in the Genus database with same CATH topology
3X1SD 1S32C 1P3KA 3UTAD 3AZNA 2XD5A 4J8UC 5AV8C 4H9OB 5GT3C 2FFFB 3MGSB 1P3OA 4XUJA 1P34A 3H0LC 1WWIA 3MGPA 5CP6D 2F8NB 2NZDD 2JSSA 5B1MC 4LD9D 5B31C 4YS3C 4WU8C 2CWEA 5BS7A 1F66A 4ZUXC 4CAYB 5GT0A 3MGQB 3B0DC 3AZLB 3AV1C 2RIQA 4UPKA 4YS3B 5B32A 3KXBD 2Y2OA 2AROA 4WU9D 2PYOA 1N1JB 5B1LC 3C1CD 3REJB 4KHAB 1U35A 3H0MC 3AZND 1P3KD 3AZKB 5B1LB 1KX5C 3B0CW 1M19B 5G49A 2ZM5A 1P3LA 4XUJD 1P3OD 5DNMA 1P34D 1P3AC 3W96A 3AZMC 5B0ZC 1TZYA 5AY8A 4KGCA 3UTBB 5B2JC 1KX4C 1F66D 3B0BA 2Y2GA 5GT0D 3REIC 3WAAA 5B32D 2AROD 3WA9C 2PYOD 5B0YC 5AV5B 1P3MA 5BNXA 1BFMA 1U35D 1P3PD 1KX3C 4J8WC 4ZBJB 1ID3C 2LY8A 3EPJA 4J8WB 5DNMD 2HIOA 3W96D 3F6TA 5CPIC 2Y2PA 1TZYD 4HGAB 3TU4C 4H9NB 5AY8D 4KGCD 3X1SC 1AOIB 3UTAC 4H9RA 3X1UB 5JA4A 3WAAD 3RELA 5BT1D 5CP6C 3KUYB 2NZDC 3MVDB 3X1TA 1P3MD 1M18A 2F8NG 4LD9C 3WKJB 2Y2MA 5F99A 2L5AA 2HIOD 3KXBC 3VH5A 4WU9C 3C1CC 3KWQB 1P3KC 3AZNC 4Z66A 1P3FB 4NE5A 1P3OC 4XUJC 1P34C 4WNNA 4H9PB 3LELB 3RELD 2W8SA 1P3IB 3MGPC 3UT9A 1M1AB 3X1TD 1M18D 3MNNA 1P34B 3MGPB 2HUEB 5BS7C 5F99D 5JRGB 1F66C 5GT0C 3W99B 5B40B 3W97A 2G5HC 2Y2LA 2AROC 5B32C 3VH6W 3WTPE 2PYOC 2FJ7B 1U35C 2XD1A 5GSUA 4YM6A 4Z66D 5BNVA 3R45A 1P3LC 3AYWB 2NQBB 3W96C 3X1VB 3B6GA 3UT9D 3NQJA 1TZYC 3MNND 1P3LB 5AY8C 1BH9A 3AN2B 4KGCC 5CPJA 5B2IA 1H3OB 3AZEA 1JFIB 3WAAC 3W97D 3WTPB 1B67A 2UWXA 5BT1C 1P3MC 1EQZB 4KUDB 3AFAB 5GSUD 4YM6D 2ZY3A 5KDMA 1P3GB 4JJNB 2HIOC 1WWSA 3MGRA 3B6GD 3AV2A 5DNNA 4G92B 5GXQA 5CPJD 5B2ID 3A6ND 3AZED 3AZJA 2BYMA 4M6BA 3AZHB 2F8NH 4J8XA 3RELC 5B33B 3VH6A 4X23A 5AVCB 3B6FA 1ZLAA 3X1TC 1S32B 1M18C 4J8UB 5AV8B 4J8VA 5GT3B 1F1EA 5CPKA 4QLCA 5F99C 4G91C 5B1MB 3MGRD 4DQYB 3AV2D 5DNND 4H9SA 2J8PA 5GXQD 3NQUB 5E5AA 5B31B 4WU8B 1HQ3C 1P3BA 4Z66C 4ZUXB 3B0DB 3AZJD 3AV1B 1P3PA 2DQNC 1HQ3B 4J8XD 4AWLC 3UT9C 4X23D 3B6FD 1ZLAD 3MNNC 3REKD 5C3IC 4J8VD 1KX5B 5CPKD 3AZGA 4QLCD 3W98A 2YFVB 1P3AB 3W97C 4R8PA 3AZMB 3REHA 5B0ZB 5E5AD 2ZY4A 5B2JB 3EPHA 5GSUC 4YM6C 3EPLA 1P3BD 1KX4B 3REIB 4XZQA 4UUZA 5AV9D 2Y2QA 2CV5A 3WA9B 5B0YB 3B6GC 3AZIA 1KX3B 3EPKA 1ID3B 5CPJC 1TAFA 3LJAA 5BO0A 5B2IC 3AZGD 4Z2MG 3W98D 5B24A 3C1BA 3AZEC 2BYKB 5AVBA 5FUGA 4Z5TA 4R8PD 3REHD 5CPIB 3TU4B 3KFUG 3O62A 3VH5T 4WJ3C 4CSRB 3X1SB 3LZ0A 5CHLB 3UTAB 1R4VA 2G5IC 4XZQD 4H9QA 4WV4B 2CV5D 3AZFA 5CP6B 2NZDB 3MGRC 3AZID 2F2AC 3LZ1A 3AV2C 5DNNC 4LD9B 5GXQC 1KU5A 3LJAD 3A1IA 3P5JB 5AV6A 5B24D 3C1BD 5B31G 3AZJC 5AVBD 4Z5TD 3KXBB 4WU9B 4J8XC 3C1CB 4X23C 3O62D 3B6FC 4H9OA 1ZLAC 3LZ0D 3MGSA 1P3KB 3AZNB 4J8VC 5CPKC 4QLCC 2F8NA 1P3OB 4XUJB 2IO5C 1T3UA 3AZFD 1HTAA 3LZ1D 3FDDA 1B6WA 4H9SC 5E5AC 4CAYA 3MGQA 3AZLA 1P3BC 1F66B 5AV6D 5GT0B 1N1JA 4DRAA 3REJA 1BH8A 1P3PC 5B32B 2AROB 4KHAA 2PYOB 3AZKA 1U35B 3MGSD 1P3PB 1M19A 5DNMC 2VQRA 3AZGC 5G49B 2F8ND 3W98C 5DNMB 3W96B 4R8PC 3UTBA 3REHC 1TZYB 3A6NA 5AY8B 4KGCB 3MGQD 3AZLD 2RVQD 4YS3D 5AV5A 4XZQC 3REJD 3WAAB 2CV5C 3AZKD 5B1LD 1P3MB 5BNXB 3VH6T 3AZIC 4WZSB 1M19D 4E44A 3LJAC 5B24C 3C1BC 2HIOB 4H9NA 5AVBC 4Z5TC 3UTBD 5BO0B 1AOIA 3X1UA 3O62C 4E45A 3LZ0C 4H9RB 5JA4B 3KUYA 5AV5D 2ZY5A 3MVDA 1A7WA 3REKA 3RELB 3AZFC 3WKJA 4EO5C 3X1TB 1M18B 3LZ1C 4J8WD 3AZFB 4NFTA 3IP4C 5F99B 2YFWA 5AV6C 4G91B 3KWQA 1AOID 