1P3MD

Crystallographic studies of nucleosome core particles containing histone 'sin' mutants
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
92
structure length
92
Chain Sequence
KESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Palindromic 146bp Human Alpha-Satellite DNA fragment
publication title Crystal structures of histone Sin mutant nucleosomes reveal altered protein-DNA interactions
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 33
structure length 92
sequence length 92
chains with identical sequence H
ec nomenclature
pdb deposition date 2003-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1p3mD00
4JJNC 5DNMC 1AOIA 5BNVA 4YS3C 1EQZA 1M18B 5F99B 3VH5A 3X1SB 1P3OD 4YS3A 4Z66A 3B6FC 5AY8B 3KUYB 2NZDC 3AZIC 2NQBD 3AZEC 3B6FA 5AV9C 3LZ1C 3REKC 3C1CB 5B2JA 3AZIA 4CSRA 5B24B 4J8VD 5B1MC 1P3KC 3LZ1A 3MVDB 1ULYA 4UUZB 3REKA 4X23C 3VH6A 2NQBB 3AZLD 4Z5TB 3AZGA 4WU8C 5G49B 4J8VB 1U35D 5AV8A 3WKJA 3V9RA 3AZLB 3LJAB 3AV2C 3KWQC 4J8UC 3WTPC 3VH5T 1KX3C 3O62A 3AZMA 1U35B 2JSSA 3REHB 5B0YA 4CAYB 4J8UA 3W96A 3WTPA 1BH9A 1BH8A 1KX3A 3X1TC 4EO5B 5F99C 1HTAA 3X1SC 2L5AA 3X1TA 4XZQB 5AY8C 3KUYC 3VH6T 4H9PA 3LZ0A 3C1CC 1KX4D 5BO0A 5B24C 1HQ3B 1KX5D 3MVDC 1P3BB 3WTPE 5CP6D 5B0ZC 3MNNA 4Z5TC 2BYMA 3W97D 4QLCD 5B0ZA 5CP6B 5AV5C 1P3LD 5JRGC 3LJAC 5AV5A 5JRGA 3LJAA 2HIOD 3REHC 2AROB 3AZNB 4J8WA 3AZJA 5GSUA 3AFAD 2HIOB 2YFVA 4XZQC 3W99C 5KDMB 5AVBC 3W99A 4XUJD 5B31A 5AVBA 3UTBD 4KHAB 1HQ3C 1P34A 5GT0C 1P3BC 1M19D 1P3PA 3AZFD 2YFWA 1P3MA 1HQ3A 5CPJD 2CV5A 5GT0A 2F8NA 2FJ7B 3NQJB 3UT9C 3AZHA 5CPJB 1M1AD 3UT9A 5B33C 3MGSA 5AV6D 3KXBC 1F1EA 5B33A 3X1VD 2AROC 4AWLC 3B0DB 3AZNC 3KXBA 1ID3B 5B40D 5GT3B 5DNND 4ZBJB 3X1VB 3MGPD 5B1LA 5CPIB 2PYOA 3AV1D 3REJB 4LD9A 3MGPB 3C1BB 1H3OA 1F66A 4E45A 3AN2D 5E5AC 4KGCD 5B2IB 1P3AD 5E5AA 1P3GB 2FJ7C 2HUEB 4Z2MG 3MGQD 1TZYC 3AYWC 1P3AB 3R45B 4YM6A 3UTAD 1TZYA 4ZUXC 3AYWA 1AOID 5GXQA 4NFTA 5B32D 4ZUXA 3B0DC 4Z66D 1ID3C 5AVCA 4H9QB 3W98A 5GT3C 4M6BA 5B32B 4R8PB 3X1UA 1P3IA 5CPIC 3B6GB 5B2JD 3REID 3TU4C 3LZ1D 3LELB 2BYKB 5B31G 3REJC 5BNXA 3C1BC 3AZGD 3TU4A 4WU9B 4KUDA 3REIB 4H9RA 5B2IC 5AV8D 3C1BA 3WKJD 4NE3A 3B0CW 5DNMA 4JJNA 5CPKB 1P3GC 2HUEC 3O62D 3AZMD 5B0YD 4J8UD 1P3GA 1P3OB 3W96D 3WA9C 2NZDA 3AZEA 5AV9A 1P3FD 3WA9A 4J8XD 5B1MA 4H9NB 1P3KA 4X23A 1TAFB 2RVQC 1Q9CA 4WU8A 4J8XB 4R8PC 3B6GC 3LZ0D 4H9QA 3LELC 3B6GA 3NQUA 3A6NC 3AV2A 3MNND 3KWQA 1N1JB 4WU9C 5BT1C 3A6NA 4WNNB 1M18C 1JFIA 5CPKC 3WAAD 1M18A 4H9SC 5F99A 3X1SA 5AY8A 3KUYA 4H9SA 1P3OC 4J8WD 3AZJD 5GSUD 1S32D 3C1CA 2NQBC 1KX4B 5B24A 3MVDA 4UUZA 2NQBA 1KX5B 4J8VC 1S32B 4Z5TA 3AZLC 5G49A 5B31D 4J8VA 3W97B 1P34D 3AZLA 4QLCB 1U35C 1P3PD 1P3LB 1P3MD 1U35A 2CV5D 5FUGB 4H9OB 3REHA 4CAYA 4EO5C 3AZHD 3AZKD 5JA4B 3AFAB 3MGSD 1ZLAD 4XZQA 3AZKB 5B33D 3MGRD 1ZLAB 4XUJB 1KX4C 3MGRB 3UTBB 5B1LD 1P3BA 4DRBA 1KX5C 2PYOD 1M19B 5CP6C 3AZFB 4LD9D 5CP6A 4QLCC 1F66D 1P3LC 4QLCA 1M1AB 5AV6B 2HIOC 2AROA 3AZNA 4YM6D 3RELD 1B67A 1WWIA 2HIOA 3AFAC 5GXQD 5B40B 4E44A 5DNNB 5KDMA 5C3IB 5AVCD 3B0BA 2F8NK 3W98D 4XUJC 3AV1B 4KHAA 3X1UD 3UTBC 1P3ID 2IO5B 4KGCB 3AN2B 3AZFC 5CPJC 2FJ7A 3NQJA 4KUDD 1EQZD 3MGQB 5CPJA 4JJND 5DNMD 4YS3D 3UTAB 1M1AC 1AOIB 1EQZB 5AV6C 5BNVB 4ZBJC 3B6FD 3X1VC 1ID3A 2NZDD 4Z66B 3AZID 5GT3A 3AZED 5B40C 5AV9D 3REKD 3X1VA 5DNNC 5CPIA 4G92B 3B6FB 3MGPC 5C3IC 5B1MD 5B2JB 1P3KD 4CSRB 4X23D 3REJA 3LZ1B 3MGPA 1A7WA 4WV4B 3AV1C 4WU8D 3AZGB 5B2IA 2F8NG 2IO5C 4Z2MH 4KGCC 3AN2C 5AV8B 1P3AC 3V9RB 3WKJB 3AV2D 3KWQD 3WTPD 1KX3D 3A6ND 1P3AA 3MGQC 3R45A 3O62B 3AZMB 5B0YB 5BT1D 3VH5W 4J8UB 3W96B 1BH8B 1BH9B 3X1TD 3UTAC 1M18D 1KX3B 1AOIC 5F99D 3X1SD 4DRAA 1P3FB 3UTAA 5AY8D 5B32C 3KUYD 3X1TB 4Z66C 5B32A 4R8PA 3C1CD 4G92C 4H9PB 3VH6W 3LZ0B 5B24D 5B2JC 3LELA 3MVDD 5BO0B 2BYKA 3REIC 5B0ZD 4Z5TD 4WU9A 3MNNB 3REIA 3AZGC 3B0CT 2BYMB 2F8NH 5AV5D 5B0ZB 5AV8C 5JRGD 3LJAD 4G91B 5CPKA 3WKJC 3WAAB 1JFIB 4HGAB 2CWEA 5AV5B 3REHD 3O62C 1B6WA 3AZMC 5JRGB 1P3OA 5B0YC 3W96C 3KSYA 4J8WB 3AZJB 5GSUB 1P3FC 4H9NA 4XZQD 4J8XC 3W99D 2YFVB 5AVBD 1TAFA 1P3FA 4J8XA 5BS7C 3W99B 5B31B 4NE5A 3LZ0C 1HQ3D 5AVBB 5GT0D 1P3BD 5BS7A 1P34B 2F8ND 1N1JA 1P3PB 1KU5A 3MNNC 2YFWB 1P3MB 4WNNA 2CV5B 5GT0B 3UT9D 2F8NB 4G91C 3AZHB 3WAAC 4HGAC 3KXBD 3UT9B 3MGSB 3WAAA 2AROD 3AZND 5B33B 3KXBB 4J8WC 3AZJC 5GSUC 1S32C 1KX4A 4AWLB 1KX5A 3W97C 5B1LB 1S32A 2PYOB 5B32G 3W97A 5B31C 4LD9B 5E5AD 1H3OB 4NE6A 1P34C 1P3LA 1F66B 1P3PC 5FUGA 1P3MC 4H9OA 2CV5C 2FJ7D 4WZSB 5E5AB 1TZYD 3AYWD 3AZHC 4YM6B 3RELB 5JA4A 3AZKC 4ZUXD 3AFAA 1TZYB 2LY8A 3MGSC 3AYWB 5GXQB 3AZKA 1ZLAC 1ID3D 4ZUXB 3MGRC 1ZLAA 5AVCB 5GT3D 1BFMA 4XUJA 1M19C 3W98B 3MGRA 3UTBA 5CPID 3X1UB 1P3IB 5B1LC 3TU4D 1M19A 2PYOC 3AZFA 3REJD 3C1BD 4LD9C 5BNXB 1R4VA 3TU4B 5B2ID 4KUDB 1F66C 4H9RB 1M1AA 1P3GD 4JJNB 5DNMB 5AV6A 4YS3B 5CHLB 3WA9D 4YM6C 1WWSA 3RELC 2NZDB 5B40A 3AZIB 5DNNA 5GXQC 3AZEB 3RELA 5AV9B 3REKB 3WA9B 5B1MB 1P3KB 2RVQD 5AVCC 4X23B 3AV1A 4R8PD 3B6GD 3W98C 4WU8B 3X1UC 1P3IC 4KGCA 3AN2A 3LELD 3NQUB 4WU9D 3AV2B 3KWQB 3WTPB 3MGQA 4KUDC 3A6NB 1EQZC 5CPKD
