5CPID

Nucleosome containing unmethylated sat2r dna
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
93
structure length
93
Chain Sequence
SRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords Histone H3.1
publication title Influence of DNA methylation on positioning and DNA flexibility of nucleosomes with pericentric satellite DNA.
pubmed doi rcsb
source organism Homo sapiens
total genus 33
structure length 93
sequence length 93
chains with identical sequence H
ec nomenclature
pdb deposition date 2015-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5cpiD00
3X1VA 3V9RB 3C1BB 1KX3A 4WU8A 5B33C 5AVCA 2AROD 3A6NB 5GSUD 5AV6A 3AZIA 1P3MB 5DNND 3WAAD 5B1MC 3AZFB 3B6FB 1P3LC 3MGSD 3X1SA 1ZLAC 5CP6C 3AZJA 1TZYC 4HGAC 1U35A 1AOIA 3W99B 3AZNB 3AFAB 5BNVB 3X1VB 3RELC 4WU8B 5JA4A 3REHD 1M1AA 1P3KA 4H9SC 3AZIB 5FUGA 3AN2B 1P3AD 3B0CW 3LZ1D 3X1TD 3C1CC 3KWQD 5GT3D 3W96D 3AZKA 3WKJC 1U35B 4YM6C 4JJNC 5DNMA 3W97C 5AY8C 2NQBC 5JA4B 1M1AB 1P3GB 3C1BC 1N1JB 5B40B 5AV9D 5CPIA 1P3KB 5B0ZD 1P3PB 1F1EA 5FUGB 5B24D 5B2IA 4J8WD 3X1UD 3A6NC 3LJAD 1P3FA 3UTAC 3WTPB 5BS7C 3O62A 1P3MC 1KX5A 2HIOD 3WA9C 3REJC 3AZFC 5BT1C 5B32A 3B6FC 3AV2C 1M19A 5E5AB 2NZDA 5F99A 3KXBD 3W99C 4EO5B 3AZNC 5KDMB 3MGPD 3MNNA 4KGCB 3X1VC 3LZ0D 5GXQD 4WV4B 4WU8C 1KX3C 2PYOA 2IO5C 5AVCC 5AV6C 3AZIC 5GT0A 3AN2C 3MGQD 1EQZD 3UTBB 1HQ3A 3B6GD 3NQJB 3REKD 2F8NH 2YFVA 3X1SC 3AZED 4J8VB 5F99B 5B1MA 2NZDB 1U35C 3UT9B 5B1LB 2BYKA 2FJ7D 4Z66D 4CSRB 4H9OA 5CP6A 2F8NG 2F8NB 1M1AC 1P3GC 2PYOB 1P3KC 1P3PC 3VH6W 3MVDD 3VH5T 5BNXA 3AYWA 1P34A 3AZHD 3WTPC 4R8PB 3MGRD 1M18D 4LD9A 4H9QA 4H9SA 3AV1D 4H9PB 5B33D 1S32B 3C1CA 5AV8B 4YS3B 5B31A 2BYKB 3VH6A 1BH9A 4H9OB 3REIA 3WKJA 4YM6A 1ZLAD 4KGCC 4JJNA 3AZLD 1TZYD 5BNXB 4X23B 5AY8A 5AV5B 4Z5TB 1KX5C 3V9RA 4H9QB 3C1BA 3RELD 5B32C 3A6NA 3UTBC 2F8NK 1M19C 1P3BA 3KUYB 5B31B 5F99C 4J8VC 3AZFA 2NZDC 2LY8A 3UT9C 5CPJD 4WU9D 5B2JB 3AZNA 3AFAA 2PYOC 5BNVA 4XUJB 4R8PC 4ZUXB 1HQ3C 1ID3D 5DNNA 3AN2A 1P3BB 5AV8C 3UTAD 3TU4B 4YS3C 1WWSA 5B0YD 3WA9D 3REJD 3W98B 4XZQB 3R45A 1ULYA 1TAFB 2RVQC 3AV2D 2HUEC 3VH5W 5CPKD 1F66D 1P3OD 3REHA 3AYWC 1P34C 4Z5TC 4QLCD 5GSUB 1P3GA 4LD9C 1N1JA 5B40A 5DNNB 1P3PA 1KX3D 5G49A 3WAAB 5AVCD 3WTPA 5AV6D 1KU5A 5GT3A 1Q9CA 3KUYC 3MGSB 4J8UD 3NQUB 5B31C 1B67A 4J8XD 3R45B 3REIC 5E5AA 3X1SD 5AVBD 4DRBA 4E44A 3AZJD 1AOID 5KDMA 3REHB 5BO0B 4KGCA 1P3AB 3LZ1B 3X1TB 5G49B 4ZUXC 1JFIB 4WNNB 1P3BC 3KWQB 5GT3B 3WTPE 3W96B 3UTBA 3TU4C 3NQJA 3W98C 4XZQC 3KXBA 4J8VA 1BFMA 3AZKD 3UT9A 5B1LA 3AFAC 5AV9B 3LZ0A 4CSRA 5GXQA 2CV5D 5B0ZB 5DNMD 5B24B 3AZMD 2F8NA 4J8WB 3X1UB 3LJAB 1R4VA 4NE5A 3AZGD 5DNNC 2HIOB 3LELD 5CPID 3MGQA 5B2ID 1EQZA 1P3FD 3B6GA 1BH8B 4R8PA 3O62D 3REKA 1KX5D 3MGSC 4KUDD 4H9PA 1S32A 5AV8A 5B32D 3KXBB 1M19D 4YS3A 3MGPB 3LZ0B 5GXQB 3REHC 5JRGD 1KX4D 3MNND 1P3AC 5B40C 3LZ1C 4X23A 3MGQB 1EQZB 3B0DB 4NFTA 5AV5A 4Z5TA 3B6GB 3KWQC 3AV1A 5GT3C 5GT0D 3REKB 4UUZB 3AZEB 1HQ3D 3KUYA 5E5AC 2FJ7B 4Z66B 4EO5C 4NE6A 5B1MD 4DRAA 5C3IB 1P3IA 1P3LD 5B0ZC 2JSSA 3MVDB 5B24C 5CP6D 5B2JA 3X1UC 3LJAC 3AZHB 3MGRB 1M18B 3AV1B 1A7WA 5B33B 4XUJA 3AYWD 1P34D 4ZUXA 4LD9D 3KXBC 3C1CD 4WZSB 3TU4A 2NQBB 3MGPC 4WU9A 1HTAA 5B1LC 1P3IB 1ZLAB 3W98A 4XZQA 1TAFA 3LZ0C 5GXQC 3AZLB 3REID 3WKJD 4YM6D 2BYMA 4JJND 4G91B 3RELB 3W97D 3MGQC 1EQZC 2AROA 3B0DC 5AY8D 5GSUA 2NQBD 3B6GC 3REKC 4H9RA 3C1BD 4KHAA 3WAAA 3AZEC 4CAYA 1S32C 3A6ND 5B0YA 5CPJB 1P3MD 3MGSA 4H9NA 3NQUA 4WU9B 4Z66C 3AZFD 5BT1D 3B6FD 1F66A 4ZBJB 3MVDC 2BYMB 3W99D 3AZHC 3AZND 3AFAD 4X23C 2AROB 5AV5C 1ID3B 5BO0A 3AV1C 1P3AA 4H9RB 3X1VD 3LZ1A 4KHAB 3X1TA 4WU8D 1JFIA 3UTAB 4WNNA 4CAYB 5B0YB 3KWQA 4J8UA 3AZID 3AN2D 3WA9B 3REJB 4H9NB 2YFWA 4J8XA 3VH5A 3W96A 3AV2B 1P3IC 5AVBA 5CPKB 3AZLC 1F66B 1P3OB 5B2JC 1U35D 4QLCB 4G91C 5AV9A 5B0ZA 1KX3B 5B24A 4J8WA 4XUJC 3X1UA 3LJAA 2IO5B 5AVCB 5AV6B 1M1AD 1P3GD 5B40D 2HIOA 1B6WA 1P3KD 1P3PD 3VH6T 4J8UB 4NE3A 2YFWB 1BH8A 4J8XB 5CPJC 3WTPD 4WU9C 3X1SB 4Z2MH 5AVBB 3AZJB 1AOIB 5E5AD 3MGPA 2CV5A 4ZBJC 4E45A 4M6BA 3AZMA 4Z2MG 2AROC 3AZGA 1ID3C 5GSUC 3KSYA 3LELA 4KGCD 3WAAC 5B0YC 4KUDA 4UUZA 3AZEA 3UTBD 3AZKB 2FJ7A 5CPKC 4Z66A 2CV5B 1F66C 4J8VD 5F99D 2NZDD 1P3OC 5DNMB 3AZMB 3UT9D 5B1LD 4QLCC 5JRGA 1KX4A 3AZGB 3MVDA 3LELB 5CPIB 5B2IB 4AWLB 3AZHA 3X1TC 1P3FB 2F8ND 3MGRA 1M18A 2PYOD 3O62B 1KX5B 4KUDB 4J8UC 4G92B 5B33A 3B0BA 5B32G 5B32B 4J8XC 2L5AA 3W96C 1M18C 4R8PD 1M19B 2CWEA 5AVBC 1H3OA 1S32D 5AV8D 3AZJC 1P3LA 1AOIC 4YS3D 1ZLAA 5JRGB 1KX4B 3MNNB 5AV9C 3AZLA 1TZYA 2RVQD 4J8WC 5GT0B 2HIOC 3RELA 4X23D 1WWIA 1HQ3B 5AV5D 4Z5TD 2YFVB 1H3OB 3B0CT 5B1MB 3AZKC 5CPJA 1P3LB 3KUYD 2CV5C 5B31D 5DNMC 2HUEB 5CP6B 3AZMC 1TZYB 4HGAB 1P3ID 3AZGC 3LELC 5CPIC 5CHLB 3W97A 5B2IC 4AWLC 5B2JD 3AYWB 1P34B 1P3FC 2NQBA 3O62C 1ID3A 4LD9B 4KUDC 4G92C 4XUJD 3C1CB 3UTAA 4ZUXD 5BS7A 1P3MA 3WA9A 1P3BD 5B31G 3REJA 2FJ7C 3B6FA 3AV2A 1BH9B 3TU4D 3REIB 5C3IC 3WKJB 5JRGC 4YM6B 1KX4C 3MNNC 5CPKA 4XZQD 4JJNB 3W99A 3W98D 1P3OA 3W97B 5AY8B 4QLCA 3MGRC 5GT0C
