1P3IA

Crystallographic studies of nucleosome core particles containing histone 'sin' mutants
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
98
structure length
98
Chain Sequence
b'PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Palindromic 146bp Human Alpha-Satellite DNA fragment
publication title Crystal structures of histone Sin mutant nucleosomes reveal altered protein-DNA interactions
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 32
structure length 98
sequence length 98
chains with identical sequence E
ec nomenclature
pdb deposition date 2003-04-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1p3iA00
5CP6D 5AV6A 5B0YC 5AVBC 2CWEA 3WAAA 5B1LB 1BH8B 4KUDD 3C1CB 1KX3A 3AZIA 2HUEC 5CPJB 4X23A 5B40C 1P3OB 2AROA 1M1AC 1TZYA 1P3AD 5JRGD 4JJNB 1P3BD 3O62C 4YS3D 3AZFC 4R8PC 5AVCC 3NQUB 5F99C 4WU8B 3LZ1B 3MGPC 5CPKC 4ZUXD 5GT0B 1P3KA 3RELC 1P3FA 5B33D 3AFAA 3AZEA 2LY8A 3REHD 5AY8C 4CSRA 4ZUXB 3X1VB 1F1EA 5B24C 3LZ0B 5GSUD 4H9RB 3W98D 3REJD 2CV5A 3W99B 5CPID 4KGCD 1KX5B 5B31B 3AZHC 3X1TC 5DNMB 1AOIC 1P3IB 1B67A 3AV1B 3B6GA 3REKA 4XZQC 1P3LB 4LD9A 3W97A 1BH9A 4Z66D 2NQBD 4J8VD 3B0DC 1EQZB 4XUJD 4YS3C 3MGSB 3LJAA 1ID3C 1WWSA 4WNNB 3AV2A 5AV6D 1HQ3A 1ZLAC 2PYOA 3WAAD 3W96A 3X1UA 4EO5C 5BO0A 1KX3D 3AZID 3W98C 4WV4B 4X23D 2AROD 1WWIA 3KXBA 1KX3B 1TZYD 3KWQC 5B0YA 5AVBA 3AYWB 5GT3C 3AZNB 1P3KD 3UTAC 3AFAD 3AZED 5B40A 1S32B 1KX4C 1M1AA 3KUYC 1P3FB 1P3PB 1TAFA 3O62A 3AZFA 3VH6T 4CSRB 4DRBA 1M19B 4R8PA 4CAYA 5AVCA 5F99A 3MGPA 5CPKA 2CV5D 3AZKC 3RELA 3AN2B 4YM6C 3B6GD 4LD9D 3W97D 2CV5B 5AY8A 3AZJB 3B0BA 2BYKA 5B24A 1P3MC 3B0CT 3REKB 3MGRC 3LJAD 4J8WC 4LD9B 1N1JB 3C1BB 5FUGA 3AV2D 1P34C 3AZMB 3AZHA 1AOIA 3X1TA 4NE6A 1U35C 3V9RB 3LJAB 5BT1C 3X1UD 2F8NG 5JRGA 1HQ3B 2PYOB 5B1MB 5E5AB 4WU9B 4YS3A 3W96B 3X1UB 5B0ZB 3KXBD 1ID3A 1M18B 1Q9CA 1ZLAA 5AVBD 5C3IB 1KU5A 5B2IB 3TU4C 2IO5C 3B6FC 5B0YB 3WTPE 3W98A 5B40D 3MVDB 5CPIA 3KWQA 3O62D 3AZGC 3AZFD 1JFIA 4R8PD 5AVCD 3MGPD 5F99D 1M1AB 4HGAB 5CPKD 4NE3A 3RELD 3UTAA 4J8XB 4Z2MH 3UTBD 5AVCB 4CAYB 5AY8D 4KHAB 1KX4A 5KDMA 5GXQC 3KUYA 5B24D 5BS7C 3WA9C 5AV8C 5CP6B 2BYKB 3AZKA 3AZHD 3X1TD 1AOID 4KUDB 4YM6A 4XZQD 5FUGB 3X1SC 3UT9C 3A6NC 4UUZB 1P3MA 4AWLB 3MGRA 1B6WA 1P3AB 5JRGB 2L5AA 1ID3D 1P3GC 1P3BB 3B0DB 1P34A 4YS3B 1ZLAD 3UTBC 1U35A 3KSYA 2YFVA 4Z5TD 3WTPC 1ID3B 5G49B 5B33B 3REHB 5JA4A 4QLCC 4EO5B 4ZBJB 1H3OA 3VH5A 3KWQD 5GSUB 3W98B 2YFWA 4H9OA 3REJB 5GT3D 3TU4A 5CPIB 4KGCB 2F8NA 3UTAD 3B6FA 4Z66B 2NQBB 3C1CC 4J8VB 4XUJB 4H9NA 1KX4D 3KUYD 5BNXB 4Z5TC 3AZGA 5AV6B 5KDMB 3WAAB 3AZKD 4YM6D 3LZ1C 4WU8C 5B31G 4G92B 3AZIB 3AZKB 4X23B 5GXQA 2AROB 1P3MD 5AV5D 3MGRD 3MGQC 5BS7A 1TZYB 4J8WD 3WA9A 5AV8A 3X1VC 1P34D 1F66D 3LZ0C 3AZLD 1U35D 5CHLB 5BT1D 1P3KB 3W99C 1KX5C 5B31C 5DNMC 1P3IC 3X1SA 3AFAB 3AV1C 3AZEB 3UT9A 3A6NA 4WZSB 1U35B 1P3LC 2YFVB 1EQZC 4DRAA 1P3GA 3NQJB 3MGSC 4J8UD 5JA4B 3UTBA 3TU4D 3WTPA 2F8NK 1H3OB 2F8ND 3B6GB 3B6FD 2NZDD 5AV5C 4G91B 3W97B 1BH9B 4QLCA 1F66C 2HIOC 3AZLC 4H9SC 4H9PA 3NQJA 4XZQA 4H9QA 3AZGD 3AV2B 4H9NB 2FJ7C 3AYWC 5BO0B 5B32D 3AZNC 3R45A 3C1CA 4E44A 4J8UC 5GXQD 5BNVA 3KXBB 4Z5TA 1S32C 3WA9D 5AV8D 2NZDC 4NE5A 5AVBB 5B32G 1P3PC 4NFTA 1M19C 3LZ1A 3NQUA 4WU8A 3AN2C 2HUEB 3X1SD 3UT9D 5B40B 3A6ND 5GT3A 3MGQA 3AZJC 3X1VA 1P3GD 1TAFB 3O62B 3AZFB 5B32C 5AV9C 3LZ0A 4R8PB 4H9RA 3MGPB 3C1BC 5F99B 5CPKB 3WTPD 3W99A 3RELB 3AZMC 1KX5A 5B31A 5DNMA 1P3IA 3AV1A 3UTBB 3MNNC 5AY8B 1P3LA 4QLCD 5B1MC 1EQZA 5B24B 5E5AC 4WU9C 5DNND 3VH5T 3W96C 5B2JC 3MGSA 5B0ZC 3WKJD 1M18C 3AZHB 1AOIB 3X1TB 5C3IC 5B2IC 5AV5A 4H9PB 5B1LD 4XZQB 4J8WA 3C1CD 1F66A 2HIOA 5CPJD 3AZLA 3LELC 4H9SA 1P3OD 3MVDC 1BFMA 3R45B 1R4VA 1ZLAB 4JJND 2FJ7A 5BNVB 3AYWA 4Z5TB 3LZ1D 3REIC 3AZNA 4WU8D 4HGAC 5DNNC 5GT0D 3WKJC 4J8UA 4J8XC 3MGQD 1S32A 3X1VD 3KWQB 2NZDA 5B1LC 1P3PA 3LZ0D 5GT3B 1JFIB 5CP6C 3MGQB 1M19A 3W99D 3UTAB 5CPJC 1KX5D 2RVQD 5B31D 5DNMD 1P3OC 3AN2A 1P3ID 3AV1D 4KUDC 1P3LD 1KX4B 4JJNC 3KUYB 1EQZD 3AZJA 2F8NH 3MGSD 4AWLC 5B32A 5AV9A 1P3AC 1N1JA 5GT0C 5JRGC 3C1BA 1P3BC 3AZMA 4Z2MG 4YM6B 2BYMA 3VH6W 3V9RA 4ZUXC 3MNNA 5B33C 2HIOD 5B1MA 1P3MB 5E5AA 4WU9A 3REHC 5AV5B 3MGRB 5B2JA 4J8WB 5B0ZA 2RVQC 4ZBJC 1P34B 1F66B 1A7WA 2HIOB 1M18A 2FJ7D 3B0CW 5GSUC 3AZLB 2JSSA 3REJC 5B2IA 3AYWD 5CPIC 4KGCC 3AZND 2FJ7B 4Z66C 3LELA 2NQBC 3MVDA 4J8VC 4XUJC 1S32D 1P3FD 2YFWB 4J8UB 4H9OB 1P3PD 3TU4B 5AV6C 1M19D 3REIA 2F8NB 3WAAC 2IO5B 5DNNA 3B6FB 4H9QB 2NZDB 3AN2D 3WKJA 4J8XA 1KX3C 4G92C 3AZIC 4KHAA 4X23C 3AZJD 2AROC 5B1LA 1BH8A 3REKD 5AV9D 3AZGB 1TZYC 3C1BD 5CP6A 3AZMD 5CPJA 1P3OA 5B32B 5AV9B 4KUDA 1P3KC 3MNND 1P3FC 4JJNA 1HQ3D 5GXQB 3AFAC 2PYOD 5B1MD 4E45A 3AZEC 5E5AD 4WU9D 2BYMB 4UUZA 3W96D 5B2JD 3WA9B 5AV8B 5B0ZD 3MNNB 1P3AA 5GT0A 1P3BA 1M18D 5B2JB 3VH6A 5B2ID 2CV5C 4ZUXA 1ULYA 3X1SB 3B6GC 3UT9B 5G49A 3VH5W 5B33A 5B0YD 3A6NB 4G91C 3REKC 4LD9C 3W97C 3LELD 3REHA 3MVDD 1P3GB 4M6BA 3LJAC 5GSUA 3LELB 3REJA 3AV2C 3WTPB 1HQ3C 4KGCA 2PYOC 3REID 1M1AD 3X1UC 4J8XD 4Z66A 3WKJB 4QLCB 2NQBA 4WNNA 4J8VA 3REIB 4XUJA 5DNNB 5BNXA 1HTAA 3KXBC
