1P3MD

Crystallographic studies of nucleosome core particles containing histone 'sin' mutants
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
92
structure length
92
Chain Sequence
KESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Structural protein/dna
molecule keywords Palindromic 146bp Human Alpha-Satellite DNA fragment
publication title Crystal structures of histone Sin mutant nucleosomes reveal altered protein-DNA interactions
pubmed doi rcsb
source organism Homo sapiens
total genus 33
structure length 92
sequence length 92
chains with identical sequence H
ec nomenclature
pdb deposition date 2003-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1p3mD00
5B1MA 4XZQA 5B31C 4QLCB 4KUDA 5CPIB 4JJND 3W97C 2YFWB 3MVDD 3AZHB 1P3GD 2BYMB 1ZLAC 3AV2C 1P3IB 5GXQD 4Z5TB 5B33A 3REIA 4J8XB 5GT3A 5B0YD 1U35D 1KX5A 3W98C 3WKJD 1TZYA 1KU5A 5BS7C 4G92C 4J8UC 1M18A 2LY8A 3W99D 3REKC 4YS3B 3AZFD 3AZJC 2NZDA 5B32D 1HTAA 3R45A 1P3PD 4CAYB 5BT1D 3KXBD 3X1SA 1M1AA 1EQZC 1R4VA 3RELA 1ID3A 4J8VA 3TU4C 4H9NB 4KGCD 5JRGA 4H9OA 3AYWC 4WU9A 5AVCA 3REJC 3W96C 1P3MC 5BO0A 3AZNC 5DNMD 3MGRD 3W97B 4ZUXA 1P3FD 1ZLAB 3AV2B 1Q9CA 3AZMD 3X1VD 5B1LC 5DNNA 4Z2MG 3AFAC 3AZIC 5B0ZA 1ULYA 3MGSD 5BNVB 3B6GC 2CV5B 4H9PB 2AROC 2NQBA 2PYOB 4Z66D 5AV9D 3AZLC 3X1TD 4R8PD 5C3IB 3W98B 2F8NB 3LZ0B 4WU8A 5B1MD 5GSUD 2HIOD 4XZQD 3O62B 4G92B 3LJAC 3REKB 3AZJB 3MGQD 3VH5W 3AZEA 1HQ3C 3X1UA 1P3KB 3NQUB 3LELA 4G91C 3WTPA 4LD9A 5B33D 3AYWB 1F66C 3C1CC 5B2IC 3REID 1P3AB 5E5AD 3W96B 2IO5C 4E44A 5AV5B 5GT3D 4X23A 3MGPA 1KX4D 3UT9B 3AZNB 3WA9C 5AV8C 1KX5D 3REHA 3A6NA 4EO5B 5F99C 5B24C 4XUJB 2FJ7D 1TZYD 1AOIA 5B2JC 4NE3A 5B1LB 3KUYA 3AZIB 3AFAB 2NZDD 1WWIA 1TAFB 1M1AD 5CPJD 3AZLB 3RELD 1P3BC 4J8VD 4ZBJC 4QLCA 5CPKB 3UTAD 5CPIA 4WU9D 1S32B 3LJAB 2YFWA 3WAAD 3AZHA 4JJNC 2BYMA 1WWSA 3NQJB 1M19D 1P3IA 1N1JB 4ZUXD 5AY8C 3MVDC 1HQ3B 4Z5TA 1P3GC 4G91B 5DNND 3VH6W 4J8XA 3UTBB 1F66B 2CWEA 3C1CB 1H3OB 2NQBD 3AN2D 4NE5A 5B0YC 3WA9B 5G49B 1U35C 4YS3A 3VH5A 5B24B 3WKJC 3A6NB 4H9QB 4CAYA 5B40B 3W99C 3AZFC 2RVQD 5B32C 3AZED 4H9NA 5BT1C 3KXBC 3AZGD 4WNNB 3LELD 5GT0B 3WTPD 4LD9D 4KGCC 3C1BD 4H9RB 3W97A 3MGPD 4J8WD 4JJNB 1ZLAA 3REHD 3AV2A 3KWQB 3VH5T 5DNMC 5JA4B 5AY8B 3MVDB 3MGRC 1P34D 1P3GB 5BNVA 2BYKB 1JFIB 3AZMC 4H9PA 3X1VC 3KUYD 2CV5A 2PYOA 3MGSC 2F8NG 3W98A 2F8NA 3LZ0A 4Z66C 5AV9C 3O62A 5BS7A 4R8PC 3X1TC 3REKA 3KSYA 4QLCD 5CPID 3B6FB 3AZJA 5AV6C 5B1MC 5GSUC 2HIOC 4XZQC 3MNND 3AZFB 3AZHD 1P3KA 3VH6A 5AVBC 5B32B 3MGQC 3NQUA 1KX3B 3KXBB 4Z5TD 3AYWA 4NFTA 3W96A 3AZKD 1P3AA 4YM6D 5AV5A 4KGCB 5B31B 3UT9A 5B33C 3AZNA 3REIC 5E5AC 5GT3C 4XUJA 1KX4C 1KX5C 4YS3D 5B1LA 5DNMB 3AZIA 3AFAA 2FJ7C 1TZYC 1TAFA 5CP6D 3AZLA 3VH6T 2NZDC 1B67A 5CPKA 4UUZB 5CPJC 1P3LD 1M1AC 1S32A 3RELC 5FUGB 3X1TB 3LJAA 4J8VC 4J8UB 3UTAC 5AV6B 5GSUB 2HIOB 4KUDD 3NQJA 3W97D 1N1JA 1HQ3A 3WAAC 5AVBB 1BH8B 3MGQB 1M19C 1EQZB 3UTBA 4DRBA 1F66A 1P3OC 3C1CA 3TU4B 1H3OA 2CV5D 2PYOD 5DNNC 3REJB 3WA9A 5G49A 1P3MB 5E5AB 3LZ0D 2F8ND 2NQBC 5B24A 1KX4B 3O62D 5BNXB 3AN2C 4H9QA 5B2JA 3B0CW 5B40A 3B0DC 1M18D 2FJ7B 3AV1C 3B6GB 1P3KD 2AROB 4WNNA 3X1SD 5GT0A 5CPJB 3AYWD 3AZGC 1ID3D 5JRGD 1P3AD 4H9RA 3LZ1C 4CSRB 5AV5D 3WTPC 4LD9C 5AVCD 3UT9D 3UTAB 4JJNA 3C1BC 3KWQA 3MGPC 5JA4A 5AY8A 3MVDA 4XUJD 4J8WC 4H9SC 1P3GA 1JFIA 2BYKA 3WAAB 1M19B 3REHC 5B1LD 1P3OB 1P34C 5GXQC 5B0ZD 4Z2MH 3KUYC 5B2IB 2IO5B 1U35A 5CPKD 3B6FA 5AV8B 1S32D 3WKJA 3AN2B 5F99B 4WU8D 3W99A 4QLCC 3B0DB 5B32G 5B2JB 5CPIC 3AZFA 4WZSB 3AV1B 5B32A 3MNNC 1KX3A 4WV4B 3KXBA 4KHAB 1HQ3D 3AZHC 1P3PC 5B31G 3UTBD 3X1UD 4KGCA 5B31A 3AZGB 1P3BB 4Z5TC 4ZBJB 3AZKC 3LZ1B 1BH9B 4YM6C 3WA9D 3C1BB 4X23D 5DNMA 5B24D 3A6ND 2HUEC 5B40D 1P3FC 1AOID 2JSSA 1P34B 1BFMA 5GXQB 5CP6C 4UUZA 1F1EA 4HGAC 5FUGA 5GT0D 3X1TA 5B0YB 4J8UA 1U35B 5AV6A 1P3LC 5GSUA 2HIOA 5KDMB 3B0CT 3WKJB 5CHLB 3W99B 5AVBA 1BH8A 3MGQA 3MNNB 3KWQD 4KUDC 1EQZA 5AY8D 3TU4A 1P3ID 1P3PB 3REJA 4J8XD 1P3MA 3AZKB 5E5AA 2CV5C 2PYOC 4YM6B 1KX4A 5BNXA 3WTPE 5C3IC 3LZ0C 3B6FD 3V9RA 2YFVB 2HUEB 4NE6A 3O62C 2FJ7A 3MGRB 1P3FB 3B6GA 3AZMB 1M18C 2AROA 3X1VB 1KX3D 5CP6B 3MGSB 5CPJA 2L5AA 1P3KC 4HGAB 3X1SC 4Z66B 5AV9B 4CSRA 5B31D 3UTAA 4R8PB 1P3LB 1ID3C 1B6WA 5JRGC 1P3AC 4E45A 5B1MB 5AV5C 4WU9C 4XZQB 5AVCC 3UT9C 3WAAA 4KUDB 1M19A 4EO5C 1ZLAD 3AV2D 1P3OA 4XUJC 4ZUXC 5B2IA 5B0ZC 5B33B 5AV8A 3W98D 3REIB 2F8NH 3AN2A 5F99A 5GT3B 5CPKC 4J8UD 5AV6D 1KX5B 3REKD 1S32C 3AV1A 3V9RB 3AZJD 4WU8C 1TZYB 4KHAA 1M18B 5AVBD 1EQZD 2NZDB 2RVQC 3AZGA 1P3BA 3TU4D 3R45B 3AZEC 1M1AB 3X1SB 3LZ1A 1BH9A 3X1UC 3UTBC 3REJD 3RELB 3W96D 1ID3B 3LELC 4J8VB 3C1BA 1P3MD 5JRGB 4M6BA 4H9OB 3AZND 4WU9B 2F8NK 5AVCB 4J8WA 4H9SA 4X23C 5BO0B 3B0BA 1P34A 3A6NC 4AWLC 5GXQA 3AFAD 3AZID 4ZUXB 5B40C 3B6GD 1AOIC 2AROD 5DNNB 3AZLD 5B0ZB 5B0YA 2NQBB 5KDMA 5GT0C 3LJAD 3MNNA 4WU8B 1P3PA 3KWQC 1P3OD 3AZEB 1P3IC 3AZKA 1F66D 3C1CD 5B2ID 4YM6A 3X1UB 4DRAA 3LELB 3WTPB 4J8XC 4LD9B 1A7WA 5AV8D 2YFVA 5F99D 3MGPB 3MGRA 4X23B 4J8WB 1P3FA 5B2JD 3B6FC 3REHB 3AZMA 3AV1D 4AWLB 4YS3C 3X1VA 5CP6A 3MGSA 1AOIB 3KUYB 4Z66A 5AV9A 1KX3C 1P3BD 1P3LA 4R8PA 3LZ1D
