1P3IA

Crystallographic studies of nucleosome core particles containing histone 'sin' mutants
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
98
structure length
98
Chain Sequence
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Structural protein/dna
molecule keywords Palindromic 146bp Human Alpha-Satellite DNA fragment
publication title Crystal structures of histone Sin mutant nucleosomes reveal altered protein-DNA interactions
pubmed doi rcsb
source organism Homo sapiens
total genus 32
structure length 98
sequence length 98
chains with identical sequence E
ec nomenclature
pdb deposition date 2003-04-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1p3iA00
3AZLB 1P3IA 3LJAD 5AVCD 4E44A 4J8XD 5CPJD 1P3GC 2BYKB 5AV8D 3X1VB 3AV1D 2NQBB 4XZQA 5B31A 3AZKD 3B6FB 1P3LD 4EO5C 3REIA 2CV5C 4G91B 4J8WA 1P3KD 3X1UD 3REJB 3TU4A 5DNMA 3LJAB 5AVCB 4J8XB 3AV1B 2RVQD 4XZQC 3C1CD 3O62B 4LD9A 4WU9A 4KUDC 5CP6C 1P3KB 3X1UB 4J8WC 4Z5TD 3KSYA 3MNND 2AROD 4AWLC 4NE3A 3AZMD 1P3MA 5GT0B 5DNMC 3MVDA 3AYWD 5CPID 3W99A 1BFMA 3RELD 5GT3C 5B2ID 2IO5B 3AZFA 1ID3D 4X23D 5GSUC 3W98D 5CPIA 5AVBD 3X1TB 3MNNB 3AZMB 2AROB 4WU8D 4H9PA 5BO0B 3AN2C 5F99D 1P3MC 3AYWB 1S32C 1U35D 3W99C 5JRGA 3AZKA 5B2IB 3REKA 2YFVA 3UT9D 4H9NA 1P3LA 3B0DB 2HUEB 3WA9D 5AVBB 5CPIC 5B1MD 1ULYA 3AZJA 5F99B 5CPJC 2HIOD 5AV8C 1R4VA 5BNXA 1HTAA 3AZKC 3NQJA 4CSRA 1P3LC 1TZYD 5AV6A 4ZUXB 3AV2A 3WAAD 3UTAA 3C1BA 1M1AA 2HIOB 1HQ3B 1EQZB 4UUZA 1ZLAA 4H9QA 2RVQC 4R8PB 2IO5C 3C1CC 2YFWA 3KXBA 2F8NA 3UTBB 3WTPA 3W98A 3AZGD 1TZYB 4J8VD 4QLCA 3AZHB 4Z66A 4Z5TC 4J8UD 3MNNC 3WAAB 2AROC 4YS3D 1P3AD 5FUGB 1P3OD 1P3PD 3LZ1D 3RELC 3REHD 5B2IC 3UT9A 1ZLAC 5AV9B 5B33D 3AZGB 3KWQB 1ID3C 4X23C 3W98C 4J8VB 3R45A 5B0YA 4QLCC 3MGQB 4XUJA 2NZDB 4WU8C 4YM6B 4YS3B 1P3AB 2FJ7A 1P3OB 2F8NK 3LZ0A 1P3PB 3KUYB 5KDMA 1U35C 4H9OA 4H9RB 5CHLB 1H3OB 5JA4A 3UT9C 3AZID 3W97D 5B33B 3LELB 5B2JA 5CPKD 5DNND 3WA9C 5B32D 3V9RA 5C3IC 3AZLD 2PYOB 1P3GA 5B1MC 5B40D 4XUJC 2BYMA 3X1VD 2NQBD 5B32G 5BS7C 4ZBJB 3MGPB 3LZ0C 3VH5T 1TAFA 5AV5D 5B24D 1P3IB 3AZIB 3W97B 2CV5A 5BT1D 1TZYC 3MGSB 4WNNA 5CPKB 5DNNB 5B32B 4J8UA 1KX4D 5B40B 4NE5A 4DRBA 3B6GD 1P3FB 5AV5B 3VH6T 5B24B 3O62D 3TU4B 4KUDA 5CP6A 1BH9B 5G49B 4J8UC 1KX4B 4M6BA 5GT0D 1P3AC 1P34A 2JSSA 1P3OC 3B6GB 3LZ1C 5GT3A 3MGRA 3REHC 4JJND 3A6ND 1AOIB 5E5AD 5GSUA 5B33C 3MVDB 1KX5D 5B1LA 3X1TD 1M18D 4HGAB 5B0ZD 3AZLA 5AY8D 3AN2A 2BYKA 1S32A 1P34C 1F66D 1M19B 3B6FA 3MGRC 1WWIA 1JFIB 4JJNB 3A6NB 3B0BA 3AZIC 5E5AB 5BNVA 3AZND 1KX5B 3X1SD 5DNNC 3REJA 3WKJB 1M18B 5B0ZB 5JRGB 3W96D 5B1LC 5AY8B 3LJAA 5AVCA 3AZLC 4J8XA 5CPJA 2YFVB 5B40C 5AV8A 3AV1A 3X1VC 1F66B 2NQBC 5AV5C 3B6FC 5B24C 5BT1C 3AZNB 3AZJB 4ZUXD 1P3KA 3X1UA 4G91C 3X1SB 5GXQB 3REJC 3W96B 5GT0A 3LJAC 5AVCC 4J8XC 5AV6B 3AV1C 1HQ3D 3NQUB 1EQZD 1KX3B 3C1CA 4R8PD 3O62C 3UTBD 3C1BB 1M1AB 3X1TA 4Z5TA 1BH8B 1P3KC 3X1UC 3AZHD 3MNNA 3AZMA 2AROA 4UUZB 5BO0A 5GT0C 3KXBB 3AYWA 2F8NB 3WTPB 3RELA 5B2IA 4CAYB 4Z66B 5AV9D 4JJNC 1ID3A 4X23A 5E5AC 3KWQD 5AVBA 4DRAA 3X1TC 3AZED 4WU8A 3MGQD 4KHAB 3AZMC 2NZDD 5F99A 4YM6D 4E45A 3AYWC 1U35A 3WTPE 1F66C 3VH5A 3KUYD 3R45B 5B0YB 3WA9A 3B0DC 4KGCB 3LELD 2HUEC 5AVBC 3X1SC 5KDMB 3AZEB 3W96C 5B1MA 2PYOD 4H9OB 2HIOA 5F99C 5BS7A 1P3BD 5B2JB 3MGPD 3VH6A 3AFAD 3V9RB 1P3ID 1TZYA 1P3GB 2BYMB 3MGSD 4ZUXC 4XZQD 3WAAA 5B31D 1N1JB 3VH5W 2CV5B 2HIOC 1P3BB 3REID 1HQ3C 4Z2MG 1P3FD 1EQZC 5B31G 3AFAB 4R8PC 3TU4D 3AZGA 3UTBC 5DNMD 4J8VA 3AZHC 4XZQB 5B31B 4YS3A 1P3AA 3WAAC 4LD9D 1P3OA 4KUDB 4WU9D 1P3PA 3LZ1A 3VH6W 3REHA 3REIB 4J8WB 4H9RA 4AWLB 5B33A 1AOID 5AV9C 5DNMB 1P3MD 3LELA 3AZGC 1WWSA 3KWQC 3MVDD 3W99D 4J8VC 2PYOA 3MGQC 2NZDC 4LD9B 4YM6C 4YS3C 4WU9B 5GSUB 3AZFD 1P3PC 1M19D 3KUYC 3AZIA 3W97A 4H9SA 3AN2B 1P3MB 3MGSA 5CPKA 5DNNA 1S32B 1B6WA 5B32A 3LELC 3W99B 3WKJD 5JRGD 2PYOC 3AFAA 5B40A 3REKD 3X1VA 2NQBA 5BNVB 3AZFB 1P3BC 1P3FA 4ZBJC 5AV5A 3MGPC 5CPIB 5B24A 3AFAC 1P3IC 3W97C 4H9PB 4H9SC 5CPJB 5AV8B 3AZJD 1BH9A 3MGSC 5G49A 5CPKC 5B32C 5GXQD 1KX4A 3AZKB 5B31C 3REKB 1P3LB 4H9NB 3B6GA 5AV6D 3REIC 1P3FC 1KX3D 3O62A 1AOIA 4Z2MH 3TU4C 3AV2D 3UTAD 3C1BD 1M1AD 5BNXB 1ZLAD 3C1CB 1KU5A 1KX4C 4LD9C 3KXBD 2F8ND 3NQJB 4WU9C 4CSRB 3WTPD 1M19A 3B6GC 4Z5TB 4QLCD 1JFIA 4JJNA 4Z66D 3A6NA 2F8NG 5E5AA 3AV2B 1AOIC 3UTAB 1KX5A 3WKJA 3MVDC 1M18A 5B0ZA 3RELB 5AY8A 4HGAC 1ZLAB 4H9QB 2YFWB 1F66A 1ID3B 4X23B 3W98B 3AZFC 1M19C 4QLCB 5B0YD 4WU8B 4G92B 4XUJD 3A6NC 3AZNA 2FJ7D 4KGCD 3X1SA 1U35B 5GXQA 3LZ0D 3W96A 1KX5C 3WKJC 1M18C 2CWEA 5JRGC 5B0ZC 5AY8C 3REKC 3UT9B 3NQUA 3WA9B 1F1EA 1KX3A 5B2JD 4WV4B 5C3IB 5B1MB 4XUJB 1P3GD 4ZUXA 2FJ7B 3AZJC 3AZNC 1BH8A 3LZ0B 5GXQC 5JA4B 1HQ3A 2CV5D 5AV6C 1EQZA 4NE6A 4CAYA 4R8PA 1KX3C 3UTBA 3AV2C 3UTAC 1B67A 3C1BC 1M1AC 3AZHA 4KHAA 1TAFB 5FUGA 3B0CW 3KXBC 4KUDD 4EO5B 3WTPC 5CP6D 3B0CT 4WNNB 4J8WD 4J8UB 5AV9A 4Z66C 1A7WA 4G92C 3KWQA 4KGCA 1P34D 2F8NH 3LZ1B 3AZEA 3REHB 5GT3D 3MGQA 3MGRD 2NZDA 4YM6A 2LY8A 5GSUD 3KUYA 5CP6B 5B1LD 1H3OA 5B0YC 3AN2D 4NFTA 1P34B 2FJ7C 1S32D 4KGCC 1Q9CA 5GT3B 3MGRB 3AZEC 3B6FD 1N1JA 4WZSB 2L5AA 1P3BA 3MGPA 5B2JC 3REJD 5B1LB
