5CPID

Nucleosome containing unmethylated sat2r dna
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
93
structure length
93
Chain Sequence
b'SRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.1
publication title Influence of DNA methylation on positioning and DNA flexibility of nucleosomes with pericentric satellite DNA.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 33
structure length 93
sequence length 93
chains with identical sequence H
ec nomenclature
pdb deposition date 2015-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5cpiD00
3AYWB 3WTPC 5GXQD 5GSUD 3AZNC 3UT9B 1P3KB 1P3OB 3A6NB 3B6GA 3AV2D 1TZYA 4WNNA 5CPIC 3V9RA 1S32A 3MGQD 5B32B 3WTPE 5B40D 1AOIB 3UTBD 5B33C 5B0YC 4H9RB 3MGPA 4JJND 3AZEA 3AV1D 1P3GC 3W98B 3R45A 3MNND 3LJAA 4G92B 3C1BD 5GT0A 1P3PC 1N1JA 5AV9C 5JA4B 1KX5C 2F8NH 3AYWA 3UT9A 2FJ7B 1M1AC 5AV6B 1P3KA 1P3OA 3MGSD 2HIOB 3A6NA 5B1MD 3MGRC 5B31D 4Z2MG 4WU8C 4XZQC 5B32A 1BH8B 1P3BC 1AOIA 3B0BA 4H9RA 4KGCD 3W98A 1F66B 5DNMB 4LD9B 1B6WA 5G49B 5JA4A 3AN2D 5CP6B 2NQBC 4G91B 3WKJD 1P3LD 2FJ7A 5AV6A 2HIOA 4NE6A 1KX4D 1BH9B 3X1TC 3AZGB 1P3ID 3W97D 2PYOC 3REHC 1WWSA 3LELB 1BH8A 1BFMA 3REIC 5CPJC 4Z5TC 3B6GD 4QLCD 1TZYD 1EQZC 1F66A 4R8PC 3UTAC 1M19C 5DNMA 1S32D 4LD9A 3MVDB 5BNVB 5G49A 5CP6A 3NQJB 3O62B 1ULYA 2L5AA 3WAAB 4CAYB 3MGPD 1P3AD 5C3IC 1BH9A 3LJAD 3AZMB 5GT0D 3AZKC 3X1SB 2AROB 1KX3B 5AVCB 3LELA 3AYWD 3AZJD 3UT9D 5AVBB 5DNNB 1P3KD 1P3OD 2JSSA 4J8VB 3A6ND 5KDMB 2IO5C 4X23B 4J8WB 3AZFD 3MVDA 5BNVA 5B32D 3NQJA 3VH6A 4ZUXD 3O62A 1AOID 3WAAA 3RELC 4CAYA 3WA9B 3AZHC 3W98D 1R4VA 3AZLB 3AZMA 3KXBB 1P3FC 3X1SA 5BT1C 4ZBJB 2AROA 5JRGB 1KX3A 5AVCA 2YFVB 3VH6W 2FJ7D 4H9PB 5AVBA 5AV6D 5DNNA 3AZID 1ZLAB 4J8VA 2HIOD 5KDMA 4X23A 1HQ3B 4J8WA 5CPIB 3AFAB 5AY8C 3C1CB 3W96C 5B24C 5B0YB 1P3GB 3WA9A 3REKB 4KUDC 3AZLA 1F66D 4CSRB 5AV9B 3KXBA 3X1UC 2LY8A 4LD9D 5BS7A 3WTPA 5CP6D 3AZNA 4DRBA 4Z66C 2YFVA 4H9PA 1ZLAA 5CPKC 5E5AC 1HQ3A 4NE3A 4XUJB 4Z2MH 3AFAA 4WU8B 3C1CA 3AZGD 5CPIA 2HUEC 2CWEA 3LELD 5GT3C 3NQUB 5B0YA 5B0ZC 1P3GA 3KWQB 3REKA 1H3OB 4CSRA 5AV9A 5GXQC 5GSUC 3MVDD 3O62D 3WAAD 3AV2C 4WU9C 3AZMD 4XUJA 3MGQC 3X1SD 4WU8A 5B32G 3LZ1B 5B40C 2AROD 1KX3D 5AVCD 3AV1C 4JJNC 3B6FB 3B0CW 5CPJB 3NQUA 4Z5TB 5AVBD 5DNND 3MNNC 3W99B 3C1BC 4J8VD 3KWQA 5B2IC 1EQZB 5B1LB 4X23D 1M19B 4J8WD 3X1VC 1P34D 1H3OA 5CHLB 3MGSC 5B1MC 5B31C 3WA9D 3AZLD 4H9NB 3LZ1A 2F8ND 2CV5B 5JRGD 5B2JB 3B6FA 5AV8B 4KGCC 3REIA 5CPJA 4Z5TA 3W99A 1ZLAD 1EQZA 5B1LA 1HQ3D 1M19A 3AN2C 3AFAD 3C1CD 5CPID 3WKJC 1P3LC 3KSYA 3RELB 1KX4C 1P3GD 1P3IC 3REKD 2RVQD 1P3FB 3W97C 4H9NA 1U35D 5AV9D 4EO5C 3B0DC 3KUYB 2CV5A 4HGAC 5B2JA 1P3MC 3B6GC 5AV8A 1ID3B 4QLCC 3LZ0C 5AY8B 4XUJD 4J8UB 3W96B 4AWLC 1HTAA 1P3AC 3MGPC 1WWIA 5AV5B 3RELA 3LJAC 5GT0C 3KWQD 3AZED 1P3FA 3AZJC 3AYWC 3KUYA 3UT9C 1P3OC 3A6NC 1ID3A 3TU4B 4KHAB 3AZFC 5AY8A 3W96A 4J8UA 5B32C 3LZ1D 4ZUXC 5B24A 2NZDB 5GT3B 3VH5T 5B0ZB 3B6FD 5AV5A 5CPJD 1M18C 3W99D 4M6BA 4G92C 1EQZD 5B1LD 1M19D 5B31G 2F8NG 5GSUB 3REJB 5F99B 5BNXB 5AV6C 3AZIC 4J8XC 3WTPB 3AZNB 3TU4A 4KHAA 4DRAA 4WU9B 3MGQB 4H9QB 5B40B 4YS3C 2CV5D 2NZDA 5B2JD 5GT3A 5B0ZA 5AV8D 5B33B 5B2IB 1F66C 3X1VB 4LD9C 5GSUA 3REJA 4G91C 5F99A 1P3PB 1F1EA 5BNXA 5DNMD 1KX5B 1M1AB 3AZGC 4WU9A 3MGQA 3MGRB 4H9QA 4H9OB 1B67A 5B40A 3LELC 3KUYD 4XZQB 3AV1A 1ID3D 4YM6C 1P3BB 3C1BA 5B33A 5B2IA 3X1VA 5AY8D 5FUGB 4J8UD 3W96D 1P3PA 3O62C 1KX4B 2BYMB 1KX5A 5AV5D 2NQBB 2YFWB 1A7WA 3AZMC 1M1AA 3MGRA 4EO5B 2AROC 3B0DB 3X1TB 1KX3C 3VH5A 4H9OA 1P3MB 5AVBC 4XZQA 3REHB 2PYOB 4J8VC 3UTBC 4QLCB 1P3BA 4X23C 3TU4D 4J8WC 1P34C 3LZ0B 3REIB 5FUGA 4AWLB 4R8PB 3UTAB 1P3AB 2NZDD 2BYKB 4H9SC 5GT3D 1KX4A 2BYMA 5B0ZD 2NQBA 3WA9C 2YFWA 5C3IB 5BS7C 3AZJB 4ZBJC 4NFTA 5JRGC 3REJD 3X1TA 5F99D 3AZKB 3KXBD 1P3MA 1KU5A 2PYOA 3REHA 1ZLAC 3WTPD 4QLCA 3AZND 1HQ3C 3AZFB 3LZ0A 3AFAC 4WU9D 3C1CC 2IO5B 4ZUXB 4R8PA 3UTAA 1P3AA 2BYKA 1M18B 3REKC 2RVQC 5B33D 5B2ID 5B0YD 1U35C 3X1VD 4WZSB 3AZHB 3AZJA 5BO0B 1Q9CA 3AZKA 1P3PD 3AZIB 4J8XB 1KX5D 3VH6T 4XUJC 1M1AD 3AZFA 1TZYC 3MGRD 4YS3B 1S32C 4ZUXA 4WU8D 4XZQD 5B24B 1M18A 3KWQC 1P3BD 3AZEC 3AZHA 4KUDB 5BO0A 3X1UB 3AZIA 4J8XA 4UUZB 2NQBD 4Z66B 1P3KC 3LZ1C 5CPKB 5E5AB 3X1TD 4YS3A 3B6FC 2HUEB 1P3MD 2PYOD 3REHD 3W99C 4YM6B 1AOIC 5B1LC 3LZ0D 3REID 3W98C 4Z5TD 4KUDA 4R8PD 3UTAD 3X1UA 5GXQB 4UUZA 2FJ7C 4Z66A 3AZGA 2HIOC 3AV2B 2CV5C 5CPKA 5E5AA 5B2JC 3AZKD 5AV8C 3UTBB 4YM6A 3B0CT 3AV1B 4JJNB 1P34B 3MNNB 3C1BB 4E44A 5DNMC 5GXQA 5CP6C 1M18D 3MGSB 4WV4B 5B1MB 3RELD 3AV2A 5B31B 2F8NB 3KUYC 3AZHD 1P3FD 5BT1D 1ID3C 4J8XD 1TAFB 3UTBA 4JJNA 1P34A 4KGCB 3MNNA 4J8UC 2F8NK 4YS3D 3AN2B 5AV5C 3MVDC 3WKJB 4H9SA 1P3LB 1JFIB 5B24D 3WAAC 3MGSA 1U35B 5B1MA 5B31A 2F8NA 1P3IB 5JRGA 3X1SC 3W97B 4KUDD 3X1UD 5AVCC 3TU4C 1TAFA 4HGAB 4Z66D 5DNNC 3B6GB 4KGCA 4NE5A 1TZYB 4WNNB 3V9RB 1S32B 5CPKD 5E5AD 2NZDC 3AN2A 3WKJA 3VH5W 4E45A 1JFIA 1P3LA 4YM6D 3MGPB 3AZEB 1U35A 3R45B 3LJAB 3REJC 5GT0B 5F99C 3AZLC 1N1JB 1P3IA 3KXBC 3W97A