chains in the Genus database with same CATH superfamily
2Y2PA 5CP6D 5AV6A 5B0YC 2ZM5A 5AVBC 2CWEA 3WAAA 5B1LB 1BH8B 4KUDD 2ZY5A 3C1CB 1KX3A 3AZIA 2HUEC 5CPJB 4X23A 5B40C 1P3OB 2AROA 1M1AC 1TZYA 1P3AD 5JRGD 4JJNB 1P3BD 3O62C 4YS3D 3AZFC 2Y2IA 4R8PC 5AVCC 3NQUB 5F99C 4WU8B 3LZ1B 3MGPC 5CPKC 4ZUXD 2XD5A 2G5IC 5GT0B 4DQYB 3RELC 1P3KA 1P3FA 5B33D 3AFAA 3AZEA 2LY8A 3REHD 5AY8C 4CSRA 4ZUXB 3X1VB 3KFUG 1F1EA 2UWXA 5B24C 3LZ0B 5GSUD 4H9RB 3W98D 3REJD 2CV5A 3W99B 5CPID 4KGCD 1KX5B 5B31B 3AZHC 3X1TC 5DNMB 1AOIC 1P3IB 1B67A 3AV1B 3B6GA 3REKA 4XZQC 1P3LB 4LD9A 3W97A 1BH9A 4Z66D 2NQBD 4J8VD 3B0DC 1EQZB 4XUJD 4YS3C 3MGSB 3LJAA 3H0MC 1ID3C 2BG1A 1WWSA 4WNNB 3AV2A 5AV6D 1HQ3A 1ZLAC 2PYOA 3WAAD 3W96A 2G5HC 3X1UA 4EO5C 5BO0A 1KX3D 3AZID 3W98C 4WV4B 4X23D 2AROD 1WWIA 3KXBA 1KX3B 1TZYD 2DQNC 3KWQC 5B0YA 2FFFB 5AVBA 3AYWB 5GT3C 3AZNB 1P3KD 3UTAC 3AFAD 2F2AC 3AZED 5B40A 1S32B 1KX4C 1M1AA 3KUYC 1P3FB 1P3PB 1TAFA 3O62A 3AZFA 3VH6T 4CSRB 4DRBA 1M19B 4R8PA 4CAYA 5AVCA 5F99A 3MGPA 5CPKA 2CV5D 3AZKC 3RELA 3AN2B 3EPLA 4WJ3C 4YM6C 3B6GD 4LD9D 3W97D 2CV5B 5AY8A 3AZJB 3B0BA 2BYKA 5B24A 1P3MC 3B0CT 3REKB 3MGRC 3LJAD 2ZY3A 4J8WC 1N1JB 4LD9B 3C1BB 5FUGA 3AV2D 1P34C 3AZMB 3AZHA 1AOIA 3X1TA 4NE6A 1U35C 3V9RB 3LJAB 5BT1C 3X1UD 3EPHA 2F8NG 5JRGA 1HQ3B 2PYOB 5B1MB 5E5AB 4WU9B 4YS3A 3W96B 3X1UB 5B0ZB 3KXBD 1ID3A 3EPJA 1M18B 1Q9CA 1ZLAA 5AVBD 5C3IB 1KU5A 5B2IB 3TU4C 2IO5C 3P5JB 5B0YB 3B6FC 3WTPE 3W98A 5B40D 3MVDB 3F6TA 5CPIA 2Y2LA 3KWQA 3O62D 3AZGC 3AZFD 1JFIA 1HTAA 4R8PD 5AVCD 3MGPD 5F99D 1M1AB 4HGAB 5CPKD 3AL0C 4NE3A 3RELD 3UTAA 4J8XB 4Z2MH 3UTBD 5AVCB 4CAYB 5AY8D 4KHAB 1KX4A 5KDMA 5GXQC 3KUYA 5B24D 5BS7C 3WA9C 5AV8C 5CP6B 2BYKB 3AZKA 3AZHD 3X1TD 1AOID 4KUDB 4YM6A 4XZQD 5FUGB 3X1SC 3UT9C 3A6NC 4UUZB 1P3MA 2RIQA 4AWLB 3MGRA 1B6WA 1P3AB 5JRGB 2L5AA 1ID3D 1P3GC 1P3BB 3B0DB 1P34A 4YS3B 1ZLAD 3UTBC 1U35A 3KSYA 2YFVA 4Z5TD 3WTPC 1Z2CB 1ID3B 5G49B 5B33B 3REHB 5JA4A 4QLCC 4EO5B 4ZBJB 1H3OA 3VH5A 2Y2KA 3KWQD 5GSUB 3W98B 2YFWA 4H9OA 3REJB 5GT3D 3TU4A 5CPIB 4KGCB 2ZY4A 2F8NA 3UTAD 3B6FA 2Y2OA 4Z66B 2NQBB 3C1CC 4J8VB 4XUJB 4H9NA 1KX4D 3KUYD 5BNXB 4Z5TC 3AZGA 5AV6B 5KDMB 3WAAB 3AZKD 4YM6D 3LZ1C 4WU8C 5B31G 3FDDA 4G92B 3AZIB 3H0RC 3AZKB 4X23B 5GXQA 2AROB 1P3MD 5AV5D 3MGRD 3MGQC 5BS7A 1TZYB 4J8WD 3WA9A 5AV8A 3X1VC 1P34D 1F66D 3LZ0C 3AZLD 1U35D 5CHLB 5BT1D 3EPKA 3W99C 1P3KB 1KX5C 5B31C 5DNMC 1P3IC 3X1SA 3AFAB 3AV1C 3AZEB 3UT9A 3A6NA 1PZRA 4WZSB 1U35B 1P3LC 2YFVB 1EQZC 4DRAA 1P3GA 3NQJB 3MGSC 4J8UD 5JA4B 3UTBA 3TU4D 3WTPA 2F8NK 1H3OB 2F8ND 3B6GB 3B6FD 2NZDD 5AV5C 4G91B 3W97B 1BH9B 4UPKA 4QLCA 1F66C 2HIOC 3AZLC 4H9SC 2Y2GA 4H9PA 3NQJA 4XZQA 4H9QA 3AZGD 3AV2B 1T3UA 4H9NB 2FJ7C 2Y2JA 3A1KA 3AYWC 5BO0B 5B32D 3AZNC 3R45A 3C1CA 4E44A 4J8UC 5GXQD 5BNVA 3KXBB 4Z5TA 1S32C 3WA9D 2Y2HA 5AV8D 2NZDC 4NE5A 3EG5B 5AVBB 5B32G 3H0LC 1P3PC 4NFTA 1M19C 2DF4C 3LZ1A 2JCHA 3NQUA 4WU8A 3AN2C 2HUEB 3X1SD 3UT9D 5B40B 3A6ND 5GT3A 3MGQA 3AZJC 3X1VA 1P3GD 1TAFB 3O62B 3AZFB 5B32C 5AV9C 3LZ0A 4R8PB 4H9RA 3MGPB 3C1BC 5F99B 5CPKB 3WTPD 3W99A 3RELB 3AZMC 1KX5A 5B31A 5DNMA 1P3IA 3AV1A 3UTBB 3MNNC 5AY8B 1P3LA 4QLCD 5B1MC 1EQZA 5B24B 5E5AC 4WU9C 5DNND 3VH5T 3W96C 5B2JC 3MGSA 5B0ZC 3WKJD 1M18C 3AZHB 1AOIB 3X1TB 2XD1A 5C3IC 5B2IC 5AV5A 4H9PB 5B1LD 4XZQB 4J8WA 3C1CD 1F66A 2HIOA 5CPJD 3AZLA 3LELC 4H9SA 1P3OD 3MVDC 1BFMA 2W8SA 3A1IA 3R45B 1R4VA 1ZLAB 2Y2QA 4JJND 2Y2NA 2FJ7A 5BNVB 3AYWA 4Z5TB 3LZ1D 3REIC 3AZNA 4WU8D 4HGAC 5DNNC 3IP4C 5GT0D 3WKJC 4J8UA 4J8XC 2ZY2A 3MGQD 1S32A 3X1VD 3KWQB 2NZDA 5B1LC 1P3PA 3LZ0D 5GT3B 1JFIB 5CP6C 3MGQB 1M19A 3W99D 3UTAB 5CPJC 1KX5D 2RVQD 5B31D 5DNMD 1P3OC 3AN2A 1P3ID 3AV1D 4KUDC 1P3LD 1KX4B 4JJNC 3KUYB 1EQZD 3AZJA 2F8NH 3MGSD 4AWLC 5B32A 5AV9A 2JE5A 1P3AC 1N1JA 5GT0C 5JRGC 3C1BA 1P3BC 3AZMA 4Z2MG 4YM6B 2BYMA 3VH6W 3V9RA 4ZUXC 3MNNA 5B33C 2HIOD 5B1MA 1P3MB 5E5AA 