1P3MD

Crystallographic studies of nucleosome core particles containing histone 'sin' mutants
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
92
structure length
92
Chain Sequence
KESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Palindromic 146bp Human Alpha-Satellite DNA fragment
publication title Crystal structures of histone Sin mutant nucleosomes reveal altered protein-DNA interactions
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 33
structure length 92
sequence length 92
chains with identical sequence H
ec nomenclature
pdb deposition date 2003-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1p3mD00
3O62C 5AVCB 3B0DB 3KXBD 5CPJC 5GSUB 3X1VB 1P3MC 3TU4D 4XZQD 2YFWA 3A6NB 4J8WA 3W98B 5GT3D 5AV6A 3W97A 4YM6C 4H9OA 5JA4B 3REKA 2NQBD 4G91C 4YS3C 4NE3A 3MGPB 1P3AC 1M19C 5AVBD 2LY8A 4WU8B 3AZNB 1P3FB 2JSSA 4J8WD 1P3GC 5DNMA 4H9SC 2BYMB 5AV6D 3MVDB 3AYWB 3AZGC 3AZFA 4KGCD 1P3OB 1M1AA 4Z2MH 3REHA 4HGAB 3UTBA 1BH9A 1B6WA 3WAAC 5AV9B 5B24C 2PYOA 4EO5B 3MGRB 4XUJA 4KUDB 3KSYA 3LELB 3VH5T 3B0DC 5GT0B 5GSUC 3X1VC 5JRGA 3AZFD 1S32B 5GXQA 3LZ0A 3A6NC 3AZMB 1M1AD 4J8VB 2HIOA 3REHD 1ZLAA 3UTBD 3R45A 3AZIA 2PYOD 1P34B 1JFIA 4XUJD 4WU8C 3AZNC 3VH6T 1P3FC 4LD9A 5JRGD 1ID3B 5GXQD 3LZ0D 5AV8A 1ZLAD 3AV1B 3MVDC 3REJB 3X1SB 3AYWC 4R8PB 3AZID 5CPKA 3NQUA 5KDMA 4HGAC 4H9RB 3B0CT 3MGQA 1KX5B 4LD9D 3AN2D 5B0ZA 4EO5C 3MGRC 5AV8D 4KUDC 1TAFB 3LELC 5B1LA 1S32C 1R4VA 3AZMC 4J8VC 5B32G 4DRAA 3LZ1B 3MGQD 5B31G 5B0ZD 1P34C 2CV5B 5C3IB 3MGSA 5B1LD 3UTAA 1ID3C 1TZYB 1HQ3B 3LJAB 4CAYB 1KX3B 4AWLB 5B1MB 1P3MA 3AV1C 4X23B 3X1SC 5B2JB 4R8PC 2IO5B 4WU9B 1U35B 1P3IB 3MGSD 4YS3A 5DNNB 1KX5C 3AZJB 2FJ7B 3UTAD 1M19A 4DRBA 4H9NA 2NZDB 4M6BA 1P3MD 5G49A 1P3LB 4H9SA 3AFAB 5B32B 2BYKA 3AZKB 4E45A 4E44A 3REIA 5B40B 4YS3D 3LZ1C 2CV5C 1M19D 5C3IC 3W99B 3WAAA 3AZEB 1TZYC 1HQ3C 3LJAC 3REID 1KX3C 4QLCB 4AWLC 5B1MC 5GSUA 5BS7A 3AZGD 1KX4B 4X23C 3A6NA 5B2JC 2IO5C 4WU9C 1U35C 4UUZA 2F8NK 1P3IC 2F8NA 3WAAD 5DNNC 4H9QB 3AZJC 2FJ7C 5AV5B 1F1EA 5CP6B 4WU8A 1P3FA 2NZDC 5GSUD 1P3KA 5CPIA 3A6ND 3WTPA 1P3LC 3AFAC 1H3OA 5B32C 3AZKC 3B6FB 5E5AB 3WA9A 5AVBA 5B40C 2F8ND 5B31C 2HUEB 4WNNA 4ZUXB 4WU8D 3W99C 3AZND 1P3BB 1P3FD 1P3KD 4JJNB 3AZEC 3X1TA 5CPID 5B0YA 3WTPD 4KGCA 5F99B 4Z5TC 3LELA 3AV2B 3WA9D 4QLCC 4H9PA 1KX4C 1N1JA 3AZMA 1P3PA 3X1UA 2YFVB 3WKJA 3X1TD 1P34A 5B0YD 2RVQD 5CHLB 3MGRD 3KWQA 5AV5C 1AOIA 5CP6C 3LELD 1ID3A 4Z2MG 3AZMD 2AROB 4J8VD 1P3PD 3X1UD 3RELB 1BH8B 3B6FC 5E5AC 3WKJD 5AVCC 4R8PA 1P34D 4CSRB 3KWQD 1AOID 2HUEC 4ZUXC 3W98C 1P3BC 2NQBB 4J8XA 4NE6A 4JJNC 1ID3D 5F99C 1TAFA 3MGPC 3KUYB 3AV2C 3V9RA 4R8PD 2YFWB 4J8WB 3AN2A 5B2IA 5BT1D 5AV6B 3W97B 1KX5D 4H9OB 4J8XD 3REKB 3AZLA 5BNXB 1P3OC 3W96A 2CWEA 2AROC 5AV9C 3LJAA 5DNMB 5B2ID 3RELC 1KX3A 5B1MA 3C1CA 5B2JA 3AZLD 5GT0C 2CV5D 1U35A 1M1AB 1P3IA 3REHB 1M18B 4Z66B 2NQBC 1BH9B 3W96D 1TZYD 2PYOB 3LJAD 1KX3D 4XUJB 5B1MD 3KUYC 3C1CD 5B2JD 5B32A 1BFMA 5GXQB 3LZ0B 4J8WC 1U35D 2HIOB 1P3ID 1A7WA 3O62A 1HTAA 3W97C 5B31A 5CPJA 3AZJD 3REKC 2FJ7D 3R45B 3REJC 1JFIB 3W99A 2NZDD 3AZEA 4YM6A 3AFAD 5B32D 4Z5TA 5DNMC 1P3AA 5AV8B 5BNVA 3O62D 4G92B 1KX4A 5B31D 5CPJD 4KHAA 1P3GA 3W99D 5CPKB 3NQUB 5KDMB 3REHC 1M18C 1EQZB 3AZED 4YM6D 4Z66C 3AZGA 2PYOC 5B0ZB 4Z5TD 3UT9B 1P3AD 4QLCD 4XUJC 1KX4D 5B24A 5B1LB 1P3GD 5FUGA 5GXQC 3LZ0C 2HIOC 3MNNB 5AVCA 3X1VA 5AV5D 4ZUXA 5CP6D 3W98A 4JJNA 5JA4A 5B24D 3UTAB 3MGPA 3B6FD 3B6GB 5AV8C 4G92C 5AVCD 3AZNA 3X1VD 4ZUXD 3W98D 2YFVA 2BYMA 5CPKC 1P3BD 1Q9CA 3VH5W 2F8NH 1EQZC 4JJND 3MVDA 3AYWA 1P3OA 5BO0B 5F99D 5B0ZC 3MGPD 3UT9C 4H9NB 3B0BA 4J8UB 5G49B 5AV9A 5B1LC 3RELA 3MGRA 2BYKB 4KUDA 3VH6W 3MNNC 3REIB 3MVDD 5GT0A 3AYWD 1S32A 5AY8B 1P3OD 4J8VA 3C1BB 5B33B 2AROD 5AV9D 3RELD 3UTAC 3KUYA 4KUDD 3B6GC 3B0CW 3NQJB 5GT0D 1S32D 3AZHB 1F66B 4UUZB 3AV1A 2F8NB 3REJA 3X1SA 3KXBB 5BNXA 3TU4B 4XZQB 3KUYD 5GT3B 4J8UC 4H9RA 1P3KB 5CPIB 1KX5A 4WV4B 3WTPB 1H3OB 3W97D 3REIC 3REKD 3WA9B 3AV1D 5AVBB 3REJD 3X1SD 5AY8C 1M18A 4WNNB 4Z66A 3C1BC 3LZ1A 5B33C 3X1TB 5B0YB 5DNMD 4KGCB 2CV5A 1WWSA 4H9PB 5BS7C 1N1JB 4WZSB 1TZYA 3X1UB 1P3PB 1HQ3A 3AZHC 1M18D 4CAYA 4Z66D 1F66C 3LZ1D 3WKJB 4X23A 3KXBC 3AZFB 3KWQB 4WU9A 3TU4C 1AOIB 4XZQC 5GT3C 5DNNA 3UTBB 1P3KC 5CPIC 3AZJA 2FJ7A 3WTPC 1ULYA 2HIOD 1HQ3D 2NZDA 3WA9C 5AVBC 4X23D 1P3LA 3AFAA 5JRGB 4WU9D 3AZKA 1EQZA 3VH5A 5B40A 5AV6C 4J8XB 5DNND 1ZLAB 3X1TC 1KU5A 2RVQC 5B0YC 3UT9A 4KGCC 3AZIB 3V9RB 1P3LD 4LD9B 5CPKD 3AN2B 3X1UC 1P3PC 5B2IB 3MNNA 3AZKD 1EQZD 3VH6A 4QLCA 5B40D 3WKJC 3AZLB 2L5AA 3UT9D 3AZFC 3KWQC 4NE5A 1AOIC 1M1AC 3UTBC 4H9QA 3W96B 3MGQB 5AV5A 4ZBJB 3B6GA 5CP6A 3MNND 3C1CB 5JRGC 3B6FA 5E5AA 5BT1C 1WWIA 4J8XC 1ZLAC 5BO0A 3B6GD 3AZIC 1P3BA 4J8UA 3MGSB 4LD9C 3AN2C 5F99A 5B2IC 3AV2A 3O62B 5E5AD 5B31B 5CPJB 5AY8A 1P3MB 3AZLC 3C1BA 5B33A 4J8UD 4YM6B 4G91B 4YS3B 1B67A 3W96C 2F8NG 3MGQC 3WTPE 4ZBJC 4Z5TB 1P3AB 3AV2D 3NQJA 1M19B 5BNVB 4KHAB 4NFTA 5AY8D 3C1CC 3AZHA 2AROA 1P3GB 1F66A 1BH8A 3C1BD 5B33D 3KXBA 3AZGB 3TU4A 4XZQA 4CSRA 5GT3A 2NQBA 3MGSC 3WAAB 5B24B 3AZHD 5FUGB 1F66D
