1P3IA

Crystallographic studies of nucleosome core particles containing histone 'sin' mutants
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
98
structure length
98
Chain Sequence
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Palindromic 146bp Human Alpha-Satellite DNA fragment
publication title Crystal structures of histone Sin mutant nucleosomes reveal altered protein-DNA interactions
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 32
structure length 98
sequence length 98
chains with identical sequence E
ec nomenclature
pdb deposition date 2003-04-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1p3iA00
5B24B 3WKJA 1WWSA 4CSRA 3AYWA 4J8XB 3X1VC 1ID3D 5AV8B 3MVDC 5G49A 3MGRB 4H9QB 3UTAC 4HGAB 3AZLD 3AZHA 3AV2D 1KX5C 3A6ND 5GT0D 4R8PB 2AROC 5B31B 2HIOB 4XZQA 5GXQC 5CPJA 4H9PA 5E5AB 2NZDA 5BT1C 4ZUXD 5AVBC 3W97A 2HUEB 4YM6B 3AZLB 3WKJB 3AYWB 1P3IC 3X1TA 1P3GC 5B0YD 5BNXA 3REKD 5JRGD 5G49B 3LZ1D 3AZHB 5B1MC 3REHA 3RELC 4XZQB 3VH5W 3O62D 3KXBB 4H9PB 5CPJB 2NZDB 3R45A 5GSUA 3X1SC 5B40D 5FUGA 1KX3A 3X1TB 5BNXB 4Z2MH 1HQ3A 5CPIC 4NE6A 5AY8C 3AZJA 3AZEC 3UTBA 3WAAC 1KX4C 3X1VD 1ULYA 5C3IB 3W98A 3MVDD 3R45B 1M18C 3UTAD 5GSUB 1TAFA 4WNNA 1P3PD 2AROD 1P34C 5GXQD 3AV1C 4Z2MG 5BT1D 5DNNA 4G92B 1HTAA 1HQ3B 3KUYB 3AZNC 3MGSB 3AZJB 3LZ0A 5AV6A 1P3LB 3UTBB 1P3ID 3VH6W 1P3GD 2YFVA 3W98B 3B6FA 1P3AA 5B1MD 1TAFB 4WNNB 3RELD 4WU8A 5DNNB 3WTPA 3LJAB 2F8NA 3B6GA 1P3BC 4QLCA 5AVCA 3LZ0B 5AV9C 5B33C 1B67A 2YFVB 4LD9A 5CPID 3B6FB 5AY8D 2NQBC 1P3AB 3AZED 1EQZC 3LELB 1R4VA 5DNMA 1KX4D 3REIA 3WAAD 3V9RA 4J8UC 4WU8B 4J8VC 5B32C 1M18D 2F8NB 5B24C 3B6GB 4J8XC 3UT9C 5AVCB 5F99A 4QLCB 1P34D 4CAYA 5AV8C 3AV1D 3MNNA 2CV5B 3MGRC 4HGAC 4LD9B 4Z5TD 3KWQA 3AZND 3TU4B 4WU9A 4R8PC 5B31C 2HIOC 5GT3A 1M1AA 5E5AC 5CPKA 3AZMD 3AZGA 2HUEC 4YM6C 4Z66D 3AV2C 3AZLC 3VH5A 3WKJC 3AYWC 5F99B 3AZMB 1P3BD 1P3FD 3AZHC 4WU9B 5B0ZA 3WTPE 3KWQB 5AV9D 5GT3B 3AZKA 1M1AB 4G91B 4XZQC 3KXBC 2NZDC 3REKC 1F66A 3VH6T 1EQZD 2FJ7A 4JJNA 1P3KA 3W96A 3O62C 4J8UD 4J8VD 3AZFA 3X1TC 1TZYB 5B24D 4J8XD 5B0ZB 5B2IA 3NQUA 3AZKB 5AV5B 3MGPA 5AV8D 5C3IC 1M19A 3X1UA 4KUDA 2F8NK 3MGRD 4H9NB 5GSUC 1F66B 1WWIA 2IO5B 5CHLB 4R8PD 5B31D 3VH6A 2HIOD 2FJ7B 1S32B 5E5AD 1P3KB 4ZBJC 4G92C 3AZFB 4UUZA 1HQ3C 3KUYC 4YM6D 4KGCA 3WKJD 3MGSC 4H9SC 3AZJC 3AYWD 1P3LC 1P3PC 3UTBC 5B2IB 1P3MA 1AOIB 1M19B 3X1UB 3W98C 4KUDB 5KDMA 4H9RA 3AZHD 4CSRB 3C1CA 1ID3A 4NE3A 4XZQD 3KXBD 5CPJD 2NZDD 5DNNC 5B1LA 3LJAC 4UUZB 3AN2A 3A6NA 2PYOA 4KGCB 3AZIA 3LZ0C 3WA9A 5CP6A 5JA4A 3REJA 4DRBA 4ZUXA 3X1TD 5BS7C 3B6FC 3W97B 4H9RB 1P3AC 1ZLAA 3LELC 1P3OA 3C1CB 3LZ1A 5B1LB 5GSUD 3B6GC 3AN2B 1H3OA 4QLCC 5AVCC 3AZIB 3WA9B 5CP6B 3REHB 3REJB 2CV5C 3AFAA 2F8NH 4LD9C 1HQ3D 5B40A 3KUYD 5BNVA 3TU4C 3MGSD 3AZJD 1ZLAB 1P3LD 3UTBD 5FUGB 1P3OB 3W98D 1KX3B 3B0DB 4Z5TC 4E44A 1H3OB 5F99C 2F8NG 5DNND 3LJAD 3AFAB 3AZMC 1KX5A 1U35A 4Z66C 4WU9C 3NQJA 3LZ0D 5GT3C 5AV6D 5GXQA 4G91C 1M1AC 5AVBA 3B6FD 1P3FC 1P3AD 3LELD 5AV6B 4WZSB 4WU8D 1TZYC 1KX5B 2F8ND 3B6GD 1U35B 4DRAA 4NFTA 4QLCD 5AVCD 5B0ZC 3NQJB 3RELA 3AZKC 5AV5C 1Q9CA 1N1JA 2CV5D 3VH5T 3X1SA 5AVBB 3WTPB 1F66C 2YFWA 4LD9D 3TU4D 2IO5C 2FJ7C 1S32C 1P3KC 5CPIA 5AY8A 3W99A 3AZEA 1F1EA 1KX4A 5F99D 5B2IC 1AOIC 5DNMB 3REIB 3V9RB 3C1BA 1N1JB 4WU9D 3KWQD 3MGQA 4YS3A 5GT3D 1P34A 1M1AD 3AV1A 4CAYB 1JFIA 3MNNB 2LY8A 3AZGD 3AZNA 3W99B 4KGCC 4KHAA 5CPJC 5B2JA 3C1BB 4XUJA 1TZYD 3B0BA 5CPKB 3W97C 3AZGB 5B0ZD 3MGQB 3AZKD 5AV5D 4YS3B 4H9OA 1P3BA 1JFIB 1F66D 3AN2C 2BYMA 4AWLB 5B33A 2FJ7D 3AZIC 1S32D 3WA9C 5CP6C 3REHC 4KHAB 3REJC 1P3KD 5B2JB 3AZFD 4XUJB 2NQBA 4J8WA 1ZLAC 1AOID 5B2ID 4X23A 4JJNB 1M19D 4J8UA 3B0CW 3X1UD 3W96B 4KUDD 5B32A 1KX3C 3B0DC 3UT9A 5B33B 5AV8A 3NQUB 3KSYA 3MGPB 3MGRA 4H9QA 3AFAC 2CWEA 4R8PA 4KGCD 2NQBB 4J8WB 4X23B 5B32B 4YM6A 3AV2A 3AZLA 3W97D 5GT0A 3UT9B 3C1CD 5AV6C 1P3MB 5B1LD 5KDMB 1U35C 3AN2D 2PYOD 3AZID 3KXBA 5CP6D 3REHD 1ID3B 3WA9D 3REJD 5B0YA 4WU8C 3REKA 5JRGA 3WTPC 3AV2B 2PYOB 3A6NB 5GT0B 1ZLAD 1P3OD 3O62A 5JA4B 4EO5B 4ZUXB 1KX3D 4WV4B 5DNMC 3REIC 5B0YB 3REKB 3AFAD 5JRGB 3LZ1B 3X1VA 1BFMA 3O62B 3MVDA 3MNNC 3B0CT 3KUYA 3UTAA 3W99C 4H9SA 3MGSA 5B40B 1P3LA 2AROA 3KWQC 5BNVB 1P3PA 2RVQC 3C1BC 5CPKC 1KX5D 1U35D 3AZGC 3MGQC 4YS3C 1P3IA 3X1VB 1P3GA 4ZBJB 3LJAA 3MVDB 5AVBD 3WTPD 3UTAB 4AWLC 5B1MA 1P3PB 2AROB 5GXQB 1BH9A 5B2JC 5BS7A 4XUJC 3LELA 4JJNC 1BH8A 1P3IB 5DNMD 3REID 3W96C 1P3GB 3AZFC 3X1SD 2L5AA 5B1MB 3WAAA 3RELB 1M19C 3MGPC 2CV5A 3X1UC 1BH9B 4KUDC 3MNND 1M18A 4M6BA 3X1SB 3TU4A 3W99D 2YFWB 1B6WA 4J8WC 2RVQD 4X23C 1BH8B 3C1BD 5CPKD 4Z5TA 5CPIB 5AY8B 3AZEB 3MGQD 1KU5A 5BO0A 1P3MC 2BYKA 4YS3D 1KX4B 3WAAB 3AZMA 1M18B 4Z66A 3C1CC 1ID3C 1P34B 3AV1B 5B2JD 5B1LC 4XUJD 1P3FA 4Z5TB 3AZNB 3A6NC 5GT0C 2PYOC 5AV9A 1A7WA 4JJND 5B32G 4E45A 5BO0B 2BYKB 3W96D 4EO5C 4ZUXC 1TZYA 4Z66B 1EQZA 5B33D 5AV5A 1P3OC 3MGPD 4J8VA 5B0YC 4H9OB 4H9NA 5B31G 5JRGC 5B24A 3LZ1C 1P3BB 1P3FB 2NQBD 4J8XA 2BYMB 2JSSA 4J8WD 1S32A 5AV9B 4X23D 5B32D 5B40C 3UT9D 1EQZB 5B31A 1AOIA 2HIOA 1P3MD 5E5AA 4J8UB 4NE5A 4J8VB