chains in the Genus database with same CATH superfamily
3X1VA 3V9RB 3C1BB 1KX3A 4WU8A 5B33C 5AVCA 2AROD 3A6NB 5GSUD 5AV6A 3AZIA 1P3MB 5DNND 3WAAD 4UPKA 5B1MC 3AZFB 3B6FB 1P3LC 3MGSD 3X1SA 1ZLAC 2Y2NA 5CP6C 3AZJA 1TZYC 4HGAC 1U35A 1AOIA 3W99B 3AZNB 3AFAB 3P5JB 3A1KA 5BNVB 3X1VB 3RELC 4WU8B 5JA4A 3REHD 1M1AA 1P3KA 4H9SC 3AZIB 5FUGA 3AN2B 1P3AD 3B0CW 3LZ1D 3X1TD 3C1CC 3KWQD 1Z2CB 2DF4C 5GT3D 3W96D 3AZKA 3WKJC 1U35B 4YM6C 4JJNC 5DNMA 3W97C 5AY8C 2NQBC 5JA4B 1M1AB 1P3GB 3C1BC 1N1JB 5B40B 5AV9D 5CPIA 1P3KB 5B0ZD 1P3PB 1F1EA 5FUGB 5B24D 5B2IA 4J8WD 3X1UD 3A6NC 3LJAD 1P3FA 3UTAC 3WTPB 5BS7C 3O62A 1P3MC 1KX5A 2HIOD 3WA9C 3REJC 3AZFC 5BT1C 5B32A 3B6FC 3AV2C 1M19A 5E5AB 2NZDA 5F99A 3KXBD 3W99C 4EO5B 3AZNC 5KDMB 3MGPD 3MNNA 4KGCB 3X1VC 3LZ0D 5GXQD 4WV4B 4WU8C 1KX3C 2VQRA 2PYOA 2IO5C 5AVCC 5AV6C 3AZIC 5GT0A 3AN2C 3MGQD 1EQZD 3UTBB 1HQ3A 3B6GD 3NQJB 3REKD 2F8NH 2YFVA 3X1SC 3AZED 4J8VB 5F99B 5B1MA 2NZDB 1U35C 3UT9B 3EPJA 5B1LB 2BYKA 2FJ7D 4Z66D 4CSRB 4H9OA 5CP6A 2F8NG 2JE5A 2F8NB 2ZY2A 1M1AC 1P3GC 2PYOB 1P3KC 1P3PC 3VH6W 3MVDD 3VH5T 5BNXA 3AYWA 1P34A 3AZHD 2Y2LA 3WTPC 4R8PB 3MGRD 1M18D 4LD9A 4H9QA 4H9SA 3AV1D 4H9PB 5B33D 1S32B 3C1CA 5AV8B 4YS3B 2BG1A 5B31A 2BYKB 3VH6A 1BH9A 4H9OB 3REIA 3WKJA 4YM6A 1ZLAD 2Y2KA 4KGCC 4JJNA 3AZLD 1TZYD 5BNXB 4X23B 5AY8A 5AV5B 4Z5TB 1KX5C 3A1IA 4H9QB 3V9RA 3C1BA 3RELD 5B32C 3A6NA 3EG5B 3UTBC 2F8NK 1M19C 1P3BA 3KUYB 5B31B 5F99C 4J8VC 3AZFA 2NZDC 2LY8A 2G5IC 3UT9C 5CPJD 3H0LC 4WU9D 5B2JB 3AZNA 3AFAA 2PYOC 5BNVA 4XUJB 4R8PC 4ZUXB 1HQ3C 1ID3D 5DNNA 3AN2A 1P3BB 5AV8C 3UTAD 3TU4B 4YS3C 1WWSA 5B0YD 3WA9D 3REJD 3W98B 4XZQB 3R45A 1ULYA 1TAFB 2RVQC 3AV2D 2HUEC 2Y2OA 3VH5W 5CPKD 1F66D 1P3OD 3REHA 3AYWC 2W8SA 1P34C 4Z5TC 4QLCD 5GSUB 1P3GA 4LD9C 1N1JA 5B40A 5DNNB 1P3PA 3EPLA 1KX3D 5G49A 3WAAB 5AVCD 3WTPA 5AV6D 1KU5A 5GT3A 1Q9CA 3KUYC 3MGSB 4J8UD 3NQUB 5B31C 1B67A 4J8XD 3R45B 3REIC 5E5AA 3X1SD 5AVBD 4DRBA 4E44A 3AZJD 1AOID 5KDMA 3REHB 5BO0B 4KGCA 1P3AB 3LZ1B 3X1TB 5G49B 4ZUXC 1JFIB 4WNNB 1P3BC 3KWQB 5GT3B 3WTPE 3W96B 3UTBA 3TU4C 3NQJA 3W98C 4XZQC 3KXBA 4J8VA 1BFMA 3H0RC 3UT9A 3AZKD 5B1LA 3AFAC 5AV9B 3LZ0A 4CSRA 5GXQA 2CV5D 5B0ZB 5DNMD 5B24B 3AZMD 2F8NA 4J8WB 3X1UB 2Y2QA 3LJAB 1R4VA 4NE5A 3AZGD 5DNNC 2HIOB 3LELD 5CPID 3MGQA 5B2ID 1EQZA 1P3FD 3B6GA 1BH8B 2UWXA 2XD5A 4R8PA 3O62D 3REKA 1KX5D 3MGSC 4KUDD 4H9PA 1S32A 5AV8A 5B32D 3KXBB 1M19D 2ZY5A 4YS3A 3MGPB 3LZ0B 5GXQB 3REHC 2ZY3A 5JRGD 1KX4D 3MNND 1P3AC 5B40C 3LZ1C 4X23A 3MGQB 1EQZB 3B0DB 4NFTA 5AV5A 4Z5TA 3B6GB 3KWQC 3AV1A 4WJ3C 5GT3C 5GT0D 3REKB 4UUZB 3AZEB 1HQ3D 3KUYA 5E5AC 2FJ7B 4Z66B 4EO5C 4NE6A 5B1MD 4DRAA 5C3IB 1P3IA 1P3LD 3EPKA 5B0ZC 2JSSA 3MVDB 5B24C 5CP6D 5B2JA 3X1UC 3LJAC 3AZHB 4DQYB 3MGRB 1M18B 3AV1B 1A7WA 5B33B 4XUJA 3AYWD 1P34D 4ZUXA 1T3UA 4LD9D 3KXBC 3C1CD 4WZSB 3TU4A 2NQBB 3MGPC 4WU9A 1HTAA 5B1LC 1P3IB 1ZLAB 3W98A 4XZQA 1TAFA 3LZ0C 5GXQC 3AZLB 3REID 3WKJD 4YM6D 2BYMA 4JJND 4G91B 3RELB 3W97D 3MGQC 1EQZC 2AROA 3B0DC 5AY8D 5GSUA 2NQBD 3B6GC 3REKC 4H9RA 3C1BD 4KHAA 3WAAA 3AZEC 4CAYA 1S32C 3A6ND 5B0YA 5CPJB 1P3MD 3MGSA 4H9NA 3NQUA 4WU9B 4Z66C 3AZFD 5BT1D 3B6FD 1F66A 4ZBJB 3MVDC 2BYMB 3W99D 2Y2MA 3AZHC 3AZND 3AFAD 4X23C 2AROB 5AV5C 1ID3B 5BO0A 3AV1C 1P3AA 2JCHA 4H9RB 3X1VD 3LZ1A 4KHAB 3X1TA 4WU8D 1JFIA 3UTAB 4WNNA 4CAYB 2XD1A 5B0YB 3KWQA 4J8UA 3AZID 3AN2D 3WA9B 3REJB 4H9NB 2YFWA 4J8XA 3VH5A 3W96A 3AV2B 1P3IC 5AVBA 5CPKB 3AZLC 1F66B 3H0MC 1P3OB 5B2JC 1U35D 2FFFB 4QLCB 4G91C 5AV9A 3IP4C 5B0ZA 1KX3B 5B24A 4J8WA 4XUJC 3X1UA 3LJAA 2IO5B 5AVCB 2RIQA 5AV6B 1M1AD 1P3GD 5B40D 2HIOA 1B6WA 1P3KD 1P3PD 3VH6T 4J8UB 4NE3A 2YFWB 1BH8A 4J8XB 5CPJC 3WTPD 4WU9C 3X1SB 4Z2MH 5AVBB 2Y2IA 3AZJB 1AOIB 5E5AD 3MGPA 2CV5A 4ZBJC 4E45A 4M6BA 3AZMA 4Z2MG 2AROC 3AZGA 1ID3C 5GSUC 3KSYA 3LELA 4KGCD 2Y2PA 3WAAC 5B0YC 4KUDA 2ZY4A 2Y2GA 4UUZA 3AZEA 3UTBD 3AZKB 3AL0C 2FJ7A 5CPKC 4Z66A 2CV5B 1F66C 4J8VD 5F99D 2NZDD 