chains in the Genus database with same CATH superfamily
3AZLB 1P3IA 3LJAD 5AVCD 4E44A 2JE5A 4J8XD 5CPJD 1P3GC 2BYKB 5AV8D 3X1VB 3AV1D 2NQBB 4XZQA 5B31A 3AZKD 3B6FB 1P3LD 2RIQA 3H0RC 4EO5C 3REIA 2CV5C 4G91B 4J8WA 1P3KD 3X1UD 3REJB 2XD1A 3TU4A 2BG1A 5DNMA 3LJAB 5AVCB 4J8XB 3AV1B 2RVQD 4XZQC 3C1CD 3O62B 4LD9A 4WU9A 4KUDC 5CP6C 1P3KB 3X1UB 4J8WC 4Z5TD 3KSYA 3EG5B 2AROD 3MNND 4NE3A 4AWLC 3AZMD 5GT0B 1P3MA 5DNMC 3MVDA 3AYWD 5CPID 3W99A 1BFMA 3RELD 5GT3C 5B2ID 2IO5B 3AZFA 1ID3D 4X23D 5GSUC 3W98D 5CPIA 5AVBD 3X1TB 3MNNB 3AZMB 2AROB 4WU8D 4H9PA 5BO0B 3AN2C 5F99D 1P3MC 3AYWB 1S32C 1U35D 3W99C 5JRGA 3AZKA 5B2IB 3REKA 2YFVA 3UT9D 4H9NA 1P3LA 3B0DB 2HUEB 3WA9D 5AVBB 5CPIC 5B1MD 1ULYA 3AZJA 5F99B 5CPJC 2HIOD 5AV8C 1R4VA 5BNXA 1HTAA 3AZKC 3NQJA 4CSRA 1P3LC 1TZYD 5AV6A 4ZUXB 2DQNC 3AV2A 4DQYB 3WAAD 2G5IC 3UTAA 3C1BA 1M1AA 2HIOB 1HQ3B 1EQZB 3A1IA 4UUZA 1ZLAA 4H9QA 2RVQC 4R8PB 2IO5C 3C1CC 2YFWA 3KXBA 2F8NA 3UTBB 3WTPA 3W98A 3AZGD 1TZYB 4J8VD 4QLCA 3AZHB 4Z66A 4Z5TC 4J8UD 3KFUG 3MNNC 3WAAB 2AROC 4YS3D 1P3AD 5FUGB 1P3OD 1P3PD 3LZ1D 3RELC 3REHD 5B2IC 3UT9A 1ZLAC 5AV9B 5B33D 3AZGB 3KWQB 1ID3C 4X23C 3W98C 4J8VB 3R45A 5B0YA 4QLCC 3MGQB 4XUJA 2NZDB 4WU8C 2FFFB 4YM6B 4YS3B 1P3AB 2FJ7A 1P3OB 2F8NK 3AL0C 3LZ0A 1P3PB 3KUYB 5KDMA 1U35C 4H9OA 4H9RB 5CHLB 1H3OB 5JA4A 3UT9C 3AZID 3W97D 5B33B 3LELB 5B2JA 5CPKD 5DNND 3WA9C 5B32D 3V9RA 5C3IC 3AZLD 2PYOB 1P3GA 5B1MC 5B40D 4XUJC 2BYMA 2Y2OA 3X1VD 2NQBD 5B32G 5BS7C 4ZBJB 3MGPB 3LZ0C 3VH5T 1TAFA 5AV5D 5B24D 2Y2GA 1P3IB 3AZIB 3W97B 2CV5A 5BT1D 1TZYC 3MGSB 3IP4C 4WNNA 5CPKB 5DNNB 5B32B 4J8UA 2XD5A 1KX4D 5B40B 4NE5A 4DRBA 3B6GD 1P3FB 5AV5B 3VH6T 5B24B 3O62D 3TU4B 4KUDA 5CP6A 1BH9B 5G49B 4J8UC 1KX4B 4M6BA 5GT0D 1P3AC 1P34A 2JSSA 1P3OC 3B6GB 2G5HC 3LZ1C 5GT3A 3MGRA 3REHC 4JJND 3A6ND 1AOIB 5E5AD 5GSUA 5B33C 1Z2CB 3MVDB 1KX5D 5B1LA 2J8PA 3X1TD 4HGAB 5B0ZD 3AZLA 1M18D 5AY8D 3AN2A 2BYKA 1S32A 1P34C 1F66D 1M19B 3B6FA 3MGRC 1WWIA 1JFIB 4JJNB 3A6NB 3B0BA 3AZIC 5E5AB 5BNVA 4WJ3C 3AZND 1KX5B 3X1SD 5DNNC 3REJA 3WKJB 1M18B 3EPKA 5B0ZB 5JRGB 3W96D 5B1LC 5AY8B 3LJAA 5AVCA 3AZLC 4J8XA 5CPJA 2YFVB 5B40C 5AV8A 3AV1A 3X1VC 1F66B 2NQBC 5AV5C 3B6FC 5B24C 1T3UA 5BT1C 3AZNB 3P5JB 4ZUXD 3AZJB 1P3KA 3X1UA 4G91C 3X1SB 5GXQB 3REJC 3W96B 5GT0A 3LJAC 5AVCC 4J8XC 5AV6B 3AV1C 1HQ3D 3NQUB 1EQZD 1KX3B 3C1CA 4R8PD 3O62C 2Y2KA 3UTBD 3C1BB 1M1AB 3X1TA 4Z5TA 1BH8B 1P3KC 3X1UC 3AZHD 3MNNA 3AZMA 2AROA 4UUZB 5BO0A 5GT0C 3KXBB 3AYWA 2F8NB 3WTPB 3RELA 5B2IA 4CAYB 4Z66B 5AV9D 4JJNC 1ID3A 4X23A 5E5AC 3KWQD 5AVBA 4DRAA 3X1TC 3AZED 4WU8A 3MGQD 4KHAB 3AZMC 2NZDD 5F99A 4YM6D 4E45A 3AYWC 1U35A 3WTPE 1F66C 3VH5A 3KUYD 3R45B 5B0YB 1PZRA 3WA9A 2ZY2A 3B0DC 4KGCB 3LELD 2HUEC 5AVBC 3X1SC 5KDMB 3AZEB 3W96C 5B1MA 2PYOD 4H9OB 2HIOA 5F99C 5BS7A 1P3BD 2ZY4A 5B2JB 3VH6A 3MGPD 3AFAD 3V9RB 1P3ID 1TZYA 1P3GB 2BYMB 3MGSD 4ZUXC 3F6TA 2W8SA 4XZQD 3WAAA 5B31D 1N1JB 3H0LC 3VH5W 2ZY3A 2HIOC 2CV5B 1P3BB 3REID 1HQ3C 4Z2MG 1P3FD 1EQZC 5B31G 3AFAB 4R8PC 3EPJA 3TU4D 2ZY5A 3AZGA 3UTBC 5DNMD 4J8VA 3AZHC 4XZQB 5B31B 4YS3A 3FDDA 1P3AA 3WAAC 4LD9D 1P3OA 4KUDB 4WU9D 1P3PA 3LZ1A 3VH6W 3REHA 3REIB 4J8WB 4H9RA 2Y2JA 4AWLB 5B33A 1AOID 5AV9C 5DNMB 1P3MD 3LELA 3AZGC 1WWSA 3KWQC 3MVDD 3W99D 4J8VC 2PYOA 3MGQC 2NZDC 3EPLA 4LD9B 2F2AC 4YM6C 4YS3C 4WU9B 5GSUB 3AZFD 1P3PC 1M19D 3KUYC 3AZIA 3W97A 4H9SA 3AN2B 1P3MB 3MGSA 5CPKA 5DNNA 1S32B 1B6WA 5B32A 3LELC 3W99B 3WKJD 5JRGD 2PYOC 3AFAA 5B40A 3REKD 3H0MC 3X1VA 2NQBA 5BNVB 3AZFB 1P3BC 1P3FA 2VQRA 2Y2IA 4ZBJC 5AV5A 5B24A 3MGPC 3A1KA 5CPIB 3AFAC 2Y2LA 1P3IC 3W97C 4H9PB 4H9SC 5CPJB 5AV8B 3AZJD 1BH9A 3MGSC 1W2EA 5G49A 5CPKC 5B32C 5GXQD 1KX4A 3AZKB 5B31C 3REKB 1P3LB 4H9NB 3B6GA 5AV6D 3REIC 1P3FC 1KX3D 3O62A 1AOIA 2Y2HA 4Z2MH 3TU4C 3AV2D 3UTAD 3C1BD 1M1AD 5BNXB 1ZLAD 3C1CB 1KU5A 1KX4C 4LD9C 3KXBD 2F8ND 3NQJB 