chains in the Genus database with same CATH superfamily
5B24B 3WKJA 1WWSA 4CSRA 3AYWA 4J8XB 2Y2QA 3X1VC 1ID3D 5AV8B 3EPHA 3MVDC 5G49A 3MGRB 2G5HC 4H9QB 4HGAB 3UTAC 3AZLD 2ZY2A 3AZHA 3AV2D 3A6ND 5GT0D 4R8PB 2AROC 5B31B 2HIOB 1W2EA 4XZQA 5GXQC 5CPJA 4H9PA 5E5AB 2NZDA 5BT1C 4ZUXD 3P5JB 5AVBC 3W97A 2HUEB 4YM6B 3AZLB 3WKJB 3AYWB 1P3IC 3X1TA 1P3GC 5B0YD 5BNXA 3REKD 5JRGD 5G49B 3LZ1D 3AZHB 5B1MC 3REHA 3RELC 4XZQB 3VH5W 3O62D 3KXBB 4H9PB 5CPJB 2NZDB 3R45A 5GSUA 1T3UA 3X1SC 5B40D 5FUGA 3A1IA 1KX3A 3X1TB 5BNXB 4Z2MH 1HQ3A 5CPIC 4NE6A 5AY8C 3AZJA 3AZEC 3UTBA 3WAAC 1KX4C 3X1VD 1ULYA 5C3IB 3W98A 3MVDD 3R45B 1M18C 3UTAD 5GSUB 1TAFA 4WNNA 1P3PD 2AROD 1P34C 5GXQD 3AV1C 4Z2MG 5BT1D 5DNNA 4G92B 1HTAA 1HQ3B 3KUYB 2ZM5A 3AZNC 3MGSB 3AZJB 3LZ0A 2Y2JA 5AV6A 1P3LB 3UTBB 1P3ID 3F6TA 3VH6W 1P3GD 2YFVA 3W98B 3B6FA 1P3AA 5B1MD 1TAFB 4WNNB 3RELD 4WU8A 5DNNB 3WTPA 3LJAB 3EPJA 2F8NA 1P3BC 3B6GA 2Y2HA 4QLCA 5AVCA 3LZ0B 5AV9C 5B33C 1B67A 2YFVB 4LD9A 5CPID 3B6FB 5AY8D 2NQBC 1P3AB 3AZED 1EQZC 3LELB 1R4VA 5DNMA 1KX4D 3REIA 3WAAD 3V9RA 4J8UC 4WU8B 4J8VC 5B32C 1M18D 3H0RC 2F8NB 5B24C 3B6GB 4J8XC 3UT9C 5AVCB 5F99A 4QLCB 1P34D 4CAYA 5AV8C 3AV1D 3MNNA 2FFFB 2CV5B 3MGRC 4HGAC 4LD9B 4Z5TD 3KWQA 3AZND 3TU4B 4WU9A 4R8PC 5B31C 2HIOC 5GT3A 1M1AA 5E5AC 5CPKA 3AZMD 3AZGA 2HUEC 4YM6C 4Z66D 3AV2C 3AZLC 3VH5A 3WKJC 3AYWC 5F99B 3AZMB 1P3BD 1P3FD 3AZHC 4WU9B 5B0ZA 3WTPE 3KWQB 5AV9D 5GT3B 3AZKA 1M1AB 4G91B 4XZQC 3KXBC 2NZDC 3REKC 1F66A 3VH6T 1EQZD 2FJ7A 4JJNA 1P3KA 3W96A 3O62C 4J8UD 4J8VD 3AZFA 3X1TC 1TZYB 5B24D 4J8XD 5B0ZB 5B2IA 3NQUA 3AZKB 5AV5B 3MGPA 5AV8D 5C3IC 1M19A 3X1UA 4KUDA 2F8NK 3MGRD 4H9NB 5GSUC 1F66B 1WWIA 2IO5B 5CHLB 4R8PD 5B31D 3VH6A 2HIOD 2FJ7B 3KFUG 1S32B 5E5AD 3EG5B 1P3KB 4ZBJC 4G92C 3AZFB 4UUZA 1HQ3C 3KUYC 4YM6D 4KGCA 3WKJD 3MGSC 4H9SC 3AZJC 3AYWD 1P3LC 1P3PC 3UTBC 5B2IB 1P3MA 1AOIB 1M19B 3X1UB 2JCHA 3W98C 4KUDB 5KDMA 4H9RA 3AZHD 4CSRB 3C1CA 1ID3A 4NE3A 4XZQD 3KXBD 5CPJD 2NZDD 5DNNC 5B1LA 3LJAC 2UWXA 4UUZB 3AN2A 3A6NA 2PYOA 4KGCB 3AZIA 3LZ0C 3WA9A 5CP6A 5JA4A 3REJA 4DRBA 4ZUXA 2ZY3A 3X1TD 2F2AC 5BS7C 3B6FC 3W97B 4H9RB 1P3AC 1ZLAA 3LELC 1P3OA 3C1CB 3LZ1A 5B1LB 5GSUD 3B6GC 3AN2B 1H3OA 4QLCC 5AVCC 3AZIB 3WA9B 5CP6B 3REHB 3REJB 2CV5C 3AFAA 2F8NH 4LD9C 1HQ3D 5B40A 3KUYD 5BNVA 3TU4C 3MGSD 3AZJD 1ZLAB 1P3LD 3UTBD 5FUGB 1P3OB 2Y2GA 3W98D 1KX3B 3B0DB 4Z5TC 4E44A 1H3OB 5F99C 3FDDA 2F8NG 5DNND 3LJAD 3AFAB 3AZMC 1KX5A 1U35A 4Z66C 2JE5A 4WU9C 3NQJA 3LZ0D 5GT3C 5AV6D 5GXQA 4G91C 1M1AC 3A1KA 5AVBA 3B6FD 1P3FC 1P3AD 2Y2KA 3LELD 5AV6B 4WZSB 4WU8D 3H0MC 1TZYC 1KX5B 2F8ND 3B6GD 1U35B 4DRAA 4NFTA 4QLCD 5AVCD 5B0ZC 3NQJB 3RELA 3AZKC 5AV5C 2DQNC 1Q9CA 2VQRA 1N1JA 2CV5D 3VH5T 3X1SA 5AVBB 3WTPB 1F66C 2YFWA 4LD9D 3TU4D 2IO5C 2FJ7C 1S32C 1P3KC 5CPIA 5AY8A 3W99A 3AZEA 1F1EA 1KX4A 5F99D 5B2IC 1AOIC 5DNMB 3REIB 3V9RB 3C1BA 1N1JB 4WU9D 3KWQD 3MGQA 4YS3A 5GT3D 1P34A 1M1AD 3AV1A 4CAYB 4DQYB 1JFIA 3MNNB 2LY8A 3AZGD 3AZNA 3W99B 4KGCC 1PZRA 4KHAA 5CPJC 5B2JA 3C1BB 4XUJA 1TZYD 3B0BA 5CPKB 3W97C 3AZGB 5B0ZD 3MGQB 3AZKD 5AV5D 3IP4C 4YS3B 2G5IC 4H9OA 2Y2MA 1P3BA 2ZY4A 1JFIB 1F66D 2RIQA 3AN2C 2BYMA 4AWLB 5B33A 2FJ7D 3AZIC 1S32D 3WA9C 5CP6C 3REHC 4KHAB 3REJC 1P3KD 5B2JB 3AZFD 4XUJB 2NQBA 4J8WA 1ZLAC 1AOID 5B2ID 4X23A 4JJNB 1M19D 4J8UA 3B0CW 3X1UD 3W96B 4KUDD 4WJ3C 5B32A 1KX3C 3B0DC 3UT9A 5B33B 5AV8A 3NQUB 3KSYA 3MGPB 4UPKA 4H9QA 3AFAC 3MGRA 2CWEA 4R8PA 4KGCD 2NQBB 4J8WB 3EPKA 4X23B 1Z2CB 5B32B 4YM6A 3AV2A 3AZLA 3W97D 5GT0A 3UT9B 2XD5A 3C1CD 5AV6C 1P3MB 5B1LD 5KDMB 1U35C 3AN2D 2PYOD 2XD1A 3AZID 3EPLA 3KXBA 5CP6D 3REHD 1ID3B 3WA9D 3REJD 2ZY5A 1KX5C 5B0YA 4WU8C 3REKA 5JRGA 3WTPC 3AV2B 2Y2NA 2PYOB 3A6NB 5GT0B 1ZLAD 1P3OD 3O62A 5JA4B 4EO5B 4ZUXB 1KX3D 2Y2PA 4WV4B 5DNMC 3REIC 5B0YB 3REKB 3AFAD 5JRGB 3LZ1B 3X1VA 1BFMA 3O62B 3MVDA 3H0LC 3MNNC 3B0CT 3KUYA 3UTAA 3W99C 4H9SA 3MGSA 