1P3OC 5DNMB 3AZMB 3UT9D 5B1LD 4QLCC 5JRGA 1KX4A 3KFUG 3AZGB 3MVDA 3LELB 5CPIB 5B2IB 4AWLB 3AZHA 3X1TC 1P3FB 2F8ND 3MGRA 1M18A 2PYOD 3O62B 1KX5B 4KUDB 4J8UC 4G92B 3EPHA 5B33A 3B0BA 5B32G 3FDDA 5B32B 4J8XC 2L5AA 3W96C 1M18C 4R8PD 1M19B 2CWEA 5AVBC 1H3OA 1S32D 5AV8D 3AZJC 1P3LA 1AOIC 2F2AC 4YS3D 1ZLAA 5JRGB 1KX4B 1PZRA 3MNNB 5AV9C 3AZLA 1TZYA 2RVQD 4J8WC 2ZM5A 5GT0B 2HIOC 3RELA 4X23D 1WWIA 1HQ3B 5AV5D 4Z5TD 2DQNC 2YFVB 2Y2JA 1H3OB 3B0CT 5B1MB 3AZKC 5CPJA 1P3LB 1W2EA 3KUYD 2CV5C 5B31D 2Y2HA 5DNMC 2HUEB 5CP6B 3AZMC 1TZYB 4HGAB 1P3ID 2G5HC 2J8PA 3AZGC 3LELC 5CPIC 5CHLB 3F6TA 3W97A 5B2IC 4AWLC 5B2JD 3AYWB 1P34B 1P3FC 2NQBA 3O62C 1ID3A 4LD9B 4KUDC 4G92C 4XUJD 3C1CB 3UTAA 4ZUXD 5BS7A 1P3MA 3WA9A 1P3BD 5B31G 3REJA 2FJ7C 3B6FA 3AV2A 1BH9B 3TU4D 3REIB 5C3IC 3WKJB 5JRGC 4YM6B 1KX4C 3MNNC 5CPKA 4XZQD 4JJNB 3W99A 3W98D 1P3OA 3W97B 5AY8B 4QLCA 3MGRC 5GT0C
chains in the Genus database with same CATH topology
3X1VA 3V9RB 3C1BB 1KX3A 4WU8A 5B33C 5AVCA 2AROD 3A6NB 5GSUD 5AV6A 3AZIA 1P3MB 5DNND 3WAAD 4UPKA 5B1MC 3AZFB 3B6FB 1P3LC 3MGSD 3X1SA 1ZLAC 2Y2NA 5CP6C 3AZJA 1TZYC 4HGAC 1U35A 1AOIA 3W99B 3AZNB 3AFAB 3P5JB 3A1KA 5BNVB 3X1VB 3RELC 4WU8B 5JA4A 3REHD 1M1AA 1P3KA 4H9SC 3AZIB 5FUGA 3AN2B 1P3AD 3B0CW 3LZ1D 3X1TD 3C1CC 3KWQD 1Z2CB 2DF4C 5GT3D 3W96D 3AZKA 3WKJC 1U35B 4YM6C 4JJNC 5DNMA 3W97C 5AY8C 2NQBC 5JA4B 1M1AB 1P3GB 3C1BC 1N1JB 5B40B 5AV9D 5CPIA 1P3KB 5B0ZD 1P3PB 1F1EA 5FUGB 5B24D 5B2IA 4J8WD 3X1UD 3A6NC 3LJAD 1P3FA 3UTAC 3WTPB 5BS7C 3O62A 1P3MC 1KX5A 2HIOD 3WA9C 3REJC 3AZFC 5BT1C 5B32A 3B6FC 3AV2C 1M19A 5E5AB 2NZDA 5F99A 3KXBD 3W99C 4EO5B 3AZNC 5KDMB 3MGPD 3MNNA 4KGCB 3X1VC 3LZ0D 5GXQD 4WV4B 4WU8C 1KX3C 2VQRA 2PYOA 2IO5C 5AVCC 5AV6C 3AZIC 5GT0A 3AN2C 3MGQD 1EQZD 3UTBB 1HQ3A 3B6GD 3NQJB 3REKD 2F8NH 2YFVA 3X1SC 3AZED 4J8VB 5F99B 5B1MA 2NZDB 1U35C 3UT9B 3EPJA 5B1LB 2BYKA 2FJ7D 4Z66D 4CSRB 4H9OA 5CP6A 2F8NG 2JE5A 2F8NB 2ZY2A 1M1AC 1P3GC 2PYOB 1P3KC 1P3PC 3VH6W 3MVDD 3VH5T 5BNXA 3AYWA 1P34A 3AZHD 2Y2LA 3WTPC 4R8PB 3MGRD 1M18D 4LD9A 4H9QA 4H9SA 3AV1D 4H9PB 5B33D 1S32B 3C1CA 5AV8B 4YS3B 2BG1A 5B31A 2BYKB 3VH6A 1BH9A 4H9OB 3REIA 3WKJA 4YM6A 1ZLAD 2Y2KA 4KGCC 4JJNA 3AZLD 1TZYD 5BNXB 4X23B 5AY8A 5AV5B 4Z5TB 1KX5C 3A1IA 4H9QB 3V9RA 3C1BA 3RELD 5B32C 3A6NA 3EG5B 3UTBC 2F8NK 1M19C 1P3BA 3KUYB 5B31B 5F99C 4J8VC 3AZFA 2NZDC 2LY8A 2G5IC 3UT9C 5CPJD 3H0LC 4WU9D 5B2JB 3AZNA 3AFAA 2PYOC 5BNVA 4XUJB 4R8PC 4ZUXB 1HQ3C 1ID3D 5DNNA 3AN2A 1P3BB 5AV8C 3UTAD 3TU4B 4YS3C 1WWSA 5B0YD 3WA9D 3REJD 3W98B 4XZQB 3R45A 1ULYA 1TAFB 2RVQC 3AV2D 2HUEC 2Y2OA 3VH5W 5CPKD 1F66D 1P3OD 3REHA 3AYWC 2W8SA 1P34C 4Z5TC 4QLCD 5GSUB 1P3GA 4LD9C 1N1JA 5B40A 5DNNB 1P3PA 3EPLA 1KX3D 5G49A 3WAAB 5AVCD 3WTPA 5AV6D 1KU5A 5GT3A 1Q9CA 3KUYC 3MGSB 4J8UD 3NQUB 5B31C 1B67A 4J8XD 3R45B 3REIC 5E5AA 3X1SD 5AVBD 4DRBA 4E44A 3AZJD 1AOID 5KDMA 3REHB 5BO0B 4KGCA 1P3AB 3LZ1B 3X1TB 5G49B 4ZUXC 1JFIB 4WNNB 1P3BC 3KWQB 5GT3B 3WTPE 3W96B 3UTBA 3TU4C 3NQJA 3W98C 4XZQC 3KXBA 4J8VA 1BFMA 3H0RC 3UT9A 3AZKD 5B1LA 3AFAC 5AV9B 3LZ0A 4CSRA 5GXQA 2CV5D 5B0ZB 5DNMD 5B24B 3AZMD 2F8NA 4J8WB 3X1UB 2Y2QA 3LJAB 1R4VA 4NE5A 3AZGD 5DNNC 2HIOB 3LELD 5CPID 3MGQA 5B2ID 1EQZA 1P3FD 3B6GA 1BH8B 2UWXA 2XD5A 4R8PA 3O62D 3REKA 1KX5D 3MGSC 4KUDD 4H9PA 1S32A 5AV8A 5B32D 3KXBB 1M19D 2ZY5A 4YS3A 3MGPB 3LZ0B 5GXQB 3REHC 2ZY3A 5JRGD 1KX4D 3MNND 1P3AC 5B40C 3LZ1C 4X23A 3MGQB 1EQZB 3B0DB 4NFTA 5AV5A 4Z5TA 3B6GB 3KWQC 3AV1A 4WJ3C 5GT3C 5GT0D 3REKB 4UUZB 3AZEB 1HQ3D 3KUYA 5E5AC 2FJ7B 4Z66B 4EO5C 4NE6A 5B1MD 4DRAA 5C3IB 1P3IA 1P3LD 3EPKA 5B0ZC 2JSSA 3MVDB 5B24C 5CP6D 5B2JA 3X1UC 3LJAC 3AZHB 4DQYB 3MGRB 1M18B 3AV1B 1A7WA 5B33B 4XUJA 3AYWD 1P34D 4ZUXA 1T3UA 4LD9D 3KXBC 3C1CD 4WZSB 3TU4A 2NQBB 3MGPC 4WU9A 1HTAA 5B1LC 1P3IB 1ZLAB 3W98A 4XZQA 1TAFA 3LZ0C 5GXQC 3AZLB 3REID 3WKJD 4YM6D 2BYMA 4JJND 4G91B 3RELB 3W97D 3MGQC 1EQZC 2AROA 3B0DC 5AY8D 5GSUA 2NQBD 3B6GC 3REKC 4H9RA 3C1BD 4KHAA 3WAAA 3AZEC 4CAYA 1S32C 3A6ND 5B0YA 5CPJB 1P3MD 3MGSA 4H9NA 3NQUA 4WU9B 4Z66C 3AZFD 5BT1D 3B6FD 1F66A 4ZBJB 3MVDC 2BYMB 3W99D 2Y2MA 3AZHC 3AZND 3AFAD 4X23C 2AROB 5AV5C 1ID3B 5BO0A 3AV1C 1P3AA 2JCHA 4H9RB 3X1VD 3LZ1A 4KHAB 3X1TA 4WU8D 1JFIA 3UTAB 4WNNA 4CAYB 2XD1A 5B0YB 3KWQA 4J8UA 3AZID 3AN2D 3WA9B 3REJB 4H9NB 2YFWA 4J8XA 3VH5A 3W96A 3AV2B 1P3IC 5AVBA 5CPKB 3AZLC 1F66B 3H0MC 1P3OB 5B2JC 1U35D 2FFFB 4QLCB 4G91C 5AV9A 3IP4C 5B0ZA 1KX3B 5B24A 4J8WA 4XUJC 3X1UA 3LJAA 2IO5B 5AVCB 2RIQA 5AV6B 1M1AD 1P3GD 