3X1UD 1P3FA 5B32G 5AV9A 3MGSC 4Z66B 4H9PA 3LELA 1P3IA 3KUYD 3V9RA 1M1AA 3MVDD 4WNNB 4AWLB 3UT9B 3WKJD 3MNNB 5C3IB 5JRGA 3MGQC 5B40A 3W99A 3AZLC 2RVQC 2DF4C 3AL0C 2ZY2A 3REJC 2FJ7A 3W97B 3KWQD 3AZKC 1P3FD 1BH8B 1M19C 5GSUB 4YM6B 4NE6A 3AYWA 3LELD 5BNVB 3X1VA 2NQBA 1P3ID 3R45B 1M1AD 3AN2A 3UTBC 3B6GB 3NQJB 3MGPD 3VH5W 1H3OA 3B0CT 3A6NC 1BH9B 5JRGD 5CPJB 3W99D 5B40D 5B2IB 1JFIA 1PZRA 3A6NB 3WTPA 3AZEB 5AV5C 2FJ7D 1EQZA 4KUDA 3AFAA 4ZBJC 1P3GA 2Y2JA 5KDMB 3AYWD 4JJNA 2NQBD 3X1VD 4HGAC 1P3LD 3MGRB 3AN2D 2Y2NA 1AOIC 2Y2KA 3X1UC 3AV2B 5DNNB 5GXQB 3AZHA 3WTPD 3AZJB 5B33A 2BYMB 3KUYC 3KSYA 5AVCA 3MVDC 3REKC 1ULYA 1S32A 4J8XB 1EQZD 4KUDD 3AFAD 4J8UA 5AV8A 4X23B 3B6FB 5GT3A 1ZLAB 3WKJC 4NE3A 1P3GD 1Q9CA 3REKB 4J8VB 3H0RC 5CPKB 3EG5B 4JJND 4QLCB 5B1MA 2IO5B 3KWQC 5B31A 3NQUA 4YS3A 2YFWB 4WU8A 1P3FC 5E5AB 4ZUXA 2JCHA 5AV9C 3AV1A 1P3BB 4DRBA 3AZHD 1HQ3A 3LELC 5B1LA 5B33D 1P3IC 3A1KA 5AV9B 5AVCD 1M1AC 1S32D 4J8UD 5AV8D 1KX5A 5GT3D 3V9RB 2HUEC 2YFVA 5JRGC 1P3AA 3W99C 5B40C 3AZGB 3AZMA 3W98B 5B1MD 5B0ZA 2FJ7C 4R8PB 3REHB 5B31D 5B2JA 4WU8D 1KX4A 4ZUXD 3REIA 3AV1D 2Y2IA 3WA9A 1HQ3D 5B0YA 4Z2MH 2JE5A 4UUZB 4XZQB 3X1VC 3AYWC 2NQBC 1Z2CB 2CV5B 1KX3A 4J8WA 3AN2C 1ID3A 1KX5D 1W2EA 3AZIB 2BYKA 1TAFB 1P3AD 3LJAB 3AZMD 5CPIA 5B24B 5B0ZD 3WTPC 3C1BB 3TU4A 5AVBB 5FUGB 4Z5TB 4CSRA 3X1SA 1EQZC 5B2JD 3UTAA 4KUDC 3AFAC 3O62B 1KX4D 1P3GC 3LZ0B 3REID 3WA9D 5B0YD 4JJNC 5CP6A 2NZDA 2BG1A 4H9QB 1KX3D 4G92C 4LD9A 1ID3D 4EO5B 2Y2HA 2F8NK 3LZ1B 3KXBA 3AZHC 5CPID 5AV6B 4WU9A 3C1CA 5B33C 3TU4D 5AVCC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3X1S D;  1S32 C;  1P3K A;  3UTA D;  3AZN A;  4J8U C;  5AV8 C;  4H9O B;  5GT3 C;  3MGS B;  1P3O A;  4XUJ A;  1P34 A;  1WWI A;  3MGP A;  5CP6 D;  2F8N B;  2NZD D;  2JSS A;  5B1M C;  4LD9 D;  5B31 C;  4YS3 C;  4WU8 C;  2CWE A;  5BS7 A;  1F66 A;  4ZUX C;  4CAY B;  5GT0 A;  3MGQ B;  3B0D C;  3AZL B;  3AV1 C;  4YS3 B;  5B32 A;  3KXB D;  2ARO A;  4WU9 D;  2PYO A;  1N1J B;  5B1L C;  3C1C D;  3REJ B;  4KHA B;  1U35 A;  1P3K D;  3AZN D;  3AZK B;  5B1L B;  1KX5 C;  3B0C W;  1M19 B;  5G49 A;  1P3L A;  4XUJ D;  1P3O D;  5DNM A;  1P34 D;  1P3A C;  3W96 A;  3AZM C;  5B0Z C;  1TZY A;  5AY8 A;  4KGC A;  3UTB B;  5B2J C;  1KX4 C;  1F66 D;  3B0B A;  5GT0 D;  3REI C;  3WAA A;  5B32 D;  2ARO D;  3WA9 C;  2PYO D;  5B0Y C;  5AV5 B;  1P3M A;  5BNX A;  1BFM A;  1U35 D;  1P3P D;  1KX3 C;  4J8W C;  4ZBJ B;  1ID3 C;  2LY8 A;  4J8W B;  5DNM D;  2HIO A;  3W96 D;  5CPI C;  1TZY D;  4HGA B;  3TU4 C;  4H9N B;  5AY8 D;  4KGC D;  3X1S C;  1AOI B;  3UTA C;  4H9R A;  3X1U B;  5JA4 A;  3WAA D;  3REL A;  5BT1 D;  5CP6 C;  3KUY B;  2NZD C;  3MVD B;  3X1T A;  1P3M D;  1M18 A;  2F8N G;  4LD9 C;  3WKJ B;  5F99 A;  2L5A A;  2HIO D;  3KXB C;  3VH5 A;  4WU9 C;  3C1C C;  3KWQ B;  1P3K C;  3AZN C;  4Z66 A;  1P3F B;  4NE5 A;  1P3O C;  4XUJ C;  1P34 C;  4WNN A;  4H9P B;  3LEL B;  3REL D;  1P3I B;  3MGP C;  3UT9 A;  1M1A B;  3X1T D;  1M18 D;  3MNN A;  1P34 B;  3MGP B;  2HUE B;  5BS7 C;  5F99 D;  5JRG B;  1F66 C;  5GT0 C;  3W99 B;  5B40 B;  3W97 A;  5B32 C;  2ARO C;  3WTP E;  3VH6 W;  2PYO C;  2FJ7 B;  1U35 C;  5GSU A;  4YM6 A;  4Z66 D;  5BNV A;  3R45 A;  