chains in the Genus database with same CATH superfamily
3O62C 5AVCB 3B0DB 3KXBD 5CPJC 5GSUB 3X1VB 1P3MC 3TU4D 4XZQD 2YFWA 3A6NB 4J8WA 2Y2MA 3W98B 4DQYB 5GT3D 5AV6A 3W97A 4YM6C 4H9OA 5JA4B 3REKA 2NQBD 4G91C 4YS3C 4NE3A 4UPKA 3MGPB 1P3AC 1M19C 5AVBD 2LY8A 4WU8B 3AZNB 1P3FB 2JSSA 4J8WD 1P3GC 5DNMA 4H9SC 2BYMB 5AV6D 3MVDB 3AYWB 3AZGC 3AZFA 4KGCD 1P3OB 1M1AA 2G5HC 4Z2MH 3REHA 4HGAB 3UTBA 4WJ3C 1BH9A 1B6WA 3WAAC 5AV9B 5B24C 2PYOA 4EO5B 3MGRB 4XUJA 4KUDB 2DQNC 3KSYA 3LELB 3VH5T 3B0DC 5GT0B 1W2EA 5GSUC 3X1VC 5JRGA 3AZFD 5GXQA 3LZ0A 3A6NC 3AZMB 1S32B 4J8VB 1M1AD 2HIOA 3REHD 1ZLAA 3UTBD 3R45A 3AZIA 2PYOD 1P34B 1JFIA 2Y2OA 4XUJD 4WU8C 3AZNC 3VH6T 1P3FC 4LD9A 5JRGD 1ID3B 2UWXA 5GXQD 3LZ0D 3IP4C 5AV8A 1ZLAD 3AV1B 3MVDC 3REJB 3X1SB 3AYWC 4R8PB 3AZID 5CPKA 3NQUA 3H0LC 5KDMA 4HGAC 4H9RB 3B0CT 3MGQA 1KX5B 4LD9D 3AN2D 5B0ZA 3KFUG 4EO5C 3MGRC 5AV8D 4KUDC 1TAFB 3LELC 5B1LA 1S32C 1R4VA 2F2AC 3AZMC 4J8VC 5B32G 4DRAA 3LZ1B 3MGQD 2W8SA 5B31G 5B0ZD 1P34C 2CV5B 5C3IB 2Y2NA 3MGSA 5B1LD 3UTAA 1ID3C 1TZYB 1HQ3B 3LJAB 4CAYB 1KX3B 4AWLB 5B1MB 1P3MA 3AV1C 4X23B 3P5JB 3X1SC 5B2JB 4R8PC 2IO5B 4WU9B 1U35B 1P3IB 3MGSD 4YS3A 5DNNB 1KX5C 3AZJB 2FJ7B 3UTAD 1M19A 4DRBA 4H9NA 3H0RC 2NZDB 4M6BA 1P3MD 5G49A 1P3LB 4H9SA 3AFAB 5B32B 2BYKA 3AZKB 4E45A 4E44A 3REIA 5B40B 4YS3D 3LZ1C 2CV5C 1M19D 5C3IC 3W99B 3WAAA 3AZEB 1TZYC 1HQ3C 3LJAC 3REID 1KX3C 4QLCB 4AWLC 5B1MC 5GSUA 5BS7A 3AZGD 1KX4B 4X23C 3A6NA 5B2JC 2IO5C 4WU9C 1U35C 4UUZA 2F8NK 1P3IC 2F8NA 3WAAD 5DNNC 4H9QB 3AZJC 2FJ7C 5AV5B 1F1EA 5CP6B 4WU8A 1P3FA 2NZDC 5GSUD 1P3KA 5CPIA 3A6ND 3WTPA 1P3LC 3AFAC 1H3OA 5B32C 3AZKC 3B6FB 5E5AB 3WA9A 5AVBA 5B40C 2F8ND 5B31C 2HUEB 4WNNA 4ZUXB 4WU8D 3W99C 3AZND 1P3BB 1P3FD 1P3KD 4JJNB 3AZEC 3X1TA 5CPID 5B0YA 3WTPD 4KGCA 5F99B 4Z5TC 3LELA 3AV2B 3WA9D 4QLCC 4H9PA 1KX4C 1N1JA 3AZMA 1P3PA 3X1UA 2YFVB 3WKJA 3X1TD 1P34A 5B0YD 2RVQD 5CHLB 3MGRD 3KWQA 5AV5C 1AOIA 5CP6C 3LELD 1ID3A 4Z2MG 3AZMD 2AROB 4J8VD 1T3UA 3X1UD 1P3PD 3RELB 1BH8B 3B6FC 5E5AC 3WKJD 5AVCC 4R8PA 1P34D 4CSRB 3KWQD 1AOID 2HUEC 4ZUXC 3W98C 1P3BC 2Y2GA 2NQBB 4J8XA 4NE6A 4JJNC 1ID3D 5F99C 1TAFA 3MGPC 3KUYB 3AV2C 3V9RA 4R8PD 2YFWB 4J8WB 3AN2A 5B2IA 5BT1D 5AV6B 3W97B 1KX5D 4H9OB 4J8XD 3REKB 3AZLA 5BNXB 1P3OC 3W96A 2CWEA 2AROC 5AV9C 3LJAA 5DNMB 5B2ID 3RELC 2Y2LA 1KX3A 5B1MA 3C1CA 5B2JA 3AZLD 5GT0C 2CV5D 1U35A 1M1AB 1P3IA 3REHB 1M18B 4Z66B 2NQBC 1BH9B 3W96D 1TZYD 2PYOB 3LJAD 2ZY2A 1KX3D 4XUJB 5B1MD 3KUYC 3C1CD 5B2JD 5B32A 1BFMA 5GXQB 3LZ0B 4J8WC 1U35D 2HIOB 1P3ID 1A7WA 3O62A 1HTAA 3W97C 5B31A 5CPJA 3AZJD 3REKC 2FJ7D 3R45B 3REJC 1JFIB 3W99A 3A1IA 2NZDD 3AZEA 4YM6A 3AFAD 5B32D 4Z5TA 5DNMC 1P3AA 5AV8B 5BNVA 3O62D 4G92B 1KX4A 5B31D 5CPJD 4KHAA 1P3GA 3W99D 5CPKB 2JCHA 3NQUB 5KDMB 3EPKA 3REHC 3AZED 4YM6D 1M18C 4Z66C 1EQZB 3AZGA 2PYOC 5B0ZB 4Z5TD 3UT9B 1P3AD 2FFFB 3AL0C 2ZY4A 4QLCD 4XUJC 1KX4D 3EPHA 2VQRA 5B24A 5B1LB 1P3GD 5FUGA 5GXQC 3LZ0C 2HIOC 3MNNB 5AVCA 3F6TA 3X1VA 2Y2QA 5AV5D 4ZUXA 5CP6D 3W98A 2BG1A 2ZM5A 4JJNA 5JA4A 5B24D 3UTAB 3EPJA 3MGPA 3B6FD 3B6GB 5AV8C 2DF4C 4G92C 5AVCD 2JE5A 3AZNA 3X1VD 4ZUXD 2XD1A 2YFVA 2BYMA 5CPKC 1P3BD 1Q9CA 3W98D 3VH5W 2F8NH 1EQZC 4JJND 3MVDA 3A1KA 3AYWA 1P3OA 5BO0B 5F99D 5B0ZC 3MGPD 3UT9C 4H9NB 3B0BA 4J8UB 5G49B 5AV9A 5B1LC 3RELA 3MGRA 2BYKB 4KUDA 3VH6W 3MNNC 3REIB 3MVDD 5GT0A 3AYWD 1S32A 5AY8B 1P3OD 4J8VA 3C1BB 2Y2JA 5B33B 2AROD 5AV9D 3RELD 3UTAC 3KUYA 4KUDD 3B6GC 3B0CW 3NQJB 5GT0D 1S32D 3AZHB 1F66B 4UUZB 3AV1A 2F8NB 3REJA 3X1SA 3KXBB 5BNXA 3TU4B 4XZQB 3KUYD 5GT3B 4J8UC 4H9RA 1P3KB 5CPIB 1KX5A 4WV4B 2ZY5A 3WTPB 1H3OB 3W97D 3REIC 3REKD 3WA9B 3AV1D 5AVBB 1PZRA 3REJD 3X1SD 5AY8C 1M18A 4WNNB 4Z66A 3C1BC 3LZ1A 5B33C 3EG5B 3X1TB 5B0YB 5DNMD 4KGCB 2CV5A 1WWSA 2Y2IA 4H9PB 5BS7C 1N1JB 4WZSB 1TZYA 3X1UB 1P3PB 1HQ3A 3AZHC 1M18D 2Y2PA 4CAYA 4Z66D 1F66C 3LZ1D 3WKJB 4X23A 3KXBC 3AZFB 3KWQB 