5B40D 2HIOA 1B6WA 1P3KD 1P3PD 3VH6T 4J8UB 4NE3A 2YFWB 1BH8A 4J8XB 5CPJC 3WTPD 4WU9C 3X1SB 4Z2MH 5AVBB 2Y2IA 3AZJB 1AOIB 5E5AD 3MGPA 2CV5A 4ZBJC 4E45A 4M6BA 3AZMA 4Z2MG 2AROC 3AZGA 1ID3C 5GSUC 3KSYA 3LELA 4KGCD 2Y2PA 3WAAC 5B0YC 4KUDA 2ZY4A 2Y2GA 4UUZA 3AZEA 3UTBD 3AZKB 3AL0C 2FJ7A 5CPKC 4Z66A 2CV5B 1F66C 4J8VD 5F99D 2NZDD 1P3OC 5DNMB 3AZMB 3UT9D 5B1LD 4QLCC 5JRGA 1KX4A 3KFUG 3AZGB 3MVDA 3LELB 5CPIB 5B2IB 4AWLB 3AZHA 3X1TC 1P3FB 2F8ND 3MGRA 1M18A 2PYOD 3O62B 1KX5B 4KUDB 4J8UC 4G92B 3EPHA 5B33A 3B0BA 5B32G 3FDDA 5B32B 4J8XC 2L5AA 3W96C 1M18C 4R8PD 1M19B 2CWEA 5AVBC 1H3OA 1S32D 5AV8D 3AZJC 1P3LA 1AOIC 2F2AC 4YS3D 1ZLAA 5JRGB 1KX4B 1PZRA 3MNNB 5AV9C 3AZLA 1TZYA 2RVQD 4J8WC 2ZM5A 5GT0B 2HIOC 3RELA 4X23D 1WWIA 1HQ3B 5AV5D 4Z5TD 2DQNC 2YFVB 2Y2JA 1H3OB 3B0CT 5B1MB 3AZKC 5CPJA 1P3LB 1W2EA 3KUYD 2CV5C 5B31D 2Y2HA 5DNMC 2HUEB 5CP6B 3AZMC 1TZYB 4HGAB 1P3ID 2G5HC 2J8PA 3AZGC 3LELC 5CPIC 5CHLB 3F6TA 3W97A 5B2IC 4AWLC 5B2JD 3AYWB 1P34B 1P3FC 2NQBA 3O62C 1ID3A 4LD9B 4KUDC 4G92C 4XUJD 3C1CB 3UTAA 4ZUXD 5BS7A 1P3MA 3WA9A 1P3BD 5B31G 3REJA 2FJ7C 3B6FA 3AV2A 1BH9B 3TU4D 3REIB 5C3IC 3WKJB 5JRGC 4YM6B 1KX4C 3MNNC 5CPKA 4XZQD 4JJNB 3W99A 3W98D 1P3OA 3W97B 5AY8B 4QLCA 3MGRC 5GT0C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3X1V A;  3V9R B;  3C1B B;  1KX3 A;  4WU8 A;  5B33 C;  5AVC A;  2ARO D;  3A6N B;  5GSU D;  5AV6 A;  3AZI A;  1P3M B;  5DNN D;  3WAA D;  5B1M C;  3AZF B;  3B6F B;  1P3L C;  3MGS D;  3X1S A;  1ZLA C;  5CP6 C;  3AZJ A;  1TZY C;  4HGA C;  1U35 A;  1AOI A;  3W99 B;  3AZN B;  3AFA B;  5BNV B;  3X1V B;  3REL C;  4WU8 B;  5JA4 A;  3REH D;  1M1A A;  1P3K A;  4H9S C;  3AZI B;  5FUG A;  3AN2 B;  1P3A D;  3B0C W;  3LZ1 D;  3X1T D;  3C1C C;  3KWQ D;  5GT3 D;  3W96 D;  3AZK A;  3WKJ C;  1U35 B;  4YM6 C;  4JJN C;  5DNM A;  3W97 C;  5AY8 C;  2NQB C;  5JA4 B;  1M1A B;  1P3G B;  3C1B C;  1N1J B;  5B40 B;  5AV9 D;  5CPI A;  1P3K B;  5B0Z D;  1P3P B;  1F1E A;  5FUG B;  5B24 D;  5B2I A;  4J8W D;  3X1U D;  3A6N C;  3LJA D;  1P3F A;  3UTA C;  3WTP B;  5BS7 C;  3O62 A;  1P3M C;  1KX5 A;  2HIO D;  3WA9 C;  3REJ C;  3AZF C;  5BT1 C;  5B32 A;  3B6F C;  3AV2 C;  1M19 A;  5E5A B;  2NZD A;  5F99 A;  3KXB D;  3W99 C;  4EO5 B;  3AZN C;  5KDM B;  3MGP D;  3MNN A;  4KGC B;  3X1V C;  3LZ0 D;  5GXQ D;  4WV4 B;  4WU8 C;  1KX3 C;  2PYO A;  2IO5 C;  5AVC C;  5AV6 C;  3AZI C;  5GT0 A;  3AN2 C;  3MGQ D;  1EQZ D;  3UTB B;  1HQ3 A;  3B6G D;  3NQJ B;  3REK D;  2F8N H;  2YFV A;  3X1S C;  3AZE D;  4J8V B;  5F99 B;  5B1M A;  2NZD B;  1U35 C;  3UT9 B;  5B1L B;  2BYK A;  2FJ7 D;  4Z66 D;  4CSR B;  4H9O A;  5CP6 A;  2F8N G;  2F8N B;  1M1A C;  1P3G C;  2PYO B;  1P3K C;  1P3P C;  3VH6 W;  3MVD D;  3VH5 T;  5BNX A;  3AYW A;  1P34 A;  3AZH D;  3WTP C;  4R8P B;  3MGR D;  1M18 D;  4LD9 A;  4H9Q A;  4H9S A;  3AV1 D;  4H9P B;  5B33 D;  1S32 B;  3C1C A;  5AV8 B;  4YS3 B;  5B31 A;  2BYK B;  3VH6 A;  1BH9 A;  4H9O B;  3REI A;  3WKJ A;  4YM6 A;  1ZLA D;  4KGC C;  4JJN A;  3AZL D;  1TZY D;  5BNX B;  4X23 B;  5AY8 A;  5AV5 B;  4Z5T B;  1KX5 C;  3V9R A;  4H9Q B;  3C1B A;  3REL D;  5B32 C;  3A6N A;  3UTB C;  2F8N K;  1M19 C;  1P3B A;  3KUY B;  5B31 B;  5F99 C;  4J8V C;  3AZF A;  2NZD C;  2LY8 A;  3UT9 C;  5CPJ D;  4WU9 D;  5B2J B;  3AZN A;  3AFA A;  2PYO C;  5BNV A;  4XUJ B;  4R8P C;  4ZUX B;  1HQ3 C;  1ID3 D;  5DNN A;  3AN2 A;  1P3B B;  5AV8 C;  3UTA D;  3TU4 B;  4YS3 C;  1WWS A;  5B0Y D;  3WA9 D;  3REJ D;  3W98 B;  4XZQ B;  3R45 A;  1ULY A;  1TAF B;  2RVQ C;  3AV2 D;  2HUE C;  3VH5 W;  5CPK D;  1F66 D;  1P3O D;  3REH A;  3AYW C;  1P34 C;  4Z5T C;  4QLC D;  5GSU B;  1P3G A;  4LD9 C;  1N1J A;  5B40 A;  5DNN B;  1P3P A;  1KX3 D;  5G49 A;  3WAA B;  5AVC D;  3WTP A;  5AV6 D;  1KU5 A;  5GT3 A;  1Q9C A;  3KUY C;  3MGS B;  4J8U D;  3NQU B;  5B31 C;  1B67 A;  4J8X D;  3R45 B;  3REI C;  5E5A A;  3X1S D;  5AVB D;  4DRB A;  4E44 A;  3AZJ D;  1AOI D;  5KDM A;  3REH B;  5BO0 B;  4KGC A;  1P3A B;  3LZ1 B;  3X1T B;  5G49 B;  4ZUX C;  1JFI B;  4WNN B;  1P3B C;  3KWQ B;  5GT3 B;  3WTP E;  3W96 B;  3UTB A;  3TU4 C;  3NQJ A;  3W98 C;  4XZQ C;  3KXB A;  4J8V A;  1BFM A;  3AZK D;  3UT9 A;  5B1L A;  3AFA C;  5AV9 B;  3LZ0 A;  4CSR A;  5GXQ A;  2CV5 D;  5B0Z B;  5DNM D;  5B24 B;  3AZM D;  2F8N A;  4J8W B;  3X1U B;  3LJA B;  1R4V A;  4NE5 A;  3AZG D;  5DNN C;  2HIO B;  3LEL D;  5CPI D;  3MGQ A;  5B2I D;  1EQZ A;  1P3F D;  3B6G A;  1BH8 