chains in the Genus database with same CATH superfamily
3AYWB 3WTPC 5GXQD 5GSUD 3AZNC 3UT9B 1P3KB 1P3OB 3A6NB 3B6GA 3AV2D 1TZYA 4WNNA 5CPIC 3V9RA 1S32A 3MGQD 5B32B 3WTPE 5B40D 1AOIB 3UTBD 5B33C 5B0YC 4H9RB 3MGPA 4JJND 3AZEA 3AV1D 1P3GC 3W98B 3R45A 3MNND 3LJAA 4G92B 3C1BD 5GT0A 1P3PC 1N1JA 5AV9C 5JA4B 1KX5C 2F8NH 3AYWA 3EPKA 3UT9A 2FJ7B 1M1AC 5AV6B 1P3KA 1P3OA 3MGSD 2HIOB 3A6NA 5B1MD 3MGRC 5B31D 4Z2MG 4WU8C 4XZQC 5B32A 1BH8B 1P3BC 1AOIA 3B0BA 4H9RA 4KGCD 3W98A 1F66B 5DNMB 4LD9B 1B6WA 5G49B 5JA4A 3AN2D 5CP6B 2NQBC 4G91B 3WKJD 1P3LD 2FJ7A 5AV6A 2HIOA 4NE6A 1KX4D 1BH9B 3X1TC 3AZGB 1P3ID 3W97D 2PYOC 3REHC 1WWSA 3LELB 1BH8A 1BFMA 3REIC 5CPJC 4Z5TC 2Y2JA 2ZY3A 3B6GD 4QLCD 1TZYD 1EQZC 1F66A 4R8PC 3UTAC 1M19C 5DNMA 3EPJA 1S32D 4LD9A 3MVDB 5BNVB 5G49A 5CP6A 3NQJB 3O62B 1ULYA 2L5AA 3WAAB 4CAYB 3MGPD 1P3AD 5C3IC 1BH9A 3LJAD 3AZMB 5GT0D 3AZKC 3X1SB 2AROB 1KX3B 5AVCB 3LELA 3AYWD 3AZJD 3UT9D 5AVBB 5DNNB 1P3KD 1P3OD 2JSSA 3P5JB 4J8VB 3A6ND 5KDMB 2IO5C 4X23B 4J8WB 3AZFD 3MVDA 5BNVA 5B32D 2Y2OA 3NQJA 3VH6A 4ZUXD 3O62A 1AOID 2JCHA 3RELC 3WAAA 4CAYA 3WA9B 3AZHC 3EPLA 3W98D 1R4VA 3AZLB 3AZMA 3KXBB 1P3FC 3X1SA 5BT1C 2ZY2A 4ZBJB 2AROA 5JRGB 1KX3A 5AVCA 2YFVB 3VH6W 2FJ7D 4H9PB 5AVBA 5AV6D 5DNNA 3AZID 1ZLAB 4J8VA 2HIOD 5KDMA 4X23A 1HQ3B 4J8WA 5CPIB 3AFAB 5AY8C 3C1CB 3W96C 5B24C 5B0YB 1P3GB 3WA9A 3REKB 3H0RC 4KUDC 3AZLA 1F66D 4CSRB 5AV9B 3KXBA 3X1UC 2LY8A 4LD9D 5BS7A 3WTPA 5CP6D 3AZNA 4DRBA 4Z66C 2YFVA 4H9PA 1ZLAA 5CPKC 5E5AC 1HQ3A 2VQRA 4NE3A 4Z2MH 4XUJB 4WU8B 3AFAA 3C1CA 3AZGD 5CPIA 2HUEC 2CWEA 3LELD 5GT3C 3NQUB 5B0YA 5B0ZC 1P3GA 3KWQB 3IP4C 3REKA 1H3OB 4CSRA 5AV9A 5GXQC 5GSUC 3MVDD 3O62D 2FFFB 3AV2C 3WAAD 4WU9C 3AZMD 4XUJA 3MGQC 3X1SD 4WU8A 5B32G 3LZ1B 5B40C 2AROD 1KX3D 5AVCD 3AV1C 4JJNC 3B6FB 3B0CW 5CPJB 3NQUA 4Z5TB 5AVBD 5DNND 3MNNC 3W99B 3C1BC 4J8VD 3KWQA 5B2IC 1EQZB 5B1LB 4X23D 1M19B 4J8WD 3X1VC 1P34D 1H3OA 5CHLB 3MGSC 5B1MC 5B31C 3WA9D 3AZLD 4H9NB 2G5IC 3LZ1A 2F8ND 2CV5B 2XD5A 5JRGD 5B2JB 3B6FA 5AV8B 4KGCC 2BG1A 3REIA 5CPJA 4Z5TA 3W99A 2Y2GA 1ZLAD 1EQZA 5B1LA 2Y2NA 1HQ3D 1M19A 3AN2C 3AFAD 3C1CD 5CPID 3WKJC 1P3LC 3KSYA 3RELB 1KX4C 1P3GD 1P3IC 3REKD 2RVQD 1P3FB 3W97C 4H9NA 1U35D 5AV9D 4EO5C 3B0DC 3KUYB 2CV5A 4HGAC 5B2JA 1P3MC 3B6GC 5AV8A 1ID3B 4QLCC 4DQYB 3LZ0C 5AY8B 4XUJD 4J8UB 3W96B 4AWLC 2UWXA 1HTAA 1P3AC 3MGPC 1WWIA 5AV5B 3RELA 2F2AC 3LJAC 5GT0C 3KWQD 3AZED 1P3FA 1PZRA 3AZJC 3AYWC 3KUYA 3UT9C 1P3OC 3A6NC 1ID3A 3TU4B 3FDDA 4KHAB 3AZFC 2ZM5A 5AY8A 3W96A 4J8UA 5B32C 4UPKA 3LZ1D 4ZUXC 5B24A 2NZDB 5GT3B 3VH5T 5B0ZB 3B6FD 5AV5A 5CPJD 1M18C 3W99D 4M6BA 4G92C 1EQZD 5B1LD 1M19D 5B31G 2F8NG 5GSUB 3REJB 5F99B 5BNXB 5AV6C 3AZIC 4WJ3C 4J8XC 3WTPB 3AZNB 3TU4A 4KHAA 4DRAA 4WU9B 3MGQB 4H9QB 5B40B 3A1KA 4YS3C 2JE5A 2CV5D 2NZDA 5B2JD 5GT3A 5B0ZA 5AV8D 5B33B 5B2IB 1F66C 3X1VB 4LD9C 2W8SA 5GSUA 3REJA 3H0LC 4G91C 5F99A 1P3PB 1F1EA 5BNXA 5DNMD 1KX5B 2Y2HA 1M1AB 3AZGC 4WU9A 3MGQA 3MGRB 4H9QA 4H9OB 1B67A 5B40A 3LELC 3KUYD 3H0MC 4XZQB 3AV1A 2ZY4A 1ID3D 4YM6C 1P3BB 3C1BA 5B33A 5B2IA 3X1VA 5AY8D 5FUGB 4J8UD 3W96D 1W2EA 1P3PA 3O62C 1KX4B 2BYMB 1KX5A 5AV5D 2NQBB 2YFWB 1A7WA 2DF4C 3AZMC 1M1AA 3MGRA 4EO5B 2AROC 3B0DB 3X1TB 1KX3C 3VH5A 4H9OA 1P3MB 5AVBC 4XZQA 3REHB 2PYOB 4J8VC 3UTBC 4QLCB 1P3BA 4X23C 3TU4D 2Y2KA 4J8WC 1P34C 3LZ0B 3EPHA 3REIB 5FUGA 4AWLB 4R8PB 3UTAB 1P3AB 2NZDD 2BYKB 4H9SC 5GT3D 1KX4A 2BYMA 5B0ZD 2NQBA 3WA9C 3F6TA 2YFWA 5C3IB 5BS7C 3AZJB 4ZBJC 4NFTA 5JRGC 3REJD 3X1TA 5F99D 3AZKB 3KXBD 1P3MA 1KU5A 2PYOA 3REHA 2Y2PA 1ZLAC 3WTPD 4QLCA 3AZND 1HQ3C 3AZFB 3LZ0A 3AFAC 4WU9D 3C1CC 2IO5B 4ZUXB 4R8PA 2DQNC 3UTAA 1P3AA 2BYKA 1M18B 3REKC 2RVQC 5B33D 5B2ID 5B0YD 1U35C 3X1VD 4WZSB 3AZHB 3AZJA 5BO0B 1Q9CA 3AZKA 1P3PD 3AZIB 4J8XB 1KX5D 3VH6T 4XUJC 1M1AD 2XD1A 2Y2QA 3AZFA 1TZYC 3MGRD 4YS3B 1S32C 4ZUXA 4WU8D 4XZQD 5B24B 1M18A 3KWQC 1P3BD 3AZEC 1T3UA 3AZHA 2J8PA 4KUDB 2Y2IA 5BO0A 3X1UB 3AZIA 4J8XA 4UUZB 