5B40B 1P3LA 2AROA 3KWQC 5BNVB 1P3PA 2RVQC 3C1BC 5CPKC 1KX5D 1U35D 3AZGC 3MGQC 4YS3C 1P3IA 3X1VB 1P3GA 4ZBJB 3LJAA 3MVDB 5AVBD 3WTPD 3UTAB 4AWLC 5B1MA 1P3PB 2AROB 5GXQB 1BH9A 5B2JC 2BG1A 2W8SA 5BS7A 4XUJC 3LELA 4JJNC 1BH8A 2Y2OA 5DNMD 1P3IB 3REID 3W96C 1P3GB 3AZFC 3X1SD 2L5AA 5B1MB 3WAAA 3RELB 1M19C 3MGPC 2CV5A 3X1UC 1BH9B 2DF4C 4KUDC 3MNND 1M18A 4M6BA 3X1SB 3TU4A 3W99D 2YFWB 1B6WA 4J8WC 2RVQD 2Y2IA 4X23C 1BH8B 3C1BD 5CPKD 4Z5TA 5CPIB 5AY8B 3AZEB 3MGQD 1KU5A 5BO0A 1P3MC 2BYKA 4YS3D 1KX4B 3WAAB 3AZMA 1M18B 4Z66A 3C1CC 1ID3C 1P34B 3AV1B 5B2JD 5B1LC 4XUJD 1P3FA 4Z5TB 3AZNB 3A6NC 5GT0C 2PYOC 5AV9A 1A7WA 4JJND 5B32G 4E45A 5BO0B 2BYKB 3W96D 4EO5C 4ZUXC 1TZYA 4Z66B 1EQZA 5B33D 2J8PA 5AV5A 1P3OC 3MGPD 4J8VA 5B0YC 4H9OB 4H9NA 5B31G 3AL0C 5JRGC 5B24A 3LZ1C 1P3BB 1P3FB 2NQBD 4J8XA 2BYMB 2JSSA 4J8WD 1S32A 2Y2LA 5AV9B 4X23D 5B32D 5B40C 3UT9D 1EQZB 5B31A 1AOIA 2HIOA 1P3MD 5E5AA 4J8UB 4NE5A 4J8VB
chains in the Genus database with same CATH topology
5B24B 3WKJA 1WWSA 4CSRA 3AYWA 4J8XB 2Y2QA 3X1VC 1ID3D 5AV8B 3EPHA 3MVDC 5G49A 3MGRB 2G5HC 4H9QB 4HGAB 3UTAC 3AZLD 2ZY2A 3AZHA 3AV2D 3A6ND 5GT0D 4R8PB 2AROC 5B31B 2HIOB 1W2EA 4XZQA 5GXQC 5CPJA 4H9PA 5E5AB 2NZDA 5BT1C 4ZUXD 3P5JB 5AVBC 3W97A 2HUEB 4YM6B 3AZLB 3WKJB 3AYWB 1P3IC 3X1TA 1P3GC 5B0YD 5BNXA 3REKD 5JRGD 5G49B 3LZ1D 3AZHB 5B1MC 3REHA 3RELC 4XZQB 3VH5W 3O62D 3KXBB 4H9PB 5CPJB 2NZDB 3R45A 5GSUA 1T3UA 3X1SC 5B40D 5FUGA 3A1IA 1KX3A 3X1TB 5BNXB 4Z2MH 1HQ3A 5CPIC 4NE6A 5AY8C 3AZJA 3AZEC 3UTBA 3WAAC 1KX4C 3X1VD 1ULYA 5C3IB 3W98A 3MVDD 3R45B 1M18C 3UTAD 5GSUB 1TAFA 4WNNA 1P3PD 2AROD 1P34C 5GXQD 3AV1C 4Z2MG 5BT1D 5DNNA 4G92B 1HTAA 1HQ3B 3KUYB 2ZM5A 3AZNC 3MGSB 3AZJB 3LZ0A 2Y2JA 5AV6A 1P3LB 3UTBB 1P3ID 3F6TA 3VH6W 1P3GD 2YFVA 3W98B 3B6FA 1P3AA 5B1MD 1TAFB 4WNNB 3RELD 4WU8A 5DNNB 3WTPA 3LJAB 3EPJA 2F8NA 1P3BC 3B6GA 2Y2HA 4QLCA 5AVCA 3LZ0B 5AV9C 5B33C 1B67A 2YFVB 4LD9A 5CPID 3B6FB 5AY8D 2NQBC 1P3AB 3AZED 1EQZC 3LELB 1R4VA 5DNMA 1KX4D 3REIA 3WAAD 3V9RA 4J8UC 4WU8B 4J8VC 5B32C 1M18D 3H0RC 2F8NB 5B24C 3B6GB 4J8XC 3UT9C 5AVCB 5F99A 4QLCB 1P34D 4CAYA 5AV8C 3AV1D 3MNNA 2FFFB 2CV5B 3MGRC 4HGAC 4LD9B 4Z5TD 3KWQA 3AZND 3TU4B 4WU9A 4R8PC 5B31C 2HIOC 5GT3A 1M1AA 5E5AC 5CPKA 3AZMD 3AZGA 2HUEC 4YM6C 4Z66D 3AV2C 3AZLC 3VH5A 3WKJC 3AYWC 5F99B 3AZMB 1P3BD 1P3FD 3AZHC 4WU9B 5B0ZA 3WTPE 3KWQB 5AV9D 5GT3B 3AZKA 1M1AB 4G91B 4XZQC 3KXBC 2NZDC 3REKC 1F66A 3VH6T 1EQZD 2FJ7A 4JJNA 1P3KA 3W96A 3O62C 4J8UD 4J8VD 3AZFA 3X1TC 1TZYB 5B24D 4J8XD 5B0ZB 5B2IA 3NQUA 3AZKB 5AV5B 3MGPA 5AV8D 5C3IC 1M19A 3X1UA 4KUDA 2F8NK 3MGRD 4H9NB 5GSUC 1F66B 1WWIA 2IO5B 5CHLB 4R8PD 5B31D 3VH6A 2HIOD 2FJ7B 3KFUG 1S32B 5E5AD 3EG5B 1P3KB 4ZBJC 4G92C 3AZFB 4UUZA 1HQ3C 3KUYC 4YM6D 4KGCA 3WKJD 3MGSC 4H9SC 3AZJC 3AYWD 1P3LC 1P3PC 3UTBC 5B2IB 1P3MA 1AOIB 1M19B 3X1UB 2JCHA 3W98C 4KUDB 5KDMA 4H9RA 3AZHD 4CSRB 3C1CA 1ID3A 4NE3A 4XZQD 3KXBD 5CPJD 2NZDD 5DNNC 5B1LA 3LJAC 2UWXA 4UUZB 3AN2A 3A6NA 2PYOA 4KGCB 3AZIA 3LZ0C 3WA9A 5CP6A 5JA4A 3REJA 4DRBA 4ZUXA 2ZY3A 3X1TD 2F2AC 5BS7C 3B6FC 3W97B 4H9RB 1P3AC 1ZLAA 3LELC 1P3OA 3C1CB 3LZ1A 5B1LB 5GSUD 3B6GC 3AN2B 1H3OA 4QLCC 5AVCC 3AZIB 3WA9B 5CP6B 3REHB 3REJB 2CV5C 3AFAA 2F8NH 4LD9C 1HQ3D 5B40A 3KUYD 5BNVA 3TU4C 3MGSD 3AZJD 1ZLAB 1P3LD 3UTBD 5FUGB 1P3OB 2Y2GA 3W98D 1KX3B 3B0DB 4Z5TC 4E44A 1H3OB 5F99C 3FDDA 2F8NG 5DNND 3LJAD 3AFAB 3AZMC 1KX5A 1U35A 4Z66C 2JE5A 4WU9C 3NQJA 3LZ0D 5GT3C 5AV6D 5GXQA 4G91C 1M1AC 3A1KA 5AVBA 3B6FD 1P3FC 1P3AD 2Y2KA 3LELD 5AV6B 4WZSB 4WU8D 3H0MC 1TZYC 1KX5B 2F8ND 3B6GD 1U35B 4DRAA 4NFTA 4QLCD 5AVCD 5B0ZC 3NQJB 3RELA 3AZKC 5AV5C 2DQNC 1Q9CA 2VQRA 1N1JA 2CV5D 3VH5T 3X1SA 5AVBB 3WTPB 1F66C 2YFWA 4LD9D 3TU4D 2IO5C 2FJ7C 1S32C 1P3KC 5CPIA 5AY8A 3W99A 3AZEA 1F1EA 1KX4A 5F99D 5B2IC 1AOIC 5DNMB 3REIB 3V9RB 3C1BA 1N1JB 4WU9D 3KWQD 3MGQA 4YS3A 5GT3D 1P34A 1M1AD 3AV1A 4CAYB 4DQYB 1JFIA 3MNNB 2LY8A 3AZGD 3AZNA 3W99B 4KGCC 1PZRA 4KHAA 5CPJC 5B2JA 3C1BB 4XUJA 1TZYD 3B0BA 5CPKB 3W97C 3AZGB 5B0ZD 3MGQB 3AZKD 5AV5D 3IP4C 4YS3B 2G5IC 4H9OA 2Y2MA 1P3BA 2ZY4A 1JFIB 1F66D 2RIQA 3AN2C 2BYMA 4AWLB 5B33A 2FJ7D 3AZIC 1S32D 3WA9C 5CP6C 3REHC 4KHAB 3REJC 1P3KD 5B2JB 3AZFD 4XUJB 2NQBA 4J8WA 1ZLAC 1AOID 5B2ID 4X23A 4JJNB 1M19D 4J8UA 3B0CW 3X1UD 3W96B 4KUDD 4WJ3C 5B32A 1KX3C 3B0DC 3UT9A 5B33B 5AV8A 3NQUB 3KSYA 3MGPB 4UPKA 4H9QA 3AFAC 3MGRA 2CWEA 4R8PA 4KGCD 2NQBB 4J8WB 3EPKA 4X23B 1Z2CB 5B32B 4YM6A 3AV2A 3AZLA 3W97D 5GT0A 3UT9B 2XD5A 3C1CD 5AV6C 1P3MB 5B1LD 5KDMB 