chains in the Genus database with same CATH superfamily
5B1MA 4XZQA 5B31C 4QLCB 4KUDA 5CPIB 4JJND 3W97C 2YFWB 3MVDD 3A1IA 3AZHB 1P3GD 3F6TA 2BYMB 1ZLAC 3AV2C 1P3IB 5GXQD 3FDDA 4Z5TB 5B33A 3REIA 4J8XB 2ZY5A 5GT3A 5B0YD 3IP4C 1U35D 1KX5A 2Y2NA 3W98C 3WKJD 2ZM5A 1TZYA 1KU5A 5BS7C 4G92C 4J8UC 1M18A 2LY8A 3W99D 3REKC 4YS3B 3AZFD 3AZJC 2NZDA 5B32D 1HTAA 3R45A 1P3PD 4CAYB 5BT1D 3KXBD 2Y2PA 3X1SA 1M1AA 1EQZC 1R4VA 3RELA 1ID3A 4J8VA 3TU4C 4H9NB 4KGCD 5JRGA 4H9OA 3AYWC 4WU9A 5AVCA 3REJC 3W96C 1P3MC 5BO0A 3AZNC 5DNMD 3MGRD 3W97B 4ZUXA 1P3FD 1ZLAB 3AV2B 1Q9CA 3AZMD 3X1VD 5B1LC 5DNNA 4Z2MG 3AFAC 3AZIC 5B0ZA 1ULYA 3MGSD 5BNVB 3B6GC 3H0MC 4H9PB 2AROC 2CV5B 2NQBA 1W2EA 2PYOB 4Z66D 5AV9D 3AZLC 3X1TD 4R8PD 5C3IB 3W98B 2F8NB 3LZ0B 4WU8A 5B1MD 5GSUD 2HIOD 4XZQD 3O62B 4G92B 3LJAC 3REKB 3AZJB 3MGQD 3VH5W 3AZEA 1HQ3C 3X1UA 1P3KB 3NQUB 3LELA 4G91C 3WTPA 4LD9A 2DF4C 5B33D 3AYWB 1F66C 3C1CC 5B2IC 3REID 1P3AB 5E5AD 3W96B 2IO5C 4E44A 5AV5B 5GT3D 4X23A 3MGPA 1KX4D 3UT9B 3AZNB 3WA9C 5AV8C 1KX5D 3REHA 3A6NA 4EO5B 5F99C 2Y2HA 5B24C 4XUJB 2FJ7D 1TZYD 1AOIA 5B2JC 4NE3A 5B1LB 3KUYA 3AZIB 3AFAB 2NZDD 2ZY3A 1WWIA 1TAFB 1M1AD 5CPJD 3AZLB 3RELD 1P3BC 4J8VD 4ZBJC 4QLCA 3KFUG 2ZY4A 5CPKB 3UTAD 5CPIA 4WU9D 1S32B 2J8PA 2VQRA 3LJAB 2YFWA 3WAAD 3AZHA 4JJNC 2BYMA 1WWSA 3NQJB 1M19D 1P3IA 1N1JB 4ZUXD 5AY8C 3MVDC 1HQ3B 4Z5TA 1P3GC 4G91B 5DNND 3VH6W 4J8XA 3UTBB 1F66B 2CWEA 3C1CB 1H3OB 4WJ3C 2NQBD 2FFFB 2G5HC 3AN2D 4NE5A 5B0YC 3WA9B 5G49B 1U35C 4YS3A 3VH5A 5B24B 3WKJC 3A6NB 4H9QB 4DQYB 4CAYA 5B40B 3W99C 3AZFC 2RVQD 5B32C 3AZED 4H9NA 5BT1C 3KXBC 3AZGD 4WNNB 3LELD 5GT0B 3WTPD 4LD9D 4KGCC 3C1BD 4H9RB 3W97A 3MGPD 3H0LC 3H0RC 4J8WD 4JJNB 1ZLAA 3REHD 3AV2A 3KWQB 3VH5T 5DNMC 5JA4B 5AY8B 3MVDB 3MGRC 1P34D 1P3GB 5BNVA 2BYKB 2XD5A 1JFIB 3AZMC 4H9PA 3X1VC 3KUYD 2CV5A 2PYOA 3MGSC 2F8NG 3W98A 2F8NA 3LZ0A 4Z66C 2RIQA 5AV9C 3O62A 5BS7A 4R8PC 3X1TC 3REKA 3KSYA 4QLCD 5CPID 3B6FB 3AZJA 5AV6C 5B1MC 5GSUC 2HIOC 4XZQC 3MNND 1PZRA 3AZFB 3AZHD 1P3KA 3VH6A 5AVBC 5B32B 3MGQC 3NQUA 1KX3B 2Y2OA 3KXBB 4Z5TD 3AYWA 4NFTA 3W96A 3AZKD 1P3AA 2ZY2A 4YM6D 5AV5A 4KGCB 5B31B 3UT9A 5B33C 3AZNA 3REIC 5E5AC 5GT3C 4XUJA 1KX4C 2DQNC 1KX5C 4YS3D 5B1LA 5DNMB 3AZIA 3AFAA 3EPKA 2FJ7C 1TZYC 1TAFA 5CP6D 3AZLA 3VH6T 2NZDC 1B67A 5CPKA 4UUZB 5CPJC 1P3LD 1M1AC 1S32A 3RELC 5FUGB 3X1TB 3LJAA 3AL0C 4J8VC 4J8UB 3UTAC 5AV6B 5GSUB 2HIOB 4KUDD 2W8SA 3NQJA 3W97D 1N1JA 2BG1A 1HQ3A 3WAAC 5AVBB 1BH8B 3MGQB 2Y2KA 1M19C 2Y2MA 1EQZB 3UTBA 2Y2QA 4DRBA 1F66A 1P3OC 3C1CA 3TU4B 1H3OA 2CV5D 2PYOD 5DNNC 3REJB 3WA9A 5G49A 1P3MB 5E5AB 3LZ0D 2F8ND 2NQBC 5B24A 1KX4B 3O62D 5BNXB 3AN2C 4H9QA 5B2JA 3B0CW 5B40A 3EPJA 3B0DC 1M18D 2FJ7B 3AV1C 3B6GB 1P3KD 2AROB 4WNNA 3X1SD 5GT0A 5CPJB 3AYWD 3AZGC 1ID3D 2F2AC 5JRGD 1P3AD 4H9RA 3LZ1C 4CSRB 5AV5D 3WTPC 4LD9C 5AVCD 3UT9D 3UTAB 4JJNA 3C1BC 3KWQA 3MGPC 5JA4A 5AY8A 3A1KA 2Y2JA 4XUJD 3MVDA 4J8WC 4H9SC 1P3GA 1JFIA 2BYKA 3WAAB 1M19B 3REHC 5B1LD 2Y2GA 1P3OB 1P34C 4UPKA 5GXQC 5B0ZD 4Z2MH 3KUYC 5B2IB 2IO5B 1U35A 5CPKD 3B6FA 5AV8B 1S32D 3WKJA 3AN2B 5F99B 3EG5B 4WU8D 3W99A 4QLCC 3B0DB 5B32G 5B2JB 5CPIC 3AZFA 4WZSB 3AV1B 5B32A 3MNNC 1KX3A 4WV4B 3KXBA 4KHAB 1HQ3D 2JCHA 3AZHC 1P3PC 5B31G 3UTBD 3X1UD 4KGCA 5B31A 3AZGB 1P3BB 4Z5TC 4ZBJB 3AZKC 3LZ1B 1BH9B 4YM6C 3WA9D 3C1BB 4X23D 5DNMA 5B24D 3A6ND 2HUEC 5B40D 1P3FC 1AOID 2JSSA 1P34B 1BFMA 5GXQB 5CP6C 4UUZA 1F1EA 4HGAC 5FUGA 5GT0D 2Y2IA 3X1TA 5B0YB 4J8UA 1U35B 5AV6A 1P3LC 5GSUA 2HIOA 5KDMB 3B0CT 3WKJB 5CHLB 3W99B 5AVBA 1BH8A 3MGQA 3MNNB 3KWQD 2UWXA 1EQZA 4KUDC 5AY8D 3TU4A 1P3ID 1P3PB 3P5JB 3EPHA 3REJA 2XD1A 4J8XD 1P3MA 3AZKB 5E5AA 2CV5C 2PYOC 4YM6B 2Y2LA 1KX4A 5BNXA 3WTPE 5C3IC 3LZ0C 3B6FD 3V9RA 2YFVB 1T3UA 2HUEB 4NE6A 3O62C 2FJ7A 3MGRB 1P3FB 3B6GA 3AZMB 1M18C 2AROA 3X1VB 1KX3D 5CP6B 3MGSB 5CPJA 2L5AA 1P3KC 4HGAB 3X1SC 