2NQBD 2ZY5A 4Z66B 1P3KC 3LZ1C 1Z2CB 5CPKB 5E5AB 3X1TD 4YS3A 3B6FC 3AL0C 2HUEB 1P3MD 2G5HC 2PYOD 3REHD 3W99C 4YM6B 1AOIC 5B1LC 3LZ0D 3REID 3W98C 4Z5TD 4KUDA 4R8PD 3UTAD 3X1UA 5GXQB 4UUZA 2FJ7C 4Z66A 3A1IA 3AZGA 2HIOC 3AV2B 3EG5B 2Y2LA 5CPKA 5E5AA 2CV5C 5B2JC 3AZKD 5AV8C 2Y2MA 3UTBB 4YM6A 3B0CT 3AV1B 4JJNB 1P34B 3KFUG 3MNNB 3C1BB 4E44A 5DNMC 5GXQA 5CP6C 1M18D 3MGSB 4WV4B 5B1MB 3RELD 3AV2A 5B31B 2F8NB 3KUYC 3AZHD 1P3FD 5BT1D 1ID3C 4J8XD 1TAFB 3UTBA 4JJNA 1P34A 4KGCB 3MNNA 4J8UC 2F8NK 4YS3D 3AN2B 5AV5C 3MVDC 3WKJB 2RIQA 4H9SA 1P3LB 1JFIB 5B24D 3WAAC 3MGSA 1U35B 5B1MA 5B31A 2F8NA 1P3IB 5JRGA 3X1SC 3W97B 4KUDD 3X1UD 5AVCC 3TU4C 1TAFA 4HGAB 4Z66D 5DNNC 3B6GB 4KGCA 4NE5A 1TZYB 4WNNB 3V9RB 1S32B 5CPKD 5E5AD 2NZDC 3AN2A 3WKJA 3VH5W 4E45A 1JFIA 1P3LA 4YM6D 3MGPB 3AZEB 1U35A 3R45B 3LJAB 3REJC 5GT0B 5F99C 3AZLC 1N1JB 1P3IA 3KXBC 3W97A
chains in the Genus database with same CATH topology
3AYWB 3WTPC 5GXQD 5GSUD 3AZNC 3UT9B 1P3KB 1P3OB 3A6NB 3B6GA 3AV2D 1TZYA 4WNNA 5CPIC 3V9RA 1S32A 3MGQD 5B32B 3WTPE 5B40D 1AOIB 3UTBD 5B33C 5B0YC 4H9RB 3MGPA 4JJND 3AZEA 3AV1D 1P3GC 3W98B 3R45A 3MNND 3LJAA 4G92B 3C1BD 5GT0A 1P3PC 1N1JA 5AV9C 5JA4B 1KX5C 2F8NH 3AYWA 3EPKA 3UT9A 2FJ7B 1M1AC 5AV6B 1P3KA 1P3OA 3MGSD 2HIOB 3A6NA 5B1MD 3MGRC 5B31D 4Z2MG 4WU8C 4XZQC 5B32A 1BH8B 1P3BC 1AOIA 3B0BA 4H9RA 4KGCD 3W98A 1F66B 5DNMB 4LD9B 1B6WA 5G49B 5JA4A 3AN2D 5CP6B 2NQBC 4G91B 3WKJD 1P3LD 2FJ7A 5AV6A 2HIOA 4NE6A 1KX4D 1BH9B 3X1TC 3AZGB 1P3ID 3W97D 2PYOC 3REHC 1WWSA 3LELB 1BH8A 1BFMA 3REIC 5CPJC 4Z5TC 2Y2JA 2ZY3A 3B6GD 4QLCD 1TZYD 1EQZC 1F66A 4R8PC 3UTAC 1M19C 5DNMA 3EPJA 1S32D 4LD9A 3MVDB 5BNVB 5G49A 5CP6A 3NQJB 3O62B 1ULYA 2L5AA 3WAAB 4CAYB 3MGPD 1P3AD 5C3IC 1BH9A 3LJAD 3AZMB 5GT0D 3AZKC 3X1SB 2AROB 1KX3B 5AVCB 3LELA 3AYWD 3AZJD 3UT9D 5AVBB 5DNNB 1P3KD 1P3OD 2JSSA 3P5JB 4J8VB 3A6ND 5KDMB 2IO5C 4X23B 4J8WB 3AZFD 3MVDA 5BNVA 5B32D 2Y2OA 3NQJA 3VH6A 4ZUXD 3O62A 1AOID 2JCHA 3RELC 3WAAA 4CAYA 3WA9B 3AZHC 3EPLA 3W98D 1R4VA 3AZLB 3AZMA 3KXBB 1P3FC 3X1SA 5BT1C 2ZY2A 4ZBJB 2AROA 5JRGB 1KX3A 5AVCA 2YFVB 3VH6W 2FJ7D 4H9PB 5AVBA 5AV6D 5DNNA 3AZID 1ZLAB 4J8VA 2HIOD 5KDMA 4X23A 1HQ3B 4J8WA 5CPIB 3AFAB 5AY8C 3C1CB 3W96C 5B24C 5B0YB 1P3GB 3WA9A 3REKB 3H0RC 4KUDC 3AZLA 1F66D 4CSRB 5AV9B 3KXBA 3X1UC 2LY8A 4LD9D 5BS7A 3WTPA 5CP6D 3AZNA 4DRBA 4Z66C 2YFVA 4H9PA 1ZLAA 5CPKC 5E5AC 1HQ3A 2VQRA 4NE3A 4Z2MH 4XUJB 4WU8B 3AFAA 3C1CA 3AZGD 5CPIA 2HUEC 2CWEA 3LELD 5GT3C 3NQUB 5B0YA 5B0ZC 1P3GA 3KWQB 3IP4C 3REKA 1H3OB 4CSRA 5AV9A 5GXQC 5GSUC 3MVDD 3O62D 2FFFB 3AV2C 3WAAD 4WU9C 3AZMD 4XUJA 3MGQC 3X1SD 4WU8A 5B32G 3LZ1B 5B40C 2AROD 1KX3D 5AVCD 3AV1C 4JJNC 3B6FB 3B0CW 5CPJB 3NQUA 4Z5TB 5AVBD 5DNND 3MNNC 3W99B 3C1BC 4J8VD 3KWQA 5B2IC 1EQZB 5B1LB 4X23D 1M19B 4J8WD 3X1VC 1P34D 1H3OA 5CHLB 3MGSC 5B1MC 5B31C 3WA9D 3AZLD 4H9NB 2G5IC 3LZ1A 2F8ND 2CV5B 2XD5A 5JRGD 5B2JB 3B6FA 5AV8B 4KGCC 2BG1A 3REIA 5CPJA 4Z5TA 3W99A 2Y2GA 1ZLAD 1EQZA 5B1LA 2Y2NA 1HQ3D 1M19A 3AN2C 3AFAD 3C1CD 5CPID 3WKJC 1P3LC 3KSYA 3RELB 1KX4C 1P3GD 1P3IC 3REKD 2RVQD 1P3FB 3W97C 4H9NA 1U35D 5AV9D 4EO5C 3B0DC 3KUYB 2CV5A 4HGAC 5B2JA 1P3MC 3B6GC 5AV8A 1ID3B 4QLCC 4DQYB 3LZ0C 5AY8B 4XUJD 4J8UB 3W96B 4AWLC 2UWXA 1HTAA 1P3AC 3MGPC 1WWIA 5AV5B 3RELA 2F2AC 3LJAC 5GT0C 3KWQD 3AZED 1P3FA 1PZRA 3AZJC 3AYWC 3KUYA 3UT9C 1P3OC 3A6NC 1ID3A 3TU4B 3FDDA 4KHAB 3AZFC 2ZM5A 5AY8A 3W96A 4J8UA 5B32C 4UPKA 3LZ1D 4ZUXC 5B24A 2NZDB 5GT3B 3VH5T 5B0ZB 3B6FD 5AV5A 5CPJD 1M18C 3W99D 4M6BA 4G92C 1EQZD 5B1LD 1M19D 5B31G 2F8NG 5GSUB 3REJB 5F99B 5BNXB 5AV6C 3AZIC 4WJ3C 4J8XC 3WTPB 3AZNB 3TU4A 4KHAA 4DRAA 4WU9B 3MGQB 4H9QB 5B40B 3A1KA 4YS3C 2JE5A 2CV5D 2NZDA 5B2JD 5GT3A 5B0ZA 5AV8D 5B33B 5B2IB 1F66C 3X1VB 4LD9C 2W8SA 5GSUA 3REJA 3H0LC 4G91C 5F99A 1P3PB 1F1EA 5BNXA 5DNMD 1KX5B 2Y2HA 1M1AB 3AZGC 4WU9A 3MGQA 3MGRB 4H9QA 4H9OB 1B67A 5B40A 3LELC 3KUYD 3H0MC 4XZQB 3AV1A 2ZY4A 1ID3D 4YM6C 1P3BB 3C1BA 5B33A 5B2IA 3X1VA 5AY8D 5FUGB 4J8UD 3W96D 1W2EA 1P3PA 3O62C 1KX4B 2BYMB 1KX5A 5AV5D 2NQBB 2YFWB 1A7WA 2DF4C 3AZMC 1M1AA 3MGRA 4EO5B 2AROC 3B0DB 3X1TB 1KX3C 3VH5A 4H9OA 1P3MB 5AVBC 4XZQA 3REHB 2PYOB 4J8VC 3UTBC 4QLCB 1P3BA 4X23C 3TU4D 2Y2KA 4J8WC 1P34C 3LZ0B 3EPHA 3REIB 5FUGA 4AWLB 4R8PB 3UTAB 1P3AB 2NZDD 2BYKB 4H9SC 5GT3D 1KX4A 2BYMA 5B0ZD 2NQBA 3WA9C 3F6TA 2YFWA 5C3IB 5BS7C 3AZJB 4ZBJC 4NFTA 5JRGC 3REJD 3X1TA 5F99D 3AZKB 3KXBD 1P3MA 1KU5A 2PYOA 3REHA 2Y2PA 1ZLAC 3WTPD 4QLCA 3AZND 1HQ3C 3AZFB 3LZ0A 3AFAC 