4WU9A 3TU4C 1AOIB 4XZQC 5GT3C 5DNNA 3UTBB 1P3KC 5CPIC 3AZJA 2FJ7A 3WTPC 1ULYA 2HIOD 1HQ3D 2NZDA 3FDDA 3WA9C 5AVBC 4X23D 1P3LA 3AFAA 5JRGB 4WU9D 3AZKA 1EQZA 3VH5A 5B40A 5AV6C 4J8XB 5DNND 1ZLAB 3X1TC 1KU5A 2RVQC 5B0YC 3UT9A 4KGCC 3AZIB 3V9RB 1P3LD 4LD9B 5CPKD 1Z2CB 3X1UC 3AN2B 1P3PC 5B2IB 3MNNA 3AZKD 1EQZD 3VH6A 2Y2HA 4QLCA 5B40D 3WKJC 3H0MC 3AZLB 2L5AA 3UT9D 3AZFC 3KWQC 4NE5A 1AOIC 1M1AC 2G5IC 3EPLA 3UTBC 4H9QA 3W96B 3MGQB 5AV5A 4ZBJB 3B6GA 5CP6A 3MNND 3C1CB 5JRGC 3B6FA 5E5AA 5BT1C 1WWIA 4J8XC 1ZLAC 5BO0A 3B6GD 3AZIC 1P3BA 4J8UA 3MGSB 4LD9C 3AN2C 5F99A 5B2IC 3AV2A 3O62B 5E5AD 5B31B 2XD5A 5CPJB 5AY8A 1P3MB 3AZLC 3C1BA 2J8PA 5B33A 4J8UD 4YM6B 4G91B 4YS3B 1B67A 3W96C 2F8NG 3MGQC 3WTPE 4ZBJC 4Z5TB 1P3AB 3AV2D 3NQJA 1M19B 5BNVB 4KHAB 4NFTA 5AY8D 3C1CC 3AZHA 2AROA 1P3GB 1F66A 1BH8A 3C1BD 5B33D 3KXBA 3AZGB 3TU4A 4XZQA 4CSRA 2Y2KA 2RIQA 5GT3A 2NQBA 3MGSC 3WAAB 5B24B 3AZHD 5FUGB 1F66D 2ZY3A
chains in the Genus database with same CATH topology
3O62C 5AVCB 3B0DB 3KXBD 5CPJC 5GSUB 3X1VB 1P3MC 3TU4D 4XZQD 2YFWA 3A6NB 4J8WA 2Y2MA 3W98B 4DQYB 5GT3D 5AV6A 3W97A 4YM6C 4H9OA 5JA4B 3REKA 2NQBD 4G91C 4YS3C 4NE3A 4UPKA 3MGPB 1P3AC 1M19C 5AVBD 2LY8A 4WU8B 3AZNB 1P3FB 2JSSA 4J8WD 1P3GC 5DNMA 4H9SC 2BYMB 5AV6D 3MVDB 3AYWB 3AZGC 3AZFA 4KGCD 1P3OB 1M1AA 2G5HC 4Z2MH 3REHA 4HGAB 3UTBA 4WJ3C 1BH9A 1B6WA 3WAAC 5AV9B 5B24C 2PYOA 4EO5B 3MGRB 4XUJA 4KUDB 2DQNC 3KSYA 3LELB 3VH5T 3B0DC 5GT0B 1W2EA 5GSUC 3X1VC 5JRGA 3AZFD 5GXQA 3LZ0A 3A6NC 3AZMB 1S32B 4J8VB 1M1AD 2HIOA 3REHD 1ZLAA 3UTBD 3R45A 3AZIA 2PYOD 1P34B 1JFIA 2Y2OA 4XUJD 4WU8C 3AZNC 3VH6T 1P3FC 4LD9A 5JRGD 1ID3B 2UWXA 5GXQD 3LZ0D 3IP4C 5AV8A 1ZLAD 3AV1B 3MVDC 3REJB 3X1SB 3AYWC 4R8PB 3AZID 5CPKA 3NQUA 3H0LC 5KDMA 4HGAC 4H9RB 3B0CT 3MGQA 1KX5B 4LD9D 3AN2D 5B0ZA 3KFUG 4EO5C 3MGRC 5AV8D 4KUDC 1TAFB 3LELC 5B1LA 1S32C 1R4VA 2F2AC 3AZMC 4J8VC 5B32G 4DRAA 3LZ1B 3MGQD 2W8SA 5B31G 5B0ZD 1P34C 2CV5B 5C3IB 2Y2NA 3MGSA 5B1LD 3UTAA 1ID3C 1TZYB 1HQ3B 3LJAB 4CAYB 1KX3B 4AWLB 5B1MB 1P3MA 3AV1C 4X23B 3P5JB 3X1SC 5B2JB 4R8PC 2IO5B 4WU9B 1U35B 1P3IB 3MGSD 4YS3A 5DNNB 1KX5C 3AZJB 2FJ7B 3UTAD 1M19A 4DRBA 4H9NA 3H0RC 2NZDB 4M6BA 1P3MD 5G49A 1P3LB 4H9SA 3AFAB 5B32B 2BYKA 3AZKB 4E45A 4E44A 3REIA 5B40B 4YS3D 3LZ1C 2CV5C 1M19D 5C3IC 3W99B 3WAAA 3AZEB 1TZYC 1HQ3C 3LJAC 3REID 1KX3C 4QLCB 4AWLC 5B1MC 5GSUA 5BS7A 3AZGD 1KX4B 4X23C 3A6NA 5B2JC 2IO5C 4WU9C 1U35C 4UUZA 2F8NK 1P3IC 2F8NA 3WAAD 5DNNC 4H9QB 3AZJC 2FJ7C 5AV5B 1F1EA 5CP6B 4WU8A 1P3FA 2NZDC 5GSUD 1P3KA 5CPIA 3A6ND 3WTPA 1P3LC 3AFAC 1H3OA 5B32C 3AZKC 3B6FB 5E5AB 3WA9A 5AVBA 5B40C 2F8ND 5B31C 2HUEB 4WNNA 4ZUXB 4WU8D 3W99C 3AZND 1P3BB 1P3FD 1P3KD 4JJNB 3AZEC 3X1TA 5CPID 5B0YA 3WTPD 4KGCA 5F99B 4Z5TC 3LELA 3AV2B 3WA9D 4QLCC 4H9PA 1KX4C 1N1JA 3AZMA 1P3PA 3X1UA 2YFVB 3WKJA 3X1TD 1P34A 5B0YD 2RVQD 5CHLB 3MGRD 3KWQA 5AV5C 1AOIA 5CP6C 3LELD 1ID3A 4Z2MG 3AZMD 2AROB 4J8VD 1T3UA 3X1UD 1P3PD 3RELB 1BH8B 3B6FC 5E5AC 3WKJD 5AVCC 4R8PA 1P34D 4CSRB 3KWQD 1AOID 2HUEC 4ZUXC 3W98C 1P3BC 2Y2GA 2NQBB 4J8XA 4NE6A 4JJNC 1ID3D 5F99C 1TAFA 3MGPC 3KUYB 3AV2C 3V9RA 4R8PD 2YFWB 4J8WB 3AN2A 5B2IA 5BT1D 5AV6B 3W97B 1KX5D 4H9OB 4J8XD 3REKB 3AZLA 5BNXB 1P3OC 3W96A 2CWEA 2AROC 5AV9C 3LJAA 5DNMB 5B2ID 3RELC 2Y2LA 1KX3A 5B1MA 3C1CA 5B2JA 3AZLD 5GT0C 2CV5D 1U35A 1M1AB 1P3IA 3REHB 1M18B 4Z66B 2NQBC 1BH9B 3W96D 1TZYD 2PYOB 3LJAD 2ZY2A 1KX3D 4XUJB 5B1MD 3KUYC 3C1CD 5B2JD 5B32A 1BFMA 5GXQB 3LZ0B 4J8WC 1U35D 2HIOB 1P3ID 1A7WA 3O62A 1HTAA 3W97C 5B31A 5CPJA 3AZJD 3REKC 2FJ7D 3R45B 3REJC 1JFIB 3W99A 3A1IA 2NZDD 3AZEA 4YM6A 3AFAD 5B32D 4Z5TA 5DNMC 1P3AA 5AV8B 5BNVA 3O62D 4G92B 1KX4A 5B31D 5CPJD 4KHAA 1P3GA 3W99D 5CPKB 2JCHA 3NQUB 5KDMB 3EPKA 3REHC 3AZED 4YM6D 1M18C 4Z66C 1EQZB 3AZGA 2PYOC 5B0ZB 4Z5TD 3UT9B 1P3AD 2FFFB 3AL0C 2ZY4A 4QLCD 4XUJC 1KX4D 3EPHA 2VQRA 5B24A 5B1LB 1P3GD 5FUGA 5GXQC 3LZ0C 2HIOC 3MNNB 5AVCA 3F6TA 3X1VA 2Y2QA 5AV5D 4ZUXA 5CP6D 3W98A 2BG1A 2ZM5A 4JJNA 5JA4A 5B24D 3UTAB 3EPJA 3MGPA 3B6FD 3B6GB 5AV8C 2DF4C 4G92C 5AVCD 2JE5A 3AZNA 3X1VD 4ZUXD 2XD1A 2YFVA 2BYMA 5CPKC 1P3BD 1Q9CA 3W98D 3VH5W 2F8NH 1EQZC 4JJND 3MVDA 3A1KA 3AYWA 1P3OA 5BO0B 5F99D 5B0ZC 3MGPD 3UT9C 4H9NB 3B0BA 4J8UB 5G49B 5AV9A 5B1LC 3RELA 3MGRA 2BYKB 4KUDA 3VH6W 3MNNC 3REIB 3MVDD 5GT0A 3AYWD 1S32A 5AY8B 1P3OD 4J8VA 3C1BB 2Y2JA 5B33B 2AROD 5AV9D 3RELD 3UTAC 3KUYA 4KUDD 3B6GC 3B0CW 3NQJB 5GT0D 1S32D 3AZHB 1F66B 4UUZB 3AV1A 2F8NB 3REJA 3X1SA 3KXBB 5BNXA 3TU4B 4XZQB 3KUYD 5GT3B 