4WU9A 3REHC 5AV5B 3MGRB 5B2JA 4J8WB 5B0ZA 2RVQC 4ZBJC 1P34B 1F66B 1A7WA 2HIOB 1M18A 2FJ7D 5GSUC 3B0CW 3AZLB 2JSSA 3REJC 5B2IA 3AYWD 5CPIC 4KGCC 3AZND 2FJ7B 4Z66C 3LELA 2NQBC 3MVDA 4J8VC 4XUJC 1S32D 1P3FD 2YFWB 4J8UB 4H9OB 1P3PD 2J8PA 3TU4B 5AV6C 1M19D 3REIA 2F8NB 3WAAC 2IO5B 5DNNA 3B6FB 2NZDB 3AN2D 3WKJA 4J8XA 1KX3C 4G92C 3AZIC 4KHAA 4X23C 3AZJD 2AROC 5B1LA 1BH8A 3REKD 5AV9D 3AZGB 1TZYC 3C1BD 5CP6A 3AZMD 5CPJA 1P3OA 5B32B 5AV9B 4KUDA 2VQRA 1P3KC 3MNND 1P3FC 4JJNA 1HQ3D 5GXQB 3AFAC 2PYOD 5B1MD 4E45A 3AZEC 5E5AD 4WU9D 2BYMB 4UUZA 3W96D 5B2JD 3WA9B 5AV8B 5B0ZD 3MNNB 1P3AA 5GT0A 1P3BA 1M18D 2Y2MA 5B2JB 3VH6A 5B2ID 2CV5C 4ZUXA 1ULYA 3X1SB 3B6GC 3UT9B 5B0YD 5G49A 3VH5W 5B33A 3A6NB 4G91C 3REKC 4LD9C 3W97C 3LELD 3REHA 3MVDD 1P3GB 4M6BA 3LJAC 5GSUA 3LELB 3REJA 3AV2C 3WTPB 1HQ3C 4KGCA 2PYOC 3REID 1M1AD 1W2EA 3X1UC 4J8XD 4Z66A 3WKJB 4QLCB 2NQBA 4WNNA 4J8VA 3REIB 4XUJA 5DNNB 5BNXA 4H9QB 3KXBC
chains in the Genus database with same CATH topology
2Y2PA 5CP6D 5AV6A 5B0YC 2ZM5A 5AVBC 2CWEA 3WAAA 5B1LB 1BH8B 4KUDD 2ZY5A 3C1CB 1KX3A 3AZIA 2HUEC 5CPJB 4X23A 5B40C 1P3OB 2AROA 1M1AC 1TZYA 1P3AD 5JRGD 4JJNB 1P3BD 3O62C 4YS3D 3AZFC 2Y2IA 4R8PC 5AVCC 3NQUB 5F99C 4WU8B 3LZ1B 3MGPC 5CPKC 4ZUXD 2XD5A 2G5IC 5GT0B 4DQYB 3RELC 1P3KA 1P3FA 5B33D 3AFAA 3AZEA 2LY8A 3REHD 5AY8C 4CSRA 4ZUXB 3X1VB 3KFUG 1F1EA 2UWXA 5B24C 3LZ0B 5GSUD 4H9RB 3W98D 3REJD 2CV5A 3W99B 5CPID 4KGCD 1KX5B 5B31B 3AZHC 3X1TC 5DNMB 1AOIC 1P3IB 1B67A 3AV1B 3B6GA 3REKA 4XZQC 1P3LB 4LD9A 3W97A 1BH9A 4Z66D 2NQBD 4J8VD 3B0DC 1EQZB 4XUJD 4YS3C 3MGSB 3LJAA 3H0MC 1ID3C 2BG1A 1WWSA 4WNNB 3AV2A 5AV6D 1HQ3A 1ZLAC 2PYOA 3WAAD 3W96A 2G5HC 3X1UA 4EO5C 5BO0A 1KX3D 3AZID 3W98C 4WV4B 4X23D 2AROD 1WWIA 3KXBA 1KX3B 1TZYD 2DQNC 3KWQC 5B0YA 2FFFB 5AVBA 3AYWB 5GT3C 3AZNB 1P3KD 3UTAC 3AFAD 2F2AC 3AZED 5B40A 1S32B 1KX4C 1M1AA 3KUYC 1P3FB 1P3PB 1TAFA 3O62A 3AZFA 3VH6T 4CSRB 4DRBA 1M19B 4R8PA 4CAYA 5AVCA 5F99A 3MGPA 5CPKA 2CV5D 3AZKC 3RELA 3AN2B 3EPLA 4WJ3C 4YM6C 3B6GD 4LD9D 3W97D 2CV5B 5AY8A 3AZJB 3B0BA 2BYKA 5B24A 1P3MC 3B0CT 3REKB 3MGRC 3LJAD 2ZY3A 4J8WC 1N1JB 4LD9B 3C1BB 5FUGA 3AV2D 1P34C 3AZMB 3AZHA 1AOIA 3X1TA 4NE6A 1U35C 3V9RB 3LJAB 5BT1C 3X1UD 3EPHA 2F8NG 5JRGA 1HQ3B 2PYOB 5B1MB 5E5AB 4WU9B 4YS3A 3W96B 3X1UB 5B0ZB 3KXBD 1ID3A 3EPJA 1M18B 1Q9CA 1ZLAA 5AVBD 5C3IB 1KU5A 5B2IB 3TU4C 2IO5C 3P5JB 5B0YB 3B6FC 3WTPE 3W98A 5B40D 3MVDB 3F6TA 5CPIA 2Y2LA 3KWQA 3O62D 3AZGC 3AZFD 1JFIA 1HTAA 4R8PD 5AVCD 3MGPD 5F99D 1M1AB 4HGAB 5CPKD 3AL0C 4NE3A 3RELD 3UTAA 4J8XB 4Z2MH 3UTBD 5AVCB 4CAYB 5AY8D 4KHAB 1KX4A 5KDMA 5GXQC 3KUYA 5B24D 5BS7C 3WA9C 5AV8C 5CP6B 2BYKB 3AZKA 3AZHD 3X1TD 1AOID 4KUDB 4YM6A 4XZQD 5FUGB 3X1SC 3UT9C 3A6NC 4UUZB 1P3MA 2RIQA 4AWLB 3MGRA 1B6WA 1P3AB 5JRGB 2L5AA 1ID3D 1P3GC 1P3BB 3B0DB 1P34A 4YS3B 1ZLAD 3UTBC 1U35A 3KSYA 2YFVA 4Z5TD 3WTPC 1Z2CB 1ID3B 5G49B 5B33B 3REHB 5JA4A 4QLCC 4EO5B 4ZBJB 1H3OA 3VH5A 2Y2KA 3KWQD 5GSUB 3W98B 2YFWA 4H9OA 3REJB 5GT3D 3TU4A 5CPIB 4KGCB 2ZY4A 2F8NA 3UTAD 3B6FA 2Y2OA 4Z66B 2NQBB 3C1CC 4J8VB 4XUJB 4H9NA 1KX4D 3KUYD 5BNXB 4Z5TC 3AZGA 5AV6B 5KDMB 3WAAB 3AZKD 4YM6D 3LZ1C 4WU8C 5B31G 3FDDA 4G92B 3AZIB 3H0RC 3AZKB 4X23B 5GXQA 2AROB 1P3MD 5AV5D 3MGRD 3MGQC 5BS7A 1TZYB 4J8WD 3WA9A 5AV8A 3X1VC 1P34D 1F66D 3LZ0C 3AZLD 1U35D 5CHLB 5BT1D 3EPKA 3W99C 1P3KB 1KX5C 5B31C 5DNMC 1P3IC 3X1SA 3AFAB 3AV1C 3AZEB 3UT9A 3A6NA 1PZRA 4WZSB 1U35B 1P3LC 2YFVB 1EQZC 4DRAA 1P3GA 3NQJB 3MGSC 4J8UD 5JA4B 3UTBA 3TU4D 3WTPA 2F8NK 1H3OB 2F8ND 3B6GB 3B6FD 2NZDD 5AV5C 4G91B 3W97B 1BH9B 4UPKA 4QLCA 1F66C 2HIOC 3AZLC 4H9SC 2Y2GA 4H9PA 3NQJA 4XZQA 4H9QA 3AZGD 3AV2B 1T3UA 4H9NB 2FJ7C 2Y2JA 3A1KA 3AYWC 5BO0B 5B32D 3AZNC 3R45A 3C1CA 4E44A 4J8UC 5GXQD 5BNVA 3KXBB 4Z5TA 1S32C 3WA9D 2Y2HA 5AV8D 2NZDC 4NE5A 3EG5B 5AVBB 5B32G 3H0LC 1P3PC 4NFTA 1M19C 2DF4C 3LZ1A 2JCHA 3NQUA 4WU8A 3AN2C 2HUEB 3X1SD 3UT9D 5B40B 3A6ND 5GT3A 3MGQA 3AZJC 3X1VA 1P3GD 1TAFB 3O62B 3AZFB 5B32C 5AV9C 3LZ0A 4R8PB 4H9RA 3MGPB 3C1BC 5F99B 5CPKB 3WTPD 3W99A 3RELB 3AZMC 1KX5A 5B31A 5DNMA 1P3IA 3AV1A 3UTBB 3MNNC 5AY8B 1P3LA 4QLCD 5B1MC 1EQZA 5B24B 5E5AC 4WU9C 5DNND 3VH5T 3W96C 5B2JC 3MGSA 5B0ZC 3WKJD 1M18C 3AZHB 1AOIB 3X1TB 2XD1A 5C3IC 5B2IC 5AV5A 4H9PB 5B1LD 4XZQB 4J8WA 3C1CD 1F66A 2HIOA 5CPJD 3AZLA 3LELC 4H9SA 1P3OD 3MVDC 1BFMA 2W8SA 3A1IA 3R45B 1R4VA 1ZLAB 2Y2QA 4JJND 2Y2NA 2FJ7A 5BNVB 3AYWA 4Z5TB 3LZ1D 3REIC 3AZNA 4WU8D 4HGAC 5DNNC 3IP4C 5GT0D 3WKJC 4J8UA 4J8XC 2ZY2A 3MGQD 1S32A 3X1VD 