4WU9D 3C1CC 2IO5B 4ZUXB 4R8PA 2DQNC 3UTAA 1P3AA 2BYKA 1M18B 3REKC 2RVQC 5B33D 5B2ID 5B0YD 1U35C 3X1VD 4WZSB 3AZHB 3AZJA 5BO0B 1Q9CA 3AZKA 1P3PD 3AZIB 4J8XB 1KX5D 3VH6T 4XUJC 1M1AD 2XD1A 2Y2QA 3AZFA 1TZYC 3MGRD 4YS3B 1S32C 4ZUXA 4WU8D 4XZQD 5B24B 1M18A 3KWQC 1P3BD 3AZEC 1T3UA 3AZHA 2J8PA 4KUDB 2Y2IA 5BO0A 3X1UB 3AZIA 4J8XA 4UUZB 2NQBD 2ZY5A 4Z66B 1P3KC 3LZ1C 1Z2CB 5CPKB 5E5AB 3X1TD 4YS3A 3B6FC 3AL0C 2HUEB 1P3MD 2G5HC 2PYOD 3REHD 3W99C 4YM6B 1AOIC 5B1LC 3LZ0D 3REID 3W98C 4Z5TD 4KUDA 4R8PD 3UTAD 3X1UA 5GXQB 4UUZA 2FJ7C 4Z66A 3A1IA 3AZGA 2HIOC 3AV2B 3EG5B 2Y2LA 5CPKA 5E5AA 2CV5C 5B2JC 3AZKD 5AV8C 2Y2MA 3UTBB 4YM6A 3B0CT 3AV1B 4JJNB 1P34B 3KFUG 3MNNB 3C1BB 4E44A 5DNMC 5GXQA 5CP6C 1M18D 3MGSB 4WV4B 5B1MB 3RELD 3AV2A 5B31B 2F8NB 3KUYC 3AZHD 1P3FD 5BT1D 1ID3C 4J8XD 1TAFB 3UTBA 4JJNA 1P34A 4KGCB 3MNNA 4J8UC 2F8NK 4YS3D 3AN2B 5AV5C 3MVDC 3WKJB 2RIQA 4H9SA 1P3LB 1JFIB 5B24D 3WAAC 3MGSA 1U35B 5B1MA 5B31A 2F8NA 1P3IB 5JRGA 3X1SC 3W97B 4KUDD 3X1UD 5AVCC 3TU4C 1TAFA 4HGAB 4Z66D 5DNNC 3B6GB 4KGCA 4NE5A 1TZYB 4WNNB 3V9RB 1S32B 5CPKD 5E5AD 2NZDC 3AN2A 3WKJA 3VH5W 4E45A 1JFIA 1P3LA 4YM6D 3MGPB 3AZEB 1U35A 3R45B 3LJAB 3REJC 5GT0B 5F99C 3AZLC 1N1JB 1P3IA 3KXBC 3W97A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AYW B;  3WTP C;  5GXQ D;  5GSU D;  3AZN C;  3UT9 B;  1P3K B;  1P3O B;  3A6N B;  3B6G A;  3AV2 D;  1TZY A;  4WNN A;  5CPI C;  3V9R A;  1S32 A;  3MGQ D;  5B32 B;  3WTP E;  5B40 D;  1AOI B;  3UTB D;  5B33 C;  5B0Y C;  4H9R B;  3MGP A;  4JJN D;  3AZE A;  3AV1 D;  1P3G C;  3W98 B;  3R45 A;  3MNN D;  3LJA A;  4G92 B;  3C1B D;  5GT0 A;  1P3P C;  1N1J A;  5AV9 C;  5JA4 B;  1KX5 C;  2F8N H;  3AYW A;  3UT9 A;  2FJ7 B;  1M1A C;  5AV6 B;  1P3K A;  1P3O A;  3MGS D;  2HIO B;  3A6N A;  5B1M D;  3MGR C;  5B31 D;  4Z2M G;  4WU8 C;  4XZQ C;  5B32 A;  1BH8 B;  1P3B C;  1AOI A;  3B0B A;  4H9R A;  4KGC D;  3W98 A;  1F66 B;  5DNM B;  4LD9 B;  1B6W A;  5G49 B;  5JA4 A;  3AN2 D;  5CP6 B;  2NQB C;  4G91 B;  3WKJ D;  1P3L D;  2FJ7 A;  5AV6 A;  2HIO A;  4NE6 A;  1KX4 D;  1BH9 B;  3X1T C;  3AZG B;  1P3I D;  3W97 D;  2PYO C;  3REH C;  1WWS A;  3LEL B;  1BH8 A;  1BFM A;  3REI C;  5CPJ C;  4Z5T C;  3B6G D;  4QLC D;  1TZY D;  1EQZ C;  1F66 A;  4R8P C;  3UTA C;  1M19 C;  5DNM A;  1S32 D;  4LD9 A;  3MVD B;  5BNV B;  5G49 A;  5CP6 A;  3NQJ B;  3O62 B;  1ULY A;  2L5A A;  3WAA B;  4CAY B;  3MGP D;  1P3A D;  5C3I C;  1BH9 A;  3LJA D;  3AZM B;  5GT0 D;  3AZK C;  3X1S B;  2ARO B;  1KX3 B;  5AVC B;  3LEL A;  3AYW D;  3AZJ D;  3UT9 D;  5AVB B;  5DNN B;  1P3K D;  1P3O D;  2JSS A;  4J8V B;  3A6N D;  5KDM B;  2IO5 C;  4X23 B;  4J8W B;  3AZF D;  3MVD A;  5BNV A;  5B32 D;  3NQJ A;  3VH6 A;  4ZUX D;  3O62 A;  1AOI D;  3WAA A;  3REL C;  4CAY A;  3WA9 B;  3AZH C;  3W98 D;  1R4V A;  3AZL B;  3AZM A;  3KXB B;  1P3F C;  3X1S A;  5BT1 C;  4ZBJ B;  2ARO A;  5JRG B;  1KX3 A;  5AVC A;  2YFV B;  3VH6 W;  2FJ7 D;  4H9P B;  5AVB A;  5AV6 D;  5DNN A;  3AZI D;  1ZLA B;  4J8V A;  2HIO D;  5KDM A;  4X23 A;  1HQ3 B;  4J8W A;  5CPI B;  3AFA B;  5AY8 C;  3C1C B;  3W96 C;  5B24 C;  5B0Y B;  1P3G B;  3WA9 A;  3REK B;  4KUD C;  3AZL A;  1F66 D;  4CSR B;  5AV9 B;  3KXB A;  3X1U C;  2LY8 A;  4LD9 D;  5BS7 A;  3WTP A;  5CP6 D;  3AZN A;  4DRB A;  4Z66 C;  2YFV A;  4H9P A;  1ZLA A;  5CPK C;  5E5A C;  1HQ3 A;  4NE3 A;  4XUJ B;  4Z2M H;  3AFA A;  4WU8 B;  3C1C A;  3AZG D;  5CPI A;  2HUE C;  2CWE A;  3LEL D;  5GT3 C;  3NQU B;  5B0Y A;  5B0Z C;  1P3G A;  3KWQ B;  3REK A;  1H3O B;  4CSR A;  5AV9 A;  5GXQ C;  5GSU C;  3MVD D;  3O62 D;  3WAA D;  3AV2 C;  4WU9 C;  3AZM D;  4XUJ A;  3MGQ C;  3X1S D;  4WU8 A;  5B32 G;  3LZ1 B;  5B40 C;  2ARO D;  1KX3 D;  5AVC D;  3AV1 C;  4JJN C;  3B6F B;  3B0C W;  5CPJ B;  3NQU A;  4Z5T B;  5AVB D;  5DNN D;  3MNN C;  3W99 B;  3C1B C;  4J8V D;  3KWQ A;  5B2I C;  1EQZ B;  5B1L B;  4X23 D;  1M19 B;  4J8W D;  3X1V C;  1P34 D;  1H3O A;  5CHL B;  3MGS C;  5B1M C;  5B31 C;  3WA9 D;  3AZL D;  4H9N B;  3LZ1 A;  2F8N D;  2CV5 B;  5JRG D;  5B2J B;  3B6F A;  5AV8 B;  4KGC C;  3REI A;  5CPJ A;  4Z5T A;  3W99 A;  1ZLA D;  1EQZ A;  5B1L A;  1HQ3 D;  1M19 A;  3AN2 C;  3AFA D;  3C1C D;  5CPI D;  3WKJ C;  1P3L C;  3KSY A;  3REL B;  1KX4 C;  1P3G D;  1P3I C;  3REK D;  2RVQ D;  1P3F B;  3W97 C;  4H9N A;  1U35 D;  5AV9 D;  4EO5 C;  3B0D C;  3KUY B;  2CV5 A;  4HGA C;  5B2J A;  1P3M C;  3B6G C;  5AV8 A;  1ID3 B;  4QLC C;  3LZ0 