1P3L C;  3AYW B;  2NQB B;  3W96 C;  3X1V B;  3B6G A;  3UT9 D;  3NQJ A;  1TZY C;  3MNN D;  1P3L B;  5AY8 C;  1BH9 A;  3AN2 B;  4KGC C;  5CPJ A;  5B2I A;  1H3O B;  3AZE A;  1JFI B;  3WAA C;  3W97 D;  3WTP B;  1B67 A;  5BT1 C;  1P3M C;  1EQZ B;  4KUD B;  3AFA B;  5GSU D;  4YM6 D;  5KDM A;  1P3G B;  4JJN B;  2HIO C;  1WWS A;  3MGR A;  3B6G D;  3AV2 A;  5DNN A;  4G92 B;  5GXQ A;  5CPJ D;  5B2I D;  3A6N D;  3AZE D;  3AZJ A;  2BYM A;  4M6B A;  3AZH B;  2F8N H;  4J8X A;  3REL C;  5B33 B;  3VH6 A;  4X23 A;  5AVC B;  3B6F A;  1ZLA A;  3X1T C;  1S32 B;  1M18 C;  4J8U B;  5AV8 B;  4J8V A;  5GT3 B;  1F1E A;  5CPK A;  4QLC A;  5F99 C;  4G91 C;  5B1M B;  3MGR D;  3AV2 D;  5DNN D;  4H9S A;  5GXQ D;  5E5A A;  3NQU B;  5B31 B;  4WU8 B;  1HQ3 C;  1P3B A;  4Z66 C;  4ZUX B;  3B0D B;  3AZJ D;  3AV1 B;  1P3P A;  1HQ3 B;  4J8X D;  4AWL C;  3UT9 C;  4X23 D;  3B6F D;  1ZLA D;  3MNN C;  3REK D;  5C3I C;  4J8V D;  1KX5 B;  5CPK D;  3AZG A;  4QLC D;  3W98 A;  2YFV B;  1P3A B;  3W97 C;  4R8P A;  3AZM B;  3REH A;  5B0Z B;  5E5A D;  5B2J B;  5GSU C;  4YM6 C;  1P3B D;  1KX4 B;  3REI B;  4UUZ A;  4XZQ A;  5AV9 D;  2CV5 A;  3WA9 B;  5B0Y B;  3B6G C;  3AZI A;  1KX3 B;  1ID3 B;  5CPJ C;  1TAF A;  3LJA A;  5BO0 A;  5B2I C;  3AZG D;  4Z2M G;  3W98 D;  5B24 A;  3C1B A;  3AZE C;  2BYK B;  5AVB A;  5FUG A;  4Z5T A;  4R8P D;  3REH D;  5CPI B;  3TU4 B;  3O62 A;  3VH5 T;  4CSR B;  3X1S B;  3LZ0 A;  5CHL B;  3UTA B;  1R4V A;  4XZQ D;  4H9Q A;  4WV4 B;  2CV5 D;  3AZF A;  5CP6 B;  2NZD B;  3MGR C;  3AZI D;  3LZ1 A;  3AV2 C;  5DNN C;  4LD9 B;  5GXQ C;  1KU5 A;  3LJA D;  5AV6 A;  5B24 D;  3C1B D;  5B31 G;  3AZJ C;  5AVB D;  4Z5T D;  3KXB B;  4WU9 B;  4J8X C;  3C1C B;  4X23 C;  3O62 D;  3B6F C;  4H9O A;  1ZLA C;  3LZ0 D;  3MGS A;  1P3K B;  3AZN B;  4J8V C;  5CPK C;  4QLC C;  2F8N A;  1P3O B;  4XUJ B;  2IO5 C;  3AZF D;  1HTA A;  3LZ1 D;  1B6W A;  4H9S C;  5E5A C;  4CAY A;  3MGQ A;  3AZL A;  1P3B C;  1F66 B;  5AV6 D;  5GT0 B;  1N1J A;  4DRA A;  3REJ A;  1BH8 A;  1P3P C;  5B32 B;  2ARO B;  4KHA A;  2PYO B;  3AZK A;  1U35 B;  3MGS D;  1P3P B;  1M19 A;  5DNM C;  3AZG C;  5G49 B;  2F8N D;  3W98 C;  5DNM B;  3W96 B;  4R8P C;  3UTB A;  3REH C;  1TZY B;  3A6N A;  5AY8 B;  4KGC B;  3MGQ D;  3AZL D;  2RVQ D;  4YS3 D;  5AV5 A;  4XZQ C;  3REJ D;  3WAA B;  2CV5 C;  3AZK D;  5B1L D;  1P3M B;  5BNX B;  3VH6 T;  3AZI C;  4WZS B;  1M19 D;  4E44 A;  3LJA C;  5B24 C;  3C1B C;  2HIO B;  4H9N A;  5AVB C;  4Z5T C;  3UTB D;  5BO0 B;  1AOI A;  3X1U A;  3O62 C;  4E45 A;  3LZ0 C;  4H9R B;  5JA4 B;  3KUY A;  5AV5 D;  3MVD A;  1A7W A;  3REK A;  3REL B;  3AZF C;  3WKJ A;  4EO5 C;  3X1T B;  1M18 B;  3LZ1 C;  4J8W D;  3AZF B;  4NFT A;  5F99 B;  2YFW A;  5AV6 C;  4G91 B;  3KWQ A;  1AOI D;  3X1U D;  1P3F A;  5B32 G;  5AV9 A;  3MGS C;  4Z66 B;  4H9P A;  3LEL A;  1P3I A;  3KUY D;  3V9R A;  1M1A A;  3MVD D;  4WNN B;  4AWL B;  3UT9 B;  3WKJ D;  3MNN B;  5C3I B;  5JRG A;  3MGQ C;  5B40 A;  3W99 A;  3AZL C;  2RVQ C;  3REJ C;  2FJ7 A;  3W97 B;  3KWQ D;  3AZK C;  1P3F D;  1BH8 B;  1M19 C;  5GSU B;  4YM6 B;  4NE6 A;  3AYW A;  3LEL D;  5BNV B;  3X1V A;  2NQB A;  1P3I D;  3R45 B;  1M1A D;  3AN2 A;  3UTB