3KWQB 2NZDA 5B1LC 1P3PA 3LZ0D 5GT3B 1JFIB 5CP6C 3MGQB 1M19A 3W99D 3UTAB 5CPJC 1KX5D 2RVQD 5B31D 5DNMD 1P3OC 3AN2A 1P3ID 3AV1D 4KUDC 1P3LD 1KX4B 4JJNC 3KUYB 1EQZD 3AZJA 2F8NH 3MGSD 4AWLC 5B32A 5AV9A 2JE5A 1P3AC 1N1JA 5GT0C 5JRGC 3C1BA 1P3BC 3AZMA 4Z2MG 4YM6B 2BYMA 3VH6W 3V9RA 4ZUXC 3MNNA 5B33C 2HIOD 5B1MA 1P3MB 5E5AA 4WU9A 3REHC 5AV5B 3MGRB 5B2JA 4J8WB 5B0ZA 2RVQC 4ZBJC 1P34B 1F66B 1A7WA 2HIOB 1M18A 2FJ7D 5GSUC 3B0CW 3AZLB 2JSSA 3REJC 5B2IA 3AYWD 5CPIC 4KGCC 3AZND 2FJ7B 4Z66C 3LELA 2NQBC 3MVDA 4J8VC 4XUJC 1S32D 1P3FD 2YFWB 4J8UB 4H9OB 1P3PD 2J8PA 3TU4B 5AV6C 1M19D 3REIA 2F8NB 3WAAC 2IO5B 5DNNA 3B6FB 2NZDB 3AN2D 3WKJA 4J8XA 1KX3C 4G92C 3AZIC 4KHAA 4X23C 3AZJD 2AROC 5B1LA 1BH8A 3REKD 5AV9D 3AZGB 1TZYC 3C1BD 5CP6A 3AZMD 5CPJA 1P3OA 5B32B 5AV9B 4KUDA 2VQRA 1P3KC 3MNND 1P3FC 4JJNA 1HQ3D 5GXQB 3AFAC 2PYOD 5B1MD 4E45A 3AZEC 5E5AD 4WU9D 2BYMB 4UUZA 3W96D 5B2JD 3WA9B 5AV8B 5B0ZD 3MNNB 1P3AA 5GT0A 1P3BA 1M18D 2Y2MA 5B2JB 3VH6A 5B2ID 2CV5C 4ZUXA 1ULYA 3X1SB 3B6GC 3UT9B 5B0YD 5G49A 3VH5W 5B33A 3A6NB 4G91C 3REKC 4LD9C 3W97C 3LELD 3REHA 3MVDD 1P3GB 4M6BA 3LJAC 5GSUA 3LELB 3REJA 3AV2C 3WTPB 1HQ3C 4KGCA 2PYOC 3REID 1M1AD 1W2EA 3X1UC 4J8XD 4Z66A 3WKJB 4QLCB 2NQBA 4WNNA 4J8VA 3REIB 4XUJA 5DNNB 5BNXA 4H9QB 3KXBC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CP6 D;  5AV6 A;  5B0Y C;  5AVB C;  2CWE A;  3WAA A;  5B1L B;  1BH8 B;  4KUD D;  3C1C B;  1KX3 A;  3AZI A;  2HUE C;  5CPJ B;  4X23 A;  5B40 C;  1P3O B;  2ARO A;  1M1A C;  1TZY A;  1P3A D;  5JRG D;  4JJN B;  1P3B D;  3O62 C;  4YS3 D;  3AZF C;  4R8P C;  5AVC C;  3NQU B;  5F99 C;  4WU8 B;  3LZ1 B;  3MGP C;  5CPK C;  4ZUX D;  5GT0 B;  1P3K A;  3REL C;  1P3F A;  5B33 D;  3AFA A;  3AZE A;  2LY8 A;  3REH D;  5AY8 C;  4CSR A;  4ZUX B;  3X1V B;  1F1E A;  5B24 C;  3LZ0 B;  5GSU D;  4H9R B;  3W98 D;  3REJ D;  2CV5 A;  3W99 B;  5CPI D;  4KGC D;  1KX5 B;  5B31 B;  3AZH C;  3X1T C;  5DNM B;  1AOI C;  1P3I B;  1B67 A;  3AV1 B;  3B6G A;  3REK A;  4XZQ C;  1P3L B;  4LD9 A;  3W97 A;  1BH9 A;  4Z66 D;  2NQB D;  4J8V D;  3B0D C;  1EQZ B;  4XUJ D;  4YS3 C;  3MGS B;  3LJA A;  1ID3 C;  1WWS A;  4WNN B;  3AV2 A;  5AV6 D;  1HQ3 A;  1ZLA C;  2PYO A;  3WAA D;  3W96 A;  3X1U A;  4EO5 C;  5BO0 A;  1KX3 D;  3AZI D;  3W98 C;  4WV4 B;  4X23 D;  2ARO D;  1WWI A;  3KXB A;  1KX3 B;  1TZY D;  3KWQ C;  5B0Y A;  5AVB A;  3AYW B;  5GT3 C;  3AZN B;  1P3K D;  3UTA C;  3AFA D;  3AZE D;  5B40 A;  1S32 B;  1KX4 C;  1M1A A;  3KUY C;  1P3F B;  1P3P B;  1TAF A;  3O62 A;  3AZF A;  3VH6 T;  4CSR B;  4DRB A;  1M19 B;  4R8P A;  4CAY A;  5AVC A;  5F99 A;  3MGP A;  5CPK A;  2CV5 D;  3AZK C;  3REL A;  3AN2 B;  4YM6 C;  3B6G D;  4LD9 D;  3W97 D;  2CV5 B;  5AY8 A;  3AZJ B;  3B0B A;  2BYK A;  5B24 A;  1P3M C;  3B0C T;  3REK B;  3MGR C;  3LJA D;  4J8W C;  4LD9 B;  1N1J B;  3C1B B;  5FUG A;  3AV2 D;  1P34 C;  3AZM B;  3AZH A;  1AOI A;  3X1T A;  4NE6 A;  1U35 C;  3V9R B;  3LJA B;  5BT1 C;  3X1U D;  2F8N G;  5JRG A;  1HQ3 B;  2PYO B;  5B1M B;  5E5A B;  4WU9 B;  4YS3 A;  3W96 B;  3X1U B;  5B0Z B;  3KXB D;  1ID3 A;  1M18 B;  1Q9C A;  1ZLA A;  5AVB D;  5C3I B;  1KU5 A;  5B2I B;  3TU4 C;  2IO5 C;  3B6F C;  5B0Y B;  3WTP E;  3W98 A;  5B40 D;  3MVD B;  5CPI A;  3KWQ A;  3O62 D;  3AZG C;  3AZF D;  1JFI A;  4R8P D;  5AVC D;  3MGP D;  5F99 D;  1M1A B;  4HGA B;  5CPK D;  4NE3 A;  3REL D;  3UTA A;  4J8X B;  4Z2M H;  3UTB D;  5AVC B;  4CAY B;  5AY8 D;  4KHA B;  1KX4 A;  5KDM A;  5GXQ C;  3KUY A;  5B24 D;  5BS7 C;  3WA9 C;  5AV8 C;  5CP6 B;  2BYK B;  3AZK A;  3AZH D;  3X1T D;  1AOI D;  4KUD B;  4YM6 A;  4XZQ D;  5FUG B;  3X1S C;  3UT9 C;  3A6N C;  4UUZ B;  1P3M A;  4AWL B;  3MGR A;  1B6W A;  1P3A B;  5JRG B;  2L5A A;  1ID3 D;  1P3G C;  1P3B B;  3B0D B;  1P34 A;  4YS3 B;  1ZLA D;  3UTB C;  1U35 A;  3KSY A;  2YFV A;  4Z5T D;  3WTP C;  1ID3 B;  5G49 B;  5B33 B;  3REH B;  5JA4 A;  4QLC C;  4EO5 B;  4ZBJ B;  1H3O A;  3VH5 A;  3KWQ D;  5GSU B;  3W98 B;  2YFW A;  4H9O A;  3REJ B;  5GT3 D;  3TU4 A;  5CPI B;  4KGC B;  2F8N A;  3UTA D;  3B6F A;  4Z66 B;  2NQB B;  3C1C C;  4J8V B;  4XUJ B;  4H9N A;  1KX4 D;  3KUY D;  5BNX B;  4Z5T C;  3AZG A;  5AV6 B;  5KDM B;  3WAA B;  3AZK D;  4YM6 D;  3LZ1 C;  4WU8 C;  5B31 G;  4G92 B;  3AZI B;  3AZK B;  4X23 B;  5GXQ A;  2ARO B;  1P3M D;  5AV5 D;  3MGR D;  3MGQ C;  5BS7 A;  1TZY B;  4J8W D;  3WA9 A;  5AV8 A;  3X1V C;  1P34 D;  1F66 D;  3LZ0 C;  3AZL D;  1U35 D;  5CHL