C;  5AY8 B;  4XUJ D;  4J8U B;  3W96 B;  4AWL C;  1HTA A;  1P3A C;  3MGP C;  1WWI A;  5AV5 B;  3REL A;  3LJA C;  5GT0 C;  3KWQ D;  3AZE D;  1P3F A;  3AZJ C;  3AYW C;  3KUY A;  3UT9 C;  1P3O C;  3A6N C;  1ID3 A;  3TU4 B;  4KHA B;  3AZF C;  5AY8 A;  3W96 A;  4J8U A;  5B32 C;  3LZ1 D;  4ZUX C;  5B24 A;  2NZD B;  5GT3 B;  3VH5 T;  5B0Z B;  3B6F D;  5AV5 A;  5CPJ D;  1M18 C;  3W99 D;  4M6B A;  4G92 C;  1EQZ D;  5B1L D;  1M19 D;  5B31 G;  2F8N G;  5GSU B;  3REJ B;  5F99 B;  5BNX B;  5AV6 C;  3AZI C;  4J8X C;  3WTP B;  3AZN B;  3TU4 A;  4KHA A;  4DRA A;  4WU9 B;  3MGQ B;  4H9Q B;  5B40 B;  4YS3 C;  2CV5 D;  2NZD A;  5B2J D;  5GT3 A;  5B0Z A;  5AV8 D;  5B33 B;  5B2I B;  1F66 C;  3X1V B;  4LD9 C;  5GSU A;  3REJ A;  4G91 C;  5F99 A;  1P3P B;  1F1E A;  5BNX A;  5DNM D;  1KX5 B;  1M1A B;  3AZG C;  4WU9 A;  3MGQ A;  3MGR B;  4H9Q A;  4H9O B;  1B67 A;  5B40 A;  3LEL C;  3KUY D;  4XZQ B;  3AV1 A;  1ID3 D;  4YM6 C;  1P3B B;  3C1B A;  5B33 A;  5B2I A;  3X1V A;  5AY8 D;  5FUG B;  4J8U D;  3W96 D;  1P3P A;  3O62 C;  1KX4 B;  2BYM B;  1KX5 A;  5AV5 D;  2NQB B;  2YFW B;  1A7W A;  3AZM C;  1M1A A;  3MGR A;  4EO5 B;  2ARO C;  3B0D B;  3X1T B;  1KX3 C;  3VH5 A;  4H9O A;  1P3M B;  5AVB C;  4XZQ A;  3REH B;  2PYO B;  4J8V C;  3UTB C;  4QLC B;  1P3B A;  4X23 C;  3TU4 D;  4J8W C;  1P34 C;  3LZ0 B;  3REI B;  5FUG A;  4AWL B;  4R8P B;  3UTA B;  1P3A B;  2NZD D;  2BYK B;  4H9S C;  5GT3 D;  1KX4 A;  2BYM A;  5B0Z D;  2NQB A;  3WA9 C;  2YFW A;  5C3I B;  5BS7 C;  3AZJ B;  4ZBJ C;  4NFT A;  5JRG C;  3REJ D;  3X1T A;  5F99 D;  3AZK B;  3KXB D;  1P3M A;  1KU5 A;  2PYO A;  3REH A;  1ZLA C;  3WTP D;  4QLC A;  3AZN D;  1HQ3 C;  3AZF B;  3LZ0 A;  3AFA C;  4WU9 D;  3C1C C;  2IO5 B;  4ZUX B;  4R8P A;  3UTA A;  1P3A A;  2BYK A;  1M18 B;  3REK C;  2RVQ C;  5B33 D;  5B2I D;  5B0Y D;  1U35 C;  3X1V D;  4WZS B;  3AZH B;  3AZJ A;  5BO0 B;  1Q9C A;  3AZK A;  1P3P D;  3AZI B;  4J8X B;  1KX5 D;  3VH6 T;  4XUJ C;  1M1A D;  3AZF A;  1TZY C;  3MGR D;  4YS3 B;  1S32 C;  4ZUX A;  4WU8 D;  4XZQ D;  5B24 B;  1M18 A;  3KWQ C;  1P3B D;  3AZE C;  3AZH A;  4KUD B;  5BO0 A;  3X1U B;  3AZI A;  4J8X A;  4UUZ B;  2NQB D;  4Z66 B;  1P3K C;  3LZ1 C;  5CPK B;  5E5A B;  3X1T D;  4YS3 A;  3B6F C;  2HUE B;  1P3M D;  2PYO D;  3REH D;  3W99 C;  4YM6 B;  1AOI C;  5B1L C;  3LZ0 D;  3REI D;  3W98 C;  4Z5T D;  4KUD A;  4R8P D;  3UTA D;  3X1U A;  5GXQ B;  4UUZ A;  2FJ7 C;  4Z66 A;  3AZG A;  2HIO C;  3AV2 B;  2CV5 C;  5CPK A;  5E5A A;  5B2J C;  3AZK D;  5AV8 C;  3UTB B;  4YM6 A;  3B0C T;  3AV1 B;  4JJN B;  1P34 B;  3MNN B;  3C1B B;  4E44 A;  5DNM C;  5GXQ A;  5CP6 C;  1M18 D;  3MGS B;  4WV4 B;  5B1M B;  3REL D;  3AV2 A;  5B31 B;  2F8N B;  3KUY C;  3AZH D;  1P3F D;  5BT1 D;  1ID3 C;  4J8X D;  1TAF B;  3UTB A;  4JJN A;  1P34 A;  4KGC B;  3MNN A;  4J8U C;  2F8N K;  4YS3 D;  3AN2 B;  5AV5 C;  3MVD C;  3WKJ B;  4H9S A;  1P3L B;  1JFI B;  5B24 D;  3WAA C;  3MGS A;  1U35 B;  5B1M A;  5B31 A;  2F8N A;  1P3I B;  5JRG A;  3X1S C;  3W97 B;  4KUD D;  3X1U D;  5AVC C;  3TU4 C;  1TAF A;  4HGA B;  4Z66 D;  5DNN C;  3B6G B;  4KGC A;  4NE5 A;  1TZY B;  4WNN B;  3V9R B;  1S32 B;  5CPK D;  5E5A D;  2NZD C;  3AN2 A;  3WKJ A;  3VH5 W;  4E45 A;  1JFI A;  1P3L A;  4YM6 D;  3MGP B;  3AZE B;  1U35 A;  3R45 B;  3LJA B;  3REJ C;  5GT0 B;  5F99 C;  3AZL C;  1N1J B;  1P3I A;  3KXB C;  3W97 A; 
#chains in the Genus database with same CATH topology
 3AYW B;  3WTP C;  5GXQ D;  5GSU D;  3AZN C;  3UT9 B;  1P3K B;  1P3O B;  3A6N B;  3B6G A;  3AV2 D;  1TZY A;  4WNN A;  5CPI C;  3V9R A;  1S32 A;  3MGQ D;  5B32 B;  3WTP E;  5B40 D;  1AOI B;  3UTB D;  5B33 C;  5B0Y C;  4H9R B;  3MGP A;  4JJN D;  3AZE A;  3AV1 D;  1P3G C;  3W98 B;  3R45 A;  3MNN D;  3LJA A;  4G92 B;  3C1B D;  5GT0 A;  1P3P C;  1N1J A;  5AV9 C;  5JA4 B;  1KX5 C;  2F8N H;  3AYW A;  3EPK A;  3UT9 A;  2FJ7 B;  1M1A C;  5AV6 B;  1P3K A;  1P3O A;  3MGS D;  2HIO B;  3A6N A;  5B1M D;  3MGR C;  5B31 D;  4Z2M G;  4WU8 C;  4XZQ C;  5B32 A;  1BH8 B;  1P3B C;  1AOI A;  3B0B A;  4H9R A;  4KGC D;  3W98 A;  1F66 B;  5DNM B;  4LD9 B;  1B6W A;  5G49 B;  5JA4 A;  3AN2 D;  5CP6 B;  2NQB C;  4G91 B;  3WKJ D;  1P3L D;  2FJ7 A;  5AV6 A;  2HIO A;  4NE6 A;  1KX4 D;  1BH9 B;  3X1T C;  3AZG B;  1P3I D;  3W97 D;  2PYO C;  3REH C;  1WWS A;  3LEL B;  1BH8 A;  1BFM A;  3REI C;  5CPJ C;  4Z5T C;  2Y2J A;  2ZY3 A;  3B6G D;  4QLC D;  