chains in the Genus database with same CATH superfamily
4JJNC 5DNMC 1AOIA 5BNVA 4YS3C 1EQZA 1M18B 5F99B 3VH5A 3X1SB 1P3OD 4YS3A 2J8PA 4Z66A 5AY8B 3KUYB 3B6FC 2NZDC 3AZIC 2NQBD 3AZEC 3H0MC 3B6FA 5AV9C 3LZ1C 3REKC 3C1CB 5B2JA 3AZIA 4CSRA 5B24B 4J8VD 4UPKA 5B1MC 3LZ1A 3MVDB 1ULYA 4UUZB 3REKA 4X23C 3VH6A 1P3KC 2NQBB 3AZLD 4Z5TB 3AZGA 4WU8C 5G49B 4J8VB 1U35D 5AV8A 3WKJA 3V9RA 3AZLB 3LJAB 3AV2C 3KWQC 4J8UC 3WTPC 3EPHA 3VH5T 1KX3C 3O62A 3AZMA 1U35B 2JSSA 3REHB 5B0YA 2Y2LA 4CAYB 4J8UA 3W96A 3WTPA 1BH9A 1BH8A 1KX3A 2VQRA 3X1TC 4EO5B 5F99C 1HTAA 3X1SC 2L5AA 3X1TA 4XZQB 5AY8C 3KUYC 3VH6T 3EPKA 4H9PA 3LZ0A 3C1CC 1KX4D 5BO0A 5B24C 1HQ3B 1KX5D 3MVDC 2Y2IA 3WTPE 1P3BB 5CP6D 5B0ZC 3MNNA 4Z5TC 2BYMA 3W97D 4QLCD 5B0ZA 5CP6B 5AV5C 1P3LD 2ZY2A 5JRGC 3LJAC 2FFFB 5AV5A 5JRGA 3LJAA 2HIOD 3REHC 2AROB 3AZNB 4J8WA 3AZJA 5GSUA 3AFAD 2HIOB 2YFVA 4DQYB 4XZQC 3W99C 5KDMB 2G5HC 5AVBC 3W99A 4XUJD 5B31A 5AVBA 3UTBD 4KHAB 1HQ3C 1P34A 5GT0C 1P3BC 1M19D 1P3PA 3AZFD 2YFWA 1P3MA 1HQ3A 2Y2OA 5CPJD 5GT0A 2CV5A 2F8NA 2FJ7B 3NQJB 3UT9C 3AZHA 2ZY3A 5CPJB 3KFUG 1M1AD 3UT9A 5B33C 3MGSA 2Y2GA 5AV6D 3KXBC 1F1EA 5B33A 3X1VD 2AROC 4AWLC 3B0DB 3AZNC 3KXBA 1ID3B 5B40D 5GT3B 5DNND 4ZBJB 3X1VB 3MGPD 2JE5A 5B1LA 5CPIB 2PYOA 3AV1D 3REJB 4LD9A 3MGPB 3C1BB 1H3OA 1F66A 4E45A 3AN2D 5E5AC 4KGCD 5B2IB 3F6TA 1P3AD 5E5AA 1P3GB 2FJ7C 2HUEB 4Z2MG 3MGQD 1TZYC 3AYWC 1P3AB 3R45B 4YM6A 3UTAD 1TZYA 4ZUXC 3AYWA 1AOID 2BG1A 5GXQA 4NFTA 5B32D 4ZUXA 3B0DC 4Z66D 1ID3C 5AVCA 4H9QB 3W98A 5GT3C 4M6BA 5B32B 4R8PB 3X1UA 1P3IA 5CPIC 3B6GB 5B2JD 3REID 3TU4C 3LZ1D 3LELB 2BYKB 5B31G 3REJC 2Y2HA 5BNXA 3C1BC 3AZGD 3TU4A 4WU9B 2DF4C 4KUDA 3REIB 3AL0C 4H9RA 5B2IC 5AV8D 3C1BA 3WKJD 4NE3A 3B0CW 5DNMA 4JJNA 5CPKB 1P3GC 2HUEC 3O62D 3AZMD 5B0YD 4J8UD 1P3GA 1P3OB 3W96D 3WA9C 2NZDA 3P5JB 3AZEA 5AV9A 1P3FD 3WA9A 4J8XD 5B1MA 4H9NB 1P3KA 4X23A 1TAFB 2RVQC 1Q9CA 4WU8A 4J8XB 4R8PC 3B6GC 3LZ0D 4H9QA 3LELC 3B6GA 3NQUA 3A6NC 3AV2A 3MNND 3KWQA 1N1JB 4WU9C 5BT1C 3A6NA 4WNNB 1M18C 1JFIA 5CPKC 3WAAD 1M18A 4H9SC 5F99A 3X1SA 5AY8A 3KUYA 4H9SA 1P3OC 3EPLA 2ZY4A 4J8WD 3AZJD 2RIQA 5GSUD 1S32D 3C1CA 2NQBC 1KX4B 5B24A 3MVDA 4UUZA 2NQBA 1KX5B 4J8VC 1S32B 4Z5TA 3AZLC 5G49A 5B31D 4J8VA 3W97B 1P34D 3AZLA 4QLCB 1U35C 1P3PD 1P3LB 1P3MD 1U35A 2CV5D 5FUGB 3FDDA 4H9OB 3REHA 4CAYA 4EO5C 3AZHD 3H0RC 3AZKD 5JA4B 3AFAB 3MGSD 1ZLAD 4XZQA 2Y2QA 3AZKB 5B33D 3MGRD 2Y2PA 1ZLAB 4XUJB 1KX4C 3MGRB 3UTBB 5B1LD 1P3BA 4DRBA 1KX5C 2PYOD 3H0LC 1M19B 5CP6C 3AZFB 4LD9D 5CP6A 4QLCC 1F66D 3EPJA 1P3LC 4QLCA 1M1AB 5AV6B 2HIOC 2AROA 3AZNA 4YM6D 3RELD 1B67A 2F2AC 1WWIA 2HIOA 2ZM5A 3AFAC 5GXQD 5B40B 4E44A 5DNNB 5KDMA 5C3IB 5AVCD 3B0BA 2F8NK 3W98D 4XUJC 3AV1B 4KHAA 3X1UD 3UTBC 1P3ID 2IO5B 2Y2KA 4KGCB 3AN2B 3AZFC 5CPJC 2FJ7A 3NQJA 4KUDD 1EQZD 3MGQB 5CPJA 4JJND 5DNMD 4YS3D 3UTAB 1M1AC 3IP4C 1AOIB 1EQZB 5AV6C 5BNVB 4ZBJC 3B6FD 3X1VC 1ID3A 2NZDD 4Z66B 3AZID 2G5IC 5GT3A 3AZED 5B40C 5AV9D 3REKD 3X1VA 5DNNC 5CPIA 4G92B 3B6FB 3MGPC 5C3IC 5B1MD 5B2JB 1P3KD 4CSRB 4X23D 3REJA 3LZ1B 3MGPA 1A7WA 4WV4B 3AV1C 4WU8D 3AZGB 5B2IA 2F8NG 2IO5C 4Z2MH 4KGCC 3AN2C 2JCHA 5AV8B 1P3AC 3V9RB 3WKJB 3AV2D 3KWQD 3WTPD 1W2EA 1KX3D 3A6ND 3A1KA 3MGQC 3R45A 3O62B 3AZMB 1P3AA 5B0YB 5BT1D 3VH5W 4J8UB 3W96B 1BH8B 1BH9B 3X1TD 3UTAC 1M18D 1KX3B 1AOIC 5F99D 3X1SD 4DRAA 1P3FB 3UTAA 5AY8D 5B32C 3KUYD 3X1TB 4Z66C 5B32A 4R8PA 3C1CD 4G92C 4H9PB 3VH6W 3LZ0B 5B24D 5B2JC 3LELA 3MVDD 5BO0B 2BYKA 3REIC 5B0ZD 4Z5TD 4WU9A 3MNNB 3REIA 3AZGC 3B0CT 2BYMB 2F8NH 2Y2MA 5AV5D 5B0ZB 5AV8C 5JRGD 3LJAD 4G91B 2Y2JA 5CPKA 3WKJC 3WAAB 1JFIB 4HGAB 2CWEA 5AV5B 3REHD 3O62C 1B6WA 3AZMC 5JRGB 1P3OA 5B0YC 3W96C 3KSYA 4J8WB 3AZJB 5GSUB 1P3FC 4H9NA 4XZQD 4J8XC 3W99D 4WJ3C 2YFVB 5AVBD 1TAFA 1P3FA 4J8XA 2DQNC 5BS7C 3W99B 5B31B 4NE5A 3LZ0C 1HQ3D 1T3UA 5AVBB 2UWXA 5GT0D 1P3BD 2XD1A 5BS7A 1P34B 2F8ND 1N1JA 1P3PB 1KU5A 