C;  3B6G B;  3NQJ B;  3MGP D;  3VH5 W;  1H3O A;  3B0C T;  3A6N C;  1BH9 B;  5JRG D;  5CPJ B;  3W99 D;  5B40 D;  5B2I B;  1JFI A;  3A6N B;  3WTP A;  3AZE B;  5AV5 C;  2FJ7 D;  1EQZ A;  4KUD A;  3AFA A;  4ZBJ C;  1P3G A;  5KDM B;  3AYW D;  4JJN A;  2NQB D;  3X1V D;  4HGA C;  1P3L D;  3MGR B;  3AN2 D;  1AOI C;  3X1U C;  3AV2 B;  5DNN B;  5GXQ B;  3AZH A;  3WTP D;  3AZJ B;  5B33 A;  2BYM B;  3KUY C;  3KSY A;  5AVC A;  3MVD C;  3REK C;  1ULY A;  1S32 A;  4J8X B;  1EQZ D;  4KUD D;  3AFA D;  4J8U A;  5AV8 A;  4X23 B;  3B6F B;  5GT3 A;  1ZLA B;  3WKJ C;  4NE3 A;  1P3G D;  1Q9C A;  3REK B;  4J8V B;  5CPK B;  4JJN D;  4QLC B;  5B1M A;  2IO5 B;  3KWQ C;  5B31 A;  3NQU A;  4YS3 A;  2YFW B;  4WU8 A;  1P3F C;  5E5A B;  4ZUX A;  5AV9 C;  3AV1 A;  1P3B B;  4DRB A;  3AZH D;  1HQ3 A;  3LEL C;  5B1L A;  5B33 D;  1P3I C;  5AV9 B;  5AVC D;  1M1A C;  1S32 D;  4J8U D;  5AV8 D;  1KX5 A;  5GT3 D;  3V9R B;  2HUE C;  2YFV A;  5JRG C;  1P3A A;  3W99 C;  5B40 C;  3AZG B;  3AZM A;  3W98 B;  5B1M D;  5B0Z A;  2FJ7 C;  4R8P B;  3REH B;  5B31 D;  5B2J A;  4WU8 D;  1KX4 A;  4ZUX D;  3REI A;  3AV1 D;  3WA9 A;  1HQ3 D;  5B0Y A;  4Z2M H;  3AYW C;  4UUZ B;  4XZQ B;  3X1V C;  2NQB C;  2CV5 B;  1KX3 A;  4J8W A;  3AN2 C;  1ID3 A;  1KX5 D;  3AZI B;  2BYK A;  1TAF B;  1P3A D;  3LJA B;  3AZM D;  5CPI A;  5B24 B;  5B0Z D;  3WTP C;  3C1B B;  3TU4 A;  5AVB B;  5FUG B;  4Z5T B;  4CSR A;  3X1S A;  1EQZ C;  5B2J D;  3UTA A;  4KUD C;  3AFA C;  3O62 B;  1KX4 D;  1P3G C;  3LZ0 B;  3REI D;  3WA9 D;  5B0Y D;  4JJN C;  5CP6 A;  2NZD A;  4H9Q B;  1KX3 D;  4G92 C;  4LD9 A;  1ID3 D;  4EO5 B;  2F8N K;  3LZ1 B;  3KXB A;  3AZH C;  5CPI D;  5AV6 B;  4WU9 A;  3C1C A;  5B33 C;  3TU4 D;  5AVC C; 
#chains in the Genus database with same CATH topology
 3X1S D;  1S32 C;  1P3K A;  3UTA D;  3AZN A;  2XD5 A;  4J8U C;  5AV8 C;  4H9O B;  5GT3 C;  2FFF B;  3MGS B;  1P3O A;  4XUJ A;  1P34 A;  3H0L C;  1WWI A;  3MGP A;  5CP6 D;  2F8N B;  2NZD D;  2JSS A;  5B1M C;  4LD9 D;  5B31 C;  4YS3 C;  4WU8 C;  2CWE A;  5BS7 A;  1F66 A;  4ZUX C;  4CAY B;  5GT0 A;  3MGQ B;  3B0D C;  3AZL B;  3AV1 C;  2RIQ A;  4UPK A;  4YS3 B;  5B32 A;  3KXB D;  2Y2O A;  2ARO A;  4WU9 D;  2PYO A;  1N1J B;  5B1L C;  3C1C D;  3REJ B;  4KHA B;  1U35 A;  3H0M C;  3AZN D;  1P3K D;  3AZK B;  5B1L B;  1KX5 C;  3B0C W;  1M19 B;  5G49 A;  2ZM5 A;  1P3L A;  4XUJ D;  1P3O D;  5DNM A;  1P34 D;  1P3A C;  3W96 A;  3AZM C;  5B0Z C;  1TZY A;  5AY8 A;  4KGC A;  3UTB B;  5B2J C;  1KX4 C;  1F66 D;  3B0B A;  2Y2G A;  5GT0 D;  3REI C;  3WAA A;  5B32 D;  2ARO D;  3WA9 C;  2PYO D;  5B0Y C;  5AV5 B;  1P3M A;  5BNX A;  1BFM A;  1U35 D;  1P3P D;  1KX3 C;  4J8W C;  4ZBJ B;  1ID3 C;  2LY8 A;  3EPJ A;  4J8W B;  5DNM D;  2HIO A;  3W96 D;  3F6T A;  5CPI C;  2Y2P A;  1TZY D;  4HGA B;  3TU4 C;  4H9N B;  5AY8 D;  4KGC D;  3X1S C;  1AOI B;  3UTA C;  4H9R A;  3X1U B;  5JA4 A;  3WAA D;  3REL A;  5BT1 D;  5CP6 C;  3KUY B;  2NZD C;  3MVD B;  3X1T A;  1P3M D;  1M18 A;  2F8N G;  4LD9 C;  3WKJ B;  2Y2M A;  5F99 A;  2L5A A;  2HIO D;  3KXB C;  3VH5 A;  4WU9 C;  3C1C C;  3KWQ B;  1P3K C;  3AZN C;  4Z66 A;  1P3F B;  4NE5 A;  1P3O C;  4XUJ C;  1P34 C;  4WNN A;  