1TZY D;  1EQZ C;  1F66 A;  4R8P C;  3UTA C;  1M19 C;  5DNM A;  3EPJ A;  1S32 D;  4LD9 A;  3MVD B;  5BNV B;  5G49 A;  5CP6 A;  3NQJ B;  3O62 B;  1ULY A;  2L5A A;  3WAA B;  4CAY B;  3MGP D;  1P3A D;  5C3I C;  1BH9 A;  3LJA D;  3AZM B;  5GT0 D;  3AZK C;  3X1S B;  2ARO B;  1KX3 B;  5AVC B;  3LEL A;  3AYW D;  3AZJ D;  3UT9 D;  5AVB B;  5DNN B;  1P3K D;  1P3O D;  2JSS A;  3P5J B;  4J8V B;  3A6N D;  5KDM B;  2IO5 C;  4X23 B;  4J8W B;  3AZF D;  3MVD A;  5BNV A;  5B32 D;  2Y2O A;  3NQJ A;  3VH6 A;  4ZUX D;  3O62 A;  1AOI D;  2JCH A;  3REL C;  3WAA A;  4CAY A;  3WA9 B;  3AZH C;  3EPL A;  3W98 D;  1R4V A;  3AZL B;  3AZM A;  3KXB B;  1P3F C;  3X1S A;  5BT1 C;  2ZY2 A;  4ZBJ B;  2ARO A;  5JRG B;  1KX3 A;  5AVC A;  2YFV B;  3VH6 W;  2FJ7 D;  4H9P B;  5AVB A;  5AV6 D;  5DNN A;  3AZI D;  1ZLA B;  4J8V A;  2HIO D;  5KDM A;  4X23 A;  1HQ3 B;  4J8W A;  5CPI B;  3AFA B;  5AY8 C;  3C1C B;  3W96 C;  5B24 C;  5B0Y B;  1P3G B;  3WA9 A;  3REK B;  3H0R C;  4KUD C;  3AZL A;  1F66 D;  4CSR B;  5AV9 B;  3KXB A;  3X1U C;  2LY8 A;  4LD9 D;  5BS7 A;  3WTP A;  5CP6 D;  3AZN A;  4DRB A;  4Z66 C;  2YFV A;  4H9P A;  1ZLA A;  5CPK C;  5E5A C;  1HQ3 A;  2VQR A;  4NE3 A;  4Z2M H;  4XUJ B;  4WU8 B;  3AFA A;  3C1C A;  3AZG D;  5CPI A;  2HUE C;  2CWE A;  3LEL D;  5GT3 C;  3NQU B;  5B0Y A;  5B0Z C;  1P3G A;  3KWQ B;  3IP4 C;  3REK A;  1H3O B;  4CSR A;  5AV9 A;  5GXQ C;  5GSU C;  3MVD D;  3O62 D;  2FFF B;  3AV2 C;  3WAA D;  4WU9 C;  3AZM D;  4XUJ A;  3MGQ C;  3X1S D;  4WU8 A;  5B32 G;  3LZ1 B;  5B40 C;  2ARO D;  1KX3 D;  5AVC D;  3AV1 C;  4JJN C;  3B6F B;  3B0C W;  5CPJ B;  3NQU A;  4Z5T B;  5AVB D;  5DNN D;  3MNN C;  3W99 B;  3C1B C;  4J8V D;  3KWQ A;  5B2I C;  1EQZ B;  5B1L B;  4X23 D;  1M19 B;  4J8W D;  3X1V C;  1P34 D;  1H3O A;  5CHL B;  3MGS C;  5B1M C;  5B31 C;  3WA9 D;  3AZL D;  4H9N B;  2G5I C;  3LZ1 A;  2F8N D;  2CV5 B;  2XD5 A;  5JRG D;  5B2J B;  3B6F A;  5AV8 B;  4KGC C;  2BG1 A;  3REI A;  5CPJ A;  4Z5T A;  3W99 A;  2Y2G A;  1ZLA D;  1EQZ A;  5B1L A;  2Y2N A;  1HQ3 D;  1M19 A;  3AN2 C;  3AFA D;  3C1C D;  5CPI D;  3WKJ C;  1P3L C;  3KSY A;  3REL B;  1KX4 C;  1P3G D;  1P3I C;  3REK D;  2RVQ D;  1P3F B;  3W97 C;  4H9N A;  1U35 D;  5AV9 D;  4EO5 C;  3B0D C;  3KUY B;  2CV5 A;  4HGA C;  5B2J A;  1P3M C;  3B6G C;  5AV8 A;  1ID3 B;  4QLC C;  4DQY B;  3LZ0 C;  5AY8 B;  4XUJ D;  4J8U B;  3W96 B;  4AWL C;  2UWX A;  1HTA A;  1P3A C;  3MGP C;  1WWI A;  5AV5 B;  3REL A;  2F2A C;  3LJA C;  5GT0 C;  3KWQ D;  3AZE D;  1P3F A;  1PZR A;  3AZJ C;  3AYW C;  3KUY A;  3UT9 C;  1P3O C;  3A6N C;  1ID3 A;  3TU4 B;  3FDD A;  4KHA B;  3AZF C;  2ZM5 A;  5AY8 A;  3W96 A;  4J8U A;  5B32 C;  4UPK A;  3LZ1 D;  4ZUX C;  5B24 A;  2NZD B;  5GT3 B;  3VH5 T;  5B0Z B;  3B6F D;  5AV5 A;  5CPJ D;  1M18 C;  3W99 D;  4M6B A;  4G92 C;  1EQZ D;  5B1L D;  1M19 D;  5B31 G;  2F8N G;  5GSU B;  3REJ B;  5F99 B;  5BNX B;  5AV6 C;  3AZI C;  4WJ3 C;  4J8X C;  3WTP B;  3AZN B;  3TU4 A;  4KHA A;  4DRA A;  4WU9 B;  3MGQ B;  4H9Q B;  5B40 B;  3A1K A;  4YS3 C;  2JE5 A;  2CV5 D;  2NZD A;  5B2J D;  5GT3 A;  5B0Z A;  5AV8 D;  5B33 B;  5B2I B;  1F66 C;  3X1V B;  4LD9 C;  2W8S A;  5GSU A;  3REJ A;  3H0L C;  4G91 C;  5F99 A;  1P3P B;  1F1E A;  5BNX A;  5DNM D;  1KX5 B;  2Y2H A;  1M1A B;  3AZG C;  4WU9 A;  3MGQ A;  3MGR B;  4H9Q A;  4H9O B;  1B67 A;  5B40 A;  3LEL C;  3KUY D;  3H0M C;  4XZQ B;  3AV1 A;  2ZY4 A;  1ID3 D;  4YM6 C;  1P3B B;  3C1B A;  5B33 A;  5B2I A;  3X1V A;  5AY8 D;  5FUG B;  4J8U D;  3W96 D;  1W2E A;  1P3P A;  3O62 C;  1KX4 B;  2BYM B;  1KX5 A;  5AV5 D;  2NQB B;  2YFW B;  1A7W A;  2DF4 C;  3AZM C;  1M1A A;  3MGR A;  4EO5 B;  2ARO C;  3B0D B;  3X1T B;  1KX3 C;  3VH5 A;  4H9O A;  1P3M B;  5AVB C;  4XZQ A;  3REH B;  2PYO B;  4J8V C;  3UTB C;  4QLC B;  1P3B A;  4X23 C;  3TU4 D;  2Y2K A;  4J8W C;  1P34 C;  3LZ0 B;  3EPH A;  3REI B;  5FUG A;  4AWL B;  4R8P B;  3UTA B;  1P3A B;  2NZD D;  2BYK B;  4H9S C;  5GT3 D;  1KX4 A;  2BYM A;  5B0Z D;  2NQB A;  3WA9 C;  3F6T A;  2YFW A;  5C3I B;  5BS7 C;  3AZJ B;  4ZBJ C;  4NFT A;  5JRG C;  3REJ D;  3X1T A;  5F99 D;  3AZK B;  3KXB D;  1P3M A;  1KU5 A;  2PYO A;  3REH A;  2Y2P A;  1ZLA C;  3WTP D;  4QLC A;  3AZN D;  1HQ3 C;  3AZF B;  3LZ0 A;  3AFA C;  4WU9 D;  3C1C C;  2IO5 B;  4ZUX B;  4R8P A;  2DQN C;  3UTA A;  1P3A A;  2BYK A;  1M18 B;  3REK C;  2RVQ C;  5B33 D;  5B2I D;  5B0Y D;  1U35 C;  3X1V