B;  4R8P A;  3O62 D;  3REK A;  1KX5 D;  3MGS C;  4KUD D;  4H9P A;  1S32 A;  5AV8 A;  5B32 D;  3KXB B;  1M19 D;  4YS3 A;  3MGP B;  3LZ0 B;  5GXQ B;  3REH C;  5JRG D;  1KX4 D;  3MNN D;  1P3A C;  5B40 C;  3LZ1 C;  4X23 A;  3MGQ B;  1EQZ B;  3B0D B;  4NFT A;  5AV5 A;  4Z5T A;  3B6G B;  3KWQ C;  3AV1 A;  5GT3 C;  5GT0 D;  3REK B;  4UUZ B;  3AZE B;  1HQ3 D;  3KUY A;  5E5A C;  2FJ7 B;  4Z66 B;  4EO5 C;  4NE6 A;  5B1M D;  4DRA A;  5C3I B;  1P3I A;  1P3L D;  5B0Z C;  2JSS A;  3MVD B;  5B24 C;  5CP6 D;  5B2J A;  3X1U C;  3LJA C;  3AZH B;  3MGR B;  1M18 B;  3AV1 B;  1A7W A;  5B33 B;  4XUJ A;  3AYW D;  1P34 D;  4ZUX A;  4LD9 D;  3KXB C;  3C1C D;  4WZS B;  3TU4 A;  2NQB B;  3MGP C;  4WU9 A;  1HTA A;  5B1L C;  1P3I B;  1ZLA B;  3W98 A;  4XZQ A;  1TAF A;  3LZ0 C;  5GXQ C;  3AZL B;  3REI D;  3WKJ D;  4YM6 D;  2BYM A;  4JJN D;  4G91 B;  3REL B;  3W97 D;  3MGQ C;  1EQZ C;  2ARO A;  3B0D C;  5AY8 D;  5GSU A;  2NQB D;  3B6G C;  3REK C;  4H9R A;  3C1B D;  4KHA A;  3WAA A;  3AZE C;  4CAY A;  1S32 C;  3A6N D;  5B0Y A;  5CPJ B;  1P3M D;  3MGS A;  4H9N A;  3NQU A;  4WU9 B;  4Z66 C;  3AZF D;  5BT1 D;  3B6F D;  1F66 A;  4ZBJ B;  3MVD C;  2BYM B;  3W99 D;  3AZH C;  3AZN D;  3AFA D;  4X23 C;  2ARO B;  5AV5 C;  1ID3 B;  5BO0 A;  3AV1 C;  1P3A A;  4H9R B;  3X1V D;  3LZ1 A;  4KHA B;  3X1T A;  4WU8 D;  1JFI A;  3UTA B;  4WNN A;  4CAY B;  5B0Y B;  3KWQ A;  4J8U A;  3AZI D;  3AN2 D;  3WA9 B;  3REJ B;  4H9N B;  2YFW A;  4J8X A;  3VH5 A;  3W96 A;  3AV2 B;  1P3I C;  5AVB A;  5CPK B;  3AZL C;  1F66 B;  1P3O B;  5B2J C;  1U35 D;  4QLC B;  4G91 C;  5AV9 A;  5B0Z A;  1KX3 B;  5B24 A;  4J8W A;  4XUJ C;  3X1U A;  3LJA A;  2IO5 B;  5AVC B;  5AV6 B;  1M1A D;  1P3G D;  5B40 D;  2HIO A;  1B6W A;  1P3K D;  1P3P D;  3VH6 T;  4J8U B;  4NE3 A;  2YFW B;  1BH8 A;  4J8X B;  5CPJ C;  3WTP D;  4WU9 C;  3X1S B;  4Z2M H;  5AVB B;  3AZJ B;  1AOI B;  5E5A D;  3MGP A;  2CV5 A;  4ZBJ C;  4E45 A;  4M6B A;  3AZM A;  4Z2M G;  2ARO C;  3AZG A;  1ID3 C;  5GSU C;  3KSY A;  3LEL A;  4KGC D;  3WAA C;  5B0Y C;  4KUD A;  4UUZ A;  3AZE A;  3UTB D;  3AZK B;  2FJ7 A;  5CPK C;  4Z66 A;  2CV5 B;  1F66 C;  4J8V D;  5F99 D;  2NZD D;  1P3O C;  5DNM B;  3AZM B;  3UT9 D;  5B1L D;  4QLC C;  5JRG A;  1KX4 A;  3AZG B;  3MVD A;  3LEL B;  5CPI B;  5B2I B;  4AWL B;  3AZH A;  3X1T C;  1P3F B;  2F8N D;  3MGR A;  1M18 A;  2PYO D;  3O62 B;  1KX5 B;  4KUD B;  4J8U C;  4G92 B;  5B33 A;  3B0B A;  5B32 G;  5B32 B;  4J8X C;  2L5A A;  3W96 C;  1M18 C;  4R8P D;  1M19 B;  2CWE A;  5AVB C;  1H3O A;  1S32 D;  5AV8 D;  3AZJ C;  1P3L A;  1AOI C;  4YS3 D;  1ZLA A;  5JRG B;  1KX4 B;  3MNN B;  5AV9 C;  3AZL A;  1TZY A;  2RVQ D;  4J8W C;  5GT0 B;  2HIO C;  3REL A;  4X23 D;  1WWI A;  1HQ3 B;  5AV5 D;  4Z5T D;  2YFV B;  1H3O B;  3B0C T;  5B1M B;  3AZK C;  5CPJ A;  1P3L B;  3KUY D;  2CV5 C;  5B31 D;  5DNM C;  2HUE B;  5CP6 B;  3AZM C;  1TZY B;  4HGA B;  1P3I D;  3AZG C;  3LEL C;  5CPI C;  5CHL B;  3W97 A;  5B2I C;  4AWL C;  5B2J D;  3AYW B;  1P34 B;  1P3F C;  2NQB A;  3O62 C;  1ID3 A;  4LD9 B;  4KUD C;  4G92 C;  4XUJ D;  3C1C B;  3UTA A;  4ZUX D;  5BS7 A;  1P3M A;  3WA9 A;  1P3B D;  5B31 G;  3REJ A;  2FJ7 C;  3B6F A;  3AV2 A;  1BH9 B;  3TU4 D;  3REI B;  5C3I C;  3WKJ B;  5JRG C;  4YM6 B;  1KX4 C;  3MNN C;  5CPK A;  4XZQ D;  4JJN B;  3W99 A;  3W98 D;  1P3O A;  3W97 B;  5AY8 B;  4QLC A;  3MGR C;  5GT0 C; 
#chains in the Genus database with same CATH topology
 3X1V A;  3V9R B;  3C1B B;  1KX3 A;  4WU8 A;  5B33 C;  5AVC A;  2ARO D;  3A6N B;  5GSU D;  5AV6 A;  3AZI A;  1P3M B;  5DNN D;  3WAA D;  4UPK A;  5B1M C;  3AZF B;  3B6F B;  1P3L C;  3MGS D;  3X1S A;  1ZLA C;  2Y2N A;  5CP6 C;  3AZJ A;  1TZY C;  4HGA C;  1U35 A;  1AOI A;  3W99 B;  3AZN B;  3AFA B;  3P5J B;  3A1K A;  5BNV B;  3X1V B;  3REL C;  4WU8 B;  5JA4 A;  3REH D;  1M1A A;  1P3K A;  4H9S C;  3AZI B;  5FUG A;  3AN2 B;  1P3A D;  3B0C W;  3LZ1 D;  3X1T D;  3C1C C;  3KWQ D;  1Z2C B;  2DF4 C;  5GT3 D;  3W96 D;  3AZK A;  3WKJ C;  1U35 B;  4YM6 C;  4JJN C;  5DNM A;  3W97 C;  5AY8 C;  2NQB C;  5JA4 B;  1M1A B;  1P3G B;  3C1B C;  1N1J B;  5B40 B;  5AV9 D;  5CPI A;  1P3K B;  5B0Z D;  1P3P B;  1F1E A;  5FUG B;  5B24 D;  5B2I A;  4J8W D;  3X1U D;  3A6N C;  3LJA D;  1P3F A;  3UTA C;  3WTP B;  5BS7 C;  3O62 A;  1P3M C;  1KX5 A;  2HIO D;  3WA9 C;  3REJ C;  3AZF C;  5BT1 C;  5B32 A;  3B6F C;  3AV2 C;  1M19 A;  5E5A B;  2NZD