1U35C 3AN2D 2PYOD 2XD1A 3AZID 3EPLA 3KXBA 5CP6D 3REHD 1ID3B 3WA9D 3REJD 2ZY5A 1KX5C 5B0YA 4WU8C 3REKA 5JRGA 3WTPC 3AV2B 2Y2NA 2PYOB 3A6NB 5GT0B 1ZLAD 1P3OD 3O62A 5JA4B 4EO5B 4ZUXB 1KX3D 2Y2PA 4WV4B 5DNMC 3REIC 5B0YB 3REKB 3AFAD 5JRGB 3LZ1B 3X1VA 1BFMA 3O62B 3MVDA 3H0LC 3MNNC 3B0CT 3KUYA 3UTAA 3W99C 4H9SA 3MGSA 5B40B 1P3LA 2AROA 3KWQC 5BNVB 1P3PA 2RVQC 3C1BC 5CPKC 1KX5D 1U35D 3AZGC 3MGQC 4YS3C 1P3IA 3X1VB 1P3GA 4ZBJB 3LJAA 3MVDB 5AVBD 3WTPD 3UTAB 4AWLC 5B1MA 1P3PB 2AROB 5GXQB 1BH9A 5B2JC 2BG1A 2W8SA 5BS7A 4XUJC 3LELA 4JJNC 1BH8A 2Y2OA 5DNMD 1P3IB 3REID 3W96C 1P3GB 3AZFC 3X1SD 2L5AA 5B1MB 3WAAA 3RELB 1M19C 3MGPC 2CV5A 3X1UC 1BH9B 2DF4C 4KUDC 3MNND 1M18A 4M6BA 3X1SB 3TU4A 3W99D 2YFWB 1B6WA 4J8WC 2RVQD 2Y2IA 4X23C 1BH8B 3C1BD 5CPKD 4Z5TA 5CPIB 5AY8B 3AZEB 3MGQD 1KU5A 5BO0A 1P3MC 2BYKA 4YS3D 1KX4B 3WAAB 3AZMA 1M18B 4Z66A 3C1CC 1ID3C 1P34B 3AV1B 5B2JD 5B1LC 4XUJD 1P3FA 4Z5TB 3AZNB 3A6NC 5GT0C 2PYOC 5AV9A 1A7WA 4JJND 5B32G 4E45A 5BO0B 2BYKB 3W96D 4EO5C 4ZUXC 1TZYA 4Z66B 1EQZA 5B33D 2J8PA 5AV5A 1P3OC 3MGPD 4J8VA 5B0YC 4H9OB 4H9NA 5B31G 3AL0C 5JRGC 5B24A 3LZ1C 1P3BB 1P3FB 2NQBD 4J8XA 2BYMB 2JSSA 4J8WD 1S32A 2Y2LA 5AV9B 4X23D 5B32D 5B40C 3UT9D 1EQZB 5B31A 1AOIA 2HIOA 1P3MD 5E5AA 4J8UB 4NE5A 4J8VB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5B24 B;  3WKJ A;  1WWS A;  4CSR A;  3AYW A;  4J8X B;  3X1V C;  1ID3 D;  5AV8 B;  3MVD C;  5G49 A;  3MGR B;  4H9Q B;  3UTA C;  4HGA B;  3AZL D;  3AZH A;  3AV2 D;  1KX5 C;  3A6N D;  5GT0 D;  4R8P B;  2ARO C;  5B31 B;  2HIO B;  4XZQ A;  5GXQ C;  5CPJ A;  4H9P A;  5E5A B;  2NZD A;  5BT1 C;  4ZUX D;  5AVB C;  3W97 A;  2HUE B;  4YM6 B;  3AZL B;  3WKJ B;  3AYW B;  1P3I C;  3X1T A;  1P3G C;  5B0Y D;  5BNX A;  3REK D;  5JRG D;  5G49 B;  3LZ1 D;  3AZH B;  5B1M C;  3REH A;  3REL C;  4XZQ B;  3VH5 W;  3O62 D;  3KXB B;  4H9P B;  5CPJ B;  2NZD B;  3R45 A;  5GSU A;  3X1S C;  5B40 D;  5FUG A;  1KX3 A;  3X1T B;  5BNX B;  4Z2M H;  1HQ3 A;  5CPI C;  4NE6 A;  5AY8 C;  3AZJ A;  3AZE C;  3UTB A;  3WAA C;  1KX4 C;  3X1V D;  1ULY A;  5C3I B;  3W98 A;  3MVD D;  3R45 B;  1M18 C;  3UTA D;  5GSU B;  1TAF A;  4WNN A;  1P3P D;  2ARO D;  1P34 C;  5GXQ D;  3AV1 C;  4Z2M G;  5BT1 D;  5DNN A;  4G92 B;  1HTA A;  1HQ3 B;  3KUY B;  3AZN C;  3MGS B;  3AZJ B;  3LZ0 A;  5AV6 A;  1P3L B;  3UTB B;  1P3I D;  3VH6 W;  1P3G D;  2YFV A;  3W98 B;  3B6F A;  1P3A A;  5B1M D;  1TAF B;  4WNN B;  3REL D;  4WU8 A;  5DNN B;  3WTP A;  3LJA B;  2F8N A;  3B6G A;  1P3B C;  4QLC A;  5AVC A;  3LZ0 B;  5AV9 C;  5B33 C;  1B67 A;  2YFV B;  4LD9 A;  5CPI D;  3B6F B;  5AY8 D;  2NQB C;  1P3A B;  3AZE D;  1EQZ C;  3LEL B;  1R4V A;  5DNM A;  1KX4 D;  3REI A;  3WAA D;  3V9R A;  4J8U C;  4WU8 B;  4J8V C;  5B32 C;  1M18 D;  2F8N B;  5B24 C;  3B6G B;  4J8X C;  3UT9 C;  5AVC B;  5F99 A;  4QLC B;  1P34 D;  4CAY A;  5AV8 C;  3AV1 D;  3MNN A;  2CV5 B;  3MGR C;  4HGA C;  4LD9 B;  4Z5T D;  3KWQ A;  3AZN D;  3TU4 B;  4WU9 A;  4R8P C;  5B31 C;  2HIO C;  5GT3 A;  1M1A A;  5E5A C;  5CPK A;  3AZM D;  3AZG A;  2HUE C;  4YM6 C;  4Z66 D;  3AV2 C;  3AZL C;  3VH5 A;  3WKJ C;  3AYW C;  5F99 B;  3AZM B;  1P3B D;  1P3F D;  3AZH C;  4WU9 B;  5B0Z A;  3WTP E;  3KWQ B;  5AV9 D;  5GT3 B;  3AZK A;  1M1A B;  4G91 B;  4XZQ C;  3KXB C;  2NZD C;  3REK C;  1F66 A;  3VH6 T;  1EQZ D;  2FJ7 A;  4JJN A;  1P3K A;  3W96 A;  3O62 C;  4J8U D;  4J8V D;  3AZF A;  3X1T C;  1TZY B;  5B24 D;  4J8X D;  5B0Z B;  5B2I A;  3NQU A;  3AZK B;  5AV5 B;  3MGP A;  5AV8 D;  5C3I C;  1M19 A;  3X1U A;  4KUD A;  2F8N K;  3MGR D;  4H9N B;  5GSU C;  1F66 B;  1WWI A;  2IO5 B;  5CHL B;  4R8P D;  5B31 D;  3VH6 A;  2HIO D;  2FJ7 B;  1S32 B;  5E5A D;  1P3K B;  4ZBJ C;  4G92 C;  3AZF B;  4UUZ A;  1HQ3 C;  3KUY C;  4YM6 D;  4KGC A;  3WKJ D;  3MGS C;  4H9S C;  3AZJ C;  3AYW D;  1P3L C;  1P3P C;  3UTB C;  5B2I B;  1P3M A;  1AOI B;  1M19 B;  3X1U B;  3W98 C;  4KUD B;  5KDM A;  4H9R A;  3AZH D;  4CSR B;  3C1C A;  1ID3 A;  4NE3 A;  4XZQ D;  3KXB D;  5CPJ D;  2NZD D;  5DNN C;  5B1L A;  3LJA C;  4UUZ B;  3AN2 A;  3A6N A;  2PYO A;  4KGC B;  3AZI A;  3LZ0 C;  3WA9 A;  5CP6 A;  5JA4 A;  3REJ A;  4DRB A;  4ZUX A;  3X1T D;  5BS7 C;  3B6F C;  3W97 B;  4H9R B;  1P3A C;  1ZLA A;  3LEL C;  1P3O A;  3C1C B;  3LZ1 A;  5B1L B;  5GSU D;  3B6G C;  3AN2 B;  1H3O A;  4QLC C;  5AVC C;  3AZI B;  3WA9 B;  5CP6 B;  3REH B;  3REJ B;  2CV5 C;  3AFA A;  2F8N H;  4LD9 C;  1HQ3 D;  5B40 