5B1LB

The mouse nucleosome structure containing h3t
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
78
structure length
78
Chain Sequence
NIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords Histone H3t
publication title Testis-Specific Histone Variant H3t Gene Is Essential for Entry into Spermatogenesis
pubmed doi rcsb
source organism Mus musculus
total genus 27
structure length 78
sequence length 78
chains with identical sequence F
ec nomenclature
pdb deposition date 2015-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5b1lB00
2CV5C 5GXQD 4YM6D 3AZKB 3A6NC 4HGAC 3C1BA 4H9SC 1H3OA 5AY8A 4LD9A 3KWQA 3AZLB 1P3MC 3X1SB 2F8NH 3AZIC 3B6GC 3RELC 3UTBC 3C1BD 1P3IB 1TZYC 3AZEC 5AV5C 5AY8D 4LD9D 3KWQD 3WA9A 3C1CA 2AROA 2HUEC 4J8VB 3WAAC 5AV9C 3B0BA 1BH9A 3LZ0A 1KX3B 4G91B 3WA9D 3C1CD 5GXQC 1TAFA 2AROD 4YM6C 5B31C 5DNMB 1P3OA 3LJAB 5GT0A 3LZ0D 3VH5A 3W99D 1R4VA 1M19B 5CP6B 3C1BC 1BFMA 4YS3D 1P3OD 3REIA 5AY8C 4Z2MG 2PYOA 1F66A 5B2JB 1EQZB 3X1TB 4ZUXA 3MGPA 1B67A 3W98A 3MGSA 3WA9C 3C1CC 2BYKB 1P3LB 2AROC 1P3PA 2PYOD 1F66D 4WNNB 5B33A 4H9RA 1M1AB 3WKJB 4KGCC 4ZUXD 2HIOB 3LZ0C 3MGPD 3WTPB 4CAYB 1P3PD 2CWEA 5B33D 1P3OC 5E5AA 5GT0C 4XZQB 4M6BA 3AV1A 1M18B 4CSRB 5BS7A 4Z66B 3AZNA 5E5AD 4X23D 3REIC 3W96B 3AZHB 3AV1D 5DNNB 2PYOC 1F66C 4QLCD 3KUYD 5F99A 3AZND 5AVCD 3REKA 2NZDA 3W98C 3MGSC 3AN2B 1U35B 1ZLAB 3REHA 4Z5TA 5GT3A 4ZBJC 3REJC 1ULYA 3AZFA 5F99D 1P3GB 3REKD 4R8PC 3VH6A 5JA4B 3AV2D 5JRGA 1P3BA 5AVBA 3KXBB 3REHD 5AV8B 5GT3D 2F8NG 3AZFD 2F8NA 4J8UC 1P34B 4J8XB 1KX5B 3UTAB 3B0DB 5JRGD 1P3BD 4WU8B 1N1JA 5CPIA 1S32A 2JSSA 3A6NA 2YFVB 4H9SA 4H9QA 1P3AB 5B0YB 2F8ND 3LELB 3AZNC 3X1VA 5CPID 1S32D 2FJ7B 3A6ND 3UTBA 3B6FA 3X1UA 1BH8B 5B1LA 3X1VD 2NZDC 1P3MD 4H9PB 4UUZA 3B6GD 3RELD 3REHC 4Z5TC 3UTBD 5GT3C 3B6FD 5C3IC 3X1UD 5B40B 1TZYD 3AZFC 2CV5B 5B1LD 2NQBA 1P3BC 3MVDC 5GSUA 4HGAB 5B31G 3LZ1B 5AVBC 5B31A 3MGQB 1ID3B 3AZMB 5AV9D 1F1EA 1KX4B 2NQBD 4EO5B 5AV6B 3AYWA 4KHAB 5GSUD 5CPIC 1S32C 5B31D 3B0CT 4WU9A 3AZEB 5AV5B 4H9OA 5B32G 2BYMA 5B32A 3AZLA 2IO5C 4H9NB 3X1SA 3X1VC 3AZJA 3AYWD 3AZGB 5CPKC 1P3FA 3WAAB 4WU9D 3B6FC 3X1UC 4G92C 4J8WC 3VH6T 3MNNB 1Q9CA 5GXQB 5B32D 5B1LC 4YM6B 3X1SD 3AZJD 1P3FD 3R45B 5CHLB 4J8VA 4KGCA 1KX3A 3VH5W 2NQBC 5GSUC 1HQ3A 3C1BB 3W97A 5DNMA 4LD9B 3KWQB 