4WU9C 4CSRB 3WTPD 1M19A 3B6GC 4Z5TB 4QLCD 1JFIA 4JJNA 4Z66D 3A6NA 2F8NG 5E5AA 3AV2B 1AOIC 3UTAB 1KX5A 3WKJA 3MVDC 1M18A 5B0ZA 3RELB 5AY8A 4HGAC 1ZLAB 4H9QB 2YFWB 1F66A 1ID3B 4X23B 3W98B 3AZFC 1M19C 4QLCB 5B0YD 4WU8B 4G92B 4XUJD 3A6NC 3AZNA 2FJ7D 4KGCD 3X1SA 1U35B 5GXQA 3LZ0D 3W96A 1KX5C 3WKJC 1M18C 2CWEA 5JRGC 5B0ZC 5AY8C 3REKC 3UT9B 3NQUA 3WA9B 1F1EA 1KX3A 5B2JD 4WV4B 5C3IB 5B1MB 4XUJB 1P3GD 4ZUXA 2FJ7B 3AZJC 3AZNC 1BH8A 3LZ0B 2DF4C 5GXQC 5JA4B 1HQ3A 2CV5D 5AV6C 1EQZA 4NE6A 2ZM5A 4CAYA 4R8PA 1KX3C 3UTBA 3EPHA 3AV2C 3UTAC 1B67A 3C1BC 1M1AC 3AZHA 2Y2NA 2JCHA 4KHAA 1TAFB 5FUGA 2Y2QA 3B0CW 3KXBC 4UPKA 4KUDD 4EO5B 3WTPC 5CP6D 3B0CT 4WNNB 4J8WD 4J8UB 5AV9A 4Z66C 2UWXA 1A7WA 4G92C 3KWQA 4KGCA 1P34D 2F8NH 2Y2MA 3LZ1B 3AZEA 3REHB 5GT3D 3MGQA 3MGRD 2NZDA 4YM6A 2LY8A 5GSUD 3KUYA 5CP6B 5B1LD 1H3OA 5B0YC 3AN2D 4NFTA 1P34B 2Y2PA 2FJ7C 1S32D 4KGCC 1Q9CA 5GT3B 3MGRB 3AZEC 3B6FD 1N1JA 4WZSB 2L5AA 1P3BA 3MGPA 5B2JC 3REJD 5B1LB
chains in the Genus database with same CATH topology
3AZLB 1P3IA 3LJAD 5AVCD 4E44A 2JE5A 4J8XD 5CPJD 1P3GC 2BYKB 5AV8D 3X1VB 3AV1D 2NQBB 4XZQA 5B31A 3AZKD 3B6FB 1P3LD 2RIQA 3H0RC 4EO5C 3REIA 2CV5C 4G91B 4J8WA 1P3KD 3X1UD 3REJB 2XD1A 3TU4A 2BG1A 5DNMA 3LJAB 5AVCB 4J8XB 3AV1B 2RVQD 4XZQC 3C1CD 3O62B 4LD9A 4WU9A 4KUDC 5CP6C 1P3KB 3X1UB 4J8WC 4Z5TD 3KSYA 3EG5B 2AROD 3MNND 4NE3A 4AWLC 3AZMD 5GT0B 1P3MA 5DNMC 3MVDA 3AYWD 5CPID 3W99A 1BFMA 3RELD 5GT3C 5B2ID 2IO5B 3AZFA 1ID3D 4X23D 5GSUC 3W98D 5CPIA 5AVBD 3X1TB 3MNNB 3AZMB 2AROB 4WU8D 4H9PA 5BO0B 3AN2C 5F99D 1P3MC 3AYWB 1S32C 1U35D 3W99C 5JRGA 3AZKA 5B2IB 3REKA 2YFVA 3UT9D 4H9NA 1P3LA 3B0DB 2HUEB 3WA9D 5AVBB 5CPIC 5B1MD 1ULYA 3AZJA 5F99B 5CPJC 2HIOD 5AV8C 1R4VA 5BNXA 1HTAA 3AZKC 3NQJA 4CSRA 1P3LC 1TZYD 5AV6A 4ZUXB 2DQNC 3AV2A 4DQYB 3WAAD 2G5IC 3UTAA 3C1BA 1M1AA 2HIOB 1HQ3B 1EQZB 3A1IA 4UUZA 1ZLAA 4H9QA 2RVQC 4R8PB 2IO5C 3C1CC 2YFWA 3KXBA 2F8NA 3UTBB 3WTPA 3W98A 3AZGD 1TZYB 4J8VD 4QLCA 3AZHB 4Z66A 4Z5TC 4J8UD 3KFUG 3MNNC 3WAAB 2AROC 4YS3D 1P3AD 5FUGB 1P3OD 1P3PD 3LZ1D 3RELC 3REHD 5B2IC 3UT9A 1ZLAC 5AV9B 5B33D 3AZGB 3KWQB 1ID3C 4X23C 3W98C 4J8VB 3R45A 5B0YA 4QLCC 3MGQB 4XUJA 2NZDB 4WU8C 2FFFB 4YM6B 4YS3B 1P3AB 2FJ7A 1P3OB 2F8NK 3AL0C 3LZ0A 1P3PB 3KUYB 5KDMA 1U35C 4H9OA 4H9RB 5CHLB 1H3OB 5JA4A 3UT9C 3AZID 3W97D 5B33B 3LELB 5B2JA 5CPKD 5DNND 3WA9C 5B32D 3V9RA 5C3IC 3AZLD 2PYOB 1P3GA 5B1MC 5B40D 4XUJC 2BYMA 2Y2OA 3X1VD 2NQBD 5B32G 5BS7C 4ZBJB 3MGPB 3LZ0C 3VH5T 1TAFA 5AV5D 5B24D 2Y2GA 1P3IB 3AZIB 3W97B 2CV5A 5BT1D 1TZYC 3MGSB 3IP4C 4WNNA 5CPKB 5DNNB 5B32B 4J8UA 2XD5A 1KX4D 5B40B 4NE5A 4DRBA 3B6GD 1P3FB 5AV5B 3VH6T 5B24B 3O62D 3TU4B 4KUDA 5CP6A 1BH9B 5G49B 4J8UC 1KX4B 4M6BA 5GT0D 1P3AC 1P34A 2JSSA 1P3OC 3B6GB 2G5HC 3LZ1C 5GT3A 3MGRA 3REHC 4JJND 3A6ND 1AOIB 5E5AD 5GSUA 5B33C 1Z2CB 3MVDB 1KX5D 5B1LA 2J8PA 3X1TD 4HGAB 5B0ZD 3AZLA 1M18D 5AY8D 3AN2A 2BYKA 1S32A 1P34C 1F66D 1M19B 3B6FA 3MGRC 1WWIA 1JFIB 4JJNB 3A6NB 3B0BA 3AZIC 5E5AB 5BNVA 4WJ3C 3AZND 1KX5B 3X1SD 5DNNC 3REJA 3WKJB 1M18B 3EPKA 5B0ZB 5JRGB 3W96D 5B1LC 5AY8B 3LJAA 5AVCA 3AZLC 4J8XA 5CPJA 2YFVB 5B40C 5AV8A 3AV1A 3X1VC 1F66B 2NQBC 5AV5C 3B6FC 5B24C 1T3UA 5BT1C 3AZNB 3P5JB 4ZUXD 3AZJB 1P3KA 3X1UA 4G91C 3X1SB 5GXQB 3REJC 3W96B 5GT0A 3LJAC 5AVCC 4J8XC 5AV6B 3AV1C 1HQ3D 3NQUB 1EQZD 1KX3B 3C1CA 4R8PD 3O62C 2Y2KA 3UTBD 3C1BB 1M1AB 3X1TA 4Z5TA 1BH8B 1P3KC 3X1UC 3AZHD 3MNNA 3AZMA 2AROA 4UUZB 5BO0A 5GT0C 3KXBB 3AYWA 2F8NB 3WTPB 3RELA 5B2IA 4CAYB 4Z66B 5AV9D 4JJNC 1ID3A 4X23A 5E5AC 3KWQD 5AVBA 4DRAA 3X1TC 3AZED 4WU8A 3MGQD 4KHAB 3AZMC 2NZDD 5F99A 4YM6D 4E45A 3AYWC 1U35A 3WTPE 1F66C 3VH5A 3KUYD 3R45B 5B0YB 1PZRA 3WA9A 2ZY2A 3B0DC 4KGCB 3LELD 2HUEC 5AVBC 3X1SC 5KDMB 3AZEB 3W96C 5B1MA 2PYOD 4H9OB 2HIOA 5F99C 5BS7A 1P3BD 2ZY4A 5B2JB 3VH6A 3MGPD 3AFAD 3V9RB 1P3ID 1TZYA 1P3GB 2BYMB 3MGSD 4ZUXC 3F6TA 2W8SA 4XZQD 3WAAA 5B31D 1N1JB 3H0LC 3VH5W 2ZY3A 2HIOC 2CV5B 1P3BB 3REID 1HQ3C 4Z2MG 1P3FD 1EQZC 5B31G 3AFAB 4R8PC 3EPJA 3TU4D 2ZY5A 3AZGA 3UTBC 5DNMD 4J8VA 3AZHC 4XZQB 5B31B 4YS3A 3FDDA 1P3AA 3WAAC 4LD9D 1P3OA 4KUDB 4WU9D 1P3PA 3LZ1A 3VH6W 3REHA 3REIB 4J8WB 4H9RA 2Y2JA 4AWLB 5B33A 1AOID 5AV9C 5DNMB 1P3MD 3LELA 3AZGC 1WWSA 3KWQC 3MVDD 3W99D 4J8VC 2PYOA 3MGQC 2NZDC 3EPLA 4LD9B 2F2AC 4YM6C 4YS3C 4WU9B 5GSUB 3AZFD 1P3PC 1M19D 3KUYC 3AZIA 3W97A 4H9SA 3AN2B 1P3MB 3MGSA 5CPKA 5DNNA 1S32B 1B6WA 5B32A 3LELC 3W99B 3WKJD 5JRGD 2PYOC 3AFAA 5B40A 3REKD 3H0MC 3X1VA 2NQBA 5BNVB 3AZFB 1P3BC 1P3FA 2VQRA 