3MNNC 2YFWB 1P3MB 4WNNA 2CV5B 5GT0B 3UT9D 2F8NB 4G91C 3AZHB 2ZY5A 3WAAC 4HGAC 3KXBD 3UT9B 3MGSB 3WAAA 2AROD 3AZND 3EG5B 5B33B 3KXBB 4J8WC 3AZJC 5GSUC 1S32C 1KX4A 4AWLB 1KX5A 3W97C 5B1LB 1S32A 2PYOB 5B32G 3W97A 5B31C 4LD9B 5E5AD 1H3OB 4NE6A 1P34C 1P3LA 1F66B 1P3PC 5FUGA 1P3MC 4H9OA 2CV5C 2FJ7D 4WZSB 5E5AB 1TZYD 3AYWD 3AZHC 4YM6B 3RELB 5JA4A 3AZKC 4ZUXD 3AFAA 1TZYB 2LY8A 3MGSC 3AYWB 5GXQB 3AZKA 1ZLAC 1ID3D 4ZUXB 3MGRC 1ZLAA 5AVCB 5GT3D 1BFMA 4XUJA 1M19C 3W98B 3MGRA 3UTBA 5CPID 3X1UB 1P3IB 5B1LC 3TU4D 1M19A 2PYOC 1PZRA 2XD5A 3AZFA 3REJD 3C1BD 2Y2NA 4LD9C 5BNXB 1R4VA 3TU4B 5B2ID 4KUDB 1F66C 4H9RB 1M1AA 1P3GD 4JJNB 5DNMB 5AV6A 4YS3B 5CHLB 1Z2CB 3A1IA 3WA9D 4YM6C 1WWSA 3RELC 2NZDB 5B40A 3AZIB 5DNNA 5GXQC 3AZEB 3RELA 5AV9B 3REKB 3WA9B 2W8SA 5B1MB 1P3KB 2RVQD 5AVCC 4X23B 3AV1A 4R8PD 3B6GD 3W98C 4WU8B 3X1UC 1P3IC 4KGCA 3AN2A 3LELD 3NQUB 4WU9D 3AV2B 3KWQB 3WTPB 3MGQA 4KUDC 3A6NB 1EQZC 5CPKD
chains in the Genus database with same CATH topology
4JJNC 5DNMC 1AOIA 5BNVA 4YS3C 1EQZA 1M18B 5F99B 3VH5A 3X1SB 1P3OD 4YS3A 2J8PA 4Z66A 5AY8B 3KUYB 3B6FC 2NZDC 3AZIC 2NQBD 3AZEC 3H0MC 3B6FA 5AV9C 3LZ1C 3REKC 3C1CB 5B2JA 3AZIA 4CSRA 5B24B 4J8VD 4UPKA 5B1MC 3LZ1A 3MVDB 1ULYA 4UUZB 3REKA 4X23C 3VH6A 1P3KC 2NQBB 3AZLD 4Z5TB 3AZGA 4WU8C 5G49B 4J8VB 1U35D 5AV8A 3WKJA 3V9RA 3AZLB 3LJAB 3AV2C 3KWQC 4J8UC 3WTPC 3EPHA 3VH5T 1KX3C 3O62A 3AZMA 1U35B 2JSSA 3REHB 5B0YA 2Y2LA 4CAYB 4J8UA 3W96A 3WTPA 1BH9A 1BH8A 1KX3A 2VQRA 3X1TC 4EO5B 5F99C 1HTAA 3X1SC 2L5AA 3X1TA 4XZQB 5AY8C 3KUYC 3VH6T 3EPKA 4H9PA 3LZ0A 3C1CC 1KX4D 5BO0A 5B24C 1HQ3B 1KX5D 3MVDC 2Y2IA 3WTPE 1P3BB 5CP6D 5B0ZC 3MNNA 4Z5TC 2BYMA 3W97D 4QLCD 5B0ZA 5CP6B 5AV5C 1P3LD 2ZY2A 5JRGC 3LJAC 2FFFB 5AV5A 5JRGA 3LJAA 2HIOD 3REHC 2AROB 3AZNB 4J8WA 3AZJA 5GSUA 3AFAD 2HIOB 2YFVA 4DQYB 4XZQC 3W99C 5KDMB 2G5HC 5AVBC 3W99A 4XUJD 5B31A 5AVBA 3UTBD 4KHAB 1HQ3C 1P34A 5GT0C 1P3BC 1M19D 1P3PA 3AZFD 2YFWA 1P3MA 1HQ3A 2Y2OA 5CPJD 5GT0A 2CV5A 2F8NA 2FJ7B 3NQJB 3UT9C 3AZHA 2ZY3A 5CPJB 3KFUG 1M1AD 3UT9A 5B33C 3MGSA 2Y2GA 5AV6D 3KXBC 1F1EA 5B33A 3X1VD 2AROC 4AWLC 3B0DB 3AZNC 3KXBA 1ID3B 5B40D 5GT3B 5DNND 4ZBJB 3X1VB 3MGPD 2JE5A 5B1LA 5CPIB 2PYOA 3AV1D 3REJB 4LD9A 3MGPB 3C1BB 1H3OA 1F66A 4E45A 3AN2D 5E5AC 4KGCD 5B2IB 3F6TA 1P3AD 5E5AA 1P3GB 2FJ7C 2HUEB 4Z2MG 3MGQD 1TZYC 3AYWC 1P3AB 3R45B 4YM6A 3UTAD 1TZYA 4ZUXC 3AYWA 1AOID 2BG1A 5GXQA 4NFTA 5B32D 4ZUXA 3B0DC 4Z66D 1ID3C 5AVCA 4H9QB 3W98A 5GT3C 4M6BA 5B32B 4R8PB 3X1UA 1P3IA 5CPIC 3B6GB 5B2JD 3REID 3TU4C 3LZ1D 3LELB 2BYKB 5B31G 3REJC 2Y2HA 5BNXA 3C1BC 3AZGD 3TU4A 4WU9B 2DF4C 4KUDA 3REIB 3AL0C 4H9RA 5B2IC 5AV8D 3C1BA 3WKJD 4NE3A 3B0CW 5DNMA 4JJNA 5CPKB 1P3GC 2HUEC 3O62D 3AZMD 5B0YD 4J8UD 1P3GA 1P3OB 3W96D 3WA9C 2NZDA 3P5JB 3AZEA 5AV9A 1P3FD 3WA9A 4J8XD 5B1MA 4H9NB 1P3KA 4X23A 1TAFB 2RVQC 1Q9CA 4WU8A 4J8XB 4R8PC 3B6GC 3LZ0D 4H9QA 3LELC 3B6GA 3NQUA 3A6NC 3AV2A 3MNND 3KWQA 1N1JB 4WU9C 5BT1C 3A6NA 4WNNB 1M18C 1JFIA 5CPKC 3WAAD 1M18A 4H9SC 5F99A 3X1SA 5AY8A 3KUYA 4H9SA 1P3OC 3EPLA 2ZY4A 4J8WD 3AZJD 2RIQA 5GSUD 1S32D 3C1CA 2NQBC 1KX4B 5B24A 3MVDA 4UUZA 2NQBA 1KX5B 4J8VC 1S32B 4Z5TA 3AZLC 5G49A 5B31D 4J8VA 3W97B 1P34D 3AZLA 4QLCB 1U35C 1P3PD 1P3LB 1P3MD 1U35A 2CV5D 5FUGB 3FDDA 4H9OB 3REHA 4CAYA 4EO5C 3AZHD 3H0RC 3AZKD 5JA4B 3AFAB 3MGSD 1ZLAD 4XZQA 2Y2QA 3AZKB 5B33D 3MGRD 2Y2PA 1ZLAB 4XUJB 1KX4C 3MGRB 3UTBB 5B1LD 1P3BA 4DRBA 1KX5C 2PYOD 3H0LC 1M19B 5CP6C 3AZFB 4LD9D 5CP6A 4QLCC 1F66D 3EPJA 1P3LC 4QLCA 1M1AB 5AV6B 2HIOC 2AROA 3AZNA 4YM6D 3RELD 1B67A 2F2AC 1WWIA 2HIOA 2ZM5A 3AFAC 5GXQD 5B40B 4E44A 5DNNB 5KDMA 5C3IB 5AVCD 3B0BA 2F8NK 3W98D 4XUJC 3AV1B 4KHAA 3X1UD 3UTBC 1P3ID 2IO5B 2Y2KA 4KGCB 3AN2B 3AZFC 5CPJC 2FJ7A 3NQJA 4KUDD 1EQZD 3MGQB 5CPJA 4JJND 5DNMD 4YS3D 3UTAB 1M1AC 3IP4C 1AOIB 1EQZB 5AV6C 5BNVB 4ZBJC 3B6FD 3X1VC 1ID3A 2NZDD 4Z66B 3AZID 2G5IC 5GT3A 3AZED 5B40C 5AV9D 3REKD 3X1VA 5DNNC 5CPIA 4G92B 3B6FB 3MGPC 5C3IC 5B1MD 5B2JB 1P3KD 4CSRB 4X23D 3REJA 3LZ1B 3MGPA 1A7WA 4WV4B 3AV1C 4WU8D 3AZGB 5B2IA 2F8NG 2IO5C 4Z2MH 4KGCC 3AN2C 2JCHA 5AV8B 1P3AC 3V9RB 3WKJB 3AV2D 3KWQD 3WTPD 1W2EA 1KX3D 3A6ND 3A1KA 3MGQC 3R45A 3O62B 3AZMB 1P3AA 5B0YB 5BT1D 3VH5W 4J8UB 3W96B 1BH8B 1BH9B 3X1TD 3UTAC 1M18D 1KX3B 1AOIC 5F99D 3X1SD 4DRAA 1P3FB 3UTAA 5AY8D 5B32C 3KUYD 3X1TB 4Z66C 5B32A 4R8PA 3C1CD 4G92C 4H9PB 3VH6W 3LZ0B 5B24D 5B2JC 3LELA 3MVDD 5BO0B 2BYKA 3REIC 5B0ZD 4Z5TD 4WU9A 3MNNB 3REIA 3AZGC 3B0CT 2BYMB 2F8NH 2Y2MA 5AV5D 5B0ZB 5AV8C 