A;  3KUY D;  5BNV A;  3TU4 C;  3MGS D;  3AZJ D;  1ZLA B;  1P3L D;  3UTB D;  5FUG B;  1P3O B;  3W98 D;  1KX3 B;  3B0D B;  4Z5T C;  4E44 A;  1H3O B;  5F99 C;  2F8N G;  5DNN D;  3LJA D;  3AFA B;  3AZM C;  1KX5 A;  1U35 A;  4Z66 C;  4WU9 C;  3NQJ A;  3LZ0 D;  5GT3 C;  5AV6 D;  5GXQ A;  4G91 C;  1M1A C;  5AVB A;  3B6F D;  1P3F C;  1P3A D;  3LEL D;  5AV6 B;  4WZS B;  4WU8 D;  1TZY C;  1KX5 B;  2F8N D;  3B6G D;  1U35 B;  4DRA A;  4NFT A;  4QLC D;  5AVC D;  5B0Z C;  3NQJ B;  3REL A;  3AZK C;  5AV5 C;  1Q9C A;  1N1J A;  2CV5 D;  3VH5 T;  3X1S A;  5AVB B;  3WTP B;  1F66 C;  2YFW A;  4LD9 D;  3TU4 D;  2IO5 C;  2FJ7 C;  1S32 C;  1P3K C;  5CPI A;  5AY8 A;  3W99 A;  3AZE A;  1F1E A;  1KX4 A;  5F99 D;  5B2I C;  1AOI C;  5DNM B;  3REI B;  3V9R B;  3C1B A;  1N1J B;  4WU9 D;  3KWQ D;  3MGQ A;  4YS3 A;  5GT3 D;  1P34 A;  1M1A D;  3AV1 A;  4CAY B;  1JFI A;  3MNN B;  2LY8 A;  3AZG D;  3AZN A;  3W99 B;  4KGC C;  4KHA A;  5CPJ C;  5B2J A;  3C1B B;  4XUJ A;  1TZY D;  3B0B A;  5CPK B;  3W97 C;  3AZG B;  5B0Z D;  3MGQ B;  3AZK D;  5AV5 D;  4YS3 B;  4H9O A;  1P3B A;  1JFI B;  1F66 D;  3AN2 C;  2BYM A;  4AWL B;  5B33 A;  2FJ7 D;  3AZI C;  1S32 D;  3WA9 C;  5CP6 C;  3REH C;  4KHA B;  3REJ C;  1P3K D;  5B2J B;  3AZF D;  4XUJ B;  2NQB A;  4J8W A;  1ZLA C;  1AOI D;  5B2I D;  4X23 A;  4JJN B;  1M19 D;  4J8U A;  3B0C W;  3X1U D;  3W96 B;  4KUD D;  5B32 A;  1KX3 C;  3B0D C;  3UT9 A;  5B33 B;  5AV8 A;  3NQU B;  3KSY A;  3MGP B;  3MGR A;  4H9Q A;  3AFA C;  2CWE A;  4R8P A;  4KGC D;  2NQB B;  4J8W B;  4X23 B;  5B32 B;  4YM6 A;  3AV2 A;  3AZL A;  3W97 D;  5GT0 A;  3UT9 B;  3C1C D;  5AV6 C;  1P3M B;  5B1L D;  5KDM B;  1U35 C;  3AN2 D;  2PYO D;  3AZI D;  3KXB A;  5CP6 D;  3REH D;  1ID3 B;  3WA9 D;  3REJ D;  5B0Y A;  4WU8 C;  3REK A;  5JRG A;  3WTP C;  3AV2 B;  2PYO B;  3A6N B;  5GT0 B;  1ZLA D;  1P3O D;  3O62 A;  5JA4 B;  4EO5 B;  4ZUX B;  1KX3 D;  4WV4 B;  5DNM C;  3REI C;  5B0Y B;  3REK B;  3AFA D;  5JRG B;  3LZ1 B;  3X1V A;  1BFM A;  3O62 B;  3MVD A;  3MNN C;  3B0C T;  3KUY A;  3UTA A;  3W99 C;  4H9S A;  3MGS A;  5B40 B;  1P3L A;  2ARO A;  3KWQ C;  5BNV B;  1P3P A;  2RVQ C;  3C1B C;  5CPK C;  1KX5 D;  1U35 D;  3AZG C;  3MGQ C;  4YS3 C;  1P3I A;  3X1V B;  1P3G A;  4ZBJ B;  3LJA A;  3MVD B;  5AVB D;  3WTP D;  3UTA B;  4AWL C;  5B1M A;  1P3P B;  2ARO B;  5GXQ B;  1BH9 A;  5B2J C;  5BS7 A;  4XUJ C;  3LEL A;  4JJN C;  1BH8 A;  1P3I B;  5DNM D;  3REI D;  3W96 C;  1P3G B;  3AZF C;  3X1S D;  2L5A A;  5B1M B;  3WAA A;  3REL B;  1M19 C;  3MGP C;  2CV5 A;  3X1U C;  1BH9 B;  4KUD C;  3MNN D;  1M18 A;  4M6B A;  3X1S B;  3TU4 A;  3W99 D;  2YFW B;  1B6W A;  4J8W C;  2RVQ D;  4X23 C;  1BH8 B;  3C1B D;  5CPK D;  4Z5T A;  5CPI B;  5AY8 B;  3AZE B;  3MGQ D;  1KU5 A;  5BO0 A;  1P3M C;  2BYK A;  4YS3 D;  1KX4 B;  3WAA B;  3AZM A;  1M18 B;  4Z66 A;  3C1C C;  1ID3 C;  1P34 B;  3AV1 B;  5B2J D;  5B1L C;  4XUJ D;  1P3F A;  4Z5T B;  3AZN B;  3A6N C;  5GT0 C;  2PYO C;  5AV9 A;  1A7W A;  4JJN D;  5B32 G;  4E45 A;  5BO0 B;  2BYK B;  3W96 D;  4EO5 C;  4ZUX C;  1TZY A;  4Z66 B;  1EQZ A;  5B33 D;  5AV5 A;  1P3O C;  3MGP D;  4J8V A;  5B0Y C;  4H9O B;  4H9N A;  5B31 G;  5JRG C;  5B24 A;  3LZ1 C;  1P3B B;  1P3F B;  2NQB D;  4J8X A;  2BYM B;  2JSS A;  4J8W D;  1S32 A;  5AV9 B;  4X23 D;  5B32 D;  5B40 C;  3UT9 D;  1EQZ B;  5B31 A;  1AOI A;  2HIO A;  1P3M D;  5E5A A;  4J8U B;  4NE5 A;  4J8V B; 
#chains in the Genus database with same CATH topology
 5B24 B;  3WKJ A;  1WWS A;  4CSR A;  3AYW A;  4J8X B;  2Y2Q A;  3X1V C;  1ID3 D;  5AV8 B;  3EPH A;  3MVD C;  5G49 A;  3MGR B;  2G5H C;  4H9Q B;  4HGA B;  3UTA C;  3AZL D;  2ZY2 A;  3AZH A;  3AV2 D;  3A6N D;  5GT0 D;  4R8P B;  2ARO C;  5B31 B;  2HIO B;  1W2E A;  4XZQ A;  5GXQ C;  5CPJ A;  4H9P A;  5E5A B;  2NZD A;  5BT1 C;  4ZUX D;  3P5J B;  5AVB C;  3W97 A;  2HUE B;  4YM6 B;  3AZL B;  3WKJ B;  3AYW B;  1P3I C;  3X1T A;  1P3G C;  5B0Y D;  5BNX A;  3REK D;  5JRG D;  5G49 B;  3LZ1 D;  3AZH B;  5B1M C;  3REH A;  3REL C;  4XZQ B;  3VH5 W;  3O62 D;  3KXB B;  4H9P B;  5CPJ B;  2NZD B;  3R45 A;  5GSU A;  1T3U A;  3X1S C;  5B40 D;  5FUG A;  3A1I A;  1KX3 A;  3X1T B;  5BNX B;  4Z2M H;  1HQ3 A;  5CPI C;  4NE6 A;  5AY8 C;  3AZJ A;  3AZE C;  3UTB A;  3WAA C;  1KX4 C;  3X1V D;  1ULY A;  5C3I B;  3W98 A;  3MVD D;  3R45 B;  1M18 C;  3UTA D;  5GSU B;  1TAF A;  4WNN A;  1P3P D;  2ARO D;  1P34 C;  5GXQ D;  