4J8UC 4H9RA 1P3KB 5CPIB 1KX5A 4WV4B 2ZY5A 3WTPB 1H3OB 3W97D 3REIC 3REKD 3WA9B 3AV1D 5AVBB 1PZRA 3REJD 3X1SD 5AY8C 1M18A 4WNNB 4Z66A 3C1BC 3LZ1A 5B33C 3EG5B 3X1TB 5B0YB 5DNMD 4KGCB 2CV5A 1WWSA 2Y2IA 4H9PB 5BS7C 1N1JB 4WZSB 1TZYA 3X1UB 1P3PB 1HQ3A 3AZHC 1M18D 2Y2PA 4CAYA 4Z66D 1F66C 3LZ1D 3WKJB 4X23A 3KXBC 3AZFB 3KWQB 4WU9A 3TU4C 1AOIB 4XZQC 5GT3C 5DNNA 3UTBB 1P3KC 5CPIC 3AZJA 2FJ7A 3WTPC 1ULYA 2HIOD 1HQ3D 2NZDA 3FDDA 3WA9C 5AVBC 4X23D 1P3LA 3AFAA 5JRGB 4WU9D 3AZKA 1EQZA 3VH5A 5B40A 5AV6C 4J8XB 5DNND 1ZLAB 3X1TC 1KU5A 2RVQC 5B0YC 3UT9A 4KGCC 3AZIB 3V9RB 1P3LD 4LD9B 5CPKD 1Z2CB 3X1UC 3AN2B 1P3PC 5B2IB 3MNNA 3AZKD 1EQZD 3VH6A 2Y2HA 4QLCA 5B40D 3WKJC 3H0MC 3AZLB 2L5AA 3UT9D 3AZFC 3KWQC 4NE5A 1AOIC 1M1AC 2G5IC 3EPLA 3UTBC 4H9QA 3W96B 3MGQB 5AV5A 4ZBJB 3B6GA 5CP6A 3MNND 3C1CB 5JRGC 3B6FA 5E5AA 5BT1C 1WWIA 4J8XC 1ZLAC 5BO0A 3B6GD 3AZIC 1P3BA 4J8UA 3MGSB 4LD9C 3AN2C 5F99A 5B2IC 3AV2A 3O62B 5E5AD 5B31B 2XD5A 5CPJB 5AY8A 1P3MB 3AZLC 3C1BA 2J8PA 5B33A 4J8UD 4YM6B 4G91B 4YS3B 1B67A 3W96C 2F8NG 3MGQC 3WTPE 4ZBJC 4Z5TB 1P3AB 3AV2D 3NQJA 1M19B 5BNVB 4KHAB 4NFTA 5AY8D 3C1CC 3AZHA 2AROA 1P3GB 1F66A 1BH8A 3C1BD 5B33D 3KXBA 3AZGB 3TU4A 4XZQA 4CSRA 2Y2KA 2RIQA 5GT3A 2NQBA 3MGSC 3WAAB 5B24B 3AZHD 5FUGB 1F66D 2ZY3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3O62 C;  5AVC B;  3B0D B;  3KXB D;  5CPJ C;  5GSU B;  3X1V B;  1P3M C;  3TU4 D;  4XZQ D;  2YFW A;  3A6N B;  4J8W A;  3W98 B;  5GT3 D;  5AV6 A;  3W97 A;  4YM6 C;  4H9O A;  5JA4 B;  3REK A;  2NQB D;  4G91 C;  4YS3 C;  4NE3 A;  3MGP B;  1P3A C;  1M19 C;  5AVB D;  2LY8 A;  4WU8 B;  3AZN B;  1P3F B;  2JSS A;  4J8W D;  1P3G C;  5DNM A;  4H9S C;  2BYM B;  5AV6 D;  3MVD B;  3AYW B;  3AZG C;  3AZF A;  4KGC D;  1P3O B;  1M1A A;  4Z2M H;  3REH A;  4HGA B;  3UTB A;  1BH9 A;  1B6W A;  3WAA C;  5AV9 B;  5B24 C;  2PYO A;  4EO5 B;  3MGR B;  4XUJ A;  4KUD B;  3KSY A;  3LEL B;  3VH5 T;  3B0D C;  5GT0 B;  5GSU C;  3X1V C;  5JRG A;  3AZF D;  1S32 B;  5GXQ A;  3LZ0 A;  3A6N C;  3AZM B;  1M1A D;  4J8V B;  2HIO A;  3REH D;  1ZLA A;  3UTB D;  3R45 A;  3AZI A;  2PYO D;  1P34 B;  1JFI A;  4XUJ D;  4WU8 C;  3AZN C;  3VH6 T;  1P3F C;  4LD9 A;  5JRG D;  1ID3 B;  5GXQ D;  3LZ0 D;  5AV8 A;  1ZLA D;  3AV1 B;  3MVD C;  3REJ B;  3X1S B;  3AYW C;  4R8P B;  3AZI D;  5CPK A;  3NQU A;  5KDM A;  4HGA C;  4H9R B;  3B0C T;  3MGQ A;  1KX5 B;  4LD9 D;  3AN2 D;  5B0Z A;  4EO5 C;  3MGR C;  5AV8 D;  4KUD C;  1TAF B;  3LEL C;  5B1L A;  1S32 C;  1R4V A;  3AZM C;  4J8V C;  5B32 G;  4DRA A;  3LZ1 B;  3MGQ D;  5B31 G;  5B0Z D;  1P34 C;  2CV5 B;  5C3I B;  3MGS A;  5B1L D;  3UTA A;  1ID3 C;  1TZY B;  1HQ3 B;  3LJA B;  4CAY B;  1KX3 B;  4AWL B;  5B1M B;  1P3M A;  3AV1 C;  4X23 B;  3X1S C;  5B2J B;  4R8P C;  2IO5 B;  4WU9 B;  1U35 B;  1P3I B;  3MGS D;  4YS3 A;  5DNN B;  1KX5 C;  3AZJ B;  2FJ7 B;  3UTA D;  1M19 A;  4DRB A;  4H9N A;  2NZD B;  4M6B A;  1P3M D;  5G49 A;  1P3L B;  4H9S A;  3AFA B;  5B32 B;  2BYK A;  3AZK B;  4E45 A;  4E44 A;  3REI A;  5B40 B;  4YS3 D;  3LZ1 C;  2CV5 C;  1M19 D;  5C3I C;  3W99 B;  3WAA A;  3AZE B;  1TZY C;  1HQ3 C;  3LJA C;  3REI D;  1KX3 C;  4QLC B;  4AWL C;  5B1M C;  5GSU A;  5BS7 A;  3AZG D;  1KX4 B;  4X23 C;  3A6N A;  5B2J C;  2IO5 C;  4WU9 C;  1U35 C;  4UUZ A;  2F8N K;  1P3I C;  2F8N A;  3WAA D;  5DNN C;  4H9Q B;  3AZJ C;  2FJ7 C;  5AV5 B;  1F1E A;  5CP6 B;  4WU8 A;  1P3F A;  2NZD C;  5GSU D;  1P3K A;  5CPI A;  3A6N D;  3WTP A;  1P3L C;  3AFA C;  1H3O A;  5B32 C;  3AZK C;  3B6F B;  5E5A B;  3WA9 A;  5AVB A;  5B40 C;  2F8N D;  5B31 C;  2HUE B;  4WNN A;  4ZUX B;  4WU8 D;  3W99 C;  3AZN D;  1P3B B;  1P3F D;  1P3K D;  4JJN B;  3AZE C;  3X1T A;  5CPI D;  5B0Y A;  3WTP D;  4KGC A;  5F99 B;  4Z5T C;  3LEL A;  3AV2 B;  3WA9 D;  4QLC C;  4H9P A;  1KX4 C;  1N1J A;  3AZM A;  1P3P A;  3X1U A;  2YFV B;  3WKJ A;  3X1T D;  1P34 A;  5B0Y D;  2RVQ D;  5CHL B;  3MGR D;  3KWQ A;  5AV5 C;  1AOI A;  5CP6 C;  3LEL D;  1ID3 A;  4Z2M G;  3AZM D;  2ARO B;  4J8V D;  1P3P D;  3X1U D;  3REL B;  1BH8 B;  3B6F C;  5E5A C;  3WKJ D;  5AVC C;  4R8P A;  1P34 D;  4CSR B;  3KWQ D;  1AOI D;  2HUE C;  4ZUX C;  3W98 C;  1P3B C;  2NQB B;  4J8X A;  4NE6 A;  4JJN C;  1ID3 D;  5F99 C;  1TAF A;  3MGP C;  3KUY B;  3AV2 C;  3V9R A;  4R8P D;  2YFW B;  4J8W B;  3AN2 A;  5B2I A;  5BT1 D;  5AV6 B;  3W97 B;  1KX5 D;  4H9O B;  4J8X D;  3REK B;  3AZL A;  5BNX B;  1P3O C;  3W96 A;  2CWE A;  2ARO