2Y2IA 4ZBJC 5AV5A 5B24A 3MGPC 3A1KA 5CPIB 3AFAC 2Y2LA 1P3IC 3W97C 4H9PB 4H9SC 5CPJB 5AV8B 3AZJD 1BH9A 3MGSC 1W2EA 5G49A 5CPKC 5B32C 5GXQD 1KX4A 3AZKB 5B31C 3REKB 1P3LB 4H9NB 3B6GA 5AV6D 3REIC 1P3FC 1KX3D 3O62A 1AOIA 2Y2HA 4Z2MH 3TU4C 3AV2D 3UTAD 3C1BD 1M1AD 5BNXB 1ZLAD 3C1CB 1KU5A 1KX4C 4LD9C 3KXBD 2F8ND 3NQJB 4WU9C 4CSRB 3WTPD 1M19A 3B6GC 4Z5TB 4QLCD 1JFIA 4JJNA 4Z66D 3A6NA 2F8NG 5E5AA 3AV2B 1AOIC 3UTAB 1KX5A 3WKJA 3MVDC 1M18A 5B0ZA 3RELB 5AY8A 4HGAC 1ZLAB 4H9QB 2YFWB 1F66A 1ID3B 4X23B 3W98B 3AZFC 1M19C 4QLCB 5B0YD 4WU8B 4G92B 4XUJD 3A6NC 3AZNA 2FJ7D 4KGCD 3X1SA 1U35B 5GXQA 3LZ0D 3W96A 1KX5C 3WKJC 1M18C 2CWEA 5JRGC 5B0ZC 5AY8C 3REKC 3UT9B 3NQUA 3WA9B 1F1EA 1KX3A 5B2JD 4WV4B 5C3IB 5B1MB 4XUJB 1P3GD 4ZUXA 2FJ7B 3AZJC 3AZNC 1BH8A 3LZ0B 2DF4C 5GXQC 5JA4B 1HQ3A 2CV5D 5AV6C 1EQZA 4NE6A 2ZM5A 4CAYA 4R8PA 1KX3C 3UTBA 3EPHA 3AV2C 3UTAC 1B67A 3C1BC 1M1AC 3AZHA 2Y2NA 2JCHA 4KHAA 1TAFB 5FUGA 2Y2QA 3B0CW 3KXBC 4UPKA 4KUDD 4EO5B 3WTPC 5CP6D 3B0CT 4WNNB 4J8WD 4J8UB 5AV9A 4Z66C 2UWXA 1A7WA 4G92C 3KWQA 4KGCA 1P34D 2F8NH 2Y2MA 3LZ1B 3AZEA 3REHB 5GT3D 3MGQA 3MGRD 2NZDA 4YM6A 2LY8A 5GSUD 3KUYA 5CP6B 5B1LD 1H3OA 5B0YC 3AN2D 4NFTA 1P34B 2Y2PA 2FJ7C 1S32D 4KGCC 1Q9CA 5GT3B 3MGRB 3AZEC 3B6FD 1N1JA 4WZSB 2L5AA 1P3BA 3MGPA 5B2JC 3REJD 5B1LB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AZL B;  1P3I A;  3LJA D;  5AVC D;  4E44 A;  4J8X D;  5CPJ D;  1P3G C;  2BYK B;  5AV8 D;  3X1V B;  3AV1 D;  2NQB B;  4XZQ A;  5B31 A;  3AZK D;  3B6F B;  1P3L D;  4EO5 C;  3REI A;  2CV5 C;  4G91 B;  4J8W A;  1P3K D;  3X1U D;  3REJ B;  3TU4 A;  5DNM A;  3LJA B;  5AVC B;  4J8X B;  3AV1 B;  2RVQ D;  4XZQ C;  3C1C D;  3O62 B;  4LD9 A;  4WU9 A;  4KUD C;  5CP6 C;  1P3K B;  3X1U B;  4J8W C;  4Z5T D;  3KSY A;  3MNN D;  2ARO D;  4AWL C;  4NE3 A;  3AZM D;  1P3M A;  5GT0 B;  5DNM C;  3MVD A;  3AYW D;  5CPI D;  3W99 A;  1BFM A;  3REL D;  5GT3 C;  5B2I D;  2IO5 B;  3AZF A;  1ID3 D;  4X23 D;  5GSU C;  3W98 D;  5CPI A;  5AVB D;  3X1T B;  3MNN B;  3AZM B;  2ARO B;  4WU8 D;  4H9P A;  5BO0 B;  3AN2 C;  5F99 D;  1P3M C;  3AYW B;  1S32 C;  1U35 D;  3W99 C;  5JRG A;  3AZK A;  5B2I B;  3REK A;  2YFV A;  3UT9 D;  4H9N A;  1P3L A;  3B0D B;  2HUE B;  3WA9 D;  5AVB B;  5CPI C;  5B1M D;  1ULY A;  3AZJ A;  5F99 B;  5CPJ C;  2HIO D;  5AV8 C;  1R4V A;  5BNX A;  1HTA A;  3AZK C;  3NQJ A;  4CSR A;  1P3L C;  1TZY D;  5AV6 A;  4ZUX B;  3AV2 A;  3WAA D;  3UTA A;  3C1B A;  1M1A A;  2HIO B;  1HQ3 B;  1EQZ B;  4UUZ A;  1ZLA A;  4H9Q A;  2RVQ C;  4R8P B;  2IO5 C;  3C1C C;  2YFW A;  3KXB A;  2F8N A;  3UTB B;  3WTP A;  3W98 A;  3AZG D;  1TZY B;  4J8V D;  4QLC A;  3AZH B;  4Z66 A;  4Z5T C;  4J8U D;  3MNN C;  3WAA B;  2ARO C;  4YS3 D;  1P3A D;  5FUG B;  1P3O D;  1P3P D;  3LZ1 D;  3REL C;  3REH D;  5B2I C;  3UT9 A;  1ZLA C;  5AV9 B;  5B33 D;  3AZG B;  3KWQ B;  1ID3 C;  4X23 C;  3W98 C;  4J8V B;  3R45 A;  5B0Y A;  4QLC C;  3MGQ B;  4XUJ A;  2NZD B;  4WU8 C;  4YM6 B;  4YS3 B;  1P3A B;  2FJ7 A;  1P3O B;  2F8N K;  3LZ0 A;  1P3P B;  3KUY B;  5KDM A;  1U35 C;  4H9O A;  4H9R B;  5CHL B;  1H3O B;  5JA4 A;  3UT9 C;  3AZI D;  3W97 D;  5B33 B;  3LEL B;  5B2J A;  5CPK D;  5DNN D;  3WA9 C;  5B32 D;  3V9R A;  5C3I C;  3AZL D;  2PYO B;  1P3G A;  5B1M C;  5B40 D;  4XUJ C;  2BYM A;  3X1V D;  2NQB D;  5B32 G;  5BS7 C;  4ZBJ B;  3MGP B;  3LZ0 C;  3VH5 T;  1TAF A;  5AV5 D;  5B24 D;  1P3I B;  3AZI B;  3W97 B;  2CV5 A;  5BT1 D;  1TZY C;  3MGS B;  4WNN A;  5CPK B;  5DNN B;  5B32 B;  4J8U A;  1KX4 D;  5B40 B;  4NE5 A;  4DRB A;  3B6G D;  1P3F B;  5AV5 B;  3VH6 T;  5B24 B;  3O62 D;  3TU4 B;  4KUD A;  5CP6 A;  1BH9 B;  5G49 B;  4J8U C;  1KX4 B;  4M6B A;  5GT0 D;  1P3A C;  1P34 A;  2JSS A;  1P3O C;  3B6G B;  3LZ1 C;  5GT3 A;  3MGR A;  3REH C;  4JJN D;  3A6N D;  1AOI B;  5E5A D;  5GSU A;  5B33 C;  3MVD B;  1KX5 D;  5B1L A;  3X1T D;  1M18 D;  4HGA B;  5B0Z D;  3AZL A;  5AY8 D;  3AN2 A;  2BYK A;  1S32 A;  1P34 C;  1F66 D;  1M19 B;  3B6F A;  3MGR C;  1WWI A;  1JFI B;  4JJN B;  3A6N B;  3B0B A;  3AZI C;  5E5A B;  5BNV A;  3AZN D;  1KX5 B;  3X1S D;  5DNN C;  3REJ A;  3WKJ B;  1M18 B;  5B0Z B;  5JRG B;  3W96 D;  5B1L C;  5AY8 B;  3LJA A;  5AVC A;  3AZL C;  4J8X A;  5CPJ A;  2YFV B;  5B40 C;  5AV8 A;  3AV1 A;  3X1V C;  1F66 B;  2NQB C;  5AV5 C;  3B6F C;  5B24 C;  5BT1 C;  3AZN B;  3AZJ B;  4ZUX D;  1P3K A;  3X1U A;  4G91 C;  3X1S B;  5GXQ B;  3REJ C;  3W96 B;  5GT0 A;  3LJA C;  