A;  5F99 A;  3KXB D;  3W99 C;  4EO5 B;  3AZN C;  5KDM B;  3MGP D;  3MNN A;  4KGC B;  3X1V C;  3LZ0 D;  5GXQ D;  4WV4 B;  4WU8 C;  1KX3 C;  2VQR A;  2PYO A;  2IO5 C;  5AVC C;  5AV6 C;  3AZI C;  5GT0 A;  3AN2 C;  3MGQ D;  1EQZ D;  3UTB B;  1HQ3 A;  3B6G D;  3NQJ B;  3REK D;  2F8N H;  2YFV A;  3X1S C;  3AZE D;  4J8V B;  5F99 B;  5B1M A;  2NZD B;  1U35 C;  3UT9 B;  3EPJ A;  5B1L B;  2BYK A;  2FJ7 D;  4Z66 D;  4CSR B;  4H9O A;  5CP6 A;  2F8N G;  2JE5 A;  2F8N B;  2ZY2 A;  1M1A C;  1P3G C;  2PYO B;  1P3K C;  1P3P C;  3VH6 W;  3MVD D;  3VH5 T;  5BNX A;  3AYW A;  1P34 A;  3AZH D;  2Y2L A;  3WTP C;  4R8P B;  3MGR D;  1M18 D;  4LD9 A;  4H9Q A;  4H9S A;  3AV1 D;  4H9P B;  5B33 D;  1S32 B;  3C1C A;  5AV8 B;  4YS3 B;  2BG1 A;  5B31 A;  2BYK B;  3VH6 A;  1BH9 A;  4H9O B;  3REI A;  3WKJ A;  4YM6 A;  1ZLA D;  2Y2K A;  4KGC C;  4JJN A;  3AZL D;  1TZY D;  5BNX B;  4X23 B;  5AY8 A;  5AV5 B;  4Z5T B;  1KX5 C;  3A1I A;  4H9Q B;  3V9R A;  3C1B A;  3REL D;  5B32 C;  3A6N A;  3EG5 B;  3UTB C;  2F8N K;  1M19 C;  1P3B A;  3KUY B;  5B31 B;  5F99 C;  4J8V C;  3AZF A;  2NZD C;  2LY8 A;  2G5I C;  3UT9 C;  5CPJ D;  3H0L C;  4WU9 D;  5B2J B;  3AZN A;  3AFA A;  2PYO C;  5BNV A;  4XUJ B;  4R8P C;  4ZUX B;  1HQ3 C;  1ID3 D;  5DNN A;  3AN2 A;  1P3B B;  5AV8 C;  3UTA D;  3TU4 B;  4YS3 C;  1WWS A;  5B0Y D;  3WA9 D;  3REJ D;  3W98 B;  4XZQ B;  3R45 A;  1ULY A;  1TAF B;  2RVQ C;  3AV2 D;  2HUE C;  2Y2O A;  3VH5 W;  5CPK D;  1F66 D;  1P3O D;  3REH A;  3AYW C;  2W8S A;  1P34 C;  4Z5T C;  4QLC D;  5GSU B;  1P3G A;  4LD9 C;  1N1J A;  5B40 A;  5DNN B;  1P3P A;  3EPL A;  1KX3 D;  5G49 A;  3WAA B;  5AVC D;  3WTP A;  5AV6 D;  1KU5 A;  5GT3 A;  1Q9C A;  3KUY C;  3MGS B;  4J8U D;  3NQU B;  5B31 C;  1B67 A;  4J8X D;  3R45 B;  3REI C;  5E5A A;  3X1S D;  5AVB D;  4DRB A;  4E44 A;  3AZJ D;  1AOI D;  5KDM A;  3REH B;  5BO0 B;  4KGC A;  1P3A B;  3LZ1 B;  3X1T B;  5G49 B;  4ZUX C;  1JFI B;  4WNN B;  1P3B C;  3KWQ B;  5GT3 B;  3WTP E;  3W96 B;  3UTB A;  3TU4 C;  3NQJ A;  3W98 C;  4XZQ C;  3KXB A;  4J8V A;  1BFM A;  3H0R C;  3UT9 A;  3AZK D;  5B1L A;  3AFA C;  5AV9 B;  3LZ0 A;  4CSR A;  5GXQ A;  2CV5 D;  5B0Z B;  5DNM D;  5B24 B;  3AZM D;  2F8N A;  4J8W B;  3X1U B;  2Y2Q A;  3LJA B;  1R4V A;  4NE5 A;  3AZG D;  5DNN C;  2HIO B;  3LEL D;  5CPI D;  3MGQ A;  5B2I D;  1EQZ A;  1P3F D;  3B6G A;  1BH8 B;  2UWX A;  2XD5 A;  4R8P A;  3O62 D;  3REK A;  1KX5 D;  3MGS C;  4KUD D;  4H9P A;  1S32 A;  5AV8 A;  5B32 D;  3KXB B;  1M19 D;  2ZY5 A;  4YS3 A;  3MGP B;  3LZ0 B;  5GXQ B;  3REH C;  2ZY3 A;  5JRG D;  1KX4 D;  3MNN D;  1P3A C;  5B40 C;  3LZ1 C;  4X23 A;  3MGQ B;  1EQZ B;  3B0D B;  4NFT A;  5AV5 A;  4Z5T A;  3B6G B;  3KWQ C;  3AV1 A;  4WJ3 C;  5GT3 C;  5GT0 D;  3REK B;  4UUZ B;  3AZE B;  1HQ3 D;  3KUY A;  5E5A C;  2FJ7 B;  4Z66 B;  4EO5 C;  4NE6 A;  5B1M D;  4DRA A;  5C3I B;  1P3I A;  1P3L D;  3EPK A;  5B0Z C;  2JSS A;  3MVD B;  5B24 C;  5CP6 D;  5B2J A;  3X1U C;  3LJA C;  3AZH B;  4DQY B;  3MGR B;  1M18 B;  3AV1 B;  1A7W A;  5B33 B;  4XUJ A;  3AYW D;  1P34 D;  4ZUX A;  1T3U A;  4LD9 D;  3KXB C;  3C1C D;  4WZS B;  3TU4 A;  2NQB B;  3MGP C;  4WU9 A;  1HTA A;  5B1L C;  1P3I B;  1ZLA B;  3W98 A;  4XZQ A;  1TAF A;  3LZ0 C;  5GXQ C;  3AZL B;  3REI D;  3WKJ D;  4YM6 D;  2BYM A;  4JJN D;  4G91 B;  3REL B;  3W97 D;  3MGQ C;  1EQZ C;  2ARO A;  3B0D C;  5AY8 D;  5GSU A;  2NQB D;  3B6G C;  3REK C;  4H9R A;  3C1B D;  4KHA A;  3WAA A;  3AZE C;  4CAY A;  1S32 C;  3A6N D;  5B0Y A;  5CPJ B;  1P3M D;  3MGS A;  4H9N A;  3NQU A;  4WU9 B;  4Z66 C;  3AZF D;  5BT1 D;  3B6F D;  1F66 A;  4ZBJ B;  3MVD C;  2BYM B;  3W99 D;  2Y2M A;  3AZH C;  3AZN D;  3AFA D;  4X23 C;  2ARO B;  5AV5 C;  1ID3 B;  5BO0 A;  3AV1 C;  1P3A A;  2JCH A;  4H9R B;  3X1V D;  3LZ1 A;  4KHA B;  3X1T A;  4WU8 D;  1JFI A;  3UTA B;  4WNN A;  4CAY B;  2XD1 A;  5B0Y B;  3KWQ A;  4J8U A;  3AZI D;  3AN2 D;  3WA9 B;  3REJ B;  4H9N B;  2YFW A;  4J8X A;  3VH5 A;  3W96 A;  3AV2 B;  1P3I C;  5AVB A;  5CPK B;  3AZL C;  1F66 B;  3H0M C;  1P3O B;  5B2J C;  1U35 D;  2FFF B;  4QLC B;  4G91 C;  5AV9 A;  3IP4 C;  5B0Z A;  1KX3 B;  5B24 A;  4J8W A;  4XUJ C;  3X1U A;  3LJA A;  2IO5 B;  5AVC B;  2RIQ A;  5AV6 B;  1M1A D;  1P3G D;  5B40 D;  2HIO A;  1B6W A;  1P3K D;  1P3P D;  3VH6 T;  4J8U B;  4NE3 A;  2YFW B;  1BH8 A;  4J8X B;  5CPJ C;  3WTP D;  4WU9 C;  3X1S B;  4Z2M H;  5AVB B;  2Y2I A;  