C;  5AV9 C;  3LJA A;  5DNM B;  5B2I D;  3REL C;  1KX3 A;  5B1M A;  3C1C A;  5B2J A;  3AZL D;  5GT0 C;  2CV5 D;  1U35 A;  1M1A B;  1P3I A;  3REH B;  1M18 B;  4Z66 B;  2NQB C;  1BH9 B;  3W96 D;  1TZY D;  2PYO B;  3LJA D;  1KX3 D;  4XUJ B;  5B1M D;  3KUY C;  3C1C D;  5B2J D;  5B32 A;  1BFM A;  5GXQ B;  3LZ0 B;  4J8W C;  1U35 D;  2HIO B;  1P3I D;  1A7W A;  3O62 A;  1HTA A;  3W97 C;  5B31 A;  5CPJ A;  3AZJ D;  3REK C;  2FJ7 D;  3R45 B;  3REJ C;  1JFI B;  3W99 A;  2NZD D;  3AZE A;  4YM6 A;  3AFA D;  5B32 D;  4Z5T A;  5DNM C;  1P3A A;  5AV8 B;  5BNV A;  3O62 D;  4G92 B;  1KX4 A;  5B31 D;  5CPJ D;  4KHA A;  1P3G A;  3W99 D;  5CPK B;  3NQU B;  5KDM B;  3REH C;  1M18 C;  1EQZ B;  3AZE D;  4YM6 D;  4Z66 C;  3AZG A;  2PYO C;  5B0Z B;  4Z5T D;  3UT9 B;  1P3A D;  4QLC D;  4XUJ C;  1KX4 D;  5B24 A;  5B1L B;  1P3G D;  5FUG A;  5GXQ C;  3LZ0 C;  2HIO C;  3MNN B;  5AVC A;  3X1V A;  5AV5 D;  4ZUX A;  5CP6 D;  3W98 A;  4JJN A;  5JA4 A;  5B24 D;  3UTA B;  3MGP A;  3B6F D;  3B6G B;  5AV8 C;  4G92 C;  5AVC D;  3AZN A;  3X1V D;  4ZUX D;  3W98 D;  2YFV A;  2BYM A;  5CPK C;  1P3B D;  1Q9C A;  3VH5 W;  2F8N H;  1EQZ C;  4JJN D;  3MVD A;  3AYW A;  1P3O A;  5BO0 B;  5F99 D;  5B0Z C;  3MGP D;  3UT9 C;  4H9N B;  3B0B A;  4J8U B;  5G49 B;  5AV9 A;  5B1L C;  3REL A;  3MGR A;  2BYK B;  4KUD A;  3VH6 W;  3MNN C;  3REI B;  3MVD D;  5GT0 A;  3AYW D;  1S32 A;  5AY8 B;  1P3O D;  4J8V A;  3C1B B;  5B33 B;  2ARO D;  5AV9 D;  3REL D;  3UTA C;  3KUY A;  4KUD D;  3B6G C;  3B0C W;  3NQJ B;  5GT0 D;  1S32 D;  3AZH B;  1F66 B;  4UUZ B;  3AV1 A;  2F8N B;  3REJ A;  3X1S A;  3KXB B;  5BNX A;  3TU4 B;  4XZQ B;  3KUY D;  5GT3 B;  4J8U C;  4H9R A;  1P3K B;  5CPI B;  1KX5 A;  4WV4 B;  3WTP B;  1H3O B;  3W97 D;  3REI C;  3REK D;  3WA9 B;  3AV1 D;  5AVB B;  3REJ D;  3X1S D;  5AY8 C;  1M18 A;  4WNN B;  4Z66 A;  3C1B C;  3LZ1 A;  5B33 C;  3X1T B;  5B0Y B;  5DNM D;  4KGC B;  2CV5 A;  1WWS A;  4H9P B;  5BS7 C;  1N1J B;  4WZS B;  1TZY A;  3X1U B;  1P3P B;  1HQ3 A;  3AZH C;  1M18 D;  4CAY A;  4Z66 D;  1F66 C;  3LZ1 D;  3WKJ B;  4X23 A;  3KXB C;  3AZF B;  3KWQ B;  4WU9 A;  3TU4 C;  1AOI B;  4XZQ C;  5GT3 C;  5DNN A;  3UTB B;  1P3K C;  5CPI C;  3AZJ A;  2FJ7 A;  3WTP C;  1ULY A;  2HIO D;  1HQ3 D;  2NZD A;  3WA9 C;  5AVB C;  4X23 D;  1P3L A;  3AFA A;  5JRG B;  4WU9 D;  3AZK A;  1EQZ A;  3VH5 A;  5B40 A;  5AV6 C;  4J8X B;  5DNN D;  1ZLA B;  3X1T C;  1KU5 A;  2RVQ C;  5B0Y C;  3UT9 A;  4KGC C;  3AZI B;  3V9R B;  1P3L D;  4LD9 B;  5CPK D;  3AN2 B;  3X1U C;  1P3P C;  5B2I B;  3MNN A;  3AZK D;  1EQZ D;  3VH6 A;  4QLC A;  5B40 D;  3WKJ C;  3AZL B;  2L5A A;  3UT9 D;  3AZF C;  3KWQ C;  4NE5 A;  1AOI C;  1M1A C;  3UTB C;  4H9Q A;  3W96 B;  3MGQ B;  5AV5 A;  4ZBJ B;  3B6G A;  5CP6 A;  3MNN D;  3C1C B;  5JRG C;  3B6F A;  5E5A A;  5BT1 C;  1WWI A;  4J8X C;  1ZLA C;  5BO0 A;  3B6G D;  3AZI C;  1P3B A;  4J8U A;  3MGS B;  4LD9 C;  3AN2 C;  5F99 A;  5B2I C;  3AV2 A;  3O62 B;  5E5A D;  5B31 B;  5CPJ B;  5AY8 A;  1P3M B;  3AZL C;  3C1B A;  5B33 A;  4J8U D;  4YM6 B;  4G91 B;  4YS3 B;  1B67 A;  3W96 C;  2F8N G;  3MGQ C;  3WTP E;  4ZBJ C;  4Z5T B;  1P3A B;  3AV2 D;  3NQJ A;  1M19 B;  5BNV B;  4KHA B;  4NFT A;  5AY8 D;  3C1C C;  3AZH A;  2ARO A;  1P3G B;  1F66 A;  1BH8 A;  3C1B D;  5B33 D;  3KXB A;  3AZG B;  3TU4 A;  4XZQ A;  4CSR A;  5GT3 A;  2NQB A;  3MGS C;  3WAA B;  5B24 B;  3AZH D;  5FUG B;  1F66 D; 
#chains in the Genus database with same CATH topology
 3O62 C;  5AVC B;  3B0D B;  3KXB D;  5CPJ C;  5GSU B;  3X1V B;  1P3M C;  3TU4 D;  4XZQ D;  2YFW A;  3A6N B;  4J8W A;  2Y2M A;  3W98 B;  4DQY B;  5GT3 D;  5AV6 A;  3W97 A;  4YM6 C;  4H9O A;  5JA4 B;  3REK A;  2NQB D;  4G91 C;  4YS3 C;  4NE3 A;  4UPK A;  3MGP B;  1P3A C;  1M19 C;  5AVB D;  2LY8 A;  4WU8 B;  3AZN B;  1P3F B;  2JSS A;  4J8W D;  1P3G C;  5DNM A;  4H9S C;  2BYM B;  5AV6 D;  3MVD B;  3AYW B;  3AZG C;  3AZF A;  4KGC D;  1P3O B;  1M1A A;  2G5H C;  4Z2M H;  3REH A;  4HGA B;  3UTB A;  4WJ3 C;  1BH9 A;  1B6W A;  3WAA C;  5AV9 B;  5B24 C;  2PYO A;  4EO5 B;  3MGR B;  4XUJ A;  4KUD B;  2DQN C;  3KSY A;  3LEL B;  3VH5 T;  3B0D C;  5GT0 B;  1W2E A;  5GSU C;  3X1V C;  5JRG A;  3AZF D;  5GXQ A;  3LZ0 A;  3A6N C;  3AZM B;  1S32 B;  4J8V B;  1M1A D;  2HIO A;  3REH D;  1ZLA A;  3UTB D;  3R45 A;  3AZI A;  2PYO D;  1P34 B;  1JFI A;  2Y2O A;  4XUJ D;  4WU8 C;  3AZN C;  3VH6 T;  1P3F C;  4LD9 A;  