4Z66B 5AV9B 4CSRA 5B31D 3UTAA 4R8PB 1P3LB 1ID3C 1B6WA 5JRGC 1P3AC 4E45A 5B1MB 5AV5C 4WU9C 4XZQB 5AVCC 3UT9C 3WAAA 4KUDB 1M19A 4EO5C 1ZLAD 3AV2D 1P3OA 4XUJC 4ZUXC 5B2IA 5B0ZC 5B33B 5AV8A 3W98D 3REIB 2F8NH 3AN2A 5F99A 5GT3B 5CPKC 4J8UD 5AV6D 1KX5B 3REKD 1S32C 3AV1A 3V9RB 3AZJD 4WU8C 1TZYB 4KHAA 1M18B 5AVBD 1EQZD 2NZDB 2RVQC 3AZGA 2JE5A 3TU4D 3R45B 3AZEC 1P3BA 3EPLA 1M1AB 3X1SB 3LZ1A 1BH9A 3X1UC 3UTBC 3REJD 3RELB 3W96D 1ID3B 3LELC 4J8VB 1Z2CB 3C1BA 5JRGB 4M6BA 1P3MD 4H9OB 3AZND 4WU9B 2F8NK 5AVCB 4J8WA 4H9SA 4X23C 5BO0B 3B0BA 1P34A 3A6NC 4AWLC 5GXQA 3AFAD 3AZID 4ZUXB 5B40C 3B6GD 1AOIC 2AROD 5DNNB 3AZLD 5B0ZB 5B0YA 2G5IC 2NQBB 5KDMA 5GT0C 3LJAD 3MNNA 4WU8B 1P3PA 3KWQC 1P3OD 3AZEB 1P3IC 3AZKA 1F66D 3C1CD 5B2ID 4YM6A 3X1UB 4DRAA 3LELB 3WTPB 4J8XC 4LD9B 1A7WA 5AV8D 2YFVA 5F99D 3MGPB 3MGRA 4X23B 4J8WB 1P3FA 5B2JD 3B6FC 3REHB 3AZMA 3AV1D 4AWLB 4YS3C 3X1VA 5CP6A 3MGSA 1AOIB 3KUYB 4Z66A 5AV9A 1KX3C 1P3BD 1P3LA 4R8PA 3LZ1D
chains in the Genus database with same CATH topology
5B1MA 4XZQA 5B31C 4QLCB 4KUDA 5CPIB 4JJND 3W97C 2YFWB 3MVDD 3A1IA 3AZHB 1P3GD 3F6TA 2BYMB 1ZLAC 3AV2C 1P3IB 5GXQD 3FDDA 4Z5TB 5B33A 3REIA 4J8XB 2ZY5A 5GT3A 5B0YD 3IP4C 1U35D 1KX5A 2Y2NA 3W98C 3WKJD 2ZM5A 1TZYA 1KU5A 5BS7C 4G92C 4J8UC 1M18A 2LY8A 3W99D 3REKC 4YS3B 3AZFD 3AZJC 2NZDA 5B32D 1HTAA 3R45A 1P3PD 4CAYB 5BT1D 3KXBD 2Y2PA 3X1SA 1M1AA 1EQZC 1R4VA 3RELA 1ID3A 4J8VA 3TU4C 4H9NB 4KGCD 5JRGA 4H9OA 3AYWC 4WU9A 5AVCA 3REJC 3W96C 1P3MC 5BO0A 3AZNC 5DNMD 3MGRD 3W97B 4ZUXA 1P3FD 1ZLAB 3AV2B 1Q9CA 3AZMD 3X1VD 5B1LC 5DNNA 4Z2MG 3AFAC 3AZIC 5B0ZA 1ULYA 3MGSD 5BNVB 3B6GC 3H0MC 4H9PB 2AROC 2CV5B 2NQBA 1W2EA 2PYOB 4Z66D 5AV9D 3AZLC 3X1TD 4R8PD 5C3IB 3W98B 2F8NB 3LZ0B 4WU8A 5B1MD 5GSUD 2HIOD 4XZQD 3O62B 4G92B 3LJAC 3REKB 3AZJB 3MGQD 3VH5W 3AZEA 1HQ3C 3X1UA 1P3KB 3NQUB 3LELA 4G91C 3WTPA 4LD9A 2DF4C 5B33D 3AYWB 1F66C 3C1CC 5B2IC 3REID 1P3AB 5E5AD 3W96B 2IO5C 4E44A 5AV5B 5GT3D 4X23A 3MGPA 1KX4D 3UT9B 3AZNB 3WA9C 5AV8C 1KX5D 3REHA 3A6NA 4EO5B 5F99C 2Y2HA 5B24C 4XUJB 2FJ7D 1TZYD 1AOIA 5B2JC 4NE3A 5B1LB 3KUYA 3AZIB 3AFAB 2NZDD 2ZY3A 1WWIA 1TAFB 1M1AD 5CPJD 3AZLB 3RELD 1P3BC 4J8VD 4ZBJC 4QLCA 3KFUG 2ZY4A 5CPKB 3UTAD 5CPIA 4WU9D 1S32B 2J8PA 2VQRA 3LJAB 2YFWA 3WAAD 3AZHA 4JJNC 2BYMA 1WWSA 3NQJB 1M19D 1P3IA 1N1JB 4ZUXD 5AY8C 3MVDC 1HQ3B 4Z5TA 1P3GC 4G91B 5DNND 3VH6W 4J8XA 3UTBB 1F66B 2CWEA 3C1CB 1H3OB 4WJ3C 2NQBD 2FFFB 2G5HC 3AN2D 4NE5A 5B0YC 3WA9B 5G49B 1U35C 4YS3A 3VH5A 5B24B 3WKJC 3A6NB 4H9QB 4DQYB 4CAYA 5B40B 3W99C 3AZFC 2RVQD 5B32C 3AZED 4H9NA 5BT1C 3KXBC 3AZGD 4WNNB 3LELD 5GT0B 3WTPD 4LD9D 4KGCC 3C1BD 4H9RB 3W97A 3MGPD 3H0LC 3H0RC 4J8WD 4JJNB 1ZLAA 3REHD 3AV2A 3KWQB 3VH5T 5DNMC 5JA4B 5AY8B 3MVDB 3MGRC 1P34D 1P3GB 5BNVA 2BYKB 2XD5A 1JFIB 3AZMC 4H9PA 3X1VC 3KUYD 2CV5A 2PYOA 3MGSC 2F8NG 3W98A 2F8NA 3LZ0A 4Z66C 2RIQA 5AV9C 3O62A 5BS7A 4R8PC 3X1TC 3REKA 3KSYA 4QLCD 5CPID 3B6FB 3AZJA 5AV6C 5B1MC 5GSUC 2HIOC 4XZQC 3MNND 1PZRA 3AZFB 3AZHD 1P3KA 3VH6A 5AVBC 5B32B 3MGQC 3NQUA 1KX3B 2Y2OA 3KXBB 4Z5TD 3AYWA 4NFTA 3W96A 3AZKD 1P3AA 2ZY2A 4YM6D 5AV5A 4KGCB 5B31B 3UT9A 5B33C 3AZNA 3REIC 5E5AC 5GT3C 4XUJA 1KX4C 2DQNC 1KX5C 4YS3D 5B1LA 5DNMB 3AZIA 3AFAA 3EPKA 2FJ7C 1TZYC 1TAFA 5CP6D 3AZLA 3VH6T 2NZDC 1B67A 5CPKA 4UUZB 5CPJC 1P3LD 1M1AC 1S32A 3RELC 5FUGB 3X1TB 3LJAA 3AL0C 4J8VC 4J8UB 3UTAC 5AV6B 5GSUB 2HIOB 4KUDD 2W8SA 3NQJA 3W97D 1N1JA 2BG1A 1HQ3A 3WAAC 5AVBB 1BH8B 3MGQB 2Y2KA 1M19C 2Y2MA 1EQZB 3UTBA 2Y2QA 4DRBA 1F66A 1P3OC 3C1CA 3TU4B 1H3OA 2CV5D 2PYOD 5DNNC 3REJB 3WA9A 5G49A 1P3MB 5E5AB 3LZ0D 2F8ND 2NQBC 5B24A 1KX4B 3O62D 5BNXB 3AN2C 4H9QA 5B2JA 3B0CW 5B40A 3EPJA 3B0DC 1M18D 2FJ7B 3AV1C 3B6GB 1P3KD 2AROB 4WNNA 3X1SD 5GT0A 5CPJB 3AYWD 3AZGC 1ID3D 2F2AC 5JRGD 1P3AD 4H9RA 3LZ1C 4CSRB 5AV5D 3WTPC 4LD9C 5AVCD 3UT9D 3UTAB 4JJNA 3C1BC 3KWQA 3MGPC 5JA4A 5AY8A 3A1KA 2Y2JA 4XUJD 3MVDA 4J8WC 4H9SC 1P3GA 1JFIA 2BYKA 3WAAB 1M19B 3REHC 5B1LD 2Y2GA 1P3OB 1P34C 4UPKA 5GXQC 5B0ZD 4Z2MH 3KUYC 5B2IB 2IO5B 1U35A 5CPKD 3B6FA 5AV8B 1S32D 3WKJA 3AN2B 5F99B 3EG5B 4WU8D 3W99A 4QLCC 3B0DB 5B32G 5B2JB 5CPIC 3AZFA 4WZSB 3AV1B 5B32A 3MNNC 1KX3A 4WV4B 3KXBA 4KHAB 1HQ3D 2JCHA 3AZHC 1P3PC 5B31G 3UTBD 3X1UD 4KGCA 5B31A 3AZGB 1P3BB 4Z5TC 4ZBJB 3AZKC 3LZ1B 1BH9B 4YM6C 3WA9D 3C1BB 4X23D 5DNMA 5B24D 3A6ND 2HUEC 5B40D 1P3FC 1AOID 2JSSA 1P34B 1BFMA 5GXQB 5CP6C 4UUZA 1F1EA 4HGAC 5FUGA 5GT0D 2Y2IA 3X1TA 5B0YB 4J8UA 1U35B 5AV6A 1P3LC 5GSUA 2HIOA 5KDMB 3B0CT 3WKJB 5CHLB 3W99B 