3AZJ B;  1AOI B;  5E5A D;  3MGP A;  2CV5 A;  4ZBJ C;  4E45 A;  4M6B A;  3AZM A;  4Z2M G;  2ARO C;  3AZG A;  1ID3 C;  5GSU C;  3KSY A;  3LEL A;  4KGC D;  2Y2P A;  3WAA C;  5B0Y C;  4KUD A;  2ZY4 A;  2Y2G A;  4UUZ A;  3AZE A;  3UTB D;  3AZK B;  3AL0 C;  2FJ7 A;  5CPK C;  4Z66 A;  2CV5 B;  1F66 C;  4J8V D;  5F99 D;  2NZD D;  1P3O C;  5DNM B;  3AZM B;  3UT9 D;  5B1L D;  4QLC C;  5JRG A;  1KX4 A;  3KFU G;  3AZG B;  3MVD A;  3LEL B;  5CPI B;  5B2I B;  4AWL B;  3AZH A;  3X1T C;  1P3F B;  2F8N D;  3MGR A;  1M18 A;  2PYO D;  3O62 B;  1KX5 B;  4KUD B;  4J8U C;  4G92 B;  3EPH A;  5B33 A;  3B0B A;  5B32 G;  3FDD A;  5B32 B;  4J8X C;  2L5A A;  3W96 C;  1M18 C;  4R8P D;  1M19 B;  2CWE A;  5AVB C;  1H3O A;  1S32 D;  5AV8 D;  3AZJ C;  1P3L A;  1AOI C;  2F2A C;  4YS3 D;  1ZLA A;  5JRG B;  1KX4 B;  1PZR A;  3MNN B;  5AV9 C;  3AZL A;  1TZY A;  2RVQ D;  4J8W C;  2ZM5 A;  5GT0 B;  2HIO C;  3REL A;  4X23 D;  1WWI A;  1HQ3 B;  5AV5 D;  4Z5T D;  2DQN C;  2YFV B;  2Y2J A;  1H3O B;  3B0C T;  5B1M B;  3AZK C;  5CPJ A;  1P3L B;  1W2E A;  3KUY D;  2CV5 C;  5B31 D;  2Y2H A;  5DNM C;  2HUE B;  5CP6 B;  3AZM C;  1TZY B;  4HGA B;  1P3I D;  2G5H C;  2J8P A;  3AZG C;  3LEL C;  5CPI C;  5CHL B;  3F6T A;  3W97 A;  5B2I C;  4AWL C;  5B2J D;  3AYW B;  1P34 B;  1P3F C;  2NQB A;  3O62 C;  1ID3 A;  4LD9 B;  4KUD C;  4G92 C;  4XUJ D;  3C1C B;  3UTA A;  4ZUX D;  5BS7 A;  1P3M A;  3WA9 A;  1P3B D;  5B31 G;  3REJ A;  2FJ7 C;  3B6F A;  3AV2 A;  1BH9 B;  3TU4 D;  3REI B;  5C3I C;  3WKJ B;  5JRG C;  4YM6 B;  1KX4 C;  3MNN C;  5CPK A;  4XZQ D;  4JJN B;  3W99 A;  3W98 D;  1P3O A;  3W97 B;  5AY8 B;  4QLC A;  3MGR C;  5GT0 C; 
#chains in the Genus database with same CATH homology
 3X1V A;  3V9R B;  3C1B B;  1KX3 A;  4WU8 A;  5B33 C;  5AVC A;  2ARO D;  3A6N B;  5GSU D;  5AV6 A;  3AZI A;  1P3M B;  5DNN D;  3WAA D;  4UPK A;  5B1M C;  3AZF B;  3B6F B;  1P3L C;  3MGS D;  3X1S A;  1ZLA C;  2Y2N A;  5CP6 C;  3AZJ A;  1TZY C;  4HGA C;  1U35 A;  1AOI A;  3W99 B;  3AZN B;  3AFA B;  3P5J B;  3A1K A;  5BNV B;  3X1V B;  3REL C;  4WU8 B;  5JA4 A;  3REH D;  1M1A A;  1P3K A;  4H9S C;  3AZI B;  5FUG A;  3AN2 B;  1P3A D;  3B0C W;  3LZ1 D;  3X1T D;  3C1C C;  3KWQ D;  1Z2C B;  2DF4 C;  5GT3 D;  3W96 D;  3AZK A;  3WKJ C;  1U35 B;  4YM6 C;  4JJN C;  5DNM A;  3W97 C;  5AY8 C;  2NQB C;  5JA4 B;  1M1A B;  1P3G B;  3C1B C;  1N1J B;  5B40 B;  5AV9 D;  5CPI A;  1P3K B;  5B0Z D;  1P3P B;  1F1E A;  5FUG B;  5B24 D;  5B2I A;  4J8W D;  3X1U D;  3A6N C;  3LJA D;  1P3F A;  3UTA C;  3WTP B;  5BS7 C;  3O62 A;  1P3M C;  1KX5 A;  2HIO D;  3WA9 C;  3REJ C;  3AZF C;  5BT1 C;  5B32 A;  3B6F C;  3AV2 C;  1M19 A;  5E5A B;  2NZD A;  5F99 A;  3KXB D;  3W99 C;  4EO5 B;  3AZN C;  5KDM B;  3MGP D;  3MNN A;  4KGC B;  3X1V C;  3LZ0 D;  5GXQ D;  4WV4 B;  4WU8 C;  1KX3 C;  2VQR A;  2PYO A;  2IO5 C;  5AVC C;  5AV6 C;  3AZI C;  5GT0 A;  3AN2 C;  3MGQ D;  1EQZ D;  3UTB B;  1HQ3 A;  3B6G D;  3NQJ B;  3REK D;  2F8N H;  2YFV A;  3X1S C;  3AZE D;  4J8V B;  5F99 B;  5B1M A;  2NZD B;  1U35 C;  3UT9 B;  3EPJ A;  5B1L B;  2BYK A;  2FJ7 D;  4Z66 D;  4CSR B;  4H9O A;  5CP6 A;  2F8N G;  2JE5 A;  2F8N B;  2ZY2 A;  1M1A C;  1P3G C;  2PYO B;  1P3K C;  1P3P C;  3VH6 W;  3MVD D;  3VH5 T;  5BNX A;  3AYW A;  1P34 A;  3AZH D;  2Y2L A;  3WTP C;  4R8P B;  3MGR D;  1M18 D;  4LD9 A;  4H9Q A;  4H9S A;  3AV1 D;  4H9P B;  5B33 D;  1S32 B;  3C1C A;  5AV8 B;  4YS3 B;  2BG1 A;  5B31 A;  2BYK B;  3VH6 A;  1BH9 A;  4H9O B;  3REI A;  3WKJ A;  4YM6 A;  1ZLA D;  2Y2K A;  4KGC C;  4JJN A;  3AZL D;  1TZY D;  5BNX B;  4X23 B;  5AY8 A;  5AV5 B;  4Z5T B;  1KX5 C;  3A1I A;  4H9Q B;  3V9R A;  3C1B A;  3REL D;  5B32 C;  3A6N A;  3EG5 B;  3UTB C;  2F8N K;  1M19 C;  1P3B A;  3KUY B;  5B31 B;  5F99 C;  4J8V C;  3AZF A;  2NZD C;  2LY8 A;  2G5I C;  3UT9 C;  5CPJ D;  3H0L C;  4WU9 D;  5B2J B;  3AZN A;  3AFA A;  2PYO C;  5BNV A;  4XUJ B;  4R8P C;  4ZUX B;  1HQ3 C;  1ID3 D;  5DNN A;  3AN2 A;  1P3B B;  5AV8 C;  3UTA D;  3TU4 B;  4YS3 C;  1WWS A;  5B0Y D;  3WA9 D;  3REJ D;  3W98 B;  4XZQ B;  3R45 A;  1ULY A;  1TAF B;  2RVQ C;  3AV2 D;  2HUE C;  2Y2O A;  3VH5 W;  5CPK D;  1F66 D;  1P3O D;  3REH A;  3AYW C;  2W8S A;  1P34 C;  4Z5T C;  4QLC D;  5GSU B;  1P3G A;  4LD9 C;  1N1J A;  5B40 A;  5DNN B;  1P3P A;  3EPL A;  1KX3 D;  5G49 A;  3WAA B;  5AVC D;  3WTP A;  5AV6 D;  1KU5 A;  5GT3 A;  1Q9C A;  3KUY C;  3MGS B;  