5JRG D;  1ID3 B;  2UWX A;  5GXQ D;  3LZ0 D;  3IP4 C;  5AV8 A;  1ZLA D;  3AV1 B;  3MVD C;  3REJ B;  3X1S B;  3AYW C;  4R8P B;  3AZI D;  5CPK A;  3NQU A;  3H0L C;  5KDM A;  4HGA C;  4H9R B;  3B0C T;  3MGQ A;  1KX5 B;  4LD9 D;  3AN2 D;  5B0Z A;  3KFU G;  4EO5 C;  3MGR C;  5AV8 D;  4KUD C;  1TAF B;  3LEL C;  5B1L A;  1S32 C;  1R4V A;  2F2A C;  3AZM C;  4J8V C;  5B32 G;  4DRA A;  3LZ1 B;  3MGQ D;  2W8S A;  5B31 G;  5B0Z D;  1P34 C;  2CV5 B;  5C3I B;  2Y2N A;  3MGS A;  5B1L D;  3UTA A;  1ID3 C;  1TZY B;  1HQ3 B;  3LJA B;  4CAY B;  1KX3 B;  4AWL B;  5B1M B;  1P3M A;  3AV1 C;  4X23 B;  3P5J B;  3X1S C;  5B2J B;  4R8P C;  2IO5 B;  4WU9 B;  1U35 B;  1P3I B;  3MGS D;  4YS3 A;  5DNN B;  1KX5 C;  3AZJ B;  2FJ7 B;  3UTA D;  1M19 A;  4DRB A;  4H9N A;  3H0R C;  2NZD B;  4M6B A;  1P3M D;  5G49 A;  1P3L B;  4H9S A;  3AFA B;  5B32 B;  2BYK A;  3AZK B;  4E45 A;  4E44 A;  3REI A;  5B40 B;  4YS3 D;  3LZ1 C;  2CV5 C;  1M19 D;  5C3I C;  3W99 B;  3WAA A;  3AZE B;  1TZY C;  1HQ3 C;  3LJA C;  3REI D;  1KX3 C;  4QLC B;  4AWL C;  5B1M C;  5GSU A;  5BS7 A;  3AZG D;  1KX4 B;  4X23 C;  3A6N A;  5B2J C;  2IO5 C;  4WU9 C;  1U35 C;  4UUZ A;  2F8N K;  1P3I C;  2F8N A;  3WAA D;  5DNN C;  4H9Q B;  3AZJ C;  2FJ7 C;  5AV5 B;  1F1E A;  5CP6 B;  4WU8 A;  1P3F A;  2NZD C;  5GSU D;  1P3K A;  5CPI A;  3A6N D;  3WTP A;  1P3L C;  3AFA C;  1H3O A;  5B32 C;  3AZK C;  3B6F B;  5E5A B;  3WA9 A;  5AVB A;  5B40 C;  2F8N D;  5B31 C;  2HUE B;  4WNN A;  4ZUX B;  4WU8 D;  3W99 C;  3AZN D;  1P3B B;  1P3F D;  1P3K D;  4JJN B;  3AZE C;  3X1T A;  5CPI D;  5B0Y A;  3WTP D;  4KGC A;  5F99 B;  4Z5T C;  3LEL A;  3AV2 B;  3WA9 D;  4QLC C;  4H9P A;  1KX4 C;  1N1J A;  3AZM A;  1P3P A;  3X1U A;  2YFV B;  3WKJ A;  3X1T D;  1P34 A;  5B0Y D;  2RVQ D;  5CHL B;  3MGR D;  3KWQ A;  5AV5 C;  1AOI A;  5CP6 C;  3LEL D;  1ID3 A;  4Z2M G;  3AZM D;  2ARO B;  4J8V D;  1T3U A;  3X1U D;  1P3P D;  3REL B;  1BH8 B;  3B6F C;  5E5A C;  3WKJ D;  5AVC C;  4R8P A;  1P34 D;  4CSR B;  3KWQ D;  1AOI D;  2HUE C;  4ZUX C;  3W98 C;  1P3B C;  2Y2G A;  2NQB B;  4J8X A;  4NE6 A;  4JJN C;  1ID3 D;  5F99 C;  1TAF A;  3MGP C;  3KUY B;  3AV2 C;  3V9R A;  4R8P D;  2YFW B;  4J8W B;  3AN2 A;  5B2I A;  5BT1 D;  5AV6 B;  3W97 B;  1KX5 D;  4H9O B;  4J8X D;  3REK B;  3AZL A;  5BNX B;  1P3O C;  3W96 A;  2CWE A;  2ARO C;  5AV9 C;  3LJA A;  5DNM B;  5B2I D;  3REL C;  2Y2L A;  1KX3 A;  5B1M A;  3C1C A;  5B2J A;  3AZL D;  5GT0 C;  2CV5 D;  1U35 A;  1M1A B;  1P3I A;  3REH B;  1M18 B;  4Z66 B;  2NQB C;  1BH9 B;  3W96 D;  1TZY D;  2PYO B;  3LJA D;  2ZY2 A;  1KX3 D;  4XUJ B;  5B1M D;  3KUY C;  3C1C D;  5B2J D;  5B32 A;  1BFM A;  5GXQ B;  3LZ0 B;  4J8W C;  1U35 D;  2HIO B;  1P3I D;  1A7W A;  3O62 A;  1HTA A;  3W97 C;  5B31 A;  5CPJ A;  3AZJ D;  3REK C;  2FJ7 D;  3R45 B;  3REJ C;  1JFI B;  3W99 A;  3A1I A;  2NZD D;  3AZE A;  4YM6 A;  3AFA D;  5B32 D;  4Z5T A;  5DNM C;  1P3A A;  5AV8 B;  5BNV A;  3O62 D;  4G92 B;  1KX4 A;  5B31 D;  5CPJ D;  4KHA A;  1P3G A;  3W99 D;  5CPK B;  2JCH A;  3NQU B;  5KDM B;  3EPK A;  3REH C;  3AZE D;  4YM6 D;  1M18 C;  4Z66 C;  1EQZ B;  3AZG A;  2PYO C;  5B0Z B;  4Z5T D;  3UT9 B;  1P3A D;  2FFF B;  3AL0 C;  2ZY4 A;  4QLC D;  4XUJ C;  1KX4 D;  3EPH A;  2VQR A;  5B24 A;  5B1L B;  1P3G D;  5FUG A;  5GXQ C;  3LZ0 C;  2HIO C;  3MNN B;  5AVC A;  3F6T A;  3X1V A;  2Y2Q A;  5AV5 D;  4ZUX A;  5CP6 D;  3W98 A;  2BG1 A;  2ZM5 A;  4JJN A;  5JA4 A;  5B24 D;  3UTA B;  3EPJ A;  3MGP A;  3B6F D;  3B6G B;  5AV8 C;  2DF4 C;  4G92 C;  5AVC D;  2JE5 A;  3AZN A;  3X1V D;  4ZUX D;  2XD1 A;  2YFV A;  2BYM A;  5CPK C;  1P3B D;  1Q9C A;  3W98 D;  3VH5 W;  2F8N H;  1EQZ C;  4JJN D;  3MVD A;  3A1K A;  3AYW A;  1P3O A;  5BO0 B;  5F99 D;  5B0Z C;  3MGP D;  3UT9 C;  4H9N B;  3B0B A;  4J8U B;  5G49 B;  5AV9 A;  5B1L C;  3REL A;  3MGR A;  2BYK B;  4KUD A;  3VH6 W;  3MNN C;  3REI B;  3MVD D;  5GT0 A;  3AYW D;  1S32 A;  5AY8 B;  1P3O D;  4J8V A;  3C1B B;  2Y2J A;  5B33 B;  2ARO D;  5AV9 D;  3REL D;  3UTA C;  3KUY A;  4KUD D;  3B6G C;  3B0C W;  3NQJ B;  5GT0 D;  1S32 D;  3AZH B;  1F66 B;  4UUZ B;  3AV1 A;  2F8N B;  3REJ A;  3X1S A;  3KXB B;  5BNX A;  3TU4 B;  4XZQ B;  3KUY D;  5GT3 B;  4J8U C;  4H9R A;  1P3K B;  5CPI B;  1KX5 A;  4WV4 B;  2ZY5 A;  3WTP B;  1H3O B;  3W97 D;  3REI C;  3REK D;  3WA9 B;  3AV1 D;  5AVB B;  1PZR A;  3REJ D;  3X1S D;  5AY8 C;  1M18 A;  4WNN B;  4Z66 A;  3C1B