B;  5BT1 D;  1P3K B;  3W99 C;  1KX5 C;  5B31 C;  5DNM C;  1P3I C;  3X1S A;  3AFA B;  3AV1 C;  3AZE B;  3UT9 A;  3A6N A;  4WZS B;  1U35 B;  1P3L C;  2YFV B;  1EQZ C;  4DRA A;  1P3G A;  3NQJ B;  3MGS C;  4J8U D;  5JA4 B;  3UTB A;  3TU4 D;  3WTP A;  2F8N K;  1H3O B;  2F8N D;  3B6G B;  3B6F D;  2NZD D;  5AV5 C;  4G91 B;  3W97 B;  1BH9 B;  4QLC A;  1F66 C;  2HIO C;  3AZL C;  4H9S C;  4H9P A;  3NQJ A;  4XZQ A;  4H9Q A;  3AZG D;  3AV2 B;  4H9N B;  2FJ7 C;  3AYW C;  5BO0 B;  5B32 D;  3AZN C;  3R45 A;  3C1C A;  4E44 A;  4J8U C;  5GXQ D;  5BNV A;  3KXB B;  4Z5T A;  1S32 C;  3WA9 D;  5AV8 D;  2NZD C;  4NE5 A;  5AVB B;  5B32 G;  1P3P C;  4NFT A;  1M19 C;  3LZ1 A;  3NQU A;  4WU8 A;  3AN2 C;  2HUE B;  3X1S D;  3UT9 D;  5B40 B;  3A6N D;  5GT3 A;  3MGQ A;  3AZJ C;  3X1V A;  1P3G D;  1TAF B;  3O62 B;  3AZF B;  5B32 C;  5AV9 C;  3LZ0 A;  4R8P B;  4H9R A;  3MGP B;  3C1B C;  5F99 B;  5CPK B;  3WTP D;  3W99 A;  3REL B;  3AZM C;  1KX5 A;  5B31 A;  5DNM A;  1P3I A;  3AV1 A;  3UTB B;  3MNN C;  5AY8 B;  1P3L A;  4QLC D;  5B1M C;  1EQZ A;  5B24 B;  5E5A C;  4WU9 C;  5DNN D;  3VH5 T;  3W96 C;  5B2J C;  3MGS A;  5B0Z C;  3WKJ D;  1M18 C;  3AZH B;  1AOI B;  3X1T B;  5C3I C;  5B2I C;  5AV5 A;  4H9P B;  5B1L D;  4XZQ B;  4J8W A;  3C1C D;  1F66 A;  2HIO A;  5CPJ D;  3AZL A;  3LEL C;  4H9S A;  1P3O D;  3MVD C;  1BFM A;  3R45 B;  1R4V A;  1ZLA B;  4JJN D;  2FJ7 A;  5BNV B;  3AYW A;  4Z5T B;  3LZ1 D;  3REI C;  3AZN A;  4WU8 D;  4HGA C;  5DNN C;  5GT0 D;  3WKJ C;  4J8U A;  4J8X C;  3MGQ D;  1S32 A;  3X1V D;  3KWQ B;  2NZD A;  5B1L C;  1P3P A;  3LZ0 D;  5GT3 B;  1JFI B;  5CP6 C;  3MGQ B;  1M19 A;  3W99 D;  3UTA B;  5CPJ C;  1KX5 D;  2RVQ D;  5B31 D;  5DNM D;  1P3O C;  3AN2 A;  1P3I D;  3AV1 D;  4KUD C;  1P3L D;  1KX4 B;  4JJN C;  3KUY B;  1EQZ D;  3AZJ A;  2F8N H;  3MGS D;  4AWL C;  5B32 A;  5AV9 A;  1P3A C;  1N1J A;  5GT0 C;  5JRG C;  3C1B A;  1P3B C;  3AZM A;  4Z2M G;  4YM6 B;  2BYM A;  3VH6 W;  3V9R A;  4ZUX C;  3MNN A;  5B33 C;  2HIO D;  5B1M A;  1P3M B;  5E5A A;  4WU9 A;  3REH C;  5AV5 B;  3MGR B;  5B2J A;  4J8W B;  5B0Z A;  2RVQ C;  4ZBJ C;  1P34 B;  1F66 B;  1A7W A;  2HIO B;  1M18 A;  2FJ7 D;  3B0C W;  5GSU C;  3AZL B;  2JSS A;  3REJ C;  5B2I A;  3AYW D;  5CPI C;  4KGC C;  3AZN D;  2FJ7 B;  4Z66 C;  3LEL A;  2NQB C;  3MVD A;  4J8V C;  4XUJ C;  1S32 D;  1P3F D;  2YFW B;  4J8U B;  4H9O B;  1P3P D;  3TU4 B;  5AV6 C;  1M19 D;  3REI A;  2F8N B;  3WAA C;  2IO5 B;  5DNN A;  3B6F B;  4H9Q B;  2NZD B;  3AN2 D;  3WKJ A;  4J8X A;  1KX3 C;  4G92 C;  3AZI C;  4KHA A;  4X23 C;  3AZJ D;  2ARO C;  5B1L A;  1BH8 A;  3REK D;  5AV9 D;  3AZG B;  1TZY C;  3C1B D;  5CP6 A;  3AZM D;  5CPJ A;  1P3O A;  5B32 B;  5AV9 B;  4KUD A;  1P3K C;  3MNN D;  1P3F C;  4JJN A;  1HQ3 D;  5GXQ B;  3AFA C;  2PYO D;  5B1M D;  4E45 A;  3AZE C;  5E5A D;  4WU9 D;  2BYM B;  4UUZ A;  3W96 D;  5B2J D;  3WA9 B;  5AV8 B;  5B0Z D;  3MNN B;  1P3A A;  5GT0 A;  1P3B A;  1M18 D;  5B2J B;  3VH6 A;  5B2I D;  2CV5 C;  4ZUX A;  1ULY A;  3X1S B;  3B6G C;  3UT9 B;  5G49 A;  3VH5 W;  5B33 A;  5B0Y D;  3A6N B;  4G91 C;  3REK C;  4LD9 C;  3W97 C;  3LEL D;  3REH A;  3MVD D;  1P3G B;  4M6B A;  3LJA C;  5GSU A;  3LEL B;  3REJ A;  3AV2 C;  3WTP B;  1HQ3 C;  4KGC A;  2PYO C;  3REI D;  1M1A D;  3X1U C;  4J8X D;  4Z66 A;  3WKJ B;  4QLC B;  2NQB A;  4WNN A;  4J8V A;  3REI B;  4XUJ A;  5DNN B;  5BNX A;  1HTA A;  3KXB C; 
#chains in the Genus database with same CATH topology
 2Y2P A;  5CP6 D;  5AV6 A;  5B0Y C;  2ZM5 A;  5AVB C;  2CWE A;  3WAA A;  5B1L B;  1BH8 B;  4KUD D;  2ZY5 A;  3C1C B;  1KX3 A;  3AZI A;  2HUE C;  5CPJ B;  4X23 A;  5B40 C;  1P3O B;  2ARO A;  1M1A C;  1TZY A;  1P3A D;  5JRG D;  4JJN B;  1P3B D;  3O62 C;  4YS3 D;  3AZF C;  2Y2I A;  4R8P C;  5AVC C;  3NQU B;  5F99 C;  4WU8 B;  3LZ1 B;  3MGP C;  5CPK C;  4ZUX D;  2XD5 A;  2G5I C;  5GT0 B;  4DQY B;  3REL C;  1P3K A;  1P3F A;  5B33 D;  3AFA A;  3AZE A;  2LY8 A;  3REH D;  5AY8 C;  4CSR A;  4ZUX B;  3X1V B;  3KFU G;  1F1E A;  2UWX A;  5B24 C;  3LZ0 B;  5GSU D;  4H9R B;  3W98 D;  3REJ D;  2CV5 A;  3W99 B;  5CPI D;  4KGC D;  1KX5 B;  5B31 B;  3AZH C;  3X1T C;  5DNM B;  1AOI C;  1P3I B;  1B67 A;  3AV1 B;  3B6G A;  3REK A;  4XZQ C;  1P3L B;  4LD9 A;  3W97 A;  1BH9 A;  4Z66 D;  2NQB D;  4J8V D;  3B0D C;  1EQZ B;  4XUJ D;  4YS3 C;  3MGS B;  3LJA A;  3H0M C;  1ID3 C;  2BG1 A;  1WWS A;  4WNN B;  3AV2 A;  