5JRGD 3LJAD 4G91B 2Y2JA 5CPKA 3WKJC 3WAAB 1JFIB 4HGAB 2CWEA 5AV5B 3REHD 3O62C 1B6WA 3AZMC 5JRGB 1P3OA 5B0YC 3W96C 3KSYA 4J8WB 3AZJB 5GSUB 1P3FC 4H9NA 4XZQD 4J8XC 3W99D 4WJ3C 2YFVB 5AVBD 1TAFA 1P3FA 4J8XA 2DQNC 5BS7C 3W99B 5B31B 4NE5A 3LZ0C 1HQ3D 1T3UA 5AVBB 2UWXA 5GT0D 1P3BD 2XD1A 5BS7A 1P34B 2F8ND 1N1JA 1P3PB 1KU5A 3MNNC 2YFWB 1P3MB 4WNNA 2CV5B 5GT0B 3UT9D 2F8NB 4G91C 3AZHB 2ZY5A 3WAAC 4HGAC 3KXBD 3UT9B 3MGSB 3WAAA 2AROD 3AZND 3EG5B 5B33B 3KXBB 4J8WC 3AZJC 5GSUC 1S32C 1KX4A 4AWLB 1KX5A 3W97C 5B1LB 1S32A 2PYOB 5B32G 3W97A 5B31C 4LD9B 5E5AD 1H3OB 4NE6A 1P34C 1P3LA 1F66B 1P3PC 5FUGA 1P3MC 4H9OA 2CV5C 2FJ7D 4WZSB 5E5AB 1TZYD 3AYWD 3AZHC 4YM6B 3RELB 5JA4A 3AZKC 4ZUXD 3AFAA 1TZYB 2LY8A 3MGSC 3AYWB 5GXQB 3AZKA 1ZLAC 1ID3D 4ZUXB 3MGRC 1ZLAA 5AVCB 5GT3D 1BFMA 4XUJA 1M19C 3W98B 3MGRA 3UTBA 5CPID 3X1UB 1P3IB 5B1LC 3TU4D 1M19A 2PYOC 1PZRA 2XD5A 3AZFA 3REJD 3C1BD 2Y2NA 4LD9C 5BNXB 1R4VA 3TU4B 5B2ID 4KUDB 1F66C 4H9RB 1M1AA 1P3GD 4JJNB 5DNMB 5AV6A 4YS3B 5CHLB 1Z2CB 3A1IA 3WA9D 4YM6C 1WWSA 3RELC 2NZDB 5B40A 3AZIB 5DNNA 5GXQC 3AZEB 3RELA 5AV9B 3REKB 3WA9B 2W8SA 5B1MB 1P3KB 2RVQD 5AVCC 4X23B 3AV1A 4R8PD 3B6GD 3W98C 4WU8B 3X1UC 1P3IC 4KGCA 3AN2A 3LELD 3NQUB 4WU9D 3AV2B 3KWQB 3WTPB 3MGQA 4KUDC 3A6NB 1EQZC 5CPKD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JJN C;  5DNM C;  1AOI A;  5BNV A;  4YS3 C;  1EQZ A;  1M18 B;  5F99 B;  3VH5 A;  3X1S B;  1P3O D;  4YS3 A;  4Z66 A;  3B6F C;  5AY8 B;  3KUY B;  2NZD C;  3AZI C;  2NQB D;  3AZE C;  3B6F A;  5AV9 C;  3LZ1 C;  3REK C;  3C1C B;  5B2J A;  3AZI A;  4CSR A;  5B24 B;  4J8V D;  5B1M C;  1P3K C;  3LZ1 A;  3MVD B;  1ULY A;  4UUZ B;  3REK A;  4X23 C;  3VH6 A;  2NQB B;  3AZL D;  4Z5T B;  3AZG A;  4WU8 C;  5G49 B;  4J8V B;  1U35 D;  5AV8 A;  3WKJ A;  3V9R A;  3AZL B;  3LJA B;  3AV2 C;  3KWQ C;  4J8U C;  3WTP C;  3VH5 T;  1KX3 C;  3O62 A;  3AZM A;  1U35 B;  2JSS A;  3REH B;  5B0Y A;  4CAY B;  4J8U A;  3W96 A;  3WTP A;  1BH9 A;  1BH8 A;  1KX3 A;  3X1T C;  4EO5 B;  5F99 C;  1HTA A;  3X1S C;  2L5A A;  3X1T A;  4XZQ B;  5AY8 C;  3KUY C;  3VH6 T;  4H9P A;  3LZ0 A;  3C1C C;  1KX4 D;  5BO0 A;  5B24 C;  1HQ3 B;  1KX5 D;  3MVD C;  1P3B B;  3WTP E;  5CP6 D;  5B0Z C;  3MNN A;  4Z5T C;  2BYM A;  3W97 D;  4QLC D;  5B0Z A;  5CP6 B;  5AV5 C;  1P3L D;  5JRG C;  3LJA C;  5AV5 A;  5JRG A;  3LJA A;  2HIO D;  3REH C;  2ARO B;  3AZN B;  4J8W A;  3AZJ A;  5GSU A;  3AFA D;  2HIO B;  2YFV A;  4XZQ C;  3W99 C;  5KDM B;  5AVB C;  3W99 A;  4XUJ D;  5B31 A;  5AVB A;  3UTB D;  4KHA B;  1HQ3 C;  1P34 A;  5GT0 C;  1P3B C;  1M19 D;  1P3P A;  3AZF D;  2YFW A;  1P3M A;  1HQ3 A;  5CPJ D;  2CV5 A;  5GT0 A;  2F8N A;  2FJ7 B;  3NQJ B;  3UT9 C;  3AZH A;  5CPJ B;  1M1A D;  3UT9 A;  5B33 C;  3MGS A;  5AV6 D;  3KXB C;  1F1E A;  5B33 A;  3X1V D;  2ARO C;  4AWL C;  3B0D B;  3AZN C;  3KXB A;  1ID3 B;  5B40 D;  5GT3 B;  5DNN D;  4ZBJ B;  3X1V B;  3MGP D;  5B1L A;  5CPI B;  2PYO A;  3AV1 D;  3REJ B;  4LD9 A;  3MGP B;  3C1B B;  1H3O A;  1F66 A;  4E45 A;  3AN2 D;  5E5A C;  4KGC D;  5B2I B;  1P3A D;  5E5A A;  1P3G B;  2FJ7 C;  2HUE B;  4Z2M G;  3MGQ D;  1TZY C;  3AYW C;  1P3A B;  3R45 B;  4YM6 A;  3UTA D;  1TZY A;  4ZUX C;  3AYW A;  1AOI D;  5GXQ A;  4NFT A;  5B32 D;  4ZUX A;  3B0D C;  4Z66 D;  1ID3 C;  5AVC A;  4H9Q B;  3W98 A;  5GT3 C;  4M6B A;  5B32 B;  4R8P B;  3X1U A;  1P3I A;  5CPI C;  3B6G B;  5B2J D;  3REI D;  3TU4 C;  3LZ1 D;  3LEL B;  2BYK B;  5B31 G;  3REJ C;  5BNX A;  3C1B C;  3AZG D;  3TU4 A;  4WU9 B;  4KUD A;  3REI B;  4H9R A;  5B2I C;  5AV8 D;  3C1B A;  3WKJ D;  4NE3 A;  3B0C W;  5DNM A;  4JJN A;  5CPK B;  1P3G C;  2HUE C;  3O62 D;  3AZM D;  5B0Y D;  4J8U D;  1P3G A;  1P3O B;  3W96 D;  3WA9 C;  2NZD A;  3AZE A;  5AV9 A;  1P3F D;  3WA9 A;  4J8X D;  5B1M A;  4H9N B;  1P3K A;  4X23 A;  1TAF B;  2RVQ C;  1Q9C A;  4WU8 A;  4J8X B;  4R8P C;  3B6G C;  3LZ0 D;  4H9Q A;  3LEL C;  3B6G A;  3NQU A;  3A6N C;  3AV2 A;  3MNN D;  3KWQ A;  1N1J B;  4WU9 C;  5BT1 C;  3A6N A;  4WNN B;  1M18 C;  1JFI A;  5CPK C;  3WAA D;  1M18 A;  4H9S C;  5F99 A;  3X1S A;  5AY8 A;  3KUY A;  4H9S A;  1P3O C;  4J8W D;  3AZJ D;  5GSU D;  1S32 D;  3C1C A;  2NQB C;  1KX4 B;  5B24 A;  3MVD A;  4UUZ A;  2NQB A;  1KX5 B;  4J8V C;  1S32 B;  4Z5T A;  3AZL C;  5G49 A;  5B31 D;  4J8V A;  3W97 B;  1P34 D;  3AZL A;  4QLC B;  1U35 C;  1P3P D;  1P3L B;  1P3M D;  1U35 A;  2CV5 D;  5FUG B;  4H9O B;  3REH A;  4CAY A;  4EO5 