4H9P B;  3LEL B;  3REL D;  2W8S A;  1P3I B;  3MGP C;  3UT9 A;  1M1A B;  3X1T D;  1M18 D;  3MNN A;  1P34 B;  3MGP B;  2HUE B;  5BS7 C;  5F99 D;  5JRG B;  1F66 C;  5GT0 C;  3W99 B;  5B40 B;  3W97 A;  2G5H C;  2Y2L A;  2ARO C;  5B32 C;  3VH6 W;  3WTP E;  2PYO C;  2FJ7 B;  1U35 C;  2XD1 A;  5GSU A;  4YM6 A;  4Z66 D;  5BNV A;  3R45 A;  1P3L C;  3AYW B;  2NQB B;  3W96 C;  3X1V B;  3B6G A;  3UT9 D;  3NQJ A;  1TZY C;  3MNN D;  1P3L B;  5AY8 C;  1BH9 A;  3AN2 B;  4KGC C;  5CPJ A;  5B2I A;  1H3O B;  3AZE A;  1JFI B;  3WAA C;  3W97 D;  3WTP B;  1B67 A;  2UWX A;  5BT1 C;  1P3M C;  1EQZ B;  4KUD B;  3AFA B;  5GSU D;  4YM6 D;  2ZY3 A;  5KDM A;  1P3G B;  4JJN B;  2HIO C;  1WWS A;  3MGR A;  3B6G D;  3AV2 A;  5DNN A;  4G92 B;  5GXQ A;  5CPJ D;  5B2I D;  3A6N D;  3AZE D;  3AZJ A;  2BYM A;  4M6B A;  3AZH B;  2F8N H;  4J8X A;  3REL C;  5B33 B;  3VH6 A;  4X23 A;  5AVC B;  3B6F A;  1ZLA A;  3X1T C;  1S32 B;  1M18 C;  4J8U B;  5AV8 B;  4J8V A;  5GT3 B;  1F1E A;  5CPK A;  4QLC A;  5F99 C;  4G91 C;  5B1M B;  3MGR D;  4DQY B;  3AV2 D;  5DNN D;  4H9S A;  2J8P A;  5GXQ D;  3NQU B;  5E5A A;  5B31 B;  4WU8 B;  1HQ3 C;  1P3B A;  4Z66 C;  4ZUX B;  3B0D B;  3AZJ D;  3AV1 B;  1P3P A;  2DQN C;  1HQ3 B;  4J8X D;  4AWL C;  3UT9 C;  4X23 D;  3B6F D;  1ZLA D;  3MNN C;  3REK D;  5C3I C;  4J8V D;  1KX5 B;  5CPK D;  3AZG A;  4QLC D;  3W98 A;  2YFV B;  1P3A B;  3W97 C;  4R8P A;  3AZM B;  3REH A;  5B0Z B;  5E5A D;  2ZY4 A;  5B2J B;  3EPH A;  5GSU C;  4YM6 C;  3EPL A;  1P3B D;  1KX4 B;  3REI B;  4XZQ A;  4UUZ A;  5AV9 D;  2Y2Q A;  2CV5 A;  3WA9 B;  5B0Y B;  3B6G C;  3AZI A;  1KX3 B;  3EPK A;  1ID3 B;  5CPJ C;  1TAF A;  3LJA A;  5BO0 A;  5B2I C;  3AZG D;  4Z2M G;  3W98 D;  5B24 A;  3C1B A;  3AZE C;  2BYK B;  5AVB A;  5FUG A;  4Z5T A;  4R8P D;  3REH D;  5CPI B;  3TU4 B;  3KFU G;  3O62 A;  3VH5 T;  4WJ3 C;  4CSR B;  3X1S B;  3LZ0 A;  5CHL B;  3UTA B;  1R4V A;  2G5I C;  4XZQ D;  4H9Q A;  4WV4 B;  2CV5 D;  3AZF A;  5CP6 B;  2NZD B;  3MGR C;  3AZI D;  2F2A C;  3LZ1 A;  3AV2 C;  5DNN C;  4LD9 B;  5GXQ C;  1KU5 A;  3LJA D;  3A1I A;  3P5J B;  5AV6 A;  5B24 D;  3C1B D;  5B31 G;  3AZJ C;  5AVB D;  4Z5T D;  3KXB B;  4WU9 B;  4J8X C;  3C1C B;  4X23 C;  3O62 D;  3B6F C;  4H9O A;  1ZLA C;  3LZ0 D;  3MGS A;  1P3K B;  3AZN B;  4J8V C;  5CPK C;  4QLC C;  2F8N A;  1P3O B;  4XUJ B;  2IO5 C;  1T3U A;  3AZF D;  1HTA A;  3LZ1 D;  3FDD A;  1B6W A;  4H9S C;  5E5A C;  4CAY A;  3MGQ A;  3AZL A;  1P3B C;  1F66 B;  5AV6 D;  5GT0 B;  1N1J A;  4DRA A;  3REJ A;  1BH8 A;  1P3P C;  5B32 B;  2ARO B;  4KHA A;  2PYO B;  3AZK A;  1U35 B;  3MGS D;  1P3P B;  1M19 A;  5DNM C;  2VQR A;  3AZG C;  5G49 B;  2F8N D;  3W98 C;  5DNM B;  3W96 B;  4R8P C;  3UTB A;  3REH C;  1TZY B;  3A6N A;  5AY8 B;  4KGC B;  3MGQ D;  3AZL D;  2RVQ D;  4YS3 D;  5AV5 A;  4XZQ C;  3REJ D;  3WAA B;  2CV5 C;  3AZK D;  5B1L D;  1P3M B;  5BNX B;  3VH6 T;  3AZI C;  4WZS B;  1M19 D;  4E44 A;  3LJA C;  5B24 C;  3C1B C;  2HIO B;  4H9N A;  5AVB C;  4Z5T C;  3UTB D;  5BO0 B;  1AOI A;  3X1U A;  3O62 C;  4E45 A;  3LZ0 C;  4H9R B;  5JA4 B;  3KUY A;  5AV5 D;  2ZY5 A;  3MVD A;  1A7W A;  3REK A;  3REL B;  3AZF C;  3WKJ A;  4EO5 C;  3X1T