C;  3LZ1 A;  5B33 C;  3EG5 B;  3X1T B;  5B0Y B;  5DNM D;  4KGC B;  2CV5 A;  1WWS A;  2Y2I A;  4H9P B;  5BS7 C;  1N1J B;  4WZS B;  1TZY A;  3X1U B;  1P3P B;  1HQ3 A;  3AZH C;  1M18 D;  2Y2P A;  4CAY A;  4Z66 D;  1F66 C;  3LZ1 D;  3WKJ B;  4X23 A;  3KXB C;  3AZF B;  3KWQ B;  4WU9 A;  3TU4 C;  1AOI B;  4XZQ C;  5GT3 C;  5DNN A;  3UTB B;  1P3K C;  5CPI C;  3AZJ A;  2FJ7 A;  3WTP C;  1ULY A;  2HIO D;  1HQ3 D;  2NZD A;  3FDD A;  3WA9 C;  5AVB C;  4X23 D;  1P3L A;  3AFA A;  5JRG B;  4WU9 D;  3AZK A;  1EQZ A;  3VH5 A;  5B40 A;  5AV6 C;  4J8X B;  5DNN D;  1ZLA B;  3X1T C;  1KU5 A;  2RVQ C;  5B0Y C;  3UT9 A;  4KGC C;  3AZI B;  3V9R B;  1P3L D;  4LD9 B;  5CPK D;  1Z2C B;  3X1U C;  3AN2 B;  1P3P C;  5B2I B;  3MNN A;  3AZK D;  1EQZ D;  3VH6 A;  2Y2H A;  4QLC A;  5B40 D;  3WKJ C;  3H0M C;  3AZL B;  2L5A A;  3UT9 D;  3AZF C;  3KWQ C;  4NE5 A;  1AOI C;  1M1A C;  2G5I C;  3EPL A;  3UTB C;  4H9Q A;  3W96 B;  3MGQ B;  5AV5 A;  4ZBJ B;  3B6G A;  5CP6 A;  3MNN D;  3C1C B;  5JRG C;  3B6F A;  5E5A A;  5BT1 C;  1WWI A;  4J8X C;  1ZLA C;  5BO0 A;  3B6G D;  3AZI C;  1P3B A;  4J8U A;  3MGS B;  4LD9 C;  3AN2 C;  5F99 A;  5B2I C;  3AV2 A;  3O62 B;  5E5A D;  5B31 B;  2XD5 A;  5CPJ B;  5AY8 A;  1P3M B;  3AZL C;  3C1B A;  2J8P A;  5B33 A;  4J8U D;  4YM6 B;  4G91 B;  4YS3 B;  1B67 A;  3W96 C;  2F8N G;  3MGQ C;  3WTP E;  4ZBJ C;  4Z5T B;  1P3A B;  3AV2 D;  3NQJ A;  1M19 B;  5BNV B;  4KHA B;  4NFT A;  5AY8 D;  3C1C C;  3AZH A;  2ARO A;  1P3G B;  1F66 A;  1BH8 A;  3C1B D;  5B33 D;  3KXB A;  3AZG B;  3TU4 A;  4XZQ A;  4CSR A;  2Y2K A;  2RIQ A;  5GT3 A;  2NQB A;  3MGS C;  3WAA B;  5B24 B;  3AZH D;  5FUG B;  1F66 D;  2ZY3 A; 
#chains in the Genus database with same CATH homology
 3O62 C;  5AVC B;  3B0D B;  3KXB D;  5CPJ C;  5GSU B;  3X1V B;  1P3M C;  3TU4 D;  4XZQ D;  2YFW A;  3A6N B;  4J8W A;  2Y2M A;  3W98 B;  4DQY B;  5GT3 D;  5AV6 A;  3W97 A;  4YM6 C;  4H9O A;  5JA4 B;  3REK A;  2NQB D;  4G91 C;  4YS3 C;  4NE3 A;  4UPK A;  3MGP B;  1P3A C;  1M19 C;  5AVB D;  2LY8 A;  4WU8 B;  3AZN B;  1P3F B;  2JSS A;  4J8W D;  1P3G C;  5DNM A;  4H9S C;  2BYM B;  5AV6 D;  3MVD B;  3AYW B;  3AZG C;  3AZF A;  4KGC D;  1P3O B;  1M1A A;  2G5H C;  4Z2M H;  3REH A;  4HGA B;  3UTB A;  4WJ3 C;  1BH9 A;  1B6W A;  3WAA C;  5AV9 B;  5B24 C;  2PYO A;  4EO5 B;  3MGR B;  4XUJ A;  4KUD B;  2DQN C;  3KSY A;  3LEL B;  3VH5 T;  3B0D C;  5GT0 B;  1W2E A;  5GSU C;  3X1V C;  5JRG A;  3AZF D;  5GXQ A;  3LZ0 A;  3A6N C;  3AZM B;  1S32 B;  4J8V B;  1M1A D;  2HIO A;  3REH D;  1ZLA A;  3UTB D;  3R45 A;  3AZI A;  2PYO D;  1P34 B;  1JFI A;  2Y2O A;  4XUJ D;  4WU8 C;  3AZN C;  3VH6 T;  1P3F C;  4LD9 A;  5JRG D;  1ID3 B;  2UWX A;  5GXQ D;  3LZ0 D;  3IP4 C;  5AV8 A;  1ZLA D;  3AV1 B;  3MVD C;  3REJ B;  3X1S B;  3AYW C;  4R8P B;  3AZI D;  5CPK A;  3NQU A;  3H0L C;  5KDM A;  4HGA C;  4H9R B;  3B0C T;  3MGQ A;  1KX5 B;  4LD9 D;  3AN2 D;  5B0Z A;  3KFU G;  4EO5 C;  3MGR C;  5AV8 D;  4KUD C;  1TAF B;  3LEL C;  5B1L A;  1S32 C;  1R4V A;  2F2A C;  3AZM C;  4J8V C;  5B32 G;  4DRA A;  3LZ1 B;  3MGQ D;  2W8S A;  5B31 G;  5B0Z D;  1P34 C;  2CV5 B;  5C3I B;  2Y2N A;  3MGS A;  5B1L D;  3UTA A;  1ID3 C;  1TZY B;  1HQ3 B;  3LJA B;  4CAY B;  1KX3 B;  4AWL B;  5B1M B;  1P3M A;  3AV1 C;  4X23 B;  3P5J B;  3X1S C;  5B2J B;  4R8P C;  2IO5 B;  4WU9 B;  1U35 B;  1P3I B;  3MGS D;  4YS3 A;  5DNN B;  1KX5 C;  3AZJ B;  2FJ7 B;  3UTA D;  1M19 A;  4DRB A;  4H9N A;  3H0R C;  2NZD B;  4M6B A;  1P3M D;  5G49 A;  1P3L B;  4H9S A;  3AFA B;  5B32 B;  2BYK A;  3AZK B;  4E45 A;  4E44 A;  3REI A;  5B40 B;  4YS3 D;  3LZ1 C;  2CV5 C;  1M19 D;  5C3I C;  3W99 B;  3WAA A;  3AZE B;  1TZY C;  1HQ3 C;  3LJA C;  3REI D;  1KX3 C;  4QLC B;  4AWL C;  5B1M C;  5GSU A;  5BS7 A;  3AZG D;  1KX4 B;  4X23 C;  3A6N A;  5B2J C;  2IO5 C;  4WU9 C;  1U35 C;  4UUZ A;  2F8N K;  1P3I C;  2F8N A;  3WAA D;  5DNN C;  4H9Q B;  3AZJ C;  2FJ7 C;  5AV5 B;  1F1E A;  5CP6 B;  4WU8 A;  1P3F A;  2NZD C;  5GSU D;  1P3K A;  5CPI A;  3A6N D;  3WTP A;  1P3L C;  3AFA C;  1H3O A;  5B32 C;  3AZK C;  3B6F B;  5E5A B;  3WA9 A;  5AVB A;  5B40 C;  2F8N D;  5B31 C;  2HUE B;  4WNN A;  4ZUX B;  4WU8 D;  3W99 C;  3AZN D;  1P3B B;  1P3F D;  1P3K D;  4JJN B;  3AZE C;  3X1T A;  5CPI D;  5B0Y A;  3WTP D;  4KGC A;  5F99 B;  4Z5T C;  3LEL A;  3AV2 B;  3WA9 D;  4QLC C;  4H9P A;  1KX4 C;  1N1J A;  3AZM A;  1P3P A;  3X1U A;  2YFV B;  