5AVBA 1BH8A 3MGQA 3MNNB 3KWQD 2UWXA 1EQZA 4KUDC 5AY8D 3TU4A 1P3ID 1P3PB 3P5JB 3EPHA 3REJA 2XD1A 4J8XD 1P3MA 3AZKB 5E5AA 2CV5C 2PYOC 4YM6B 2Y2LA 1KX4A 5BNXA 3WTPE 5C3IC 3LZ0C 3B6FD 3V9RA 2YFVB 1T3UA 2HUEB 4NE6A 3O62C 2FJ7A 3MGRB 1P3FB 3B6GA 3AZMB 1M18C 2AROA 3X1VB 1KX3D 5CP6B 3MGSB 5CPJA 2L5AA 1P3KC 4HGAB 3X1SC 4Z66B 5AV9B 4CSRA 5B31D 3UTAA 4R8PB 1P3LB 1ID3C 1B6WA 5JRGC 1P3AC 4E45A 5B1MB 5AV5C 4WU9C 4XZQB 5AVCC 3UT9C 3WAAA 4KUDB 1M19A 4EO5C 1ZLAD 3AV2D 1P3OA 4XUJC 4ZUXC 5B2IA 5B0ZC 5B33B 5AV8A 3W98D 3REIB 2F8NH 3AN2A 5F99A 5GT3B 5CPKC 4J8UD 5AV6D 1KX5B 3REKD 1S32C 3AV1A 3V9RB 3AZJD 4WU8C 1TZYB 4KHAA 1M18B 5AVBD 1EQZD 2NZDB 2RVQC 3AZGA 2JE5A 3TU4D 3R45B 3AZEC 1P3BA 3EPLA 1M1AB 3X1SB 3LZ1A 1BH9A 3X1UC 3UTBC 3REJD 3RELB 3W96D 1ID3B 3LELC 4J8VB 1Z2CB 3C1BA 5JRGB 4M6BA 1P3MD 4H9OB 3AZND 4WU9B 2F8NK 5AVCB 4J8WA 4H9SA 4X23C 5BO0B 3B0BA 1P34A 3A6NC 4AWLC 5GXQA 3AFAD 3AZID 4ZUXB 5B40C 3B6GD 1AOIC 2AROD 5DNNB 3AZLD 5B0ZB 5B0YA 2G5IC 2NQBB 5KDMA 5GT0C 3LJAD 3MNNA 4WU8B 1P3PA 3KWQC 1P3OD 3AZEB 1P3IC 3AZKA 1F66D 3C1CD 5B2ID 4YM6A 3X1UB 4DRAA 3LELB 3WTPB 4J8XC 4LD9B 1A7WA 5AV8D 2YFVA 5F99D 3MGPB 3MGRA 4X23B 4J8WB 1P3FA 5B2JD 3B6FC 3REHB 3AZMA 3AV1D 4AWLB 4YS3C 3X1VA 5CP6A 3MGSA 1AOIB 3KUYB 4Z66A 5AV9A 1KX3C 1P3BD 1P3LA 4R8PA 3LZ1D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5B1M A;  4XZQ A;  5B31 C;  4QLC B;  4KUD A;  5CPI B;  4JJN D;  3W97 C;  2YFW B;  3MVD D;  3AZH B;  1P3G D;  2BYM B;  1ZLA C;  3AV2 C;  1P3I B;  5GXQ D;  4Z5T B;  5B33 A;  3REI A;  4J8X B;  5GT3 A;  5B0Y D;  1U35 D;  1KX5 A;  3W98 C;  3WKJ D;  1TZY A;  1KU5 A;  5BS7 C;  4G92 C;  4J8U C;  1M18 A;  2LY8 A;  3W99 D;  3REK C;  4YS3 B;  3AZF D;  3AZJ C;  2NZD A;  5B32 D;  1HTA A;  3R45 A;  1P3P D;  4CAY B;  5BT1 D;  3KXB D;  3X1S A;  1M1A A;  1EQZ C;  1R4V A;  3REL A;  1ID3 A;  4J8V A;  3TU4 C;  4H9N B;  4KGC D;  5JRG A;  4H9O A;  3AYW C;  4WU9 A;  5AVC A;  3REJ C;  3W96 C;  1P3M C;  5BO0 A;  3AZN C;  5DNM D;  3MGR D;  3W97 B;  4ZUX A;  1P3F D;  1ZLA B;  3AV2 B;  1Q9C A;  3AZM D;  3X1V D;  5B1L C;  5DNN A;  4Z2M G;  3AFA C;  3AZI C;  5B0Z A;  1ULY A;  3MGS D;  5BNV B;  3B6G C;  2CV5 B;  4H9P B;  2ARO C;  2NQB A;  2PYO B;  4Z66 D;  5AV9 D;  3AZL C;  3X1T D;  4R8P D;  5C3I B;  3W98 B;  2F8N B;  3LZ0 B;  4WU8 A;  5B1M D;  5GSU D;  2HIO D;  4XZQ D;  3O62 B;  4G92 B;  3LJA C;  3REK B;  3AZJ B;  3MGQ D;  3VH5 W;  3AZE A;  1HQ3 C;  3X1U A;  1P3K B;  3NQU B;  3LEL A;  4G91 C;  3WTP A;  4LD9 A;  5B33 D;  3AYW B;  1F66 C;  3C1C C;  5B2I C;  3REI D;  1P3A B;  5E5A D;  3W96 B;  2IO5 C;  4E44 A;  5AV5 B;  5GT3 D;  4X23 A;  3MGP A;  1KX4 D;  3UT9 B;  3AZN B;  3WA9 C;  5AV8 C;  1KX5 D;  3REH A;  3A6N A;  4EO5 B;  5F99 C;  5B24 C;  4XUJ B;  2FJ7 D;  1TZY D;  1AOI A;  5B2J C;  4NE3 A;  5B1L B;  3KUY A;  3AZI B;  3AFA B;  2NZD D;  1WWI A;  1TAF B;  1M1A D;  5CPJ D;  3AZL B;  3REL D;  1P3B C;  4J8V D;  4ZBJ C;  4QLC A;  5CPK B;  3UTA D;  5CPI A;  4WU9 D;  1S32 B;  3LJA B;  2YFW A;  3WAA D;  3AZH A;  4JJN C;  2BYM A;  1WWS A;  3NQJ B;  1M19 D;  1P3I A;  1N1J B;  4ZUX D;  5AY8 C;  3MVD C;  1HQ3 B;  4Z5T A;  1P3G C;  4G91 B;  5DNN D;  3VH6 W;  4J8X A;  3UTB B;  1F66 B;  2CWE A;  3C1C B;  1H3O B;  2NQB D;  3AN2 D;  4NE5 A;  5B0Y C;  3WA9 B;  5G49 B;  1U35 C;  4YS3 A;  3VH5 A;  5B24 B;  3WKJ C;  3A6N B;  4H9Q B;  4CAY A;  5B40 B;  3W99 C;  3AZF C;  2RVQ D;  5B32 C;  3AZE D;  4H9N A;  5BT1 C;  3KXB C;  3AZG D;  4WNN B;  3LEL D;  5GT0 B;  3WTP D;  4LD9 D;  4KGC C;  3C1B D;  4H9R B;  3W97 A;  3MGP D;  4J8W D;  4JJN B;  1ZLA A;  3REH D;  3AV2 A;  3KWQ B;  3VH5 T;  5DNM C;  5JA4 B;  5AY8 B;  3MVD B;  3MGR C;  1P34 D;  1P3G B;  5BNV A;  2BYK B;  1JFI B;  3AZM C;  4H9P A;  3X1V C;  3KUY D;  2CV5 A;  2PYO A;  3MGS C;  2F8N G;  3W98 A;  2F8N A;  3LZ0 A;  4Z66 C;  5AV9 C;  3O62 A;  5BS7 A;  4R8P C;  3X1T C;  3REK A;  3KSY A;  4QLC D;  5CPI D;  3B6F B;  3AZJ A;  5AV6 C;  5B1M C;  5GSU C;  2HIO C;  4XZQ C;  3MNN D;  3AZF B;  3AZH D;  1P3K A;  3VH6 A;  5AVB C;  5B32 B;  3MGQ C;  3NQU A;  1KX3 B;  3KXB B;  4Z5T D;  3AYW A;  4NFT A;  3W96 A;  3AZK D;  1P3A A;  4YM6 D;  5AV5 A;  4KGC B;  5B31 B;  3UT9 A;  5B33 C;  3AZN A;  3REI C;  5E5A C;  5GT3 C;  4XUJ A;  1KX4 C;  1KX5 C;  4YS3 D;  5B1L A;  5DNM B;  3AZI A;  3AFA A;  2FJ7 C;  1TZY C;  1TAF A;  5CP6 D;  3AZL A;  3VH6 T;  2NZD C;  1B67 A;  5CPK A;  4UUZ B;  5CPJ C;  1P3L D;  1M1A C;  1S32 A;  