3AV1 C;  4Z2M G;  5BT1 D;  5DNN A;  4G92 B;  1HTA A;  1HQ3 B;  3KUY B;  2ZM5 A;  3AZN C;  3MGS B;  3AZJ B;  3LZ0 A;  2Y2J A;  5AV6 A;  1P3L B;  3UTB B;  1P3I D;  3F6T A;  3VH6 W;  1P3G D;  2YFV A;  3W98 B;  3B6F A;  1P3A A;  5B1M D;  1TAF B;  4WNN B;  3REL D;  4WU8 A;  5DNN B;  3WTP A;  3LJA B;  3EPJ A;  2F8N A;  1P3B C;  3B6G A;  2Y2H A;  4QLC A;  5AVC A;  3LZ0 B;  5AV9 C;  5B33 C;  1B67 A;  2YFV B;  4LD9 A;  5CPI D;  3B6F B;  5AY8 D;  2NQB C;  1P3A B;  3AZE D;  1EQZ C;  3LEL B;  1R4V A;  5DNM A;  1KX4 D;  3REI A;  3WAA D;  3V9R A;  4J8U C;  4WU8 B;  4J8V C;  5B32 C;  1M18 D;  3H0R C;  2F8N B;  5B24 C;  3B6G B;  4J8X C;  3UT9 C;  5AVC B;  5F99 A;  4QLC B;  1P34 D;  4CAY A;  5AV8 C;  3AV1 D;  3MNN A;  2FFF B;  2CV5 B;  3MGR C;  4HGA C;  4LD9 B;  4Z5T D;  3KWQ A;  3AZN D;  3TU4 B;  4WU9 A;  4R8P C;  5B31 C;  2HIO C;  5GT3 A;  1M1A A;  5E5A C;  5CPK A;  3AZM D;  3AZG A;  2HUE C;  4YM6 C;  4Z66 D;  3AV2 C;  3AZL C;  3VH5 A;  3WKJ C;  3AYW C;  5F99 B;  3AZM B;  1P3B D;  1P3F D;  3AZH C;  4WU9 B;  5B0Z A;  3WTP E;  3KWQ B;  5AV9 D;  5GT3 B;  3AZK A;  1M1A B;  4G91 B;  4XZQ C;  3KXB C;  2NZD C;  3REK C;  1F66 A;  3VH6 T;  1EQZ D;  2FJ7 A;  4JJN A;  1P3K A;  3W96 A;  3O62 C;  4J8U D;  4J8V D;  3AZF A;  3X1T C;  1TZY B;  5B24 D;  4J8X D;  5B0Z B;  5B2I A;  3NQU A;  3AZK B;  5AV5 B;  3MGP A;  5AV8 D;  5C3I C;  1M19 A;  3X1U A;  4KUD A;  2F8N K;  3MGR D;  4H9N B;  5GSU C;  1F66 B;  1WWI A;  2IO5 B;  5CHL B;  4R8P D;  5B31 D;  3VH6 A;  2HIO D;  2FJ7 B;  3KFU G;  1S32 B;  5E5A D;  3EG5 B;  1P3K B;  4ZBJ C;  4G92 C;  3AZF B;  4UUZ A;  1HQ3 C;  3KUY C;  4YM6 D;  4KGC A;  3WKJ D;  3MGS C;  4H9S C;  3AZJ C;  3AYW D;  1P3L C;  1P3P C;  3UTB C;  5B2I B;  1P3M A;  1AOI B;  1M19 B;  3X1U B;  2JCH A;  3W98 C;  4KUD B;  5KDM A;  4H9R A;  3AZH D;  4CSR B;  3C1C A;  1ID3 A;  4NE3 A;  4XZQ D;  3KXB D;  5CPJ D;  2NZD D;  5DNN C;  5B1L A;  3LJA C;  2UWX A;  4UUZ B;  3AN2 A;  3A6N A;  2PYO A;  4KGC B;  3AZI A;  3LZ0 C;  3WA9 A;  5CP6 A;  5JA4 A;  3REJ A;  4DRB A;  4ZUX A;  2ZY3 A;  3X1T D;  2F2A C;  5BS7 C;  3B6F C;  3W97 B;  4H9R B;  1P3A C;  1ZLA A;  3LEL C;  1P3O A;  3C1C B;  3LZ1 A;  5B1L B;  5GSU D;  3B6G C;  3AN2 B;  1H3O A;  4QLC C;  5AVC C;  3AZI B;  3WA9 B;  5CP6 B;  3REH B;  3REJ B;  2CV5 C;  3AFA A;  2F8N H;  4LD9 C;  1HQ3 D;  5B40 A;  3KUY D;  5BNV A;  3TU4 C;  3MGS D;  3AZJ D;  1ZLA B;  1P3L D;  3UTB D;  5FUG B;  1P3O B;  2Y2G A;  3W98 D;  1KX3 B;  3B0D B;  4Z5T C;  4E44 A;  1H3O B;  5F99 C;  3FDD A;  2F8N G;  5DNN D;  3LJA D;  3AFA B;  3AZM C;  1KX5 A;  1U35 A;  4Z66 C;  2JE5 A;  4WU9 C;  3NQJ A;  3LZ0 D;  5GT3 C;  5AV6 D;  5GXQ A;  4G91 C;  1M1A C;  3A1K A;  5AVB A;  3B6F D;  1P3F C;  1P3A D;  2Y2K A;  3LEL D;  5AV6 B;  4WZS B;  4WU8 D;  3H0M C;  1TZY C;  1KX5 B;  2F8N D;  3B6G D;  1U35 B;  4DRA A;  4NFT A;  4QLC D;  5AVC D;  5B0Z C;  3NQJ B;  3REL A;  3AZK C;  5AV5 C;  2DQN C;  1Q9C A;  2VQR A;  1N1J A;  2CV5 D;  3VH5 T;  3X1S A;  5AVB B;  3WTP B;  1F66 C;  2YFW A;  4LD9 D;  3TU4 D;  2IO5 C;  2FJ7 C;  1S32 C;  1P3K C;  5CPI A;  5AY8 A;  3W99 A;  3AZE A;  1F1E A;  1KX4 A;  5F99 D;  5B2I C;  1AOI C;  5DNM B;  3REI B;  3V9R B;  3C1B A;  1N1J B;  4WU9 D;  3KWQ D;  3MGQ A;  4YS3 A;  5GT3 D;  1P34 A;  1M1A D;  3AV1 A;  4CAY B;  4DQY B;  1JFI A;  3MNN B;  2LY8 A;  3AZG D;  3AZN A;  3W99 B;  4KGC C;  1PZR A;  4KHA A;  5CPJ C;  5B2J A;  3C1B B;  4XUJ A;  1TZY D;  3B0B A;  5CPK B;  3W97 C;  3AZG B;  5B0Z D;  3MGQ B;  3AZK D;  5AV5 D;  3IP4 C;  4YS3 B;  2G5I C;  4H9O A;  2Y2M A;  1P3B A;  2ZY4 A;  1JFI B;  1F66 D;  2RIQ A;  3AN2 C;  2BYM A;  4AWL B;  5B33 A;  2FJ7 D;  3AZI C;  1S32 D;  3WA9 C;  5CP6 C;  3REH C;  4KHA B;  3REJ C;  1P3K D;  5B2J B;  3AZF D;  4XUJ B;  2NQB A;  4J8W A;  1ZLA C;  1AOI D;  5B2I D;  4X23 A;  4JJN B;  1M19 D;  4J8U A;  3B0C W;  3X1U D;  3W96 B;  4KUD D;  4WJ3 C;  5B32 A;  1KX3 C;  3B0D C;  3UT9 A;  5B33 B;  5AV8 A;  3NQU B;  3KSY A;  3MGP B;  4UPK A;  4H9Q A;  3AFA C;  3MGR A;  2CWE A;  4R8P A;  4KGC D;  2NQB B;  4J8W B;  3EPK A;  4X23 B;  1Z2C B;  5B32 B;  4YM6 A;  3AV2 A;  3AZL A;  3W97 D;  5GT0 A;  3UT9 B;  2XD5 A;  3C1C D;  5AV6 C;  1P3M B;  5B1L D;  5KDM B;  1U35 C;  3AN2 D;  2PYO D;  2XD1 A;  3AZI D;  3EPL A;  3KXB A;  5CP6 D;  3REH D;  1ID3 B;  3WA9 D;  3REJ D;  2ZY5 A;  1KX5 C;  5B0Y A;  4WU8 C;  3REK A;  5JRG A;  3WTP C;  3AV2 B;  2Y2N A;  2PYO