5AV6 D;  1HQ3 A;  1ZLA C;  2PYO A;  3WAA D;  3W96 A;  2G5H C;  3X1U A;  4EO5 C;  5BO0 A;  1KX3 D;  3AZI D;  3W98 C;  4WV4 B;  4X23 D;  2ARO D;  1WWI A;  3KXB A;  1KX3 B;  1TZY D;  2DQN C;  3KWQ C;  5B0Y A;  2FFF B;  5AVB A;  3AYW B;  5GT3 C;  3AZN B;  1P3K D;  3UTA C;  3AFA D;  2F2A C;  3AZE D;  5B40 A;  1S32 B;  1KX4 C;  1M1A A;  3KUY C;  1P3F B;  1P3P B;  1TAF A;  3O62 A;  3AZF A;  3VH6 T;  4CSR B;  4DRB A;  1M19 B;  4R8P A;  4CAY A;  5AVC A;  5F99 A;  3MGP A;  5CPK A;  2CV5 D;  3AZK C;  3REL A;  3AN2 B;  3EPL A;  4WJ3 C;  4YM6 C;  3B6G D;  4LD9 D;  3W97 D;  2CV5 B;  5AY8 A;  3AZJ B;  3B0B A;  2BYK A;  5B24 A;  1P3M C;  3B0C T;  3REK B;  3MGR C;  3LJA D;  2ZY3 A;  4J8W C;  1N1J B;  4LD9 B;  3C1B B;  5FUG A;  3AV2 D;  1P34 C;  3AZM B;  3AZH A;  1AOI A;  3X1T A;  4NE6 A;  1U35 C;  3V9R B;  3LJA B;  5BT1 C;  3X1U D;  3EPH A;  2F8N G;  5JRG A;  1HQ3 B;  2PYO B;  5B1M B;  5E5A B;  4WU9 B;  4YS3 A;  3W96 B;  3X1U B;  5B0Z B;  3KXB D;  1ID3 A;  3EPJ A;  1M18 B;  1Q9C A;  1ZLA A;  5AVB D;  5C3I B;  1KU5 A;  5B2I B;  3TU4 C;  2IO5 C;  3P5J B;  5B0Y B;  3B6F C;  3WTP E;  3W98 A;  5B40 D;  3MVD B;  3F6T A;  5CPI A;  2Y2L A;  3KWQ A;  3O62 D;  3AZG C;  3AZF D;  1JFI A;  1HTA A;  4R8P D;  5AVC D;  3MGP D;  5F99 D;  1M1A B;  4HGA B;  5CPK D;  3AL0 C;  4NE3 A;  3REL D;  3UTA A;  4J8X B;  4Z2M H;  3UTB D;  5AVC B;  4CAY B;  5AY8 D;  4KHA B;  1KX4 A;  5KDM A;  5GXQ C;  3KUY A;  5B24 D;  5BS7 C;  3WA9 C;  5AV8 C;  5CP6 B;  2BYK B;  3AZK A;  3AZH D;  3X1T D;  1AOI D;  4KUD B;  4YM6 A;  4XZQ D;  5FUG B;  3X1S C;  3UT9 C;  3A6N C;  4UUZ B;  1P3M A;  2RIQ A;  4AWL B;  3MGR A;  1B6W A;  1P3A B;  5JRG B;  2L5A A;  1ID3 D;  1P3G C;  1P3B B;  3B0D B;  1P34 A;  4YS3 B;  1ZLA D;  3UTB C;  1U35 A;  3KSY A;  2YFV A;  4Z5T D;  3WTP C;  1Z2C B;  1ID3 B;  5G49 B;  5B33 B;  3REH B;  5JA4 A;  4QLC C;  4EO5 B;  4ZBJ B;  1H3O A;  3VH5 A;  2Y2K A;  3KWQ D;  5GSU B;  3W98 B;  2YFW A;  4H9O A;  3REJ B;  5GT3 D;  3TU4 A;  5CPI B;  4KGC B;  2ZY4 A;  2F8N A;  3UTA D;  3B6F A;  2Y2O A;  4Z66 B;  2NQB B;  3C1C C;  4J8V B;  4XUJ B;  4H9N A;  1KX4 D;  3KUY D;  5BNX B;  4Z5T C;  3AZG A;  5AV6 B;  5KDM B;  3WAA B;  3AZK D;  4YM6 D;  3LZ1 C;  4WU8 C;  5B31 G;  3FDD A;  4G92 B;  3AZI B;  3H0R C;  3AZK B;  4X23 B;  5GXQ A;  2ARO B;  1P3M D;  5AV5 D;  3MGR D;  3MGQ C;  5BS7 A;  1TZY B;  4J8W D;  3WA9 A;  5AV8 A;  3X1V C;  1P34 D;  1F66 D;  3LZ0 C;  3AZL D;  1U35 D;  5CHL B;  5BT1 D;  3EPK A;  3W99 C;  1P3K B;  1KX5 C;  5B31 C;  5DNM C;  1P3I C;  3X1S A;  3AFA B;  3AV1 C;  3AZE B;  3UT9 A;  3A6N A;  1PZR A;  4WZS B;  1U35 B;  1P3L C;  2YFV B;  1EQZ C;  4DRA A;  1P3G A;  3NQJ B;  3MGS C;  4J8U D;  5JA4 B;  3UTB A;  3TU4 D;  3WTP A;  2F8N K;  1H3O B;  2F8N D;  3B6G B;  3B6F D;  2NZD D;  5AV5 C;  4G91 B;  3W97 B;  1BH9 B;  4UPK A;  4QLC A;  1F66 C;  2HIO C;  3AZL C;  4H9S C;  2Y2G A;  4H9P A;  3NQJ A;  4XZQ A;  4H9Q A;  3AZG D;  3AV2 B;  1T3U A;  4H9N B;  2FJ7 C;  2Y2J A;  3A1K A;  3AYW C;  5BO0 B;  5B32 D;  3AZN C;  3R45 A;  3C1C A;  4E44 A;  4J8U C;  5GXQ D;  5BNV A;  3KXB B;  4Z5T A;  1S32 C;  3WA9 D;  2Y2H A;  5AV8 D;  2NZD C;  4NE5 A;  3EG5 B;  5AVB B;  5B32 G;  3H0L C;  1P3P C;  4NFT A;  1M19 C;  2DF4 C;  3LZ1 A;  2JCH A;  3NQU A;  4WU8 A;  3AN2 C;  2HUE B;  3X1S D;  3UT9 D;  5B40 B;  3A6N D;  5GT3 A;  3MGQ A;  3AZJ C;  3X1V A;  1P3G D;  1TAF B;  3O62 B;  3AZF B;  5B32 C;  5AV9 C;  3LZ0 A;  4R8P B;  4H9R A;  3MGP B;  3C1B C;  5F99 B;  5CPK B;  3WTP D;  3W99 A;  3REL B;  3AZM C;  1KX5 A;  5B31 A;  5DNM A;  1P3I A;  3AV1 A;  3UTB B;  3MNN C;  5AY8 B;  1P3L A;  4QLC D;  5B1M C;  1EQZ A;  5B24 B;  5E5A C;  4WU9 C;  5DNN D;  3VH5 T;  3W96 C;  5B2J C;  3MGS A;  5B0Z C;  3WKJ D;  1M18 C;  3AZH B;  1AOI B;  3X1T B;  2XD1 A;  5C3I C;  5B2I C;  5AV5 A;  4H9P B;  5B1L D;  4XZQ B;  4J8W A;  3C1C D;  1F66 A;  2HIO A;  5CPJ D;  3AZL A;  3LEL C;  4H9S A;  1P3O D;  3MVD C;  1BFM A;  2W8S A;  3A1I A;  3R45 B;  1R4V A;  1ZLA B;  2Y2Q A;  4JJN D;  2Y2N A;  2FJ7 A;  5BNV B;  3AYW A;  4Z5T B;  3LZ1 D;  3REI C;  3AZN A;  4WU8 D;  4HGA C;  5DNN C;  3IP4 C;  5GT0 D;  3WKJ C;  4J8U A;  4J8X C;  2ZY2 A;  3MGQ D;  1S32 A;  3X1V D;  3KWQ B;  2NZD A;  5B1L C;  1P3P A;  3LZ0 D;  5GT3 B;  1JFI B;  5CP6 C;  3MGQ B;  1M19 A;  3W99 D;  3UTA B;  5CPJ C;  1KX5 D;  2RVQ D;  5B31 D;  5DNM D;  1P3O C;  3AN2 A;  1P3I D;  3AV1 D;  4KUD C;  1P3L