3REL C;  5FUG B;  3X1T B;  3LJA A;  4J8V C;  4J8U B;  3UTA C;  5AV6 B;  5GSU B;  2HIO B;  4KUD D;  3NQJ A;  3W97 D;  1N1J A;  1HQ3 A;  3WAA C;  5AVB B;  1BH8 B;  3MGQ B;  1M19 C;  1EQZ B;  3UTB A;  4DRB A;  1F66 A;  1P3O C;  3C1C A;  3TU4 B;  1H3O A;  2CV5 D;  2PYO D;  5DNN C;  3REJ B;  3WA9 A;  5G49 A;  1P3M B;  5E5A B;  3LZ0 D;  2F8N D;  2NQB C;  5B24 A;  1KX4 B;  3O62 D;  5BNX B;  3AN2 C;  4H9Q A;  5B2J A;  3B0C W;  5B40 A;  3B0D C;  1M18 D;  2FJ7 B;  3AV1 C;  3B6G B;  1P3K D;  2ARO B;  4WNN A;  3X1S D;  5GT0 A;  5CPJ B;  3AYW D;  3AZG C;  1ID3 D;  5JRG D;  1P3A D;  4H9R A;  3LZ1 C;  4CSR B;  5AV5 D;  3WTP C;  4LD9 C;  5AVC D;  3UT9 D;  3UTA B;  4JJN A;  3C1B C;  3KWQ A;  3MGP C;  5JA4 A;  5AY8 A;  3MVD A;  4XUJ D;  4J8W C;  4H9S C;  1P3G A;  1JFI A;  2BYK A;  3WAA B;  1M19 B;  3REH C;  5B1L D;  1P3O B;  1P34 C;  5GXQ C;  5B0Z D;  4Z2M H;  3KUY C;  5B2I B;  2IO5 B;  1U35 A;  5CPK D;  3B6F A;  5AV8 B;  1S32 D;  3WKJ A;  3AN2 B;  5F99 B;  4WU8 D;  3W99 A;  4QLC C;  3B0D B;  5B32 G;  5B2J B;  5CPI C;  3AZF A;  4WZS B;  3AV1 B;  5B32 A;  3MNN C;  1KX3 A;  4WV4 B;  3KXB A;  4KHA B;  1HQ3 D;  3AZH C;  1P3P C;  5B31 G;  3UTB D;  3X1U D;  4KGC A;  5B31 A;  3AZG B;  1P3B B;  4Z5T C;  4ZBJ B;  3AZK C;  3LZ1 B;  1BH9 B;  4YM6 C;  3WA9 D;  3C1B B;  4X23 D;  5DNM A;  5B24 D;  3A6N D;  2HUE C;  5B40 D;  1P3F C;  1AOI D;  2JSS A;  1P34 B;  1BFM A;  5GXQ B;  5CP6 C;  4UUZ A;  1F1E A;  4HGA C;  5FUG A;  5GT0 D;  3X1T A;  5B0Y B;  4J8U A;  1U35 B;  5AV6 A;  1P3L C;  5GSU A;  2HIO A;  5KDM B;  3B0C T;  3WKJ B;  5CHL B;  3W99 B;  5AVB A;  1BH8 A;  3MGQ A;  3MNN B;  3KWQ D;  4KUD C;  1EQZ A;  5AY8 D;  3TU4 A;  1P3I D;  1P3P B;  3REJ A;  4J8X D;  1P3M A;  3AZK B;  5E5A A;  2CV5 C;  2PYO C;  4YM6 B;  1KX4 A;  5BNX A;  3WTP E;  5C3I C;  3LZ0 C;  3B6F D;  3V9R A;  2YFV B;  2HUE B;  4NE6 A;  3O62 C;  2FJ7 A;  3MGR B;  1P3F B;  3B6G A;  3AZM B;  1M18 C;  2ARO A;  3X1V B;  1KX3 D;  5CP6 B;  3MGS B;  5CPJ A;  2L5A A;  1P3K C;  4HGA B;  3X1S C;  4Z66 B;  5AV9 B;  4CSR A;  5B31 D;  3UTA A;  4R8P B;  1P3L B;  1ID3 C;  1B6W A;  5JRG C;  1P3A C;  4E45 A;  5B1M B;  5AV5 C;  4WU9 C;  4XZQ B;  5AVC C;  3UT9 C;  3WAA A;  4KUD B;  1M19 A;  4EO5 C;  1ZLA D;  3AV2 D;  1P3O A;  4XUJ C;  4ZUX C;  5B2I A;  5B0Z C;  5B33 B;  5AV8 A;  3W98 D;  3REI B;  2F8N H;  3AN2 A;  5F99 A;  5GT3 B;  5CPK C;  4J8U D;  5AV6 D;  1KX5 B;  3REK D;  1S32 C;  3AV1 A;  3V9R B;  3AZJ D;  4WU8 C;  1TZY B;  4KHA A;  1M18 B;  5AVB D;  1EQZ D;  2NZD B;  2RVQ C;  3AZG A;  1P3B A;  3TU4 D;  3R45 B;  3AZE C;  1M1A B;  3X1S B;  3LZ1 A;  1BH9 A;  3X1U C;  3UTB C;  3REJ D;  3REL B;  3W96 D;  1ID3 B;  3LEL C;  4J8V B;  3C1B A;  1P3M D;  5JRG B;  4M6B A;  4H9O B;  3AZN D;  4WU9 B;  2F8N K;  5AVC B;  4J8W A;  4H9S A;  4X23 C;  5BO0 B;  3B0B A;  1P34 A;  3A6N C;  4AWL C;  5GXQ A;  3AFA D;  3AZI D;  4ZUX B;  5B40 C;  3B6G D;  1AOI C;  2ARO D;  5DNN B;  3AZL D;  5B0Z B;  5B0Y A;  2NQB B;  5KDM A;  5GT0 C;  3LJA D;  3MNN A;  4WU8 B;  1P3P A;  3KWQ C;  1P3O D;  3AZE B;  1P3I C;  3AZK A;  1F66 D;  3C1C D;  5B2I D;  4YM6 A;  3X1U B;  4DRA A;  3LEL B;  3WTP B;  4J8X C;  4LD9 B;  1A7W A;  5AV8 D;  2YFV A;  5F99 D;  3MGP B;  3MGR A;  4X23 B;  4J8W B;  1P3F A;  5B2J D;  3B6F C;  3REH B;  3AZM A;  3AV1 D;  4AWL B;  4YS3 C;  3X1V A;  5CP6 A;  3MGS A;  1AOI B;  3KUY B;  4Z66 A;  5AV9 A;  1KX3 C;  1P3B D;  1P3L A;  4R8P A;  3LZ1 D; 
#chains in the Genus database with same CATH topology
 5B1M A;  4XZQ A;  5B31 C;  4QLC B;  4KUD A;  5CPI B;  4JJN D;  3W97 C;  2YFW B;  3MVD D;  3A1I A;  3AZH B;  1P3G D;  3F6T A;  2BYM B;  1ZLA C;  3AV2 C;  1P3I B;  5GXQ D;  3FDD A;  4Z5T B;  5B33 A;  3REI A;  4J8X B;  2ZY5 A;  5GT3 A;  5B0Y D;  3IP4 C;  1U35 D;  1KX5 A;  2Y2N A;  3W98 C;  3WKJ D;  2ZM5 A;  1TZY A;  1KU5 A;  5BS7 C;  4G92 C;  4J8U C;  1M18 A;  2LY8 A;  3W99 D;  3REK C;  4YS3 B;  3AZF D;  3AZJ C;  2NZD A;  5B32 D;  1HTA A;  3R45 A;  1P3P D;  4CAY B;  5BT1 D;  3KXB D;  2Y2P A;  3X1S A;  1M1A A;  1EQZ C;  1R4V A;  3REL A;  1ID3 A;  4J8V A;  3TU4 C;  4H9N B;  4KGC D;  5JRG A;  4H9O A;  3AYW C;  4WU9 A;  5AVC A;  3REJ C;  3W96 C;  1P3M C;  5BO0 A;  3AZN C;  5DNM D;  3MGR D;  3W97 B;  4ZUX A;  1P3F D;  1ZLA B;  3AV2 B;  1Q9C A;  3AZM D;  3X1V D;  5B1L C;  5DNN A;  4Z2M G;  3AFA C;  3AZI C;  5B0Z A;  1ULY A;  3MGS D;  5BNV B;  3B6G C;  3H0M C;  4H9P B;  2ARO C;  