B;  1M18 B;  3LZ1 C;  4J8W D;  3AZF B;  4NFT A;  3IP4 C;  5F99 B;  2YFW A;  5AV6 C;  4G91 B;  3KWQ A;  1AOI D;  3X1U D;  1P3F A;  5B32 G;  5AV9 A;  3MGS C;  4Z66 B;  4H9P A;  3LEL A;  1P3I A;  3KUY D;  3V9R A;  1M1A A;  3MVD D;  4WNN B;  4AWL B;  3UT9 B;  3WKJ D;  3MNN B;  5C3I B;  5JRG A;  3MGQ C;  5B40 A;  3W99 A;  3AZL C;  2RVQ C;  2DF4 C;  3AL0 C;  2ZY2 A;  3REJ C;  2FJ7 A;  3W97 B;  3KWQ D;  3AZK C;  1P3F D;  1BH8 B;  1M19 C;  5GSU B;  4YM6 B;  4NE6 A;  3AYW A;  3LEL D;  5BNV B;  3X1V A;  2NQB A;  1P3I D;  3R45 B;  1M1A D;  3AN2 A;  3UTB C;  3B6G B;  3NQJ B;  3MGP D;  3VH5 W;  1H3O A;  3B0C T;  3A6N C;  1BH9 B;  5JRG D;  5CPJ B;  3W99 D;  5B40 D;  5B2I B;  1JFI A;  1PZR A;  3A6N B;  3WTP A;  3AZE B;  5AV5 C;  2FJ7 D;  1EQZ A;  4KUD A;  3AFA A;  4ZBJ C;  1P3G A;  2Y2J A;  5KDM B;  3AYW D;  4JJN A;  2NQB D;  3X1V D;  4HGA C;  1P3L D;  3MGR B;  3AN2 D;  2Y2N A;  1AOI C;  2Y2K A;  3X1U C;  3AV2 B;  5DNN B;  5GXQ B;  3AZH A;  3WTP D;  3AZJ B;  5B33 A;  2BYM B;  3KUY C;  3KSY A;  5AVC A;  3MVD C;  3REK C;  1ULY A;  1S32 A;  4J8X B;  1EQZ D;  4KUD D;  3AFA D;  4J8U A;  5AV8 A;  4X23 B;  3B6F B;  5GT3 A;  1ZLA B;  3WKJ C;  4NE3 A;  1P3G D;  1Q9C A;  3REK B;  4J8V B;  3H0R C;  5CPK B;  3EG5 B;  4JJN D;  4QLC B;  5B1M A;  2IO5 B;  3KWQ C;  5B31 A;  3NQU A;  4YS3 A;  2YFW B;  4WU8 A;  1P3F C;  5E5A B;  4ZUX A;  2JCH A;  5AV9 C;  3AV1 A;  1P3B B;  4DRB A;  3AZH D;  1HQ3 A;  3LEL C;  5B1L A;  5B33 D;  1P3I C;  3A1K A;  5AV9 B;  5AVC D;  1M1A C;  1S32 D;  4J8U D;  5AV8 D;  1KX5 A;  5GT3 D;  3V9R B;  2HUE C;  2YFV A;  5JRG C;  1P3A A;  3W99 C;  5B40 C;  3AZG B;  3AZM A;  3W98 B;  5B1M D;  5B0Z A;  2FJ7 C;  4R8P B;  3REH B;  5B31 D;  5B2J A;  4WU8 D;  1KX4 A;  4ZUX D;  3REI A;  3AV1 D;  2Y2I A;  3WA9 A;  1HQ3 D;  5B0Y A;  4Z2M H;  2JE5 A;  4UUZ B;  4XZQ B;  3X1V C;  3AYW C;  2NQB C;  1Z2C B;  2CV5 B;  1KX3 A;  4J8W A;  3AN2 C;  1ID3 A;  1KX5 D;  1W2E A;  3AZI B;  2BYK A;  1TAF B;  1P3A D;  3LJA B;  3AZM D;  5CPI A;  5B24 B;  5B0Z D;  3WTP C;  3C1B B;  3TU4 A;  5AVB B;  5FUG B;  4Z5T B;  4CSR A;  3X1S A;  1EQZ C;  5B2J D;  3UTA A;  4KUD C;  3AFA C;  3O62 B;  1KX4 D;  1P3G C;  3LZ0 B;  3REI D;  3WA9 D;  5B0Y D;  4JJN C;  5CP6 A;  2NZD A;  2BG1 A;  4H9Q B;  1KX3 D;  4G92 C;  4LD9 A;  1ID3 D;  4EO5 B;  2Y2H A;  2F8N K;  3LZ1 B;  3KXB A;  3AZH C;  5CPI D;  5AV6 B;  4WU9 A;  3C1C A;  5B33 C;  3TU4 D;  5AVC C; 
#chains in the Genus database with same CATH homology
 3X1S D;  1S32 C;  1P3K A;  3UTA D;  3AZN A;  2XD5 A;  4J8U C;  5AV8 C;  4H9O B;  5GT3 C;  2FFF B;  3MGS B;  1P3O A;  4XUJ A;  1P34 A;  3H0L C;  1WWI A;  3MGP A;  5CP6 D;  2F8N B;  2NZD D;  2JSS A;  5B1M C;  4LD9 D;  5B31 C;  4YS3 C;  4WU8 C;  2CWE A;  5BS7 A;  1F66 A;  4ZUX C;  4CAY B;  5GT0 A;  3MGQ B;  3B0D C;  3AZL B;  3AV1 C;  2RIQ A;  4UPK A;  4YS3 B;  5B32 A;  3KXB D;  2Y2O A;  2ARO A;  4WU9 D;  2PYO A;  1N1J B;  5B1L C;  3C1C D;  3REJ B;  4KHA B;  1U35 A;  3H0M C;  3AZN D;  1P3K D;  3AZK B;  5B1L B;  1KX5 C;  3B0C W;  1M19 B;  5G49 A;  2ZM5 A;  1P3L A;  4XUJ D;  1P3O D;  5DNM A;  1P34 D;  1P3A C;  3W96 A;  3AZM C;  5B0Z C;  1TZY A;  5AY8 A;  4KGC A;  3UTB B;  