C;  3AZH D;  3AZK D;  5JA4 B;  3AFA B;  3MGS D;  1ZLA D;  4XZQ A;  3AZK B;  5B33 D;  3MGR D;  1ZLA B;  4XUJ B;  1KX4 C;  3MGR B;  3UTB B;  5B1L D;  1P3B A;  4DRB A;  1KX5 C;  2PYO D;  1M19 B;  5CP6 C;  3AZF B;  4LD9 D;  5CP6 A;  4QLC C;  1F66 D;  1P3L C;  4QLC A;  1M1A B;  5AV6 B;  2HIO C;  2ARO A;  3AZN A;  4YM6 D;  3REL D;  1B67 A;  1WWI A;  2HIO A;  3AFA C;  5GXQ D;  5B40 B;  4E44 A;  5DNN B;  5KDM A;  5C3I B;  5AVC D;  3B0B A;  2F8N K;  3W98 D;  4XUJ C;  3AV1 B;  4KHA A;  3X1U D;  3UTB C;  1P3I D;  2IO5 B;  4KGC B;  3AN2 B;  3AZF C;  5CPJ C;  2FJ7 A;  3NQJ A;  4KUD D;  1EQZ D;  3MGQ B;  5CPJ A;  4JJN D;  5DNM D;  4YS3 D;  3UTA B;  1M1A C;  1AOI B;  1EQZ B;  5AV6 C;  5BNV B;  4ZBJ C;  3B6F D;  3X1V C;  1ID3 A;  2NZD D;  4Z66 B;  3AZI D;  5GT3 A;  3AZE D;  5B40 C;  5AV9 D;  3REK D;  3X1V A;  5DNN C;  5CPI A;  4G92 B;  3B6F B;  3MGP C;  5C3I C;  5B1M D;  5B2J B;  1P3K D;  4CSR B;  4X23 D;  3REJ A;  3LZ1 B;  3MGP A;  1A7W A;  4WV4 B;  3AV1 C;  4WU8 D;  3AZG B;  5B2I A;  2F8N G;  2IO5 C;  4Z2M H;  4KGC C;  3AN2 C;  5AV8 B;  1P3A C;  3V9R B;  3WKJ B;  3AV2 D;  3KWQ D;  3WTP D;  1KX3 D;  3A6N D;  1P3A A;  3MGQ C;  3R45 A;  3O62 B;  3AZM B;  5B0Y B;  5BT1 D;  3VH5 W;  4J8U B;  3W96 B;  1BH8 B;  1BH9 B;  3X1T D;  3UTA C;  1M18 D;  1KX3 B;  1AOI C;  5F99 D;  3X1S D;  4DRA A;  1P3F B;  3UTA A;  5AY8 D;  5B32 C;  3KUY D;  3X1T B;  4Z66 C;  5B32 A;  4R8P A;  3C1C D;  4G92 C;  4H9P B;  3VH6 W;  3LZ0 B;  5B24 D;  5B2J C;  3LEL A;  3MVD D;  5BO0 B;  2BYK A;  3REI C;  5B0Z D;  4Z5T D;  4WU9 A;  3MNN B;  3REI A;  3AZG C;  3B0C T;  2BYM B;  2F8N H;  5AV5 D;  5B0Z B;  5AV8 C;  5JRG D;  3LJA D;  4G91 B;  5CPK A;  3WKJ C;  3WAA B;  1JFI B;  4HGA B;  2CWE A;  5AV5 B;  3REH D;  3O62 C;  1B6W A;  3AZM C;  5JRG B;  1P3O A;  5B0Y C;  3W96 C;  3KSY A;  4J8W B;  3AZJ B;  5GSU B;  1P3F C;  4H9N A;  4XZQ D;  4J8X C;  3W99 D;  2YFV B;  5AVB D;  1TAF A;  1P3F A;  4J8X A;  5BS7 C;  3W99 B;  5B31 B;  4NE5 A;  3LZ0 C;  1HQ3 D;  5AVB B;  5GT0 D;  1P3B D;  5BS7 A;  1P34 B;  2F8N D;  1N1J A;  1P3P B;  1KU5 A;  3MNN C;  2YFW B;  1P3M B;  4WNN A;  2CV5 B;  5GT0 B;  3UT9 D;  2F8N B;  4G91 C;  3AZH B;  3WAA C;  4HGA C;  3KXB D;  3UT9 B;  3MGS B;  3WAA A;  2ARO D;  3AZN D;  5B33 B;  3KXB B;  4J8W C;  3AZJ C;  5GSU C;  1S32 C;  1KX4 A;  4AWL B;  1KX5 A;  3W97 C;  5B1L B;  1S32 A;  2PYO B;  5B32 G;  3W97 A;  5B31 C;  4LD9 B;  5E5A D;  1H3O B;  4NE6 A;  1P34 C;  1P3L A;  1F66 B;  1P3P C;  5FUG A;  1P3M C;  4H9O A;  2CV5 C;  2FJ7 D;  4WZS B;  5E5A B;  1TZY D;  3AYW D;  3AZH C;  4YM6 B;  3REL B;  5JA4 A;  3AZK C;  4ZUX D;  3AFA A;  1TZY B;  2LY8 A;  3MGS C;  3AYW B;  5GXQ B;  3AZK A;  1ZLA C;  1ID3 D;  4ZUX B;  3MGR C;  1ZLA A;  5AVC B;  5GT3 D;  1BFM A;  4XUJ A;  1M19 C;  3W98 B;  3MGR A;  3UTB A;  5CPI D;  3X1U B;  1P3I B;  5B1L C;  3TU4 D;  1M19 A;  2PYO C;  3AZF A;  3REJ D;  3C1B D;  4LD9 C;  5BNX B;  1R4V A;  3TU4 B;  5B2I D;  4KUD B;  1F66 C;  4H9R B;  1M1A A;  1P3G D;  4JJN B;  5DNM B;  5AV6 A;  4YS3 B;  5CHL B;  3WA9 D;  4YM6 C;  1WWS A;  3REL C;  2NZD B;  5B40 A;  3AZI B;  5DNN A;  5GXQ C;  3AZE B;  3REL A;  5AV9 B;  3REK B;  3WA9 B;  5B1M B;  1P3K B;  2RVQ D;  5AVC C;  4X23 B;  3AV1 A;  4R8P D;  3B6G D;  3W98 C;  4WU8 B;  3X1U C;  1P3I C;  4KGC A;  3AN2 A;  3LEL D;  3NQU B;  4WU9 D;  3AV2 B;  3KWQ B;  3WTP B;  3MGQ A;  4KUD C;  3A6N B;  1EQZ C;  5CPK D; 
#chains in the Genus database with same CATH topology
 4JJN C;  5DNM C;  1AOI A;  5BNV A;  4YS3 C;  1EQZ A;  1M18 B;  5F99 B;  3VH5 A;  3X1S B;  1P3O D;  4YS3 A;  2J8P A;  4Z66 A;  5AY8 B;  3KUY B;  3B6F C;  2NZD C;  3AZI C;  2NQB D;  3AZE C;  3H0M C;  3B6F A;  5AV9 C;  3LZ1 C;  3REK C;  3C1C B;  5B2J A;  3AZI A;  4CSR A;  5B24 B;  4J8V D;  4UPK A;  5B1M C;  3LZ1 A;  3MVD B;  1ULY A;  4UUZ B;  3REK A;  4X23 C;  3VH6 A;  1P3K C;  2NQB B;  3AZL D;  4Z5T B;  3AZG A;  4WU8 C;  5G49 B;  4J8V B;  1U35 D;  5AV8 A;  3WKJ A;  3V9R A;  3AZL B;  3LJA B;  3AV2 C;  3KWQ C;  4J8U C;  3WTP C;  3EPH A;  3VH5 T;  1KX3 C;  3O62 A;  3AZM A;  1U35 B;  2JSS A;  3REH B;  5B0Y A;  2Y2L A;  4CAY B;  4J8U A;  3W96 A;  3WTP A;  1BH9 A;  1BH8 A;  1KX3 A;  2VQR A;  3X1T C;  4EO5 B;  5F99 C;  1HTA A;  3X1S C;  2L5A A;  3X1T A;  4XZQ B;  5AY8 C;  3KUY C;  3VH6 T;  3EPK A;  4H9P A;  3LZ0 A;  3C1C C;  1KX4 D;  5BO0 A;  5B24 C;  1HQ3 B;  1KX5 D;  3MVD C;  2Y2I A;  3WTP E;  