2CV5 B;  2NQB A;  1W2E A;  2PYO B;  4Z66 D;  5AV9 D;  3AZL C;  3X1T D;  4R8P D;  5C3I B;  3W98 B;  2F8N B;  3LZ0 B;  4WU8 A;  5B1M D;  5GSU D;  2HIO D;  4XZQ D;  3O62 B;  4G92 B;  3LJA C;  3REK B;  3AZJ B;  3MGQ D;  3VH5 W;  3AZE A;  1HQ3 C;  3X1U A;  1P3K B;  3NQU B;  3LEL A;  4G91 C;  3WTP A;  4LD9 A;  2DF4 C;  5B33 D;  3AYW B;  1F66 C;  3C1C C;  5B2I C;  3REI D;  1P3A B;  5E5A D;  3W96 B;  2IO5 C;  4E44 A;  5AV5 B;  5GT3 D;  4X23 A;  3MGP A;  1KX4 D;  3UT9 B;  3AZN B;  3WA9 C;  5AV8 C;  1KX5 D;  3REH A;  3A6N A;  4EO5 B;  5F99 C;  2Y2H A;  5B24 C;  4XUJ B;  2FJ7 D;  1TZY D;  1AOI A;  5B2J C;  4NE3 A;  5B1L B;  3KUY A;  3AZI B;  3AFA B;  2NZD D;  2ZY3 A;  1WWI A;  1TAF B;  1M1A D;  5CPJ D;  3AZL B;  3REL D;  1P3B C;  4J8V D;  4ZBJ C;  4QLC A;  3KFU G;  2ZY4 A;  5CPK B;  3UTA D;  5CPI A;  4WU9 D;  1S32 B;  2J8P A;  2VQR A;  3LJA B;  2YFW A;  3WAA D;  3AZH A;  4JJN C;  2BYM A;  1WWS A;  3NQJ B;  1M19 D;  1P3I A;  1N1J B;  4ZUX D;  5AY8 C;  3MVD C;  1HQ3 B;  4Z5T A;  1P3G C;  4G91 B;  5DNN D;  3VH6 W;  4J8X A;  3UTB B;  1F66 B;  2CWE A;  3C1C B;  1H3O B;  4WJ3 C;  2NQB D;  2FFF B;  2G5H C;  3AN2 D;  4NE5 A;  5B0Y C;  3WA9 B;  5G49 B;  1U35 C;  4YS3 A;  3VH5 A;  5B24 B;  3WKJ C;  3A6N B;  4H9Q B;  4DQY B;  4CAY A;  5B40 B;  3W99 C;  3AZF C;  2RVQ D;  5B32 C;  3AZE D;  4H9N A;  5BT1 C;  3KXB C;  3AZG D;  4WNN B;  3LEL D;  5GT0 B;  3WTP D;  4LD9 D;  4KGC C;  3C1B D;  4H9R B;  3W97 A;  3MGP D;  3H0L C;  3H0R C;  4J8W D;  4JJN B;  1ZLA A;  3REH D;  3AV2 A;  3KWQ B;  3VH5 T;  5DNM C;  5JA4 B;  5AY8 B;  3MVD B;  3MGR C;  1P34 D;  1P3G B;  5BNV A;  2BYK B;  2XD5 A;  1JFI B;  3AZM C;  4H9P A;  3X1V C;  3KUY D;  2CV5 A;  2PYO A;  3MGS C;  2F8N G;  3W98 A;  2F8N A;  3LZ0 A;  4Z66 C;  2RIQ A;  5AV9 C;  3O62 A;  5BS7 A;  4R8P C;  3X1T C;  3REK A;  3KSY A;  4QLC D;  5CPI D;  3B6F B;  3AZJ A;  5AV6 C;  5B1M C;  5GSU C;  2HIO C;  4XZQ C;  3MNN D;  1PZR A;  3AZF B;  3AZH D;  1P3K A;  3VH6 A;  5AVB C;  5B32 B;  3MGQ C;  3NQU A;  1KX3 B;  2Y2O A;  3KXB B;  4Z5T D;  3AYW A;  4NFT A;  3W96 A;  3AZK D;  1P3A A;  2ZY2 A;  4YM6 D;  5AV5 A;  4KGC B;  5B31 B;  3UT9 A;  5B33 C;  3AZN A;  3REI C;  5E5A C;  5GT3 C;  4XUJ A;  1KX4 C;  2DQN C;  1KX5 C;  4YS3 D;  5B1L A;  5DNM B;  3AZI A;  3AFA A;  3EPK A;  2FJ7 C;  1TZY C;  1TAF A;  5CP6 D;  3AZL A;  3VH6 T;  2NZD C;  1B67 A;  5CPK A;  4UUZ B;  5CPJ C;  1P3L D;  1M1A C;  1S32 A;  3REL C;  5FUG B;  3X1T B;  3LJA A;  3AL0 C;  4J8V C;  4J8U B;  3UTA C;  5AV6 B;  5GSU B;  2HIO B;  4KUD D;  2W8S A;  3NQJ A;  3W97 D;  1N1J A;  2BG1 A;  1HQ3 A;  3WAA C;  5AVB B;  1BH8 B;  3MGQ B;  2Y2K A;  1M19 C;  2Y2M A;  1EQZ B;  3UTB A;  2Y2Q A;  4DRB A;  1F66 A;  1P3O C;  3C1C A;  3TU4 B;  1H3O A;  2CV5 D;  2PYO D;  5DNN C;  3REJ B;  3WA9 A;  5G49 A;  1P3M B;  5E5A B;  3LZ0 D;  2F8N D;  2NQB C;  5B24 A;  1KX4 B;  3O62 D;  5BNX B;  3AN2 C;  4H9Q A;  5B2J A;  3B0C W;  5B40 A;  3EPJ A;  3B0D C;  1M18 D;  2FJ7 B;  3AV1 C;  3B6G B;  1P3K D;  2ARO B;  4WNN A;  3X1S D;  5GT0 A;  5CPJ B;  3AYW D;  3AZG C;  1ID3 D;  2F2A C;  5JRG D;  1P3A D;  4H9R A;  3LZ1 C;  4CSR B;  5AV5 D;  3WTP C;  4LD9 C;  5AVC D;  3UT9 D;  3UTA B;  4JJN A;  3C1B C;  3KWQ A;  3MGP C;  5JA4 A;  5AY8 A;  3A1K A;  2Y2J A;  4XUJ D;  3MVD A;  4J8W C;  4H9S C;  1P3G A;  1JFI A;  2BYK A;  3WAA B;  1M19 B;  3REH C;  5B1L D;  2Y2G A;  1P3O B;  1P34 C;  4UPK A;  5GXQ C;  5B0Z D;  4Z2M H;  3KUY C;  5B2I B;  2IO5 B;  1U35 A;  5CPK D;  3B6F A;  5AV8 B;  1S32 D;  3WKJ A;  3AN2 B;  5F99 B;  3EG5 B;  4WU8 D;  3W99 A;  4QLC C;  3B0D B;  5B32 G;  5B2J B;  5CPI C;  3AZF A;  4WZS B;  3AV1 B;  5B32 A;  3MNN C;  1KX3 A;  4WV4 B;  3KXB A;  4KHA B;  1HQ3 D;  2JCH A;  3AZH C;  1P3P C;  5B31 G;  3UTB D;  3X1U D;  4KGC A;  5B31 A;  3AZG B;  1P3B B;  4Z5T C;  4ZBJ B;  3AZK C;  3LZ1 B;  1BH9 B;  4YM6 C;  3WA9 D;  3C1B B;  4X23 D;  5DNM A;  5B24 D;  3A6N D;  2HUE C;  5B40 D;  1P3F C;  1AOI D;  2JSS A;  1P34 B;  1BFM A;  5GXQ B;  5CP6 C;  4UUZ A;  1F1E A;  4HGA C;  5FUG A;  5GT0 D;  2Y2I A;  3X1T A;  5B0Y B;  4J8U A;  1U35 B;  5AV6 A;  1P3L C;  5GSU A;  2HIO A;  5KDM B;  3B0C T;  3WKJ B;  5CHL B;  3W99 B;  5AVB A;  1BH8 A;  3MGQ A;  3MNN B;  3KWQ D;  2UWX A;  1EQZ A;  4KUD C;  5AY8 D;  3TU4 A;  1P3I D;  1P3P B;  3P5J B;  3EPH A;  3REJ A;  2XD1 A;  4J8X D;  1P3M A;  3AZK B;  5E5A A;  2CV5 C;  2PYO C;  4YM6 B;  2Y2L A;  1KX4 A;  5BNX