5AVC C;  4J8X C;  5AV6 B;  3AV1 C;  1HQ3 D;  3NQU B;  1EQZ D;  1KX3 B;  3C1C A;  4R8P D;  3O62 C;  3UTB D;  3C1B B;  1M1A B;  3X1T A;  4Z5T A;  1BH8 B;  1P3K C;  3X1U C;  3AZH D;  3MNN A;  3AZM A;  2ARO A;  4UUZ B;  5BO0 A;  5GT0 C;  3KXB B;  3AYW A;  2F8N B;  3WTP B;  3REL A;  5B2I A;  4CAY B;  4Z66 B;  5AV9 D;  4JJN C;  1ID3 A;  4X23 A;  5E5A C;  3KWQ D;  5AVB A;  4DRA A;  3X1T C;  3AZE D;  4WU8 A;  3MGQ D;  4KHA B;  3AZM C;  2NZD D;  5F99 A;  4YM6 D;  4E45 A;  3AYW C;  1U35 A;  3WTP E;  1F66 C;  3VH5 A;  3KUY D;  3R45 B;  5B0Y B;  3WA9 A;  3B0D C;  4KGC B;  3LEL D;  2HUE C;  5AVB C;  3X1S C;  5KDM B;  3AZE B;  3W96 C;  5B1M A;  2PYO D;  4H9O B;  2HIO A;  5F99 C;  5BS7 A;  1P3B D;  5B2J B;  3MGP D;  3VH6 A;  3AFA D;  3V9R B;  1P3I D;  1TZY A;  1P3G B;  2BYM B;  3MGS D;  4ZUX C;  4XZQ D;  3WAA A;  5B31 D;  1N1J B;  3VH5 W;  2CV5 B;  2HIO C;  1P3B B;  3REI D;  1HQ3 C;  4Z2M G;  1P3F D;  1EQZ C;  5B31 G;  3AFA B;  4R8P C;  3TU4 D;  3AZG A;  3UTB C;  5DNM D;  4J8V A;  3AZH C;  4XZQ B;  5B31 B;  4YS3 A;  1P3A A;  3WAA C;  4LD9 D;  1P3O A;  4KUD B;  4WU9 D;  1P3P A;  3LZ1 A;  3VH6 W;  3REH A;  3REI B;  4J8W B;  4H9R A;  4AWL B;  5B33 A;  1AOI D;  5AV9 C;  5DNM B;  1P3M D;  3LEL A;  3AZG C;  1WWS A;  3KWQ C;  3MVD D;  3W99 D;  4J8V C;  2PYO A;  3MGQ C;  2NZD C;  4LD9 B;  4YM6 C;  4YS3 C;  4WU9 B;  5GSU B;  3AZF D;  1P3P C;  1M19 D;  3KUY C;  3AZI A;  3W97 A;  4H9S A;  3AN2 B;  1P3M B;  3MGS A;  5CPK A;  5DNN A;  1S32 B;  1B6W A;  5B32 A;  3LEL C;  3W99 B;  3WKJ D;  5JRG D;  2PYO C;  3AFA A;  5B40 A;  3REK D;  3X1V A;  2NQB A;  5BNV B;  3AZF B;  1P3B C;  1P3F A;  4ZBJ C;  5AV5 A;  3MGP C;  5CPI B;  5B24 A;  3AFA C;  1P3I C;  3W97 C;  4H9P B;  4H9S C;  5CPJ B;  5AV8 B;  3AZJ D;  1BH9 A;  3MGS C;  5G49 A;  5CPK C;  5B32 C;  5GXQ D;  1KX4 A;  3AZK B;  5B31 C;  3REK B;  1P3L B;  4H9N B;  3B6G A;  5AV6 D;  3REI C;  1P3F C;  1KX3 D;  3O62 A;  1AOI A;  4Z2M H;  3TU4 C;  3AV2 D;  3UTA D;  3C1B D;  1M1A D;  5BNX B;  1ZLA D;  3C1C B;  1KU5 A;  1KX4 C;  4LD9 C;  3KXB D;  2F8N D;  3NQJ B;  4WU9 C;  4CSR B;  3WTP D;  1M19 A;  3B6G C;  4Z5T B;  4QLC D;  1JFI A;  4JJN A;  4Z66 D;  3A6N A;  2F8N G;  5E5A A;  3AV2 B;  1AOI C;  3UTA B;  1KX5 A;  3WKJ A;  3MVD C;  1M18 A;  5B0Z A;  3REL B;  5AY8 A;  4HGA C;  1ZLA B;  4H9Q B;  2YFW B;  1F66 A;  1ID3 B;  4X23 B;  3W98 B;  3AZF C;  1M19 C;  4QLC B;  5B0Y D;  4WU8 B;  4G92 B;  4XUJ D;  3A6N C;  3AZN A;  2FJ7 D;  4KGC D;  3X1S A;  1U35 B;  5GXQ A;  3LZ0 D;  3W96 A;  1KX5 C;  3WKJ C;  1M18 C;  2CWE A;  5JRG C;  5B0Z C;  5AY8 C;  3REK C;  3UT9 B;  3NQU A;  3WA9 B;  1F1E A;  1KX3 A;  5B2J D;  4WV4 B;  5C3I B;  5B1M B;  4XUJ B;  1P3G D;  4ZUX A;  2FJ7 B;  3AZJ C;  3AZN C;  1BH8 A;  3LZ0 B;  5GXQ C;  5JA4 B;  1HQ3 A;  2CV5 D;  5AV6 C;  1EQZ A;  4NE6 A;  4CAY A;  4R8P A;  1KX3 C;  3UTB A;  3AV2 C;  3UTA C;  1B67 A;  3C1B C;  1M1A C;  3AZH A;  4KHA A;  1TAF B;  5FUG A;  3B0C W;  3KXB C;  4KUD D;  4EO5 B;  3WTP C;  5CP6 D;  3B0C T;  4WNN B;  4J8W D;  4J8U B;  5AV9 A;  4Z66 C;  1A7W A;  4G92 C;  3KWQ A;  4KGC A;  1P34 D;  2F8N H;  3LZ1 B;  3AZE A;  3REH B;  5GT3 D;  3MGQ A;  3MGR D;  2NZD A;  4YM6 A;  2LY8 A;  5GSU D;  3KUY A;  5CP6 B;  5B1L D;  1H3O A;  5B0Y C;  3AN2 D;  4NFT A;  1P34 B;  2FJ7 C;  1S32 D;  4KGC C;  1Q9C A;  5GT3 B;  3MGR B;  3AZE C;  3B6F D;  1N1J A;  4WZS B;  2L5A A;  1P3B A;  3MGP A;  5B2J C;  3REJ D;  5B1L B; 
#chains in the Genus database with same CATH topology
 3AZL B;  1P3I A;  3LJA D;  5AVC D;  4E44 A;  2JE5 A;  4J8X D;  5CPJ D;  1P3G C;  2BYK B;  5AV8 D;  3X1V B;  3AV1 D;  2NQB B;  4XZQ A;  5B31 A;  3AZK D;  3B6F B;  1P3L D;  2RIQ A;  3H0R C;  4EO5 C;  3REI A;  2CV5 C;  4G91 B;  4J8W A;  1P3K D;  3X1U D;  3REJ B;  2XD1 A;  3TU4 A;  2BG1 A;  5DNM A;  3LJA B;  5AVC B;  4J8X B;  3AV1 B;  2RVQ D;  4XZQ C;  3C1C D;  3O62 B;  4LD9 A;  4WU9 A;  4KUD C;  5CP6 C;  1P3K B;  3X1U B;  4J8W C;  4Z5T D;  3KSY A;  3EG5 B;  2ARO D;  3MNN D;  4NE3 A;  4AWL C;  3AZM D;  5GT0 B;  1P3M A;  5DNM C;  3MVD A;  3AYW D;  5CPI D;  3W99 A;  1BFM A;  3REL D;  5GT3 C;  5B2I D;  2IO5 B;  3AZF A;  1ID3 D;  4X23 D;  5GSU C;  3W98 D;  5CPI A;  5AVB D;  3X1T B;  3MNN B;  3AZM B;  2ARO B;  4WU8 D;  4H9P A;  5BO0 B;  3AN2 C;  5F99 D;  1P3M C;  3AYW B;  1S32 C;  1U35 D;  3W99 C;  5JRG A;  3AZK A;  5B2I B;  3REK A;  2YFV A;  3UT9 D;  4H9N A;  1P3L A;  3B0D B;  2HUE