3WKJ A;  3X1T D;  1P34 A;  5B0Y D;  2RVQ D;  5CHL B;  3MGR D;  3KWQ A;  5AV5 C;  1AOI A;  5CP6 C;  3LEL D;  1ID3 A;  4Z2M G;  3AZM D;  2ARO B;  4J8V D;  1T3U A;  3X1U D;  1P3P D;  3REL B;  1BH8 B;  3B6F C;  5E5A C;  3WKJ D;  5AVC C;  4R8P A;  1P34 D;  4CSR B;  3KWQ D;  1AOI D;  2HUE C;  4ZUX C;  3W98 C;  1P3B C;  2Y2G A;  2NQB B;  4J8X A;  4NE6 A;  4JJN C;  1ID3 D;  5F99 C;  1TAF A;  3MGP C;  3KUY B;  3AV2 C;  3V9R A;  4R8P D;  2YFW B;  4J8W B;  3AN2 A;  5B2I A;  5BT1 D;  5AV6 B;  3W97 B;  1KX5 D;  4H9O B;  4J8X D;  3REK B;  3AZL A;  5BNX B;  1P3O C;  3W96 A;  2CWE A;  2ARO C;  5AV9 C;  3LJA A;  5DNM B;  5B2I D;  3REL C;  2Y2L A;  1KX3 A;  5B1M A;  3C1C A;  5B2J A;  3AZL D;  5GT0 C;  2CV5 D;  1U35 A;  1M1A B;  1P3I A;  3REH B;  1M18 B;  4Z66 B;  2NQB C;  1BH9 B;  3W96 D;  1TZY D;  2PYO B;  3LJA D;  2ZY2 A;  1KX3 D;  4XUJ B;  5B1M D;  3KUY C;  3C1C D;  5B2J D;  5B32 A;  1BFM A;  5GXQ B;  3LZ0 B;  4J8W C;  1U35 D;  2HIO B;  1P3I D;  1A7W A;  3O62 A;  1HTA A;  3W97 C;  5B31 A;  5CPJ A;  3AZJ D;  3REK C;  2FJ7 D;  3R45 B;  3REJ C;  1JFI B;  3W99 A;  3A1I A;  2NZD D;  3AZE A;  4YM6 A;  3AFA D;  5B32 D;  4Z5T A;  5DNM C;  1P3A A;  5AV8 B;  5BNV A;  3O62 D;  4G92 B;  1KX4 A;  5B31 D;  5CPJ D;  4KHA A;  1P3G A;  3W99 D;  5CPK B;  2JCH A;  3NQU B;  5KDM B;  3EPK A;  3REH C;  3AZE D;  4YM6 D;  1M18 C;  4Z66 C;  1EQZ B;  3AZG A;  2PYO C;  5B0Z B;  4Z5T D;  3UT9 B;  1P3A D;  2FFF B;  3AL0 C;  2ZY4 A;  4QLC D;  4XUJ C;  1KX4 D;  3EPH A;  2VQR A;  5B24 A;  5B1L B;  1P3G D;  5FUG A;  5GXQ C;  3LZ0 C;  2HIO C;  3MNN B;  5AVC A;  3F6T A;  3X1V A;  2Y2Q A;  5AV5 D;  4ZUX A;  5CP6 D;  3W98 A;  2BG1 A;  2ZM5 A;  4JJN A;  5JA4 A;  5B24 D;  3UTA B;  3EPJ A;  3MGP A;  3B6F D;  3B6G B;  5AV8 C;  2DF4 C;  4G92 C;  5AVC D;  2JE5 A;  3AZN A;  3X1V D;  4ZUX D;  2XD1 A;  2YFV A;  2BYM A;  5CPK C;  1P3B D;  1Q9C A;  3W98 D;  3VH5 W;  2F8N H;  1EQZ C;  4JJN D;  3MVD A;  3A1K A;  3AYW A;  1P3O A;  5BO0 B;  5F99 D;  5B0Z C;  3MGP D;  3UT9 C;  4H9N B;  3B0B A;  4J8U B;  5G49 B;  5AV9 A;  5B1L C;  3REL A;  3MGR A;  2BYK B;  4KUD A;  3VH6 W;  3MNN C;  3REI B;  3MVD D;  5GT0 A;  3AYW D;  1S32 A;  5AY8 B;  1P3O D;  4J8V A;  3C1B B;  2Y2J A;  5B33 B;  2ARO D;  5AV9 D;  3REL D;  3UTA C;  3KUY A;  4KUD D;  3B6G C;  3B0C W;  3NQJ B;  5GT0 D;  1S32 D;  3AZH B;  1F66 B;  4UUZ B;  3AV1 A;  2F8N B;  3REJ A;  3X1S A;  3KXB B;  5BNX A;  3TU4 B;  4XZQ B;  3KUY D;  5GT3 B;  4J8U C;  4H9R A;  1P3K B;  5CPI B;  1KX5 A;  4WV4 B;  2ZY5 A;  3WTP B;  1H3O B;  3W97 D;  3REI C;  3REK D;  3WA9 B;  3AV1 D;  5AVB B;  1PZR A;  3REJ D;  3X1S D;  5AY8 C;  1M18 A;  4WNN B;  4Z66 A;  3C1B C;  3LZ1 A;  5B33 C;  3EG5 B;  3X1T B;  5B0Y B;  5DNM D;  4KGC B;  2CV5 A;  1WWS A;  2Y2I A;  4H9P B;  5BS7 C;  1N1J B;  4WZS B;  1TZY A;  3X1U B;  1P3P B;  1HQ3 A;  3AZH C;  1M18 D;  2Y2P A;  4CAY A;  4Z66 D;  1F66 C;  3LZ1 D;  3WKJ B;  4X23 A;  3KXB C;  3AZF B;  3KWQ B;  4WU9 A;  3TU4 C;  1AOI B;  4XZQ C;  5GT3 C;  5DNN A;  3UTB B;  1P3K C;  5CPI C;  3AZJ A;  2FJ7 A;  3WTP C;  1ULY A;  2HIO D;  1HQ3 D;  2NZD A;  3FDD A;  3WA9 C;  5AVB C;  4X23 D;  1P3L A;  3AFA A;  5JRG B;  4WU9 D;  3AZK A;  1EQZ A;  3VH5 A;  5B40 A;  5AV6 C;  4J8X B;  5DNN D;  1ZLA B;  3X1T C;  1KU5 A;  2RVQ C;  5B0Y C;  3UT9 A;  4KGC C;  3AZI B;  3V9R B;  1P3L D;  4LD9 B;  5CPK D;  1Z2C B;  3X1U C;  3AN2 B;  1P3P C;  5B2I B;  3MNN A;  3AZK D;  1EQZ D;  3VH6 A;  2Y2H A;  4QLC A;  5B40 D;  3WKJ C;  3H0M C;  3AZL B;  2L5A A;  3UT9 D;  3AZF C;  3KWQ C;  4NE5 A;  1AOI C;  1M1A C;  2G5I C;  3EPL A;  3UTB C;  4H9Q A;  3W96 B;  3MGQ B;  5AV5 A;  4ZBJ B;  3B6G A;  5CP6 A;  3MNN D;  3C1C B;  5JRG C;  3B6F A;  5E5A A;  5BT1 C;  1WWI A;  4J8X C;  1ZLA C;  5BO0 A;  3B6G D;  3AZI C;  1P3B A;  4J8U A;  3MGS B;  4LD9 C;  3AN2 C;  5F99 A;  5B2I C;  3AV2 A;  3O62 B;  5E5A D;  5B31 B;  2XD5 A;  5CPJ B;  5AY8 A;  1P3M B;  3AZL C;  3C1B A;  2J8P A;  5B33 A;  4J8U D;  4YM6 B;  4G91 B;  4YS3 B;  1B67 A;  3W96 C;  2F8N G;  3MGQ C;  3WTP E;  4ZBJ C;  4Z5T B;  1P3A B;  3AV2 D;  3NQJ A;  1M19 B;  5BNV B;  4KHA B;  4NFT A;  5AY8 D;  3C1C C;  3AZH A;  2ARO A;  1P3G B;  1F66 A;  1BH8 A;  3C1B D;  5B33 D;  3KXB A;  3AZG B;  3TU4 A;  4XZQ A;  4CSR A;  2Y2K A;  2RIQ A;  5GT3 A;  2NQB A;  3MGS C;  3WAA B;  5B24 B;  3AZH D;  5FUG B;  1F66 D;  2ZY3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...