5B2J C;  1KX4 C;  1F66 D;  3B0B A;  2Y2G A;  5GT0 D;  3REI C;  3WAA A;  5B32 D;  2ARO D;  3WA9 C;  2PYO D;  5B0Y C;  5AV5 B;  1P3M A;  5BNX A;  1BFM A;  1U35 D;  1P3P D;  1KX3 C;  4J8W C;  4ZBJ B;  1ID3 C;  2LY8 A;  3EPJ A;  4J8W B;  5DNM D;  2HIO A;  3W96 D;  3F6T A;  5CPI C;  2Y2P A;  1TZY D;  4HGA B;  3TU4 C;  4H9N B;  5AY8 D;  4KGC D;  3X1S C;  1AOI B;  3UTA C;  4H9R A;  3X1U B;  5JA4 A;  3WAA D;  3REL A;  5BT1 D;  5CP6 C;  3KUY B;  2NZD C;  3MVD B;  3X1T A;  1P3M D;  1M18 A;  2F8N G;  4LD9 C;  3WKJ B;  2Y2M A;  5F99 A;  2L5A A;  2HIO D;  3KXB C;  3VH5 A;  4WU9 C;  3C1C C;  3KWQ B;  1P3K C;  3AZN C;  4Z66 A;  1P3F B;  4NE5 A;  1P3O C;  4XUJ C;  1P34 C;  4WNN A;  4H9P B;  3LEL B;  3REL D;  2W8S A;  1P3I B;  3MGP C;  3UT9 A;  1M1A B;  3X1T D;  1M18 D;  3MNN A;  1P34 B;  3MGP B;  2HUE B;  5BS7 C;  5F99 D;  5JRG B;  1F66 C;  5GT0 C;  3W99 B;  5B40 B;  3W97 A;  2G5H C;  2Y2L A;  2ARO C;  5B32 C;  3VH6 W;  3WTP E;  2PYO C;  2FJ7 B;  1U35 C;  2XD1 A;  5GSU A;  4YM6 A;  4Z66 D;  5BNV A;  3R45 A;  1P3L C;  3AYW B;  2NQB B;  3W96 C;  3X1V B;  3B6G A;  3UT9 D;  3NQJ A;  1TZY C;  3MNN D;  1P3L B;  5AY8 C;  1BH9 A;  3AN2 B;  4KGC C;  5CPJ A;  5B2I A;  1H3O B;  3AZE A;  1JFI B;  3WAA C;  3W97 D;  3WTP B;  1B67 A;  2UWX A;  5BT1 C;  1P3M C;  1EQZ B;  4KUD B;  3AFA B;  5GSU D;  4YM6 D;  2ZY3 A;  5KDM A;  1P3G B;  4JJN B;  2HIO C;  1WWS A;  3MGR A;  3B6G D;  3AV2 A;  5DNN A;  4G92 B;  5GXQ A;  5CPJ D;  5B2I D;  3A6N D;  3AZE D;  3AZJ A;  2BYM A;  4M6B A;  3AZH B;  2F8N H;  4J8X A;  3REL C;  5B33 B;  3VH6 A;  4X23 A;  5AVC B;  3B6F A;  1ZLA A;  3X1T C;  1S32 B;  1M18 C;  4J8U B;  5AV8 B;  4J8V A;  5GT3 B;  1F1E A;  5CPK A;  4QLC A;  5F99 C;  4G91 C;  5B1M B;  3MGR D;  4DQY B;  3AV2 D;  5DNN D;  4H9S A;  2J8P A;  5GXQ D;  3NQU B;  5E5A A;  5B31 B;  4WU8 B;  1HQ3 C;  1P3B A;  4Z66 C;  4ZUX B;  3B0D B;  3AZJ D;  3AV1 B;  1P3P A;  2DQN C;  1HQ3 B;  4J8X D;  4AWL C;  3UT9 C;  4X23 D;  3B6F D;  1ZLA D;  3MNN C;  3REK D;  5C3I C;  4J8V D;  1KX5 B;  5CPK D;  3AZG A;  4QLC D;  3W98 A;  2YFV B;  1P3A B;  3W97 C;  4R8P A;  3AZM B;  3REH A;  5B0Z B;  5E5A D;  2ZY4 A;  5B2J B;  3EPH A;  5GSU C;  4YM6 C;  3EPL A;  1P3B D;  1KX4 B;  3REI B;  4XZQ A;  4UUZ A;  5AV9 D;  2Y2Q A;  2CV5 A;  3WA9 B;  5B0Y B;  3B6G C;  3AZI A;  1KX3 B;  3EPK A;  1ID3 B;  5CPJ C;  1TAF A;  3LJA A;  5BO0 A;  5B2I C;  3AZG D;  4Z2M G;  3W98 D;  5B24 A;  3C1B A;  3AZE C;  2BYK B;  5AVB A;  5FUG A;  4Z5T A;  4R8P D;  3REH D;  5CPI B;  3TU4 B;  3KFU G;  3O62 A;  3VH5 T;  4WJ3 C;  4CSR B;  3X1S B;  3LZ0 A;  5CHL B;  3UTA B;  1R4V A;  2G5I C;  4XZQ D;  4H9Q A;  4WV4 B;  2CV5 D;  3AZF A;  5CP6 B;  2NZD B;  3MGR C;  3AZI D;  2F2A C;  3LZ1 A;  3AV2 C;  5DNN C;  4LD9 B;  5GXQ C;  1KU5 A;  3LJA D;  3A1I A;  3P5J B;  5AV6 A;  5B24 D;  3C1B D;  5B31 G;  3AZJ C;  5AVB D;  4Z5T D;  3KXB B;  4WU9 B;  4J8X C;  3C1C B;  4X23 C;  3O62 D;  3B6F C;  4H9O A;  1ZLA C;  3LZ0 D;  3MGS A;  1P3K B;  3AZN B;  4J8V C;  5CPK C;  4QLC C;  2F8N A;  1P3O B;  4XUJ B;  2IO5 C;  1T3U A;  3AZF D;  1HTA A;  3LZ1 D;  3FDD A;  1B6W A;  4H9S C;  5E5A C;  4CAY A;  3MGQ A;  3AZL A;  1P3B C;  1F66 B;  5AV6 