1P3B B;  5CP6 D;  5B0Z C;  3MNN A;  4Z5T C;  2BYM A;  3W97 D;  4QLC D;  5B0Z A;  5CP6 B;  5AV5 C;  1P3L D;  2ZY2 A;  5JRG C;  3LJA C;  2FFF B;  5AV5 A;  5JRG A;  3LJA A;  2HIO D;  3REH C;  2ARO B;  3AZN B;  4J8W A;  3AZJ A;  5GSU A;  3AFA D;  2HIO B;  2YFV A;  4DQY B;  4XZQ C;  3W99 C;  5KDM B;  2G5H C;  5AVB C;  3W99 A;  4XUJ D;  5B31 A;  5AVB A;  3UTB D;  4KHA B;  1HQ3 C;  1P34 A;  5GT0 C;  1P3B C;  1M19 D;  1P3P A;  3AZF D;  2YFW A;  1P3M A;  1HQ3 A;  2Y2O A;  5CPJ D;  5GT0 A;  2CV5 A;  2F8N A;  2FJ7 B;  3NQJ B;  3UT9 C;  3AZH A;  2ZY3 A;  5CPJ B;  3KFU G;  1M1A D;  3UT9 A;  5B33 C;  3MGS A;  2Y2G A;  5AV6 D;  3KXB C;  1F1E A;  5B33 A;  3X1V D;  2ARO C;  4AWL C;  3B0D B;  3AZN C;  3KXB A;  1ID3 B;  5B40 D;  5GT3 B;  5DNN D;  4ZBJ B;  3X1V B;  3MGP D;  2JE5 A;  5B1L A;  5CPI B;  2PYO A;  3AV1 D;  3REJ B;  4LD9 A;  3MGP B;  3C1B B;  1H3O A;  1F66 A;  4E45 A;  3AN2 D;  5E5A C;  4KGC D;  5B2I B;  3F6T A;  1P3A D;  5E5A A;  1P3G B;  2FJ7 C;  2HUE B;  4Z2M G;  3MGQ D;  1TZY C;  3AYW C;  1P3A B;  3R45 B;  4YM6 A;  3UTA D;  1TZY A;  4ZUX C;  3AYW A;  1AOI D;  2BG1 A;  5GXQ A;  4NFT A;  5B32 D;  4ZUX A;  3B0D C;  4Z66 D;  1ID3 C;  5AVC A;  4H9Q B;  3W98 A;  5GT3 C;  4M6B A;  5B32 B;  4R8P B;  3X1U A;  1P3I A;  5CPI C;  3B6G B;  5B2J D;  3REI D;  3TU4 C;  3LZ1 D;  3LEL B;  2BYK B;  5B31 G;  3REJ C;  2Y2H A;  5BNX A;  3C1B C;  3AZG D;  3TU4 A;  4WU9 B;  2DF4 C;  4KUD A;  3REI B;  3AL0 C;  4H9R A;  5B2I C;  5AV8 D;  3C1B A;  3WKJ D;  4NE3 A;  3B0C W;  5DNM A;  4JJN A;  5CPK B;  1P3G C;  2HUE C;  3O62 D;  3AZM D;  5B0Y D;  4J8U D;  1P3G A;  1P3O B;  3W96 D;  3WA9 C;  2NZD A;  3P5J B;  3AZE A;  5AV9 A;  1P3F D;  3WA9 A;  4J8X D;  5B1M A;  4H9N B;  1P3K A;  4X23 A;  1TAF B;  2RVQ C;  1Q9C A;  4WU8 A;  4J8X B;  4R8P C;  3B6G C;  3LZ0 D;  4H9Q A;  3LEL C;  3B6G A;  3NQU A;  3A6N C;  3AV2 A;  3MNN D;  3KWQ A;  1N1J B;  4WU9 C;  5BT1 C;  3A6N A;  4WNN B;  1M18 C;  1JFI A;  5CPK C;  3WAA D;  1M18 A;  4H9S C;  5F99 A;  3X1S A;  5AY8 A;  3KUY A;  4H9S A;  1P3O C;  3EPL A;  2ZY4 A;  4J8W D;  3AZJ D;  2RIQ A;  5GSU D;  1S32 D;  3C1C A;  2NQB C;  1KX4 B;  5B24 A;  3MVD A;  4UUZ A;  2NQB A;  1KX5 B;  4J8V C;  1S32 B;  4Z5T A;  3AZL C;  5G49 A;  5B31 D;  4J8V A;  3W97 B;  1P34 D;  3AZL A;  4QLC B;  1U35 C;  1P3P D;  1P3L B;  1P3M D;  1U35 A;  2CV5 D;  5FUG B;  3FDD A;  4H9O B;  3REH A;  4CAY A;  4EO5 C;  3AZH D;  3H0R C;  3AZK D;  5JA4 B;  3AFA B;  3MGS D;  1ZLA D;  4XZQ A;  2Y2Q A;  3AZK B;  5B33 D;  3MGR D;  2Y2P A;  1ZLA B;  4XUJ B;  1KX4 C;  3MGR B;  3UTB B;  5B1L D;  1P3B A;  4DRB A;  1KX5 C;  2PYO D;  3H0L C;  1M19 B;  5CP6 C;  3AZF B;  4LD9 D;  5CP6 A;  4QLC C;  1F66 D;  3EPJ A;  1P3L C;  4QLC A;  1M1A B;  5AV6 B;  2HIO C;  2ARO A;  3AZN A;  4YM6 D;  3REL D;  1B67 A;  2F2A C;  1WWI A;  2HIO A;  2ZM5 A;  3AFA C;  5GXQ D;  5B40 B;  4E44 A;  5DNN B;  5KDM A;  5C3I B;  5AVC D;  3B0B A;  2F8N K;  3W98 D;  4XUJ C;  3AV1 B;  4KHA A;  3X1U D;  3UTB C;  1P3I D;  2IO5 B;  2Y2K A;  4KGC B;  3AN2 B;  3AZF C;  5CPJ C;  2FJ7 A;  3NQJ A;  4KUD D;  1EQZ D;  3MGQ B;  5CPJ A;  4JJN D;  5DNM D;  4YS3 D;  3UTA B;  1M1A C;  3IP4 C;  1AOI B;  1EQZ B;  5AV6 C;  5BNV B;  4ZBJ C;  3B6F D;  3X1V C;  1ID3 A;  2NZD D;  4Z66 B;  3AZI D;  2G5I C;  5GT3 A;  3AZE D;  5B40 C;  5AV9 D;  3REK D;  3X1V A;  5DNN C;  5CPI A;  4G92 B;  3B6F B;  3MGP C;  5C3I C;  5B1M D;  5B2J B;  1P3K D;  4CSR B;  4X23 D;  3REJ A;  3LZ1 B;  3MGP A;  1A7W A;  4WV4 B;  3AV1 C;  4WU8 D;  3AZG B;  5B2I A;  2F8N G;  2IO5 C;  4Z2M H;  4KGC C;  3AN2 C;  2JCH A;  5AV8 B;  1P3A C;  3V9R B;  3WKJ B;  3AV2 D;  3KWQ D;  3WTP D;  1W2E A;  1KX3 D;  3A6N D;  3A1K A;  3MGQ C;  3R45 A;  3O62 B;  3AZM B;  1P3A A;  5B0Y B;  5BT1 D;  3VH5 W;  4J8U B;  3W96 B;  1BH8 B;  1BH9 B;  3X1T D;  3UTA C;  1M18 D;  1KX3 B;  1AOI C;  5F99 D;  3X1S D;  4DRA A;  1P3F B;  3UTA A;  5AY8 D;  5B32 C;  3KUY D;  3X1T B;  4Z66 C;  5B32 A;  4R8P A;  3C1C D;  4G92 C;  4H9P B;  3VH6 W;  3LZ0 B;  5B24 D;  5B2J C;  3LEL A;  3MVD D;  5BO0 B;  2BYK A;  3REI C;  5B0Z D;  4Z5T D;  4WU9 A;  3MNN B;  3REI A;  3AZG C;  3B0C T;  2BYM B;  2F8N H;  2Y2M A;  5AV5 D;  5B0Z B;  5AV8 C;  5JRG D;  3LJA D;  4G91 B;  2Y2J A;  5CPK A;  3WKJ C;  3WAA B;  1JFI B;  4HGA B;  2CWE A;  5AV5 B;  3REH D;  3O62 C;  1B6W A;  3AZM C;  5JRG B;  1P3O A;  5B0Y C;  3W96 C;  3KSY A;  4J8W B;  3AZJ B;  5GSU