D;  1KX4 B;  4JJN C;  3KUY B;  1EQZ D;  3AZJ A;  2F8N H;  3MGS D;  4AWL C;  5B32 A;  5AV9 A;  2JE5 A;  1P3A C;  1N1J A;  5GT0 C;  5JRG C;  3C1B A;  1P3B C;  3AZM A;  4Z2M G;  4YM6 B;  2BYM A;  3VH6 W;  3V9R A;  4ZUX C;  3MNN A;  5B33 C;  2HIO D;  5B1M A;  1P3M B;  5E5A A;  4WU9 A;  3REH C;  5AV5 B;  3MGR B;  5B2J A;  4J8W B;  5B0Z A;  2RVQ C;  4ZBJ C;  1P34 B;  1F66 B;  1A7W A;  2HIO B;  1M18 A;  2FJ7 D;  5GSU C;  3B0C W;  3AZL B;  2JSS A;  3REJ C;  5B2I A;  3AYW D;  5CPI C;  4KGC C;  3AZN D;  2FJ7 B;  4Z66 C;  3LEL A;  2NQB C;  3MVD A;  4J8V C;  4XUJ C;  1S32 D;  1P3F D;  2YFW B;  4J8U B;  4H9O B;  1P3P D;  2J8P A;  3TU4 B;  5AV6 C;  1M19 D;  3REI A;  2F8N B;  3WAA C;  2IO5 B;  5DNN A;  3B6F B;  2NZD B;  3AN2 D;  3WKJ A;  4J8X A;  1KX3 C;  4G92 C;  3AZI C;  4KHA A;  4X23 C;  3AZJ D;  2ARO C;  5B1L A;  1BH8 A;  3REK D;  5AV9 D;  3AZG B;  1TZY C;  3C1B D;  5CP6 A;  3AZM D;  5CPJ A;  1P3O A;  5B32 B;  5AV9 B;  4KUD A;  2VQR A;  1P3K C;  3MNN D;  1P3F C;  4JJN A;  1HQ3 D;  5GXQ B;  3AFA C;  2PYO D;  5B1M D;  4E45 A;  3AZE C;  5E5A D;  4WU9 D;  2BYM B;  4UUZ A;  3W96 D;  5B2J D;  3WA9 B;  5AV8 B;  5B0Z D;  3MNN B;  1P3A A;  5GT0 A;  1P3B A;  1M18 D;  2Y2M A;  5B2J B;  3VH6 A;  5B2I D;  2CV5 C;  4ZUX A;  1ULY A;  3X1S B;  3B6G C;  3UT9 B;  5B0Y D;  5G49 A;  3VH5 W;  5B33 A;  3A6N B;  4G91 C;  3REK C;  4LD9 C;  3W97 C;  3LEL D;  3REH A;  3MVD D;  1P3G B;  4M6B A;  3LJA C;  5GSU A;  3LEL B;  3REJ A;  3AV2 C;  3WTP B;  1HQ3 C;  4KGC A;  2PYO C;  3REI D;  1M1A D;  1W2E A;  3X1U C;  4J8X D;  4Z66 A;  3WKJ B;  4QLC B;  2NQB A;  4WNN A;  4J8V A;  3REI B;  4XUJ A;  5DNN B;  5BNX A;  4H9Q B;  3KXB C; 
#chains in the Genus database with same CATH homology
 2Y2P A;  5CP6 D;  5AV6 A;  5B0Y C;  2ZM5 A;  5AVB C;  2CWE A;  3WAA A;  5B1L B;  1BH8 B;  4KUD D;  2ZY5 A;  3C1C B;  1KX3 A;  3AZI A;  2HUE C;  5CPJ B;  4X23 A;  5B40 C;  1P3O B;  2ARO A;  1M1A C;  1TZY A;  1P3A D;  5JRG D;  4JJN B;  1P3B D;  3O62 C;  4YS3 D;  3AZF C;  2Y2I A;  4R8P C;  5AVC C;  3NQU B;  5F99 C;  4WU8 B;  3LZ1 B;  3MGP C;  5CPK C;  4ZUX D;  2XD5 A;  2G5I C;  5GT0 B;  4DQY B;  3REL C;  1P3K A;  1P3F A;  5B33 D;  3AFA A;  3AZE A;  2LY8 A;  3REH D;  5AY8 C;  4CSR A;  4ZUX B;  3X1V B;  3KFU G;  1F1E A;  2UWX A;  5B24 C;  3LZ0 B;  5GSU D;  4H9R B;  3W98 D;  3REJ D;  2CV5 A;  3W99 B;  5CPI D;  4KGC D;  1KX5 B;  5B31 B;  3AZH C;  3X1T C;  5DNM B;  1AOI C;  1P3I B;  1B67 A;  3AV1 B;  3B6G A;  3REK A;  4XZQ C;  1P3L B;  4LD9 A;  3W97 A;  1BH9 A;  4Z66 D;  2NQB D;  4J8V D;  3B0D C;  1EQZ B;  4XUJ D;  4YS3 C;  3MGS B;  3LJA A;  3H0M C;  1ID3 C;  2BG1 A;  1WWS A;  4WNN B;  3AV2 A;  5AV6 D;  1HQ3 A;  1ZLA C;  2PYO A;  3WAA D;  3W96 A;  2G5H C;  3X1U A;  4EO5 C;  5BO0 A;  1KX3 D;  3AZI D;  3W98 C;  4WV4 B;  4X23 D;  2ARO D;  1WWI A;  3KXB A;  1KX3 B;  1TZY D;  2DQN C;  3KWQ C;  5B0Y A;  2FFF B;  5AVB A;  3AYW B;  5GT3 C;  3AZN B;  1P3K D;  3UTA C;  3AFA D;  2F2A C;  3AZE D;  5B40 A;  1S32 B;  1KX4 C;  1M1A A;  3KUY C;  1P3F B;  1P3P B;  1TAF A;  3O62 A;  3AZF A;  3VH6 T;  4CSR B;  4DRB A;  1M19 B;  4R8P A;  4CAY A;  5AVC A;  5F99 A;  3MGP A;  5CPK A;  2CV5 D;  3AZK C;  3REL A;  3AN2 B;  3EPL A;  4WJ3 C;  4YM6 C;  3B6G D;  4LD9 D;  3W97 D;  2CV5 B;  5AY8 A;  3AZJ B;  3B0B A;  2BYK A;  5B24 A;  1P3M C;  3B0C T;  3REK B;  3MGR C;  3LJA D;  2ZY3 A;  4J8W C;  1N1J B;  4LD9 B;  3C1B B;  5FUG A;  3AV2 D;  1P34 C;  3AZM B;  3AZH A;  1AOI A;  3X1T A;  4NE6 A;  1U35 C;  3V9R B;  3LJA B;  5BT1 C;  3X1U D;  3EPH A;  2F8N G;  5JRG A;  1HQ3 B;  2PYO B;  5B1M B;  5E5A B;  4WU9 B;  4YS3 A;  3W96 B;  3X1U B;  5B0Z B;  3KXB D;  1ID3 A;  3EPJ A;  1M18 B;  1Q9C A;  1ZLA A;  5AVB D;  5C3I B;  1KU5 A;  5B2I B;  3TU4 C;  2IO5 C;  3P5J B;  5B0Y B;  3B6F C;  3WTP E;  3W98 A;  5B40 D;  3MVD B;  3F6T A;  5CPI A;  2Y2L A;  3KWQ A;  3O62 D;  3AZG C;  3AZF D;  1JFI A;  1HTA A;  4R8P D;  5AVC D;  3MGP D;  5F99 D;  1M1A B;  4HGA B;  5CPK D;  3AL0 C;  4NE3 A;  3REL D;  3UTA A;  4J8X B;  4Z2M H;  3UTB D;  5AVC B;  4CAY B;  5AY8 D;  4KHA B;  1KX4 A;  5KDM A;  5GXQ C;  3KUY A;  5B24 D;  5BS7 C;  3WA9 C;  5AV8 C;  5CP6 B;  2BYK B;  3AZK A;  3AZH D;  3X1T D;  1AOI D;  4KUD B;  4YM6 A;  4XZQ D;  5FUG B;  3X1S C;  3UT9 C;  3A6N C;  4UUZ B;  1P3M A;  2RIQ A;  4AWL B;  3MGR A;  1B6W A;  1P3A B;  5JRG B;  2L5A A;  1ID3 D;  1P3G C;  1P3B B;  3B0D B;  1P34 A;  