B;  3WA9 D;  5AVB B;  5CPI C;  5B1M D;  1ULY A;  3AZJ A;  5F99 B;  5CPJ C;  2HIO D;  5AV8 C;  1R4V A;  5BNX A;  1HTA A;  3AZK C;  3NQJ A;  4CSR A;  1P3L C;  1TZY D;  5AV6 A;  4ZUX B;  2DQN C;  3AV2 A;  4DQY B;  3WAA D;  2G5I C;  3UTA A;  3C1B A;  1M1A A;  2HIO B;  1HQ3 B;  1EQZ B;  3A1I A;  4UUZ A;  1ZLA A;  4H9Q A;  2RVQ C;  4R8P B;  2IO5 C;  3C1C C;  2YFW A;  3KXB A;  2F8N A;  3UTB B;  3WTP A;  3W98 A;  3AZG D;  1TZY B;  4J8V D;  4QLC A;  3AZH B;  4Z66 A;  4Z5T C;  4J8U D;  3KFU G;  3MNN C;  3WAA B;  2ARO C;  4YS3 D;  1P3A D;  5FUG B;  1P3O D;  1P3P D;  3LZ1 D;  3REL C;  3REH D;  5B2I C;  3UT9 A;  1ZLA C;  5AV9 B;  5B33 D;  3AZG B;  3KWQ B;  1ID3 C;  4X23 C;  3W98 C;  4J8V B;  3R45 A;  5B0Y A;  4QLC C;  3MGQ B;  4XUJ A;  2NZD B;  4WU8 C;  2FFF B;  4YM6 B;  4YS3 B;  1P3A B;  2FJ7 A;  1P3O B;  2F8N K;  3AL0 C;  3LZ0 A;  1P3P B;  3KUY B;  5KDM A;  1U35 C;  4H9O A;  4H9R B;  5CHL B;  1H3O B;  5JA4 A;  3UT9 C;  3AZI D;  3W97 D;  5B33 B;  3LEL B;  5B2J A;  5CPK D;  5DNN D;  3WA9 C;  5B32 D;  3V9R A;  5C3I C;  3AZL D;  2PYO B;  1P3G A;  5B1M C;  5B40 D;  4XUJ C;  2BYM A;  2Y2O A;  3X1V D;  2NQB D;  5B32 G;  5BS7 C;  4ZBJ B;  3MGP B;  3LZ0 C;  3VH5 T;  1TAF A;  5AV5 D;  5B24 D;  2Y2G A;  1P3I B;  3AZI B;  3W97 B;  2CV5 A;  5BT1 D;  1TZY C;  3MGS B;  3IP4 C;  4WNN A;  5CPK B;  5DNN B;  5B32 B;  4J8U A;  2XD5 A;  1KX4 D;  5B40 B;  4NE5 A;  4DRB A;  3B6G D;  1P3F B;  5AV5 B;  3VH6 T;  5B24 B;  3O62 D;  3TU4 B;  4KUD A;  5CP6 A;  1BH9 B;  5G49 B;  4J8U C;  1KX4 B;  4M6B A;  5GT0 D;  1P3A C;  1P34 A;  2JSS A;  1P3O C;  3B6G B;  2G5H C;  3LZ1 C;  5GT3 A;  3MGR A;  3REH C;  4JJN D;  3A6N D;  1AOI B;  5E5A D;  5GSU A;  5B33 C;  1Z2C B;  3MVD B;  1KX5 D;  5B1L A;  2J8P A;  3X1T D;  4HGA B;  5B0Z D;  3AZL A;  1M18 D;  5AY8 D;  3AN2 A;  2BYK A;  1S32 A;  1P34 C;  1F66 D;  1M19 B;  3B6F A;  3MGR C;  1WWI A;  1JFI B;  4JJN B;  3A6N B;  3B0B A;  3AZI C;  5E5A B;  5BNV A;  4WJ3 C;  3AZN D;  1KX5 B;  3X1S D;  5DNN C;  3REJ A;  3WKJ B;  1M18 B;  3EPK A;  5B0Z B;  5JRG B;  3W96 D;  5B1L C;  5AY8 B;  3LJA A;  5AVC A;  3AZL C;  4J8X A;  5CPJ A;  2YFV B;  5B40 C;  5AV8 A;  3AV1 A;  3X1V C;  1F66 B;  2NQB C;  5AV5 C;  3B6F C;  5B24 C;  1T3U A;  5BT1 C;  3AZN B;  3P5J B;  4ZUX D;  3AZJ B;  1P3K A;  3X1U A;  4G91 C;  3X1S B;  5GXQ B;  3REJ C;  3W96 B;  5GT0 A;  3LJA C;  5AVC C;  4J8X C;  5AV6 B;  3AV1 C;  1HQ3 D;  3NQU B;  1EQZ D;  1KX3 B;  3C1C A;  4R8P D;  3O62 C;  2Y2K A;  3UTB D;  3C1B B;  1M1A B;  3X1T A;  4Z5T A;  1BH8 B;  1P3K C;  3X1U C;  3AZH D;  3MNN A;  3AZM A;  2ARO A;  4UUZ B;  5BO0 A;  5GT0 C;  3KXB B;  3AYW A;  2F8N B;  3WTP B;  3REL A;  5B2I A;  4CAY B;  4Z66 B;  5AV9 D;  4JJN C;  1ID3 A;  4X23 A;  5E5A C;  3KWQ D;  5AVB A;  4DRA A;  3X1T C;  3AZE D;  4WU8 A;  3MGQ D;  4KHA B;  3AZM C;  2NZD D;  5F99 A;  4YM6 D;  4E45 A;  3AYW C;  1U35 A;  3WTP E;  1F66 C;  3VH5 A;  3KUY D;  3R45 B;  5B0Y B;  1PZR A;  3WA9 A;  2ZY2 A;  3B0D C;  4KGC B;  3LEL D;  2HUE C;  5AVB C;  3X1S C;  5KDM B;  3AZE B;  3W96 C;  5B1M A;  2PYO D;  4H9O B;  2HIO A;  5F99 C;  5BS7 A;  1P3B D;  2ZY4 A;  5B2J B;  3VH6 A;  3MGP D;  3AFA D;  3V9R B;  1P3I D;  1TZY A;  1P3G B;  2BYM B;  3MGS D;  4ZUX C;  3F6T A;  2W8S A;  4XZQ D;  3WAA A;  5B31 D;  1N1J B;  3H0L C;  3VH5 W;  2ZY3 A;  2HIO C;  2CV5 B;  1P3B B;  3REI D;  1HQ3 C;  4Z2M G;  1P3F D;  1EQZ C;  5B31 G;  3AFA B;  4R8P C;  3EPJ A;  3TU4 D;  2ZY5 A;  3AZG A;  3UTB C;  5DNM D;  4J8V A;  3AZH C;  4XZQ B;  5B31 B;  4YS3 A;  3FDD A;  1P3A A;  3WAA C;  4LD9 D;  1P3O A;  4KUD B;  4WU9 D;  1P3P A;  3LZ1 A;  3VH6 W;  3REH A;  3REI B;  4J8W B;  4H9R A;  2Y2J A;  4AWL B;  5B33 A;  1AOI D;  5AV9 C;  5DNM B;  1P3M D;  3LEL A;  3AZG C;  1WWS A;  3KWQ C;  3MVD D;  3W99 D;  4J8V C;  2PYO A;  3MGQ C;  2NZD C;  3EPL A;  4LD9 B;  2F2A C;  4YM6 C;  4YS3 C;  4WU9 B;  5GSU B;  3AZF D;  1P3P C;  1M19 D;  3KUY C;  3AZI A;  3W97 A;  4H9S A;  3AN2 B;  1P3M B;  3MGS A;  5CPK A;  5DNN A;  1S32 B;  1B6W A;  5B32 A;  3LEL C;  3W99 B;  3WKJ D;  5JRG D;  2PYO C;  3AFA A;  5B40 A;  3REK D;  3H0M C;  3X1V A;  2NQB A;  5BNV B;  3AZF B;  1P3B C;  1P3F A;  2VQR A;  2Y2I A;  4ZBJ C;  5AV5 A;  5B24 A;  3MGP C;  3A1K A;  5CPI B;  3AFA C;  2Y2L A;  1P3I C;  3W97 C;  4H9P B;  4H9S C;  5CPJ B;  5AV8 B;  3AZJ D;  1BH9 A;  3MGS C;  1W2E A;  5G49 A;  5CPK C;  5B32 C;  5GXQ D;  1KX4 A;  3AZK B;  5B31 