A;  3WTP E;  5C3I C;  3LZ0 C;  3B6F D;  3V9R A;  2YFV B;  1T3U A;  2HUE B;  4NE6 A;  3O62 C;  2FJ7 A;  3MGR B;  1P3F B;  3B6G A;  3AZM B;  1M18 C;  2ARO A;  3X1V B;  1KX3 D;  5CP6 B;  3MGS B;  5CPJ A;  2L5A A;  1P3K C;  4HGA B;  3X1S C;  4Z66 B;  5AV9 B;  4CSR A;  5B31 D;  3UTA A;  4R8P B;  1P3L B;  1ID3 C;  1B6W A;  5JRG C;  1P3A C;  4E45 A;  5B1M B;  5AV5 C;  4WU9 C;  4XZQ B;  5AVC C;  3UT9 C;  3WAA A;  4KUD B;  1M19 A;  4EO5 C;  1ZLA D;  3AV2 D;  1P3O A;  4XUJ C;  4ZUX C;  5B2I A;  5B0Z C;  5B33 B;  5AV8 A;  3W98 D;  3REI B;  2F8N H;  3AN2 A;  5F99 A;  5GT3 B;  5CPK C;  4J8U D;  5AV6 D;  1KX5 B;  3REK D;  1S32 C;  3AV1 A;  3V9R B;  3AZJ D;  4WU8 C;  1TZY B;  4KHA A;  1M18 B;  5AVB D;  1EQZ D;  2NZD B;  2RVQ C;  3AZG A;  2JE5 A;  3TU4 D;  3R45 B;  3AZE C;  1P3B A;  3EPL A;  1M1A B;  3X1S B;  3LZ1 A;  1BH9 A;  3X1U C;  3UTB C;  3REJ D;  3REL B;  3W96 D;  1ID3 B;  3LEL C;  4J8V B;  1Z2C B;  3C1B A;  5JRG B;  4M6B A;  1P3M D;  4H9O B;  3AZN D;  4WU9 B;  2F8N K;  5AVC B;  4J8W A;  4H9S A;  4X23 C;  5BO0 B;  3B0B A;  1P34 A;  3A6N C;  4AWL C;  5GXQ A;  3AFA D;  3AZI D;  4ZUX B;  5B40 C;  3B6G D;  1AOI C;  2ARO D;  5DNN B;  3AZL D;  5B0Z B;  5B0Y A;  2G5I C;  2NQB B;  5KDM A;  5GT0 C;  3LJA D;  3MNN A;  4WU8 B;  1P3P A;  3KWQ C;  1P3O D;  3AZE B;  1P3I C;  3AZK A;  1F66 D;  3C1C D;  5B2I D;  4YM6 A;  3X1U B;  4DRA A;  3LEL B;  3WTP B;  4J8X C;  4LD9 B;  1A7W A;  5AV8 D;  2YFV A;  5F99 D;  3MGP B;  3MGR A;  4X23 B;  4J8W B;  1P3F A;  5B2J D;  3B6F C;  3REH B;  3AZM A;  3AV1 D;  4AWL B;  4YS3 C;  3X1V A;  5CP6 A;  3MGS A;  1AOI B;  3KUY B;  4Z66 A;  5AV9 A;  1KX3 C;  1P3B D;  1P3L A;  4R8P A;  3LZ1 D; 
#chains in the Genus database with same CATH homology
 5B1M A;  4XZQ A;  5B31 C;  4QLC B;  4KUD A;  5CPI B;  4JJN D;  3W97 C;  2YFW B;  3MVD D;  3A1I A;  3AZH B;  1P3G D;  3F6T A;  2BYM B;  1ZLA C;  3AV2 C;  1P3I B;  5GXQ D;  3FDD A;  4Z5T B;  5B33 A;  3REI A;  4J8X B;  2ZY5 A;  5GT3 A;  5B0Y D;  3IP4 C;  1U35 D;  1KX5 A;  2Y2N A;  3W98 C;  3WKJ D;  2ZM5 A;  1TZY A;  1KU5 A;  5BS7 C;  4G92 C;  4J8U C;  1M18 A;  2LY8 A;  3W99 D;  3REK C;  4YS3 B;  3AZF D;  3AZJ C;  2NZD A;  5B32 D;  1HTA A;  3R45 A;  1P3P D;  4CAY B;  5BT1 D;  3KXB D;  2Y2P A;  3X1S A;  1M1A A;  1EQZ C;  1R4V A;  3REL A;  1ID3 A;  4J8V A;  3TU4 C;  4H9N B;  4KGC D;  5JRG A;  4H9O A;  3AYW C;  4WU9 A;  5AVC A;  3REJ C;  3W96 C;  1P3M C;  5BO0 A;  3AZN C;  5DNM D;  3MGR D;  3W97 B;  4ZUX A;  1P3F D;  1ZLA B;  3AV2 B;  1Q9C A;  3AZM D;  3X1V D;  5B1L C;  5DNN A;  4Z2M G;  3AFA C;  3AZI C;  5B0Z A;  1ULY A;  3MGS D;  5BNV B;  3B6G C;  3H0M C;  4H9P B;  2ARO C;  2CV5 B;  2NQB A;  1W2E A;  2PYO B;  4Z66 D;  5AV9 D;  3AZL C;  3X1T D;  4R8P D;  5C3I B;  3W98 B;  2F8N B;  3LZ0 B;  4WU8 A;  5B1M D;  5GSU D;  2HIO D;  4XZQ D;  3O62 B;  4G92 B;  3LJA C;  3REK B;  3AZJ B;  3MGQ D;  3VH5 W;  3AZE A;  1HQ3 C;  3X1U A;  1P3K B;  3NQU B;  3LEL A;  4G91 C;  3WTP A;  4LD9 A;  2DF4 C;  5B33 D;  3AYW B;  1F66 C;  3C1C C;  5B2I C;  3REI D;  1P3A B;  5E5A D;  3W96 B;  2IO5 C;  4E44 A;  5AV5 B;  5GT3 D;  4X23 A;  3MGP A;  1KX4 D;  3UT9 B;  3AZN B;  3WA9 C;  5AV8 C;  1KX5 D;  3REH A;  3A6N A;  4EO5 B;  5F99 C;  2Y2H A;  5B24 C;  4XUJ B;  2FJ7 D;  1TZY D;  1AOI A;  5B2J C;  4NE3 A;  5B1L B;  3KUY A;  3AZI B;  3AFA B;  2NZD D;  2ZY3 A;  1WWI A;  1TAF B;  1M1A D;  5CPJ D;  3AZL B;  3REL D;  1P3B C;  4J8V D;  4ZBJ C;  4QLC A;  3KFU G;  2ZY4 A;  5CPK B;  3UTA D;  5CPI A;  4WU9 D;  1S32 B;  2J8P A;  2VQR A;  3LJA B;  2YFW A;  3WAA D;  3AZH A;  4JJN C;  2BYM A;  1WWS A;  3NQJ B;  1M19 D;  1P3I A;  1N1J B;  4ZUX D;  5AY8 C;  3MVD C;  1HQ3 B;  4Z5T A;  1P3G C;  4G91 B;  5DNN D;  3VH6 W;  4J8X A;  3UTB B;  1F66 B;  2CWE A;  3C1C B;  1H3O B;  4WJ3 C;  2NQB D;  2FFF B;  2G5H C;  3AN2 D;  4NE5 A;  5B0Y C;  3WA9 B;  5G49 B;  1U35 C;  4YS3 A;  3VH5 A;  5B24 B;  3WKJ C;  3A6N B;  4H9Q B;  4DQY B;  4CAY A;  5B40 B;  3W99 C;  3AZF C;  2RVQ D;  5B32 C;  3AZE D;  4H9N A;  5BT1 C;  3KXB C;  3AZG D;  4WNN B;  3LEL D;  5GT0 B;  3WTP D;  4LD9 D;  4KGC C;  3C1B D;  4H9R B;  3W97 A;  3MGP D;  3H0L C;  3H0R C;  4J8W D;  4JJN B;  1ZLA A;  3REH D;  3AV2 A;  3KWQ B;  3VH5 T;  5DNM C;  5JA4 B;  5AY8 B;  3MVD B;  3MGR C;  1P34 D;  1P3G B;  5BNV A;  2BYK B;  2XD5 A;  1JFI B;  3AZM C;  4H9P A;  3X1V C;  3KUY D;  2CV5 A;  2PYO A;  3MGS C;  2F8N G;  3W98 A;  2F8N