B;  3A6N B;  5GT0 B;  1ZLA D;  1P3O D;  3O62 A;  5JA4 B;  4EO5 B;  4ZUX B;  1KX3 D;  2Y2P A;  4WV4 B;  5DNM C;  3REI C;  5B0Y B;  3REK B;  3AFA D;  5JRG B;  3LZ1 B;  3X1V A;  1BFM A;  3O62 B;  3MVD A;  3H0L C;  3MNN C;  3B0C T;  3KUY A;  3UTA A;  3W99 C;  4H9S A;  3MGS A;  5B40 B;  1P3L A;  2ARO A;  3KWQ C;  5BNV B;  1P3P A;  2RVQ C;  3C1B C;  5CPK C;  1KX5 D;  1U35 D;  3AZG C;  3MGQ C;  4YS3 C;  1P3I A;  3X1V B;  1P3G A;  4ZBJ B;  3LJA A;  3MVD B;  5AVB D;  3WTP D;  3UTA B;  4AWL C;  5B1M A;  1P3P B;  2ARO B;  5GXQ B;  1BH9 A;  5B2J C;  2BG1 A;  2W8S A;  5BS7 A;  4XUJ C;  3LEL A;  4JJN C;  1BH8 A;  2Y2O A;  5DNM D;  1P3I B;  3REI D;  3W96 C;  1P3G B;  3AZF C;  3X1S D;  2L5A A;  5B1M B;  3WAA A;  3REL B;  1M19 C;  3MGP C;  2CV5 A;  3X1U C;  1BH9 B;  2DF4 C;  4KUD C;  3MNN D;  1M18 A;  4M6B A;  3X1S B;  3TU4 A;  3W99 D;  2YFW B;  1B6W A;  4J8W C;  2RVQ D;  2Y2I A;  4X23 C;  1BH8 B;  3C1B D;  5CPK D;  4Z5T A;  5CPI B;  5AY8 B;  3AZE B;  3MGQ D;  1KU5 A;  5BO0 A;  1P3M C;  2BYK A;  4YS3 D;  1KX4 B;  3WAA B;  3AZM A;  1M18 B;  4Z66 A;  3C1C C;  1ID3 C;  1P34 B;  3AV1 B;  5B2J D;  5B1L C;  4XUJ D;  1P3F A;  4Z5T B;  3AZN B;  3A6N C;  5GT0 C;  2PYO C;  5AV9 A;  1A7W A;  4JJN D;  5B32 G;  4E45 A;  5BO0 B;  2BYK B;  3W96 D;  4EO5 C;  4ZUX C;  1TZY A;  4Z66 B;  1EQZ A;  5B33 D;  2J8P A;  5AV5 A;  1P3O C;  3MGP D;  4J8V A;  5B0Y C;  4H9O B;  4H9N A;  5B31 G;  3AL0 C;  5JRG C;  5B24 A;  3LZ1 C;  1P3B B;  1P3F B;  2NQB D;  4J8X A;  2BYM B;  2JSS A;  4J8W D;  1S32 A;  2Y2L A;  5AV9 B;  4X23 D;  5B32 D;  5B40 C;  3UT9 D;  1EQZ B;  5B31 A;  1AOI A;  2HIO A;  1P3M D;  5E5A A;  4J8U B;  4NE5 A;  4J8V B; 
#chains in the Genus database with same CATH homology
 5B24 B;  3WKJ A;  1WWS A;  4CSR A;  3AYW A;  4J8X B;  2Y2Q A;  3X1V C;  1ID3 D;  5AV8 B;  3EPH A;  3MVD C;  5G49 A;  3MGR B;  2G5H C;  4H9Q B;  4HGA B;  3UTA C;  3AZL D;  2ZY2 A;  3AZH A;  3AV2 D;  3A6N D;  5GT0 D;  4R8P B;  2ARO C;  5B31 B;  2HIO B;  1W2E A;  4XZQ A;  5GXQ C;  5CPJ A;  4H9P A;  5E5A B;  2NZD A;  5BT1 C;  4ZUX D;  3P5J B;  5AVB C;  3W97 A;  2HUE B;  4YM6 B;  3AZL B;  3WKJ B;  3AYW B;  1P3I C;  3X1T A;  1P3G C;  5B0Y D;  5BNX A;  3REK D;  5JRG D;  5G49 B;  3LZ1 D;  3AZH B;  5B1M C;  3REH A;  3REL C;  4XZQ B;  3VH5 W;  3O62 D;  3KXB B;  4H9P B;  5CPJ B;  2NZD B;  3R45 A;  5GSU A;  1T3U A;  3X1S C;  5B40 D;  5FUG A;  3A1I A;  1KX3 A;  3X1T B;  5BNX B;  4Z2M H;  1HQ3 A;  5CPI C;  4NE6 A;  5AY8 C;  3AZJ A;  3AZE C;  3UTB A;  3WAA C;  1KX4 C;  3X1V D;  1ULY A;  5C3I B;  3W98 A;  3MVD D;  3R45 B;  1M18 C;  3UTA D;  5GSU B;  1TAF A;  4WNN A;  1P3P D;  2ARO D;  1P34 C;  5GXQ D;  3AV1 C;  4Z2M G;  5BT1 D;  5DNN A;  4G92 B;  1HTA A;  1HQ3 B;  3KUY B;  2ZM5 A;  3AZN C;  3MGS B;  3AZJ B;  3LZ0 A;  2Y2J A;  5AV6 A;  1P3L B;  3UTB B;  1P3I D;  3F6T A;  3VH6 W;  1P3G D;  2YFV A;  3W98 B;  3B6F A;  1P3A A;  5B1M D;  1TAF B;  4WNN B;  3REL D;  4WU8 A;  5DNN B;  3WTP A;  3LJA B;  3EPJ A;  2F8N A;  1P3B C;  3B6G A;  2Y2H A;  4QLC A;  5AVC A;  3LZ0 B;  5AV9 C;  5B33 C;  1B67 A;  2YFV B;  4LD9 A;  5CPI D;  3B6F B;  5AY8 D;  2NQB C;  1P3A B;  3AZE D;  1EQZ C;  3LEL B;  1R4V A;  5DNM A;  1KX4 D;  3REI A;  3WAA D;  3V9R A;  4J8U C;  4WU8 B;  4J8V C;  5B32 C;  1M18 D;  3H0R C;  2F8N B;  5B24 C;  3B6G B;  4J8X C;  3UT9 C;  5AVC B;  5F99 A;  4QLC B;  1P34 D;  4CAY A;  5AV8 C;  3AV1 D;  3MNN A;  2FFF B;  2CV5 B;  3MGR C;  4HGA C;  4LD9 B;  4Z5T D;  3KWQ A;  3AZN D;  3TU4 B;  4WU9 A;  4R8P C;  5B31 C;  2HIO C;  5GT3 A;  1M1A A;  5E5A C;  5CPK A;  3AZM D;  3AZG A;  2HUE C;  4YM6 C;  4Z66 D;  3AV2 C;  3AZL C;  3VH5 A;  3WKJ C;  3AYW C;  5F99 B;  3AZM B;  1P3B D;  1P3F D;  3AZH C;  4WU9 B;  5B0Z A;  3WTP E;  3KWQ B;  5AV9 D;  5GT3 B;  3AZK A;  1M1A B;  4G91 B;  4XZQ C;  3KXB C;  2NZD C;  3REK C;  1F66 A;  3VH6 T;  1EQZ D;  2FJ7 A;  4JJN A;  1P3K A;  3W96 A;  3O62 C;  4J8U D;  4J8V D;  3AZF A;  3X1T C;  1TZY B;  5B24 D;  4J8X D;  5B0Z B;  5B2I A;  3NQU A;  3AZK B;  5AV5 B;  3MGP A;  5AV8 D;  5C3I C;  1M19 A;  3X1U A;  4KUD A;  2F8N K;  3MGR D;  4H9N B;  5GSU C;  1F66 B;  1WWI A;  2IO5 B;  5CHL B;  4R8P D;  5B31 D;  3VH6 A;  2HIO D;  2FJ7 B;  3KFU G;  1S32 B;  5E5A D;  3EG5 B;  1P3K B;  4ZBJ C;  4G92 C;  3AZF B;  4UUZ A;  1HQ3 C;  3KUY C;  4YM6 D;  4KGC A;  3WKJ D;  3MGS C;  4H9S C;  3AZJ C;  3AYW D;  1P3L C;  1P3P C;  3UTB C;  5B2I B;  