B;  1P3F C;  4H9N A;  4XZQ D;  4J8X C;  3W99 D;  4WJ3 C;  2YFV B;  5AVB D;  1TAF A;  1P3F A;  4J8X A;  2DQN C;  5BS7 C;  3W99 B;  5B31 B;  4NE5 A;  3LZ0 C;  1HQ3 D;  1T3U A;  5AVB B;  2UWX A;  5GT0 D;  1P3B D;  2XD1 A;  5BS7 A;  1P34 B;  2F8N D;  1N1J A;  1P3P B;  1KU5 A;  3MNN C;  2YFW B;  1P3M B;  4WNN A;  2CV5 B;  5GT0 B;  3UT9 D;  2F8N B;  4G91 C;  3AZH B;  2ZY5 A;  3WAA C;  4HGA C;  3KXB D;  3UT9 B;  3MGS B;  3WAA A;  2ARO D;  3AZN D;  3EG5 B;  5B33 B;  3KXB B;  4J8W C;  3AZJ C;  5GSU C;  1S32 C;  1KX4 A;  4AWL B;  1KX5 A;  3W97 C;  5B1L B;  1S32 A;  2PYO B;  5B32 G;  3W97 A;  5B31 C;  4LD9 B;  5E5A D;  1H3O B;  4NE6 A;  1P34 C;  1P3L A;  1F66 B;  1P3P C;  5FUG A;  1P3M C;  4H9O A;  2CV5 C;  2FJ7 D;  4WZS B;  5E5A B;  1TZY D;  3AYW D;  3AZH C;  4YM6 B;  3REL B;  5JA4 A;  3AZK C;  4ZUX D;  3AFA A;  1TZY B;  2LY8 A;  3MGS C;  3AYW B;  5GXQ B;  3AZK A;  1ZLA C;  1ID3 D;  4ZUX B;  3MGR C;  1ZLA A;  5AVC B;  5GT3 D;  1BFM A;  4XUJ A;  1M19 C;  3W98 B;  3MGR A;  3UTB A;  5CPI D;  3X1U B;  1P3I B;  5B1L C;  3TU4 D;  1M19 A;  2PYO C;  1PZR A;  2XD5 A;  3AZF A;  3REJ D;  3C1B D;  2Y2N A;  4LD9 C;  5BNX B;  1R4V A;  3TU4 B;  5B2I D;  4KUD B;  1F66 C;  4H9R B;  1M1A A;  1P3G D;  4JJN B;  5DNM B;  5AV6 A;  4YS3 B;  5CHL B;  1Z2C B;  3A1I A;  3WA9 D;  4YM6 C;  1WWS A;  3REL C;  2NZD B;  5B40 A;  3AZI B;  5DNN A;  5GXQ C;  3AZE B;  3REL A;  5AV9 B;  3REK B;  3WA9 B;  2W8S A;  5B1M B;  1P3K B;  2RVQ D;  5AVC C;  4X23 B;  3AV1 A;  4R8P D;  3B6G D;  3W98 C;  4WU8 B;  3X1U C;  1P3I C;  4KGC A;  3AN2 A;  3LEL D;  3NQU B;  4WU9 D;  3AV2 B;  3KWQ B;  3WTP B;  3MGQ A;  4KUD C;  3A6N B;  1EQZ C;  5CPK D; 
#chains in the Genus database with same CATH homology
 4JJN C;  5DNM C;  1AOI A;  5BNV A;  4YS3 C;  1EQZ A;  1M18 B;  5F99 B;  3VH5 A;  3X1S B;  1P3O D;  4YS3 A;  2J8P A;  4Z66 A;  5AY8 B;  3KUY B;  3B6F C;  2NZD C;  3AZI C;  2NQB D;  3AZE C;  3H0M C;  3B6F A;  5AV9 C;  3LZ1 C;  3REK C;  3C1C B;  5B2J A;  3AZI A;  4CSR A;  5B24 B;  4J8V D;  4UPK A;  5B1M C;  3LZ1 A;  3MVD B;  1ULY A;  4UUZ B;  3REK A;  4X23 C;  3VH6 A;  1P3K C;  2NQB B;  3AZL D;  4Z5T B;  3AZG A;  4WU8 C;  5G49 B;  4J8V B;  1U35 D;  5AV8 A;  3WKJ A;  3V9R A;  3AZL B;  3LJA B;  3AV2 C;  3KWQ C;  4J8U C;  3WTP C;  3EPH A;  3VH5 T;  1KX3 C;  3O62 A;  3AZM A;  1U35 B;  2JSS A;  3REH B;  5B0Y A;  2Y2L A;  4CAY B;  4J8U A;  3W96 A;  3WTP A;  1BH9 A;  1BH8 A;  1KX3 A;  2VQR A;  3X1T C;  4EO5 B;  5F99 C;  1HTA A;  3X1S C;  2L5A A;  3X1T A;  4XZQ B;  5AY8 C;  3KUY C;  3VH6 T;  3EPK A;  4H9P A;  3LZ0 A;  3C1C C;  1KX4 D;  5BO0 A;  5B24 C;  1HQ3 B;  1KX5 D;  3MVD C;  2Y2I A;  3WTP E;  1P3B B;  5CP6 D;  5B0Z C;  3MNN A;  4Z5T C;  2BYM A;  3W97 D;  4QLC D;  5B0Z A;  5CP6 B;  5AV5 C;  1P3L D;  2ZY2 A;  5JRG C;  3LJA C;  2FFF B;  5AV5 A;  5JRG A;  3LJA A;  2HIO D;  3REH C;  2ARO B;  3AZN B;  4J8W A;  3AZJ A;  5GSU A;  3AFA D;  2HIO B;  2YFV A;  4DQY B;  4XZQ C;  3W99 C;  5KDM B;  2G5H C;  5AVB C;  3W99 A;  4XUJ D;  5B31 A;  5AVB A;  3UTB D;  4KHA B;  1HQ3 C;  1P34 A;  5GT0 C;  1P3B C;  1M19 D;  1P3P A;  3AZF D;  2YFW A;  1P3M A;  1HQ3 A;  2Y2O A;  5CPJ D;  5GT0 A;  2CV5 A;  2F8N A;  2FJ7 B;  3NQJ B;  3UT9 C;  3AZH A;  2ZY3 A;  5CPJ B;  3KFU G;  1M1A D;  3UT9 A;  5B33 C;  3MGS A;  2Y2G A;  5AV6 D;  3KXB C;  1F1E A;  5B33 A;  3X1V D;  2ARO C;  4AWL C;  3B0D B;  3AZN C;  3KXB A;  1ID3 B;  5B40 D;  5GT3 B;  5DNN D;  4ZBJ B;  3X1V B;  3MGP D;  2JE5 A;  5B1L A;  5CPI B;  2PYO A;  3AV1 D;  3REJ B;  4LD9 A;  3MGP B;  3C1B B;  1H3O A;  1F66 A;  4E45 A;  3AN2 D;  5E5A C;  4KGC D;  5B2I B;  3F6T A;  1P3A D;  5E5A A;  1P3G B;  2FJ7 C;  2HUE B;  4Z2M G;  3MGQ D;  1TZY C;  3AYW C;  1P3A B;  3R45 B;  4YM6 A;  3UTA D;  1TZY A;  4ZUX C;  3AYW A;  1AOI D;  2BG1 A;  5GXQ A;  4NFT A;  5B32 D;  4ZUX A;  3B0D C;  4Z66 D;  1ID3 C;  5AVC A;  4H9Q B;  3W98 A;  5GT3 C;  4M6B A;  5B32 B;  4R8P B;  3X1U A;  1P3I A;  5CPI C;  3B6G B;  5B2J D;  3REI D;  3TU4 C;  3LZ1 D;  3LEL B;  2BYK B;  5B31 G;  3REJ C;  2Y2H A;  5BNX A;  3C1B C;  3AZG D;  3TU4 A;  4WU9 B;  2DF4 C;  4KUD A;  3REI B;  3AL0 C;  4H9R A;  5B2I C;  5AV8 D;  3C1B A;  3WKJ D;  4NE3 A;  3B0C W;  5DNM A;  4JJN A;  5CPK B;  1P3G C;  2HUE C;  3O62 D;  3AZM D;  5B0Y D;  4J8U D;  1P3G A;  1P3O B;  3W96 D;  3WA9 C;  2NZD A;  3P5J B;  3AZE A;  5AV9 A;  1P3F D;  3WA9 A;  4J8X D;  5B1M A;  4H9N B;  