A;  3LZ0 A;  4Z66 C;  2RIQ A;  5AV9 C;  3O62 A;  5BS7 A;  4R8P C;  3X1T C;  3REK A;  3KSY A;  4QLC D;  5CPI D;  3B6F B;  3AZJ A;  5AV6 C;  5B1M C;  5GSU C;  2HIO C;  4XZQ C;  3MNN D;  1PZR A;  3AZF B;  3AZH D;  1P3K A;  3VH6 A;  5AVB C;  5B32 B;  3MGQ C;  3NQU A;  1KX3 B;  2Y2O A;  3KXB B;  4Z5T D;  3AYW A;  4NFT A;  3W96 A;  3AZK D;  1P3A A;  2ZY2 A;  4YM6 D;  5AV5 A;  4KGC B;  5B31 B;  3UT9 A;  5B33 C;  3AZN A;  3REI C;  5E5A C;  5GT3 C;  4XUJ A;  1KX4 C;  2DQN C;  1KX5 C;  4YS3 D;  5B1L A;  5DNM B;  3AZI A;  3AFA A;  3EPK A;  2FJ7 C;  1TZY C;  1TAF A;  5CP6 D;  3AZL A;  3VH6 T;  2NZD C;  1B67 A;  5CPK A;  4UUZ B;  5CPJ C;  1P3L D;  1M1A C;  1S32 A;  3REL C;  5FUG B;  3X1T B;  3LJA A;  3AL0 C;  4J8V C;  4J8U B;  3UTA C;  5AV6 B;  5GSU B;  2HIO B;  4KUD D;  2W8S A;  3NQJ A;  3W97 D;  1N1J A;  2BG1 A;  1HQ3 A;  3WAA C;  5AVB B;  1BH8 B;  3MGQ B;  2Y2K A;  1M19 C;  2Y2M A;  1EQZ B;  3UTB A;  2Y2Q A;  4DRB A;  1F66 A;  1P3O C;  3C1C A;  3TU4 B;  1H3O A;  2CV5 D;  2PYO D;  5DNN C;  3REJ B;  3WA9 A;  5G49 A;  1P3M B;  5E5A B;  3LZ0 D;  2F8N D;  2NQB C;  5B24 A;  1KX4 B;  3O62 D;  5BNX B;  3AN2 C;  4H9Q A;  5B2J A;  3B0C W;  5B40 A;  3EPJ A;  3B0D C;  1M18 D;  2FJ7 B;  3AV1 C;  3B6G B;  1P3K D;  2ARO B;  4WNN A;  3X1S D;  5GT0 A;  5CPJ B;  3AYW D;  3AZG C;  1ID3 D;  2F2A C;  5JRG D;  1P3A D;  4H9R A;  3LZ1 C;  4CSR B;  5AV5 D;  3WTP C;  4LD9 C;  5AVC D;  3UT9 D;  3UTA B;  4JJN A;  3C1B C;  3KWQ A;  3MGP C;  5JA4 A;  5AY8 A;  3A1K A;  2Y2J A;  4XUJ D;  3MVD A;  4J8W C;  4H9S C;  1P3G A;  1JFI A;  2BYK A;  3WAA B;  1M19 B;  3REH C;  5B1L D;  2Y2G A;  1P3O B;  1P34 C;  4UPK A;  5GXQ C;  5B0Z D;  4Z2M H;  3KUY C;  5B2I B;  2IO5 B;  1U35 A;  5CPK D;  3B6F A;  5AV8 B;  1S32 D;  3WKJ A;  3AN2 B;  5F99 B;  3EG5 B;  4WU8 D;  3W99 A;  4QLC C;  3B0D B;  5B32 G;  5B2J B;  5CPI C;  3AZF A;  4WZS B;  3AV1 B;  5B32 A;  3MNN C;  1KX3 A;  4WV4 B;  3KXB A;  4KHA B;  1HQ3 D;  2JCH A;  3AZH C;  1P3P C;  5B31 G;  3UTB D;  3X1U D;  4KGC A;  5B31 A;  3AZG B;  1P3B B;  4Z5T C;  4ZBJ B;  3AZK C;  3LZ1 B;  1BH9 B;  4YM6 C;  3WA9 D;  3C1B B;  4X23 D;  5DNM A;  5B24 D;  3A6N D;  2HUE C;  5B40 D;  1P3F C;  1AOI D;  2JSS A;  1P34 B;  1BFM A;  5GXQ B;  5CP6 C;  4UUZ A;  1F1E A;  4HGA C;  5FUG A;  5GT0 D;  2Y2I A;  3X1T A;  5B0Y B;  4J8U A;  1U35 B;  5AV6 A;  1P3L C;  5GSU A;  2HIO A;  5KDM B;  3B0C T;  3WKJ B;  5CHL B;  3W99 B;  5AVB A;  1BH8 A;  3MGQ A;  3MNN B;  3KWQ D;  2UWX A;  1EQZ A;  4KUD C;  5AY8 D;  3TU4 A;  1P3I D;  1P3P B;  3P5J B;  3EPH A;  3REJ A;  2XD1 A;  4J8X D;  1P3M A;  3AZK B;  5E5A A;  2CV5 C;  2PYO C;  4YM6 B;  2Y2L A;  1KX4 A;  5BNX A;  3WTP E;  5C3I C;  3LZ0 C;  3B6F D;  3V9R A;  2YFV B;  1T3U A;  2HUE B;  4NE6 A;  3O62 C;  2FJ7 A;  3MGR B;  1P3F B;  3B6G A;  3AZM B;  1M18 C;  2ARO A;  3X1V B;  1KX3 D;  5CP6 B;  3MGS B;  5CPJ A;  2L5A A;  1P3K C;  4HGA B;  3X1S C;  4Z66 B;  5AV9 B;  4CSR A;  5B31 D;  3UTA A;  4R8P B;  1P3L B;  1ID3 C;  1B6W A;  5JRG C;  1P3A C;  4E45 A;  5B1M B;  5AV5 C;  4WU9 C;  4XZQ B;  5AVC C;  3UT9 C;  3WAA A;  4KUD B;  1M19 A;  4EO5 C;  1ZLA D;  3AV2 D;  1P3O A;  4XUJ C;  4ZUX C;  5B2I A;  5B0Z C;  5B33 B;  5AV8 A;  3W98 D;  3REI B;  2F8N H;  3AN2 A;  5F99 A;  5GT3 B;  5CPK C;  4J8U D;  5AV6 D;  1KX5 B;  3REK D;  1S32 C;  3AV1 A;  3V9R B;  3AZJ D;  4WU8 C;  1TZY B;  4KHA A;  1M18 B;  5AVB D;  1EQZ D;  2NZD B;  2RVQ C;  3AZG A;  2JE5 A;  3TU4 D;  3R45 B;  3AZE C;  1P3B A;  3EPL A;  1M1A B;  3X1S B;  3LZ1 A;  1BH9 A;  3X1U C;  3UTB C;  3REJ D;  3REL B;  3W96 D;  1ID3 B;  3LEL C;  4J8V B;  1Z2C B;  3C1B A;  5JRG B;  4M6B A;  1P3M D;  4H9O B;  3AZN D;  4WU9 B;  2F8N K;  5AVC B;  4J8W A;  4H9S A;  4X23 C;  5BO0 B;  3B0B A;  1P34 A;  3A6N C;  4AWL C;  5GXQ A;  3AFA D;  3AZI D;  4ZUX B;  5B40 C;  3B6G D;  1AOI C;  2ARO D;  5DNN B;  3AZL D;  5B0Z B;  5B0Y A;  2G5I C;  2NQB B;  5KDM A;  5GT0 C;  3LJA D;  3MNN A;  4WU8 B;  1P3P A;  3KWQ C;  1P3O D;  3AZE B;  1P3I C;  3AZK A;  1F66 D;  3C1C D;  5B2I D;  4YM6 A;  3X1U B;  4DRA A;  3LEL B;  3WTP B;  4J8X C;  4LD9 B;  1A7W A;  5AV8 D;  2YFV A;  5F99 D;  3MGP B;  3MGR A;  4X23 B;  4J8W B;  1P3F A;  5B2J D;  3B6F C;  3REH B;  3AZM A;  3AV1 D;  4AWL B;  4YS3 C;  3X1V A;  5CP6 A;  3MGS A;  1AOI B;  3KUY B;  4Z66 A;  5AV9 A;  1KX3 C;  1P3B D;  1P3L A;  4R8P A;  3LZ1 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...