4J8U D;  3NQU B;  5B31 C;  1B67 A;  4J8X D;  3R45 B;  3REI C;  5E5A A;  3X1S D;  5AVB D;  4DRB A;  4E44 A;  3AZJ D;  1AOI D;  5KDM A;  3REH B;  5BO0 B;  4KGC A;  1P3A B;  3LZ1 B;  3X1T B;  5G49 B;  4ZUX C;  1JFI B;  4WNN B;  1P3B C;  3KWQ B;  5GT3 B;  3WTP E;  3W96 B;  3UTB A;  3TU4 C;  3NQJ A;  3W98 C;  4XZQ C;  3KXB A;  4J8V A;  1BFM A;  3H0R C;  3UT9 A;  3AZK D;  5B1L A;  3AFA C;  5AV9 B;  3LZ0 A;  4CSR A;  5GXQ A;  2CV5 D;  5B0Z B;  5DNM D;  5B24 B;  3AZM D;  2F8N A;  4J8W B;  3X1U B;  2Y2Q A;  3LJA B;  1R4V A;  4NE5 A;  3AZG D;  5DNN C;  2HIO B;  3LEL D;  5CPI D;  3MGQ A;  5B2I D;  1EQZ A;  1P3F D;  3B6G A;  1BH8 B;  2UWX A;  2XD5 A;  4R8P A;  3O62 D;  3REK A;  1KX5 D;  3MGS C;  4KUD D;  4H9P A;  1S32 A;  5AV8 A;  5B32 D;  3KXB B;  1M19 D;  2ZY5 A;  4YS3 A;  3MGP B;  3LZ0 B;  5GXQ B;  3REH C;  2ZY3 A;  5JRG D;  1KX4 D;  3MNN D;  1P3A C;  5B40 C;  3LZ1 C;  4X23 A;  3MGQ B;  1EQZ B;  3B0D B;  4NFT A;  5AV5 A;  4Z5T A;  3B6G B;  3KWQ C;  3AV1 A;  4WJ3 C;  5GT3 C;  5GT0 D;  3REK B;  4UUZ B;  3AZE B;  1HQ3 D;  3KUY A;  5E5A C;  2FJ7 B;  4Z66 B;  4EO5 C;  4NE6 A;  5B1M D;  4DRA A;  5C3I B;  1P3I A;  1P3L D;  3EPK A;  5B0Z C;  2JSS A;  3MVD B;  5B24 C;  5CP6 D;  5B2J A;  3X1U C;  3LJA C;  3AZH B;  4DQY B;  3MGR B;  1M18 B;  3AV1 B;  1A7W A;  5B33 B;  4XUJ A;  3AYW D;  1P34 D;  4ZUX A;  1T3U A;  4LD9 D;  3KXB C;  3C1C D;  4WZS B;  3TU4 A;  2NQB B;  3MGP C;  4WU9 A;  1HTA A;  5B1L C;  1P3I B;  1ZLA B;  3W98 A;  4XZQ A;  1TAF A;  3LZ0 C;  5GXQ C;  3AZL B;  3REI D;  3WKJ D;  4YM6 D;  2BYM A;  4JJN D;  4G91 B;  3REL B;  3W97 D;  3MGQ C;  1EQZ C;  2ARO A;  3B0D C;  5AY8 D;  5GSU A;  2NQB D;  3B6G C;  3REK C;  4H9R A;  3C1B D;  4KHA A;  3WAA A;  3AZE C;  4CAY A;  1S32 C;  3A6N D;  5B0Y A;  5CPJ B;  1P3M D;  3MGS A;  4H9N A;  3NQU A;  4WU9 B;  4Z66 C;  3AZF D;  5BT1 D;  3B6F D;  1F66 A;  4ZBJ B;  3MVD C;  2BYM B;  3W99 D;  2Y2M A;  3AZH C;  3AZN D;  3AFA D;  4X23 C;  2ARO B;  5AV5 C;  1ID3 B;  5BO0 A;  3AV1 C;  1P3A A;  2JCH A;  4H9R B;  3X1V D;  3LZ1 A;  4KHA B;  3X1T A;  4WU8 D;  1JFI A;  3UTA B;  4WNN A;  4CAY B;  2XD1 A;  5B0Y B;  3KWQ A;  4J8U A;  3AZI D;  3AN2 D;  3WA9 B;  3REJ B;  4H9N B;  2YFW A;  4J8X A;  3VH5 A;  3W96 A;  3AV2 B;  1P3I C;  5AVB A;  5CPK B;  3AZL C;  1F66 B;  3H0M C;  1P3O B;  5B2J C;  1U35 D;  2FFF B;  4QLC B;  4G91 C;  5AV9 A;  3IP4 C;  5B0Z A;  1KX3 B;  5B24 A;  4J8W A;  4XUJ C;  3X1U A;  3LJA A;  2IO5 B;  5AVC B;  2RIQ A;  5AV6 B;  1M1A D;  1P3G D;  5B40 D;  2HIO A;  1B6W A;  1P3K D;  1P3P D;  3VH6 T;  4J8U B;  4NE3 A;  2YFW B;  1BH8 A;  4J8X B;  5CPJ C;  3WTP D;  4WU9 C;  3X1S B;  4Z2M H;  5AVB B;  2Y2I A;  3AZJ B;  1AOI B;  5E5A D;  3MGP A;  2CV5 A;  4ZBJ C;  4E45 A;  4M6B A;  3AZM A;  4Z2M G;  2ARO C;  3AZG A;  1ID3 C;  5GSU C;  3KSY A;  3LEL A;  4KGC D;  2Y2P A;  3WAA C;  5B0Y C;  4KUD A;  2ZY4 A;  2Y2G A;  4UUZ A;  3AZE A;  3UTB D;  3AZK B;  3AL0 C;  2FJ7 A;  5CPK C;  4Z66 A;  2CV5 B;  1F66 C;  4J8V D;  5F99 D;  2NZD D;  1P3O C;  5DNM B;  3AZM B;  3UT9 D;  5B1L D;  4QLC C;  5JRG A;  1KX4 A;  3KFU G;  3AZG B;  3MVD A;  3LEL B;  5CPI B;  5B2I B;  4AWL B;  3AZH A;  3X1T C;  1P3F B;  2F8N D;  3MGR A;  1M18 A;  2PYO D;  3O62 B;  1KX5 B;  4KUD B;  4J8U C;  4G92 B;  3EPH A;  5B33 A;  3B0B A;  5B32 G;  3FDD A;  5B32 B;  4J8X C;  2L5A A;  3W96 C;  1M18 C;  4R8P D;  1M19 B;  2CWE A;  5AVB C;  1H3O A;  1S32 D;  5AV8 D;  3AZJ C;  1P3L A;  1AOI C;  2F2A C;  4YS3 D;  1ZLA A;  5JRG B;  1KX4 B;  1PZR A;  3MNN B;  5AV9 C;  3AZL A;  1TZY A;  2RVQ D;  4J8W C;  2ZM5 A;  5GT0 B;  2HIO C;  3REL A;  4X23 D;  1WWI A;  1HQ3 B;  5AV5 D;  4Z5T D;  2DQN C;  2YFV B;  2Y2J A;  1H3O B;  3B0C T;  5B1M B;  3AZK C;  5CPJ A;  1P3L B;  1W2E A;  3KUY D;  2CV5 C;  5B31 D;  2Y2H A;  5DNM C;  2HUE B;  5CP6 B;  3AZM C;  1TZY B;  4HGA B;  1P3I D;  2G5H C;  2J8P A;  3AZG C;  3LEL C;  5CPI C;  5CHL B;  3F6T A;  3W97 A;  5B2I C;  4AWL C;  5B2J D;  3AYW B;  1P34 B;  1P3F C;  2NQB A;  3O62 C;  1ID3 A;  4LD9 B;  4KUD C;  4G92 C;  4XUJ D;  3C1C B;  3UTA A;  4ZUX D;  5BS7 A;  1P3M A;  3WA9 A;  1P3B D;  5B31 G;  3REJ A;  2FJ7 C;  3B6F A;  3AV2 A;  1BH9 B;  3TU4 D;  3REI B;  5C3I C;  3WKJ B;  5JRG C;  4YM6 B;  1KX4 C;  3MNN C;  5CPK A;  4XZQ D;  4JJN B;  3W99 A;  3W98 D;  1P3O A;  3W97 B;  5AY8 B;  4QLC A;  3MGR C;  5GT0 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...