D;  4WZS B;  3AZH B;  3AZJ A;  5BO0 B;  1Q9C A;  3AZK A;  1P3P D;  3AZI B;  4J8X B;  1KX5 D;  3VH6 T;  4XUJ C;  1M1A D;  2XD1 A;  2Y2Q A;  3AZF A;  1TZY C;  3MGR D;  4YS3 B;  1S32 C;  4ZUX A;  4WU8 D;  4XZQ D;  5B24 B;  1M18 A;  3KWQ C;  1P3B D;  3AZE C;  1T3U A;  3AZH A;  2J8P A;  4KUD B;  2Y2I A;  5BO0 A;  3X1U B;  3AZI A;  4J8X A;  4UUZ B;  2NQB D;  2ZY5 A;  4Z66 B;  1P3K C;  3LZ1 C;  1Z2C B;  5CPK B;  5E5A B;  3X1T D;  4YS3 A;  3B6F C;  3AL0 C;  2HUE B;  1P3M D;  2G5H C;  2PYO D;  3REH D;  3W99 C;  4YM6 B;  1AOI C;  5B1L C;  3LZ0 D;  3REI D;  3W98 C;  4Z5T D;  4KUD A;  4R8P D;  3UTA D;  3X1U A;  5GXQ B;  4UUZ A;  2FJ7 C;  4Z66 A;  3A1I A;  3AZG A;  2HIO C;  3AV2 B;  3EG5 B;  2Y2L A;  5CPK A;  5E5A A;  2CV5 C;  5B2J C;  3AZK D;  5AV8 C;  2Y2M A;  3UTB B;  4YM6 A;  3B0C T;  3AV1 B;  4JJN B;  1P34 B;  3KFU G;  3MNN B;  3C1B B;  4E44 A;  5DNM C;  5GXQ A;  5CP6 C;  1M18 D;  3MGS B;  4WV4 B;  5B1M B;  3REL D;  3AV2 A;  5B31 B;  2F8N B;  3KUY C;  3AZH D;  1P3F D;  5BT1 D;  1ID3 C;  4J8X D;  1TAF B;  3UTB A;  4JJN A;  1P34 A;  4KGC B;  3MNN A;  4J8U C;  2F8N K;  4YS3 D;  3AN2 B;  5AV5 C;  3MVD C;  3WKJ B;  2RIQ A;  4H9S A;  1P3L B;  1JFI B;  5B24 D;  3WAA C;  3MGS A;  1U35 B;  5B1M A;  5B31 A;  2F8N A;  1P3I B;  5JRG A;  3X1S C;  3W97 B;  4KUD D;  3X1U D;  5AVC C;  3TU4 C;  1TAF A;  4HGA B;  4Z66 D;  5DNN C;  3B6G B;  4KGC A;  4NE5 A;  1TZY B;  4WNN B;  3V9R B;  1S32 B;  5CPK D;  5E5A D;  2NZD C;  3AN2 A;  3WKJ A;  3VH5 W;  4E45 A;  1JFI A;  1P3L A;  4YM6 D;  3MGP B;  3AZE B;  1U35 A;  3R45 B;  3LJA B;  3REJ C;  5GT0 B;  5F99 C;  3AZL C;  1N1J B;  1P3I A;  3KXB C;  3W97 A; 
#chains in the Genus database with same CATH homology
 3AYW B;  3WTP C;  5GXQ D;  5GSU D;  3AZN C;  3UT9 B;  1P3K B;  1P3O B;  3A6N B;  3B6G A;  3AV2 D;  1TZY A;  4WNN A;  5CPI C;  3V9R A;  1S32 A;  3MGQ D;  5B32 B;  3WTP E;  5B40 D;  1AOI B;  3UTB D;  5B33 C;  5B0Y C;  4H9R B;  3MGP A;  4JJN D;  3AZE A;  3AV1 D;  1P3G C;  3W98 B;  3R45 A;  3MNN D;  3LJA A;  4G92 B;  3C1B D;  5GT0 A;  1P3P C;  1N1J A;  5AV9 C;  5JA4 B;  1KX5 C;  2F8N H;  3AYW A;  3EPK A;  3UT9 A;  2FJ7 B;  1M1A C;  5AV6 B;  1P3K A;  1P3O A;  3MGS D;  2HIO B;  3A6N A;  5B1M D;  3MGR C;  5B31 D;  4Z2M G;  4WU8 C;  4XZQ C;  5B32 A;  1BH8 B;  1P3B C;  1AOI A;  3B0B A;  4H9R A;  4KGC D;  3W98 A;  1F66 B;  5DNM B;  4LD9 B;  1B6W A;  5G49 B;  5JA4 A;  3AN2 D;  5CP6 B;  2NQB C;  4G91 B;  3WKJ D;  1P3L D;  2FJ7 A;  5AV6 A;  2HIO A;  4NE6 A;  1KX4 D;  1BH9 B;  3X1T C;  3AZG B;  1P3I D;  3W97 D;  2PYO C;  3REH C;  1WWS A;  3LEL B;  1BH8 A;  1BFM A;  3REI C;  5CPJ C;  4Z5T C;  2Y2J A;  2ZY3 A;  3B6G D;  4QLC D;  1TZY D;  1EQZ C;  1F66 A;  4R8P C;  3UTA C;  1M19 C;  5DNM A;  3EPJ A;  1S32 D;  4LD9 A;  3MVD B;  5BNV B;  5G49 A;  5CP6 A;  3NQJ B;  3O62 B;  1ULY A;  2L5A A;  3WAA B;  4CAY B;  3MGP D;  1P3A D;  5C3I C;  1BH9 A;  3LJA D;  3AZM B;  5GT0 D;  3AZK C;  3X1S B;  2ARO B;  1KX3 B;  5AVC B;  3LEL A;  3AYW D;  3AZJ D;  3UT9 D;  5AVB B;  5DNN B;  1P3K D;  1P3O D;  2JSS A;  3P5J B;  4J8V B;  3A6N D;  5KDM B;  2IO5 C;  4X23 B;  4J8W B;  3AZF D;  3MVD A;  5BNV A;  5B32 D;  2Y2O A;  3NQJ A;  3VH6 A;  4ZUX D;  3O62 A;  1AOI D;  2JCH A;  3REL C;  3WAA A;  4CAY A;  3WA9 B;  3AZH C;  3EPL A;  3W98 D;  1R4V A;  3AZL B;  3AZM A;  3KXB B;  1P3F C;  3X1S A;  5BT1 C;  2ZY2 A;  4ZBJ B;  2ARO A;  5JRG B;  1KX3 A;  5AVC A;  2YFV B;  3VH6 W;  2FJ7 D;  4H9P B;  5AVB A;  5AV6 D;  5DNN A;  3AZI D;  1ZLA B;  4J8V A;  2HIO D;  5KDM A;  4X23 A;  1HQ3 B;  4J8W A;  5CPI B;  3AFA B;  5AY8 C;  3C1C B;  3W96 C;  5B24 C;  5B0Y B;  1P3G B;  3WA9 A;  3REK B;  3H0R C;  4KUD C;  3AZL A;  1F66 D;  4CSR B;  5AV9 B;  3KXB A;  3X1U C;  2LY8 A;  4LD9 D;  5BS7 A;  3WTP A;  5CP6 D;  3AZN A;  4DRB A;  4Z66 C;  2YFV A;  4H9P A;  1ZLA A;  5CPK C;  5E5A C;  1HQ3 A;  2VQR A;  4NE3 A;  4Z2M H;  4XUJ B;  4WU8 B;  3AFA A;  3C1C A;  3AZG D;  5CPI A;  2HUE C;  2CWE A;  3LEL D;  5GT3 C;  3NQU B;  5B0Y A;  5B0Z C;  1P3G A;  3KWQ B;  3IP4 C;  3REK A;  1H3O B;  4CSR A;  5AV9 A;  5GXQ C;  5GSU C;  3MVD D;  3O62 D;  2FFF B;  3AV2 C;  3WAA D;  4WU9 C;  3AZM D;  4XUJ A;  3MGQ C;  3X1S D;  4WU8 A;  5B32 G;  3LZ1 B;  5B40 C;  2ARO D;  1KX3 D;  5AVC D;  3AV1 C;  4JJN C;  3B6F B;  3B0C W;  5CPJ B;  3NQU A;  4Z5T B;  5AVB D;  5DNN D;  3MNN C;  3W99 B;  3C1B C;  4J8V D;  3KWQ A;  5B2I C;  