C;  3REK B;  1P3L B;  4H9N B;  3B6G A;  5AV6 D;  3REI C;  1P3F C;  1KX3 D;  3O62 A;  1AOI A;  2Y2H A;  4Z2M H;  3TU4 C;  3AV2 D;  3UTA D;  3C1B D;  1M1A D;  5BNX B;  1ZLA D;  3C1C B;  1KU5 A;  1KX4 C;  4LD9 C;  3KXB D;  2F8N D;  3NQJ B;  4WU9 C;  4CSR B;  3WTP D;  1M19 A;  3B6G C;  4Z5T B;  4QLC D;  1JFI A;  4JJN A;  4Z66 D;  3A6N A;  2F8N G;  5E5A A;  3AV2 B;  1AOI C;  3UTA B;  1KX5 A;  3WKJ A;  3MVD C;  1M18 A;  5B0Z A;  3REL B;  5AY8 A;  4HGA C;  1ZLA B;  4H9Q B;  2YFW B;  1F66 A;  1ID3 B;  4X23 B;  3W98 B;  3AZF C;  1M19 C;  4QLC B;  5B0Y D;  4WU8 B;  4G92 B;  4XUJ D;  3A6N C;  3AZN A;  2FJ7 D;  4KGC D;  3X1S A;  1U35 B;  5GXQ A;  3LZ0 D;  3W96 A;  1KX5 C;  3WKJ C;  1M18 C;  2CWE A;  5JRG C;  5B0Z C;  5AY8 C;  3REK C;  3UT9 B;  3NQU A;  3WA9 B;  1F1E A;  1KX3 A;  5B2J D;  4WV4 B;  5C3I B;  5B1M B;  4XUJ B;  1P3G D;  4ZUX A;  2FJ7 B;  3AZJ C;  3AZN C;  1BH8 A;  3LZ0 B;  2DF4 C;  5GXQ C;  5JA4 B;  1HQ3 A;  2CV5 D;  5AV6 C;  1EQZ A;  4NE6 A;  2ZM5 A;  4CAY A;  4R8P A;  1KX3 C;  3UTB A;  3EPH A;  3AV2 C;  3UTA C;  1B67 A;  3C1B C;  1M1A C;  3AZH A;  2Y2N A;  2JCH A;  4KHA A;  1TAF B;  5FUG A;  2Y2Q A;  3B0C W;  3KXB C;  4UPK A;  4KUD D;  4EO5 B;  3WTP C;  5CP6 D;  3B0C T;  4WNN B;  4J8W D;  4J8U B;  5AV9 A;  4Z66 C;  2UWX A;  1A7W A;  4G92 C;  3KWQ A;  4KGC A;  1P34 D;  2F8N H;  2Y2M A;  3LZ1 B;  3AZE A;  3REH B;  5GT3 D;  3MGQ A;  3MGR D;  2NZD A;  4YM6 A;  2LY8 A;  5GSU D;  3KUY A;  5CP6 B;  5B1L D;  1H3O A;  5B0Y C;  3AN2 D;  4NFT A;  1P34 B;  2Y2P A;  2FJ7 C;  1S32 D;  4KGC C;  1Q9C A;  5GT3 B;  3MGR B;  3AZE C;  3B6F D;  1N1J A;  4WZS B;  2L5A A;  1P3B A;  3MGP A;  5B2J C;  3REJ D;  5B1L B; 
#chains in the Genus database with same CATH homology
 3AZL B;  1P3I A;  3LJA D;  5AVC D;  4E44 A;  2JE5 A;  4J8X D;  5CPJ D;  1P3G C;  2BYK B;  5AV8 D;  3X1V B;  3AV1 D;  2NQB B;  4XZQ A;  5B31 A;  3AZK D;  3B6F B;  1P3L D;  2RIQ A;  3H0R C;  4EO5 C;  3REI A;  2CV5 C;  4G91 B;  4J8W A;  1P3K D;  3X1U D;  3REJ B;  2XD1 A;  3TU4 A;  2BG1 A;  5DNM A;  3LJA B;  5AVC B;  4J8X B;  3AV1 B;  2RVQ D;  4XZQ C;  3C1C D;  3O62 B;  4LD9 A;  4WU9 A;  4KUD C;  5CP6 C;  1P3K B;  3X1U B;  4J8W C;  4Z5T D;  3KSY A;  3EG5 B;  2ARO D;  3MNN D;  4NE3 A;  4AWL C;  3AZM D;  5GT0 B;  1P3M A;  5DNM C;  3MVD A;  3AYW D;  5CPI D;  3W99 A;  1BFM A;  3REL D;  5GT3 C;  5B2I D;  2IO5 B;  3AZF A;  1ID3 D;  4X23 D;  5GSU C;  3W98 D;  5CPI A;  5AVB D;  3X1T B;  3MNN B;  3AZM B;  2ARO B;  4WU8 D;  4H9P A;  5BO0 B;  3AN2 C;  5F99 D;  1P3M C;  3AYW B;  1S32 C;  1U35 D;  3W99 C;  5JRG A;  3AZK A;  5B2I B;  3REK A;  2YFV A;  3UT9 D;  4H9N A;  1P3L A;  3B0D B;  2HUE B;  3WA9 D;  5AVB B;  5CPI C;  5B1M D;  1ULY A;  3AZJ A;  5F99 B;  5CPJ C;  2HIO D;  5AV8 C;  1R4V A;  5BNX A;  1HTA A;  3AZK C;  3NQJ A;  4CSR A;  1P3L C;  1TZY D;  5AV6 A;  4ZUX B;  2DQN C;  3AV2 A;  4DQY B;  3WAA D;  2G5I C;  3UTA A;  3C1B A;  1M1A A;  2HIO B;  1HQ3 B;  1EQZ B;  3A1I A;  4UUZ A;  1ZLA A;  4H9Q A;  2RVQ C;  4R8P B;  2IO5 C;  3C1C C;  2YFW A;  3KXB A;  2F8N A;  3UTB B;  3WTP A;  3W98 A;  3AZG D;  1TZY B;  4J8V D;  4QLC A;  3AZH B;  4Z66 A;  4Z5T C;  4J8U D;  3KFU G;  3MNN C;  3WAA B;  2ARO C;  4YS3 D;  1P3A D;  5FUG B;  1P3O D;  1P3P D;  3LZ1 D;  3REL C;  3REH D;  5B2I C;  3UT9 A;  1ZLA C;  5AV9 B;  5B33 D;  3AZG B;  3KWQ B;  1ID3 C;  4X23 C;  3W98 C;  4J8V B;  3R45 A;  5B0Y A;  4QLC C;  3MGQ B;  4XUJ A;  2NZD B;  4WU8 C;  2FFF B;  4YM6 B;  4YS3 B;  1P3A B;  2FJ7 A;  1P3O B;  2F8N K;  3AL0 C;  3LZ0 A;  1P3P B;  3KUY B;  5KDM A;  1U35 C;  4H9O A;  4H9R B;  5CHL B;  1H3O B;  5JA4 A;  3UT9 C;  3AZI D;  3W97 D;  5B33 B;  3LEL B;  5B2J A;  5CPK D;  5DNN D;  3WA9 C;  5B32 D;  3V9R A;  5C3I C;  3AZL D;  2PYO B;  1P3G A;  5B1M C;  5B40 D;  4XUJ C;  2BYM A;  2Y2O A;  3X1V D;  2NQB D;  5B32 G;  5BS7 C;  4ZBJ B;  3MGP B;  3LZ0 C;  3VH5 T;  1TAF A;  5AV5 D;  5B24 D;  2Y2G A;  1P3I B;  3AZI B;  3W97 B;  2CV5 A;  5BT1 D;  1TZY C;  3MGS B;  3IP4 C;  4WNN A;  5CPK B;  5DNN B;  5B32 B;  4J8U A;  2XD5 A;  1KX4 D;  5B40 B;  4NE5 A;  4DRB A;  3B6G D;  1P3F B;  5AV5 B;  3VH6 T;  5B24 B;  3O62 D;  3TU4 B;  4KUD A;  5CP6 A;  1BH9 B;  5G49 B;  4J8U C;  1KX4 B;  4M6B A;  5GT0 D;  1P3A C;  1P34 A;  2JSS A;  1P3O C;  3B6G B;  2G5H C;  3LZ1 C;  5GT3 A;  3MGR A;  3REH C;  4JJN D;  3A6N D;  1AOI B;  5E5A D;  5GSU A;  5B33 C;  1Z2C B;  3MVD B;  1KX5 D;  5B1L