4YS3 B;  1ZLA D;  3UTB C;  1U35 A;  3KSY A;  2YFV A;  4Z5T D;  3WTP C;  1Z2C B;  1ID3 B;  5G49 B;  5B33 B;  3REH B;  5JA4 A;  4QLC C;  4EO5 B;  4ZBJ B;  1H3O A;  3VH5 A;  2Y2K A;  3KWQ D;  5GSU B;  3W98 B;  2YFW A;  4H9O A;  3REJ B;  5GT3 D;  3TU4 A;  5CPI B;  4KGC B;  2ZY4 A;  2F8N A;  3UTA D;  3B6F A;  2Y2O A;  4Z66 B;  2NQB B;  3C1C C;  4J8V B;  4XUJ B;  4H9N A;  1KX4 D;  3KUY D;  5BNX B;  4Z5T C;  3AZG A;  5AV6 B;  5KDM B;  3WAA B;  3AZK D;  4YM6 D;  3LZ1 C;  4WU8 C;  5B31 G;  3FDD A;  4G92 B;  3AZI B;  3H0R C;  3AZK B;  4X23 B;  5GXQ A;  2ARO B;  1P3M D;  5AV5 D;  3MGR D;  3MGQ C;  5BS7 A;  1TZY B;  4J8W D;  3WA9 A;  5AV8 A;  3X1V C;  1P34 D;  1F66 D;  3LZ0 C;  3AZL D;  1U35 D;  5CHL B;  5BT1 D;  3EPK A;  3W99 C;  1P3K B;  1KX5 C;  5B31 C;  5DNM C;  1P3I C;  3X1S A;  3AFA B;  3AV1 C;  3AZE B;  3UT9 A;  3A6N A;  1PZR A;  4WZS B;  1U35 B;  1P3L C;  2YFV B;  1EQZ C;  4DRA A;  1P3G A;  3NQJ B;  3MGS C;  4J8U D;  5JA4 B;  3UTB A;  3TU4 D;  3WTP A;  2F8N K;  1H3O B;  2F8N D;  3B6G B;  3B6F D;  2NZD D;  5AV5 C;  4G91 B;  3W97 B;  1BH9 B;  4UPK A;  4QLC A;  1F66 C;  2HIO C;  3AZL C;  4H9S C;  2Y2G A;  4H9P A;  3NQJ A;  4XZQ A;  4H9Q A;  3AZG D;  3AV2 B;  1T3U A;  4H9N B;  2FJ7 C;  2Y2J A;  3A1K A;  3AYW C;  5BO0 B;  5B32 D;  3AZN C;  3R45 A;  3C1C A;  4E44 A;  4J8U C;  5GXQ D;  5BNV A;  3KXB B;  4Z5T A;  1S32 C;  3WA9 D;  2Y2H A;  5AV8 D;  2NZD C;  4NE5 A;  3EG5 B;  5AVB B;  5B32 G;  3H0L C;  1P3P C;  4NFT A;  1M19 C;  2DF4 C;  3LZ1 A;  2JCH A;  3NQU A;  4WU8 A;  3AN2 C;  2HUE B;  3X1S D;  3UT9 D;  5B40 B;  3A6N D;  5GT3 A;  3MGQ A;  3AZJ C;  3X1V A;  1P3G D;  1TAF B;  3O62 B;  3AZF B;  5B32 C;  5AV9 C;  3LZ0 A;  4R8P B;  4H9R A;  3MGP B;  3C1B C;  5F99 B;  5CPK B;  3WTP D;  3W99 A;  3REL B;  3AZM C;  1KX5 A;  5B31 A;  5DNM A;  1P3I A;  3AV1 A;  3UTB B;  3MNN C;  5AY8 B;  1P3L A;  4QLC D;  5B1M C;  1EQZ A;  5B24 B;  5E5A C;  4WU9 C;  5DNN D;  3VH5 T;  3W96 C;  5B2J C;  3MGS A;  5B0Z C;  3WKJ D;  1M18 C;  3AZH B;  1AOI B;  3X1T B;  2XD1 A;  5C3I C;  5B2I C;  5AV5 A;  4H9P B;  5B1L D;  4XZQ B;  4J8W A;  3C1C D;  1F66 A;  2HIO A;  5CPJ D;  3AZL A;  3LEL C;  4H9S A;  1P3O D;  3MVD C;  1BFM A;  2W8S A;  3A1I A;  3R45 B;  1R4V A;  1ZLA B;  2Y2Q A;  4JJN D;  2Y2N A;  2FJ7 A;  5BNV B;  3AYW A;  4Z5T B;  3LZ1 D;  3REI C;  3AZN A;  4WU8 D;  4HGA C;  5DNN C;  3IP4 C;  5GT0 D;  3WKJ C;  4J8U A;  4J8X C;  2ZY2 A;  3MGQ D;  1S32 A;  3X1V D;  3KWQ B;  2NZD A;  5B1L C;  1P3P A;  3LZ0 D;  5GT3 B;  1JFI B;  5CP6 C;  3MGQ B;  1M19 A;  3W99 D;  3UTA B;  5CPJ C;  1KX5 D;  2RVQ D;  5B31 D;  5DNM D;  1P3O C;  3AN2 A;  1P3I D;  3AV1 D;  4KUD C;  1P3L D;  1KX4 B;  4JJN C;  3KUY B;  1EQZ D;  3AZJ A;  2F8N H;  3MGS D;  4AWL C;  5B32 A;  5AV9 A;  2JE5 A;  1P3A C;  1N1J A;  5GT0 C;  5JRG C;  3C1B A;  1P3B C;  3AZM A;  4Z2M G;  4YM6 B;  2BYM A;  3VH6 W;  3V9R A;  4ZUX C;  3MNN A;  5B33 C;  2HIO D;  5B1M A;  1P3M B;  5E5A A;  4WU9 A;  3REH C;  5AV5 B;  3MGR B;  5B2J A;  4J8W B;  5B0Z A;  2RVQ C;  4ZBJ C;  1P34 B;  1F66 B;  1A7W A;  2HIO B;  1M18 A;  2FJ7 D;  5GSU C;  3B0C W;  3AZL B;  2JSS A;  3REJ C;  5B2I A;  3AYW D;  5CPI C;  4KGC C;  3AZN D;  2FJ7 B;  4Z66 C;  3LEL A;  2NQB C;  3MVD A;  4J8V C;  4XUJ C;  1S32 D;  1P3F D;  2YFW B;  4J8U B;  4H9O B;  1P3P D;  2J8P A;  3TU4 B;  5AV6 C;  1M19 D;  3REI A;  2F8N B;  3WAA C;  2IO5 B;  5DNN A;  3B6F B;  2NZD B;  3AN2 D;  3WKJ A;  4J8X A;  1KX3 C;  4G92 C;  3AZI C;  4KHA A;  4X23 C;  3AZJ D;  2ARO C;  5B1L A;  1BH8 A;  3REK D;  5AV9 D;  3AZG B;  1TZY C;  3C1B D;  5CP6 A;  3AZM D;  5CPJ A;  1P3O A;  5B32 B;  5AV9 B;  4KUD A;  2VQR A;  1P3K C;  3MNN D;  1P3F C;  4JJN A;  1HQ3 D;  5GXQ B;  3AFA C;  2PYO D;  5B1M D;  4E45 A;  3AZE C;  5E5A D;  4WU9 D;  2BYM B;  4UUZ A;  3W96 D;  5B2J D;  3WA9 B;  5AV8 B;  5B0Z D;  3MNN B;  1P3A A;  5GT0 A;  1P3B A;  1M18 D;  2Y2M A;  5B2J B;  3VH6 A;  5B2I D;  2CV5 C;  4ZUX A;  1ULY A;  3X1S B;  3B6G C;  3UT9 B;  5B0Y D;  5G49 A;  3VH5 W;  5B33 A;  3A6N B;  4G91 C;  3REK C;  4LD9 C;  3W97 C;  3LEL D;  3REH A;  3MVD D;  1P3G B;  4M6B A;  3LJA C;  5GSU A;  3LEL B;  3REJ A;  3AV2 C;  3WTP B;  1HQ3 C;  4KGC A;  2PYO C;  3REI D;  1M1A D;  1W2E A;  3X1U C;  4J8X D;  4Z66 A;  3WKJ B;  4QLC B;  2NQB A;  4WNN A;  4J8V A;  3REI B;  4XUJ A;  5DNN B;  5BNX A;  4H9Q B;  3KXB C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...