D;  5GT0 B;  1N1J A;  4DRA A;  3REJ A;  1BH8 A;  1P3P C;  5B32 B;  2ARO B;  4KHA A;  2PYO B;  3AZK A;  1U35 B;  3MGS D;  1P3P B;  1M19 A;  5DNM C;  2VQR A;  3AZG C;  5G49 B;  2F8N D;  3W98 C;  5DNM B;  3W96 B;  4R8P C;  3UTB A;  3REH C;  1TZY B;  3A6N A;  5AY8 B;  4KGC B;  3MGQ D;  3AZL D;  2RVQ D;  4YS3 D;  5AV5 A;  4XZQ C;  3REJ D;  3WAA B;  2CV5 C;  3AZK D;  5B1L D;  1P3M B;  5BNX B;  3VH6 T;  3AZI C;  4WZS B;  1M19 D;  4E44 A;  3LJA C;  5B24 C;  3C1B C;  2HIO B;  4H9N A;  5AVB C;  4Z5T C;  3UTB D;  5BO0 B;  1AOI A;  3X1U A;  3O62 C;  4E45 A;  3LZ0 C;  4H9R B;  5JA4 B;  3KUY A;  5AV5 D;  2ZY5 A;  3MVD A;  1A7W A;  3REK A;  3REL B;  3AZF C;  3WKJ A;  4EO5 C;  3X1T B;  1M18 B;  3LZ1 C;  4J8W D;  3AZF B;  4NFT A;  3IP4 C;  5F99 B;  2YFW A;  5AV6 C;  4G91 B;  3KWQ A;  1AOI D;  3X1U D;  1P3F A;  5B32 G;  5AV9 A;  3MGS C;  4Z66 B;  4H9P A;  3LEL A;  1P3I A;  3KUY D;  3V9R A;  1M1A A;  3MVD D;  4WNN B;  4AWL B;  3UT9 B;  3WKJ D;  3MNN B;  5C3I B;  5JRG A;  3MGQ C;  5B40 A;  3W99 A;  3AZL C;  2RVQ C;  2DF4 C;  3AL0 C;  2ZY2 A;  3REJ C;  2FJ7 A;  3W97 B;  3KWQ D;  3AZK C;  1P3F D;  1BH8 B;  1M19 C;  5GSU B;  4YM6 B;  4NE6 A;  3AYW A;  3LEL D;  5BNV B;  3X1V A;  2NQB A;  1P3I D;  3R45 B;  1M1A D;  3AN2 A;  3UTB C;  3B6G B;  3NQJ B;  3MGP D;  3VH5 W;  1H3O A;  3B0C T;  3A6N C;  1BH9 B;  5JRG D;  5CPJ B;  3W99 D;  5B40 D;  5B2I B;  1JFI A;  1PZR A;  3A6N B;  3WTP A;  3AZE B;  5AV5 C;  2FJ7 D;  1EQZ A;  4KUD A;  3AFA A;  4ZBJ C;  1P3G A;  2Y2J A;  5KDM B;  3AYW D;  4JJN A;  2NQB D;  3X1V D;  4HGA C;  1P3L D;  3MGR B;  3AN2 D;  2Y2N A;  1AOI C;  2Y2K A;  3X1U C;  3AV2 B;  5DNN B;  5GXQ B;  3AZH A;  3WTP D;  3AZJ B;  5B33 A;  2BYM B;  3KUY C;  3KSY A;  5AVC A;  3MVD C;  3REK C;  1ULY A;  1S32 A;  4J8X B;  1EQZ D;  4KUD D;  3AFA D;  4J8U A;  5AV8 A;  4X23 B;  3B6F B;  5GT3 A;  1ZLA B;  3WKJ C;  4NE3 A;  1P3G D;  1Q9C A;  3REK B;  4J8V B;  3H0R C;  5CPK B;  3EG5 B;  4JJN D;  4QLC B;  5B1M A;  2IO5 B;  3KWQ C;  5B31 A;  3NQU A;  4YS3 A;  2YFW B;  4WU8 A;  1P3F C;  5E5A B;  4ZUX A;  2JCH A;  5AV9 C;  3AV1 A;  1P3B B;  4DRB A;  3AZH D;  1HQ3 A;  3LEL C;  5B1L A;  5B33 D;  1P3I C;  3A1K A;  5AV9 B;  5AVC D;  1M1A C;  1S32 D;  4J8U D;  5AV8 D;  1KX5 A;  5GT3 D;  3V9R B;  2HUE C;  2YFV A;  5JRG C;  1P3A A;  3W99 C;  5B40 C;  3AZG B;  3AZM A;  3W98 B;  5B1M D;  5B0Z A;  2FJ7 C;  4R8P B;  3REH B;  5B31 D;  5B2J A;  4WU8 D;  1KX4 A;  4ZUX D;  3REI A;  3AV1 D;  2Y2I A;  3WA9 A;  1HQ3 D;  5B0Y A;  4Z2M H;  2JE5 A;  4UUZ B;  4XZQ B;  3X1V C;  3AYW C;  2NQB C;  1Z2C B;  2CV5 B;  1KX3 A;  4J8W A;  3AN2 C;  1ID3 A;  1KX5 D;  1W2E A;  3AZI B;  2BYK A;  1TAF B;  1P3A D;  3LJA B;  3AZM D;  5CPI A;  5B24 B;  5B0Z D;  3WTP C;  3C1B B;  3TU4 A;  5AVB B;  5FUG B;  4Z5T B;  4CSR A;  3X1S A;  1EQZ C;  5B2J D;  3UTA A;  4KUD C;  3AFA C;  3O62 B;  1KX4 D;  1P3G C;  3LZ0 B;  3REI D;  3WA9 D;  5B0Y D;  4JJN C;  5CP6 A;  2NZD A;  2BG1 A;  4H9Q B;  1KX3 D;  4G92 C;  4LD9 A;  1ID3 D;  4EO5 B;  2Y2H A;  2F8N K;  3LZ1 B;  3KXB A;  3AZH C;  5CPI D;  5AV6 B;  4WU9 A;  3C1C A;  5B33 C;  3TU4 D;  5AVC C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...