A;  2J8P A;  3X1T D;  4HGA B;  5B0Z D;  3AZL A;  1M18 D;  5AY8 D;  3AN2 A;  2BYK A;  1S32 A;  1P34 C;  1F66 D;  1M19 B;  3B6F A;  3MGR C;  1WWI A;  1JFI B;  4JJN B;  3A6N B;  3B0B A;  3AZI C;  5E5A B;  5BNV A;  4WJ3 C;  3AZN D;  1KX5 B;  3X1S D;  5DNN C;  3REJ A;  3WKJ B;  1M18 B;  3EPK A;  5B0Z B;  5JRG B;  3W96 D;  5B1L C;  5AY8 B;  3LJA A;  5AVC A;  3AZL C;  4J8X A;  5CPJ A;  2YFV B;  5B40 C;  5AV8 A;  3AV1 A;  3X1V C;  1F66 B;  2NQB C;  5AV5 C;  3B6F C;  5B24 C;  1T3U A;  5BT1 C;  3AZN B;  3P5J B;  4ZUX D;  3AZJ B;  1P3K A;  3X1U A;  4G91 C;  3X1S B;  5GXQ B;  3REJ C;  3W96 B;  5GT0 A;  3LJA C;  5AVC C;  4J8X C;  5AV6 B;  3AV1 C;  1HQ3 D;  3NQU B;  1EQZ D;  1KX3 B;  3C1C A;  4R8P D;  3O62 C;  2Y2K A;  3UTB D;  3C1B B;  1M1A B;  3X1T A;  4Z5T A;  1BH8 B;  1P3K C;  3X1U C;  3AZH D;  3MNN A;  3AZM A;  2ARO A;  4UUZ B;  5BO0 A;  5GT0 C;  3KXB B;  3AYW A;  2F8N B;  3WTP B;  3REL A;  5B2I A;  4CAY B;  4Z66 B;  5AV9 D;  4JJN C;  1ID3 A;  4X23 A;  5E5A C;  3KWQ D;  5AVB A;  4DRA A;  3X1T C;  3AZE D;  4WU8 A;  3MGQ D;  4KHA B;  3AZM C;  2NZD D;  5F99 A;  4YM6 D;  4E45 A;  3AYW C;  1U35 A;  3WTP E;  1F66 C;  3VH5 A;  3KUY D;  3R45 B;  5B0Y B;  1PZR A;  3WA9 A;  2ZY2 A;  3B0D C;  4KGC B;  3LEL D;  2HUE C;  5AVB C;  3X1S C;  5KDM B;  3AZE B;  3W96 C;  5B1M A;  2PYO D;  4H9O B;  2HIO A;  5F99 C;  5BS7 A;  1P3B D;  2ZY4 A;  5B2J B;  3VH6 A;  3MGP D;  3AFA D;  3V9R B;  1P3I D;  1TZY A;  1P3G B;  2BYM B;  3MGS D;  4ZUX C;  3F6T A;  2W8S A;  4XZQ D;  3WAA A;  5B31 D;  1N1J B;  3H0L C;  3VH5 W;  2ZY3 A;  2HIO C;  2CV5 B;  1P3B B;  3REI D;  1HQ3 C;  4Z2M G;  1P3F D;  1EQZ C;  5B31 G;  3AFA B;  4R8P C;  3EPJ A;  3TU4 D;  2ZY5 A;  3AZG A;  3UTB C;  5DNM D;  4J8V A;  3AZH C;  4XZQ B;  5B31 B;  4YS3 A;  3FDD A;  1P3A A;  3WAA C;  4LD9 D;  1P3O A;  4KUD B;  4WU9 D;  1P3P A;  3LZ1 A;  3VH6 W;  3REH A;  3REI B;  4J8W B;  4H9R A;  2Y2J A;  4AWL B;  5B33 A;  1AOI D;  5AV9 C;  5DNM B;  1P3M D;  3LEL A;  3AZG C;  1WWS A;  3KWQ C;  3MVD D;  3W99 D;  4J8V C;  2PYO A;  3MGQ C;  2NZD C;  3EPL A;  4LD9 B;  2F2A C;  4YM6 C;  4YS3 C;  4WU9 B;  5GSU B;  3AZF D;  1P3P C;  1M19 D;  3KUY C;  3AZI A;  3W97 A;  4H9S A;  3AN2 B;  1P3M B;  3MGS A;  5CPK A;  5DNN A;  1S32 B;  1B6W A;  5B32 A;  3LEL C;  3W99 B;  3WKJ D;  5JRG D;  2PYO C;  3AFA A;  5B40 A;  3REK D;  3H0M C;  3X1V A;  2NQB A;  5BNV B;  3AZF B;  1P3B C;  1P3F A;  2VQR A;  2Y2I A;  4ZBJ C;  5AV5 A;  5B24 A;  3MGP C;  3A1K A;  5CPI B;  3AFA C;  2Y2L A;  1P3I C;  3W97 C;  4H9P B;  4H9S C;  5CPJ B;  5AV8 B;  3AZJ D;  1BH9 A;  3MGS C;  1W2E A;  5G49 A;  5CPK C;  5B32 C;  5GXQ D;  1KX4 A;  3AZK B;  5B31 C;  3REK B;  1P3L B;  4H9N B;  3B6G A;  5AV6 D;  3REI C;  1P3F C;  1KX3 D;  3O62 A;  1AOI A;  2Y2H A;  4Z2M H;  3TU4 C;  3AV2 D;  3UTA D;  3C1B D;  1M1A D;  5BNX B;  1ZLA D;  3C1C B;  1KU5 A;  1KX4 C;  4LD9 C;  3KXB D;  2F8N D;  3NQJ B;  4WU9 C;  4CSR B;  3WTP D;  1M19 A;  3B6G C;  4Z5T B;  4QLC D;  1JFI A;  4JJN A;  4Z66 D;  3A6N A;  2F8N G;  5E5A A;  3AV2 B;  1AOI C;  3UTA B;  1KX5 A;  3WKJ A;  3MVD C;  1M18 A;  5B0Z A;  3REL B;  5AY8 A;  4HGA C;  1ZLA B;  4H9Q B;  2YFW B;  1F66 A;  1ID3 B;  4X23 B;  3W98 B;  3AZF C;  1M19 C;  4QLC B;  5B0Y D;  4WU8 B;  4G92 B;  4XUJ D;  3A6N C;  3AZN A;  2FJ7 D;  4KGC D;  3X1S A;  1U35 B;  5GXQ A;  3LZ0 D;  3W96 A;  1KX5 C;  3WKJ C;  1M18 C;  2CWE A;  5JRG C;  5B0Z C;  5AY8 C;  3REK C;  3UT9 B;  3NQU A;  3WA9 B;  1F1E A;  1KX3 A;  5B2J D;  4WV4 B;  5C3I B;  5B1M B;  4XUJ B;  1P3G D;  4ZUX A;  2FJ7 B;  3AZJ C;  3AZN C;  1BH8 A;  3LZ0 B;  2DF4 C;  5GXQ C;  5JA4 B;  1HQ3 A;  2CV5 D;  5AV6 C;  1EQZ A;  4NE6 A;  2ZM5 A;  4CAY A;  4R8P A;  1KX3 C;  3UTB A;  3EPH A;  3AV2 C;  3UTA C;  1B67 A;  3C1B C;  1M1A C;  3AZH A;  2Y2N A;  2JCH A;  4KHA A;  1TAF B;  5FUG A;  2Y2Q A;  3B0C W;  3KXB C;  4UPK A;  4KUD D;  4EO5 B;  3WTP C;  5CP6 D;  3B0C T;  4WNN B;  4J8W D;  4J8U B;  5AV9 A;  4Z66 C;  2UWX A;  1A7W A;  4G92 C;  3KWQ A;  4KGC A;  1P34 D;  2F8N H;  2Y2M A;  3LZ1 B;  3AZE A;  3REH B;  5GT3 D;  3MGQ A;  3MGR D;  2NZD A;  4YM6 A;  2LY8 A;  5GSU D;  3KUY A;  5CP6 B;  5B1L D;  1H3O A;  5B0Y C;  3AN2 D;  4NFT A;  1P34 B;  2Y2P A;  2FJ7 C;  1S32 D;  4KGC C;  1Q9C A;  5GT3 B;  3MGR B;  3AZE C;  3B6F D;  1N1J A;  4WZS B;  2L5A A;  1P3B A;  3MGP A;  5B2J C;  3REJ D;  5B1L B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...