1EQZ B;  5B1L B;  4X23 D;  1M19 B;  4J8W D;  3X1V C;  1P34 D;  1H3O A;  5CHL B;  3MGS C;  5B1M C;  5B31 C;  3WA9 D;  3AZL D;  4H9N B;  2G5I C;  3LZ1 A;  2F8N D;  2CV5 B;  2XD5 A;  5JRG D;  5B2J B;  3B6F A;  5AV8 B;  4KGC C;  2BG1 A;  3REI A;  5CPJ A;  4Z5T A;  3W99 A;  2Y2G A;  1ZLA D;  1EQZ A;  5B1L A;  2Y2N A;  1HQ3 D;  1M19 A;  3AN2 C;  3AFA D;  3C1C D;  5CPI D;  3WKJ C;  1P3L C;  3KSY A;  3REL B;  1KX4 C;  1P3G D;  1P3I C;  3REK D;  2RVQ D;  1P3F B;  3W97 C;  4H9N A;  1U35 D;  5AV9 D;  4EO5 C;  3B0D C;  3KUY B;  2CV5 A;  4HGA C;  5B2J A;  1P3M C;  3B6G C;  5AV8 A;  1ID3 B;  4QLC C;  4DQY B;  3LZ0 C;  5AY8 B;  4XUJ D;  4J8U B;  3W96 B;  4AWL C;  2UWX A;  1HTA A;  1P3A C;  3MGP C;  1WWI A;  5AV5 B;  3REL A;  2F2A C;  3LJA C;  5GT0 C;  3KWQ D;  3AZE D;  1P3F A;  1PZR A;  3AZJ C;  3AYW C;  3KUY A;  3UT9 C;  1P3O C;  3A6N C;  1ID3 A;  3TU4 B;  3FDD A;  4KHA B;  3AZF C;  2ZM5 A;  5AY8 A;  3W96 A;  4J8U A;  5B32 C;  4UPK A;  3LZ1 D;  4ZUX C;  5B24 A;  2NZD B;  5GT3 B;  3VH5 T;  5B0Z B;  3B6F D;  5AV5 A;  5CPJ D;  1M18 C;  3W99 D;  4M6B A;  4G92 C;  1EQZ D;  5B1L D;  1M19 D;  5B31 G;  2F8N G;  5GSU B;  3REJ B;  5F99 B;  5BNX B;  5AV6 C;  3AZI C;  4WJ3 C;  4J8X C;  3WTP B;  3AZN B;  3TU4 A;  4KHA A;  4DRA A;  4WU9 B;  3MGQ B;  4H9Q B;  5B40 B;  3A1K A;  4YS3 C;  2JE5 A;  2CV5 D;  2NZD A;  5B2J D;  5GT3 A;  5B0Z A;  5AV8 D;  5B33 B;  5B2I B;  1F66 C;  3X1V B;  4LD9 C;  2W8S A;  5GSU A;  3REJ A;  3H0L C;  4G91 C;  5F99 A;  1P3P B;  1F1E A;  5BNX A;  5DNM D;  1KX5 B;  2Y2H A;  1M1A B;  3AZG C;  4WU9 A;  3MGQ A;  3MGR B;  4H9Q A;  4H9O B;  1B67 A;  5B40 A;  3LEL C;  3KUY D;  3H0M C;  4XZQ B;  3AV1 A;  2ZY4 A;  1ID3 D;  4YM6 C;  1P3B B;  3C1B A;  5B33 A;  5B2I A;  3X1V A;  5AY8 D;  5FUG B;  4J8U D;  3W96 D;  1W2E A;  1P3P A;  3O62 C;  1KX4 B;  2BYM B;  1KX5 A;  5AV5 D;  2NQB B;  2YFW B;  1A7W A;  2DF4 C;  3AZM C;  1M1A A;  3MGR A;  4EO5 B;  2ARO C;  3B0D B;  3X1T B;  1KX3 C;  3VH5 A;  4H9O A;  1P3M B;  5AVB C;  4XZQ A;  3REH B;  2PYO B;  4J8V C;  3UTB C;  4QLC B;  1P3B A;  4X23 C;  3TU4 D;  2Y2K A;  4J8W C;  1P34 C;  3LZ0 B;  3EPH A;  3REI B;  5FUG A;  4AWL B;  4R8P B;  3UTA B;  1P3A B;  2NZD D;  2BYK B;  4H9S C;  5GT3 D;  1KX4 A;  2BYM A;  5B0Z D;  2NQB A;  3WA9 C;  3F6T A;  2YFW A;  5C3I B;  5BS7 C;  3AZJ B;  4ZBJ C;  4NFT A;  5JRG C;  3REJ D;  3X1T A;  5F99 D;  3AZK B;  3KXB D;  1P3M A;  1KU5 A;  2PYO A;  3REH A;  2Y2P A;  1ZLA C;  3WTP D;  4QLC A;  3AZN D;  1HQ3 C;  3AZF B;  3LZ0 A;  3AFA C;  4WU9 D;  3C1C C;  2IO5 B;  4ZUX B;  4R8P A;  2DQN C;  3UTA A;  1P3A A;  2BYK A;  1M18 B;  3REK C;  2RVQ C;  5B33 D;  5B2I D;  5B0Y D;  1U35 C;  3X1V D;  4WZS B;  3AZH B;  3AZJ A;  5BO0 B;  1Q9C A;  3AZK A;  1P3P D;  3AZI B;  4J8X B;  1KX5 D;  3VH6 T;  4XUJ C;  1M1A D;  2XD1 A;  2Y2Q A;  3AZF A;  1TZY C;  3MGR D;  4YS3 B;  1S32 C;  4ZUX A;  4WU8 D;  4XZQ D;  5B24 B;  1M18 A;  3KWQ C;  1P3B D;  3AZE C;  1T3U A;  3AZH A;  2J8P A;  4KUD B;  2Y2I A;  5BO0 A;  3X1U B;  3AZI A;  4J8X A;  4UUZ B;  2NQB D;  2ZY5 A;  4Z66 B;  1P3K C;  3LZ1 C;  1Z2C B;  5CPK B;  5E5A B;  3X1T D;  4YS3 A;  3B6F C;  3AL0 C;  2HUE B;  1P3M D;  2G5H C;  2PYO D;  3REH D;  3W99 C;  4YM6 B;  1AOI C;  5B1L C;  3LZ0 D;  3REI D;  3W98 C;  4Z5T D;  4KUD A;  4R8P D;  3UTA D;  3X1U A;  5GXQ B;  4UUZ A;  2FJ7 C;  4Z66 A;  3A1I A;  3AZG A;  2HIO C;  3AV2 B;  3EG5 B;  2Y2L A;  5CPK A;  5E5A A;  2CV5 C;  5B2J C;  3AZK D;  5AV8 C;  2Y2M A;  3UTB B;  4YM6 A;  3B0C T;  3AV1 B;  4JJN B;  1P34 B;  3KFU G;  3MNN B;  3C1B B;  4E44 A;  5DNM C;  5GXQ A;  5CP6 C;  1M18 D;  3MGS B;  4WV4 B;  5B1M B;  3REL D;  3AV2 A;  5B31 B;  2F8N B;  3KUY C;  3AZH D;  1P3F D;  5BT1 D;  1ID3 C;  4J8X D;  1TAF B;  3UTB A;  4JJN A;  1P34 A;  4KGC B;  3MNN A;  4J8U C;  2F8N K;  4YS3 D;  3AN2 B;  5AV5 C;  3MVD C;  3WKJ B;  2RIQ A;  4H9S A;  1P3L B;  1JFI B;  5B24 D;  3WAA C;  3MGS A;  1U35 B;  5B1M A;  5B31 A;  2F8N A;  1P3I B;  5JRG A;  3X1S C;  3W97 B;  4KUD D;  3X1U D;  5AVC C;  3TU4 C;  1TAF A;  4HGA B;  4Z66 D;  5DNN C;  3B6G B;  4KGC A;  4NE5 A;  1TZY B;  4WNN B;  3V9R B;  1S32 B;  5CPK D;  5E5A D;  2NZD C;  3AN2 A;  3WKJ A;  3VH5 W;  4E45 A;  1JFI A;  1P3L A;  4YM6 D;  3MGP B;  3AZE B;  1U35 A;  3R45 B;  3LJA B;  3REJ C;  5GT0 B;  5F99 C;  3AZL C;  1N1J B;  1P3I A;  3KXB C;  3W97 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...