1P3K A;  4X23 A;  1TAF B;  2RVQ C;  1Q9C A;  4WU8 A;  4J8X B;  4R8P C;  3B6G C;  3LZ0 D;  4H9Q A;  3LEL C;  3B6G A;  3NQU A;  3A6N C;  3AV2 A;  3MNN D;  3KWQ A;  1N1J B;  4WU9 C;  5BT1 C;  3A6N A;  4WNN B;  1M18 C;  1JFI A;  5CPK C;  3WAA D;  1M18 A;  4H9S C;  5F99 A;  3X1S A;  5AY8 A;  3KUY A;  4H9S A;  1P3O C;  3EPL A;  2ZY4 A;  4J8W D;  3AZJ D;  2RIQ A;  5GSU D;  1S32 D;  3C1C A;  2NQB C;  1KX4 B;  5B24 A;  3MVD A;  4UUZ A;  2NQB A;  1KX5 B;  4J8V C;  1S32 B;  4Z5T A;  3AZL C;  5G49 A;  5B31 D;  4J8V A;  3W97 B;  1P34 D;  3AZL A;  4QLC B;  1U35 C;  1P3P D;  1P3L B;  1P3M D;  1U35 A;  2CV5 D;  5FUG B;  3FDD A;  4H9O B;  3REH A;  4CAY A;  4EO5 C;  3AZH D;  3H0R C;  3AZK D;  5JA4 B;  3AFA B;  3MGS D;  1ZLA D;  4XZQ A;  2Y2Q A;  3AZK B;  5B33 D;  3MGR D;  2Y2P A;  1ZLA B;  4XUJ B;  1KX4 C;  3MGR B;  3UTB B;  5B1L D;  1P3B A;  4DRB A;  1KX5 C;  2PYO D;  3H0L C;  1M19 B;  5CP6 C;  3AZF B;  4LD9 D;  5CP6 A;  4QLC C;  1F66 D;  3EPJ A;  1P3L C;  4QLC A;  1M1A B;  5AV6 B;  2HIO C;  2ARO A;  3AZN A;  4YM6 D;  3REL D;  1B67 A;  2F2A C;  1WWI A;  2HIO A;  2ZM5 A;  3AFA C;  5GXQ D;  5B40 B;  4E44 A;  5DNN B;  5KDM A;  5C3I B;  5AVC D;  3B0B A;  2F8N K;  3W98 D;  4XUJ C;  3AV1 B;  4KHA A;  3X1U D;  3UTB C;  1P3I D;  2IO5 B;  2Y2K A;  4KGC B;  3AN2 B;  3AZF C;  5CPJ C;  2FJ7 A;  3NQJ A;  4KUD D;  1EQZ D;  3MGQ B;  5CPJ A;  4JJN D;  5DNM D;  4YS3 D;  3UTA B;  1M1A C;  3IP4 C;  1AOI B;  1EQZ B;  5AV6 C;  5BNV B;  4ZBJ C;  3B6F D;  3X1V C;  1ID3 A;  2NZD D;  4Z66 B;  3AZI D;  2G5I C;  5GT3 A;  3AZE D;  5B40 C;  5AV9 D;  3REK D;  3X1V A;  5DNN C;  5CPI A;  4G92 B;  3B6F B;  3MGP C;  5C3I C;  5B1M D;  5B2J B;  1P3K D;  4CSR B;  4X23 D;  3REJ A;  3LZ1 B;  3MGP A;  1A7W A;  4WV4 B;  3AV1 C;  4WU8 D;  3AZG B;  5B2I A;  2F8N G;  2IO5 C;  4Z2M H;  4KGC C;  3AN2 C;  2JCH A;  5AV8 B;  1P3A C;  3V9R B;  3WKJ B;  3AV2 D;  3KWQ D;  3WTP D;  1W2E A;  1KX3 D;  3A6N D;  3A1K A;  3MGQ C;  3R45 A;  3O62 B;  3AZM B;  1P3A A;  5B0Y B;  5BT1 D;  3VH5 W;  4J8U B;  3W96 B;  1BH8 B;  1BH9 B;  3X1T D;  3UTA C;  1M18 D;  1KX3 B;  1AOI C;  5F99 D;  3X1S D;  4DRA A;  1P3F B;  3UTA A;  5AY8 D;  5B32 C;  3KUY D;  3X1T B;  4Z66 C;  5B32 A;  4R8P A;  3C1C D;  4G92 C;  4H9P B;  3VH6 W;  3LZ0 B;  5B24 D;  5B2J C;  3LEL A;  3MVD D;  5BO0 B;  2BYK A;  3REI C;  5B0Z D;  4Z5T D;  4WU9 A;  3MNN B;  3REI A;  3AZG C;  3B0C T;  2BYM B;  2F8N H;  2Y2M A;  5AV5 D;  5B0Z B;  5AV8 C;  5JRG D;  3LJA D;  4G91 B;  2Y2J A;  5CPK A;  3WKJ C;  3WAA B;  1JFI B;  4HGA B;  2CWE A;  5AV5 B;  3REH D;  3O62 C;  1B6W A;  3AZM C;  5JRG B;  1P3O A;  5B0Y C;  3W96 C;  3KSY A;  4J8W B;  3AZJ B;  5GSU B;  1P3F C;  4H9N A;  4XZQ D;  4J8X C;  3W99 D;  4WJ3 C;  2YFV B;  5AVB D;  1TAF A;  1P3F A;  4J8X A;  2DQN C;  5BS7 C;  3W99 B;  5B31 B;  4NE5 A;  3LZ0 C;  1HQ3 D;  1T3U A;  5AVB B;  2UWX A;  5GT0 D;  1P3B D;  2XD1 A;  5BS7 A;  1P34 B;  2F8N D;  1N1J A;  1P3P B;  1KU5 A;  3MNN C;  2YFW B;  1P3M B;  4WNN A;  2CV5 B;  5GT0 B;  3UT9 D;  2F8N B;  4G91 C;  3AZH B;  2ZY5 A;  3WAA C;  4HGA C;  3KXB D;  3UT9 B;  3MGS B;  3WAA A;  2ARO D;  3AZN D;  3EG5 B;  5B33 B;  3KXB B;  4J8W C;  3AZJ C;  5GSU C;  1S32 C;  1KX4 A;  4AWL B;  1KX5 A;  3W97 C;  5B1L B;  1S32 A;  2PYO B;  5B32 G;  3W97 A;  5B31 C;  4LD9 B;  5E5A D;  1H3O B;  4NE6 A;  1P34 C;  1P3L A;  1F66 B;  1P3P C;  5FUG A;  1P3M C;  4H9O A;  2CV5 C;  2FJ7 D;  4WZS B;  5E5A B;  1TZY D;  3AYW D;  3AZH C;  4YM6 B;  3REL B;  5JA4 A;  3AZK C;  4ZUX D;  3AFA A;  1TZY B;  2LY8 A;  3MGS C;  3AYW B;  5GXQ B;  3AZK A;  1ZLA C;  1ID3 D;  4ZUX B;  3MGR C;  1ZLA A;  5AVC B;  5GT3 D;  1BFM A;  4XUJ A;  1M19 C;  3W98 B;  3MGR A;  3UTB A;  5CPI D;  3X1U B;  1P3I B;  5B1L C;  3TU4 D;  1M19 A;  2PYO C;  1PZR A;  2XD5 A;  3AZF A;  3REJ D;  3C1B D;  2Y2N A;  4LD9 C;  5BNX B;  1R4V A;  3TU4 B;  5B2I D;  4KUD B;  1F66 C;  4H9R B;  1M1A A;  1P3G D;  4JJN B;  5DNM B;  5AV6 A;  4YS3 B;  5CHL B;  1Z2C B;  3A1I A;  3WA9 D;  4YM6 C;  1WWS A;  3REL C;  2NZD B;  5B40 A;  3AZI B;  5DNN A;  5GXQ C;  3AZE B;  3REL A;  5AV9 B;  3REK B;  3WA9 B;  2W8S A;  5B1M B;  1P3K B;  2RVQ D;  5AVC C;  4X23 B;  3AV1 A;  4R8P D;  3B6G D;  3W98 C;  4WU8 B;  3X1U C;  1P3I C;  4KGC A;  3AN2 A;  3LEL D;  3NQU B;  4WU9 D;  3AV2 B;  3KWQ B;  3WTP B;  3MGQ A;  4KUD C;  3A6N B;  1EQZ C;  5CPK D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...