1P3M A;  1AOI B;  1M19 B;  3X1U B;  2JCH A;  3W98 C;  4KUD B;  5KDM A;  4H9R A;  3AZH D;  4CSR B;  3C1C A;  1ID3 A;  4NE3 A;  4XZQ D;  3KXB D;  5CPJ D;  2NZD D;  5DNN C;  5B1L A;  3LJA C;  2UWX A;  4UUZ B;  3AN2 A;  3A6N A;  2PYO A;  4KGC B;  3AZI A;  3LZ0 C;  3WA9 A;  5CP6 A;  5JA4 A;  3REJ A;  4DRB A;  4ZUX A;  2ZY3 A;  3X1T D;  2F2A C;  5BS7 C;  3B6F C;  3W97 B;  4H9R B;  1P3A C;  1ZLA A;  3LEL C;  1P3O A;  3C1C B;  3LZ1 A;  5B1L B;  5GSU D;  3B6G C;  3AN2 B;  1H3O A;  4QLC C;  5AVC C;  3AZI B;  3WA9 B;  5CP6 B;  3REH B;  3REJ B;  2CV5 C;  3AFA A;  2F8N H;  4LD9 C;  1HQ3 D;  5B40 A;  3KUY D;  5BNV A;  3TU4 C;  3MGS D;  3AZJ D;  1ZLA B;  1P3L D;  3UTB D;  5FUG B;  1P3O B;  2Y2G A;  3W98 D;  1KX3 B;  3B0D B;  4Z5T C;  4E44 A;  1H3O B;  5F99 C;  3FDD A;  2F8N G;  5DNN D;  3LJA D;  3AFA B;  3AZM C;  1KX5 A;  1U35 A;  4Z66 C;  2JE5 A;  4WU9 C;  3NQJ A;  3LZ0 D;  5GT3 C;  5AV6 D;  5GXQ A;  4G91 C;  1M1A C;  3A1K A;  5AVB A;  3B6F D;  1P3F C;  1P3A D;  2Y2K A;  3LEL D;  5AV6 B;  4WZS B;  4WU8 D;  3H0M C;  1TZY C;  1KX5 B;  2F8N D;  3B6G D;  1U35 B;  4DRA A;  4NFT A;  4QLC D;  5AVC D;  5B0Z C;  3NQJ B;  3REL A;  3AZK C;  5AV5 C;  2DQN C;  1Q9C A;  2VQR A;  1N1J A;  2CV5 D;  3VH5 T;  3X1S A;  5AVB B;  3WTP B;  1F66 C;  2YFW A;  4LD9 D;  3TU4 D;  2IO5 C;  2FJ7 C;  1S32 C;  1P3K C;  5CPI A;  5AY8 A;  3W99 A;  3AZE A;  1F1E A;  1KX4 A;  5F99 D;  5B2I C;  1AOI C;  5DNM B;  3REI B;  3V9R B;  3C1B A;  1N1J B;  4WU9 D;  3KWQ D;  3MGQ A;  4YS3 A;  5GT3 D;  1P34 A;  1M1A D;  3AV1 A;  4CAY B;  4DQY B;  1JFI A;  3MNN B;  2LY8 A;  3AZG D;  3AZN A;  3W99 B;  4KGC C;  1PZR A;  4KHA A;  5CPJ C;  5B2J A;  3C1B B;  4XUJ A;  1TZY D;  3B0B A;  5CPK B;  3W97 C;  3AZG B;  5B0Z D;  3MGQ B;  3AZK D;  5AV5 D;  3IP4 C;  4YS3 B;  2G5I C;  4H9O A;  2Y2M A;  1P3B A;  2ZY4 A;  1JFI B;  1F66 D;  2RIQ A;  3AN2 C;  2BYM A;  4AWL B;  5B33 A;  2FJ7 D;  3AZI C;  1S32 D;  3WA9 C;  5CP6 C;  3REH C;  4KHA B;  3REJ C;  1P3K D;  5B2J B;  3AZF D;  4XUJ B;  2NQB A;  4J8W A;  1ZLA C;  1AOI D;  5B2I D;  4X23 A;  4JJN B;  1M19 D;  4J8U A;  3B0C W;  3X1U D;  3W96 B;  4KUD D;  4WJ3 C;  5B32 A;  1KX3 C;  3B0D C;  3UT9 A;  5B33 B;  5AV8 A;  3NQU B;  3KSY A;  3MGP B;  4UPK A;  4H9Q A;  3AFA C;  3MGR A;  2CWE A;  4R8P A;  4KGC D;  2NQB B;  4J8W B;  3EPK A;  4X23 B;  1Z2C B;  5B32 B;  4YM6 A;  3AV2 A;  3AZL A;  3W97 D;  5GT0 A;  3UT9 B;  2XD5 A;  3C1C D;  5AV6 C;  1P3M B;  5B1L D;  5KDM B;  1U35 C;  3AN2 D;  2PYO D;  2XD1 A;  3AZI D;  3EPL A;  3KXB A;  5CP6 D;  3REH D;  1ID3 B;  3WA9 D;  3REJ D;  2ZY5 A;  1KX5 C;  5B0Y A;  4WU8 C;  3REK A;  5JRG A;  3WTP C;  3AV2 B;  2Y2N A;  2PYO B;  3A6N B;  5GT0 B;  1ZLA D;  1P3O D;  3O62 A;  5JA4 B;  4EO5 B;  4ZUX B;  1KX3 D;  2Y2P A;  4WV4 B;  5DNM C;  3REI C;  5B0Y B;  3REK B;  3AFA D;  5JRG B;  3LZ1 B;  3X1V A;  1BFM A;  3O62 B;  3MVD A;  3H0L C;  3MNN C;  3B0C T;  3KUY A;  3UTA A;  3W99 C;  4H9S A;  3MGS A;  5B40 B;  1P3L A;  2ARO A;  3KWQ C;  5BNV B;  1P3P A;  2RVQ C;  3C1B C;  5CPK C;  1KX5 D;  1U35 D;  3AZG C;  3MGQ C;  4YS3 C;  1P3I A;  3X1V B;  1P3G A;  4ZBJ B;  3LJA A;  3MVD B;  5AVB D;  3WTP D;  3UTA B;  4AWL C;  5B1M A;  1P3P B;  2ARO B;  5GXQ B;  1BH9 A;  5B2J C;  2BG1 A;  2W8S A;  5BS7 A;  4XUJ C;  3LEL A;  4JJN C;  1BH8 A;  2Y2O A;  5DNM D;  1P3I B;  3REI D;  3W96 C;  1P3G B;  3AZF C;  3X1S D;  2L5A A;  5B1M B;  3WAA A;  3REL B;  1M19 C;  3MGP C;  2CV5 A;  3X1U C;  1BH9 B;  2DF4 C;  4KUD C;  3MNN D;  1M18 A;  4M6B A;  3X1S B;  3TU4 A;  3W99 D;  2YFW B;  1B6W A;  4J8W C;  2RVQ D;  2Y2I A;  4X23 C;  1BH8 B;  3C1B D;  5CPK D;  4Z5T A;  5CPI B;  5AY8 B;  3AZE B;  3MGQ D;  1KU5 A;  5BO0 A;  1P3M C;  2BYK A;  4YS3 D;  1KX4 B;  3WAA B;  3AZM A;  1M18 B;  4Z66 A;  3C1C C;  1ID3 C;  1P34 B;  3AV1 B;  5B2J D;  5B1L C;  4XUJ D;  1P3F A;  4Z5T B;  3AZN B;  3A6N C;  5GT0 C;  2PYO C;  5AV9 A;  1A7W A;  4JJN D;  5B32 G;  4E45 A;  5BO0 B;  2BYK B;  3W96 D;  4EO5 C;  4ZUX C;  1TZY A;  4Z66 B;  1EQZ A;  5B33 D;  2J8P A;  5AV5 A;  1P3O C;  3MGP D;  4J8V A;  5B0Y C;  4H9O B;  4H9N A;  5B31 G;  3AL0 C;  5JRG C;  5B24 A;  3LZ1 C;  1P3B B;  1P3F B;  2NQB D;  4J8X A;  2BYM B;  2JSS A;  4J8W D;  1S32 A;  2Y2L A;  5AV9 B;  4X23 D;  5B32 D;  5B40 C;  3UT9 D;  1EQZ B;  5B31 A;  1AOI A;  2HIO A;  1P3M D;  5E5A A;  4J8U B;  4NE5 A;  4J8V B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...