3LJAA 4KGCD 5B2IA 1AOIA 3AYWC 5BNVA 1HQ3D 3W97D 5CP6A 4WU9C 3TU4A 5G49A 5B2ID 3C1CB 5GT0D 5B32C 3AZLC 3X1SC 3AZJC 1AOID 5CPJA 1P3FC 5CP6D 1EQZA 3LZ0B 3TU4D 4KUDA 3REID 1TAFB 3W99B 2BYKA 5CPJD 4YS3B 3REJA 4J8VC 1P3OB 1M1AA 4KUDD 1KX3C 3WTPA 4G91C 4R8PA 3W98D 3MGSD 1HQ3C 3MGRA 3W97C 5BO0A 5DNMC 3REJD 3O62A 3LJAC 4J8UA 5B2IC 4XZQA 4R8PD 1AOIC 2PYOB 1M18A 1F66B 5BNXA 3NQUA 4CSRA 3MGRD 4Z66A 1M19C 5CP6C 5B1MA 4ZUXB 3MGPB 3TU4C 3O62D 3W96A 4J8UD 3AZHA 4XZQD 5B0ZA 1P3PB 4XUJA 4ZBJB 5B33B 5CPJC 4H9RB 1EQZC 3X1TC 5B1MD 4KUDC 4AWLB 3VH6W 3AN2A 5B0ZD 4XUJD 1P3LC 5FUGA 2L5AA 5E5AB 4X23B 1KU5A 1WWSA 1P3KA 1M1AC 3AV1B 2HIOC 5JA4A 3WTPC 5B24A 2NZDD 3MVDA 4QLCB 3KUYB 3MGRC 5AV8A 4Z5TD 3AZNB 5AVCB 1P3KD 3O62C 4J8XA 1KX5A 3UTAA 4XZQC 5B24D 3AFAA 3MVDD 1M18C 3KSYA 5AVBD 4DRAA 4Z66C 5F99B 1P3AA 4NE6A 5B0YA 3REKB 5B1MC 3AV2B 1JFIA 3W96C 4J8XD 1KX5D 3AZHC 5B0ZC 4JJNA 5CPKA 4XUJC 3AFAD 3REHB 2FJ7A 3UT9A 3AZFB 5B0YD 4J8WA 5JRGB 4NE3A 3AN2C 4JJND 5CPKD 1ZLAC 3UT9D 2F8NB 5B40A 5KDMB 4J8WD 1P3GC 1P3KC 3V9RA 2F8NK 5B24C 3LZ1A 3A6NB 3KXBC 4H9QB 5AV8C 3AZMA 5B40D 1P3MB 1KX4A 4J8XC 2RVQC 3AZIB 3UTAC 5AV6A 1KX5C 3B6GB 3RELB 4WV4B 3AFAC 3AZKA 3UTBB 3B6FB 1TZYB 1P3AC 3AZMD 5B0YC 5B1LB 3LELC 1KX4D 4H9NA 4UUZB 5AV6D 4JJNC 2HUEB 3AZKD 2FJ7C 3UT9C 5AV9B 4WZSB 1P3IA 3MNNA 2NQBB 2YFWB 5GSUB 3AZLD 5B31B 3NQJB 3R45A 1P3ID 5B40C 4NE5A 3MNND 3AYWB 3MGQC 1ID3C 4WU9B 3LZ1C 1WWIA 1H3OB 4J8VD 4H9OB 5AY8B 3AZMC 2BYMB 5B32B 3AZJB 1KX3D 1KX4C 4EO5C 5AV6C 1P3FB 3AZKC 1M19A 5DNMD 2LY8A 3LJAD 3WA9B 2AROB 3AZGC 4E44A 5B2JA 1M19D 4KGCB 3X1TA 1P3IC 1BH9B 3MNNC 3W99A 1HQ3B 3W97B 1P3LA 4YS3A 4WNNA 5B2JD 1EQZD 3X1TD 5B2IB 5GT0B 3WKJA 1AOIB 2HIOA 5BNVB 1P3LD 4CAYA 3TU4B 5G49B 1HTAA 4LD9C 3REIB 3KWQC 1M1AD 3WKJD 2HIOD 3WTPD 5CPJB 3B0CW 4KUDB 3W98B 3MGSB 1M18D 5DNNA 3REJB 4Z66D 5B2JC 1A7WA 4R8PB 3W96D 3W99C 3AZHD 3MGRB 1U35A 3WTPE 5BO0B 1ZLAA 5DNND 4YS3C 4X23A 3O62B 4J8UB 1P3GA 3WKJC 5BNXB 3AN2D 3NQUB 4QLCA 1U35D 1ZLAD 3KUYA 3KXBA 5B1MB 5AVCA 1P3GD 5B0ZB 1P34A 4XUJB 4WU8A 3KXBD 5AV8D 2YFVA 4ZUXC 3MGPC 3AV2A 2NZDB 3LELA 1P34D 2RVQD 3UTAD 5FUGB 1P3PC 4WU8D 4Z5TB 5DNNC 5BT1D 4Z2MH 5C3IB 5GT3B 5B33C 1P3KB 3VH5T 1P3AD 1BH8A 5B24B 3LELD 1P3BB 4AWLC 3MVDB 4H9PA 5AVBB 1U35C 2FJ7D 4NFTA 5E5AC 5KDMA 4X23C 2CV5A 3AV1C 3AFAB 1N1JB 5CPIB 1S32B 3MGQA 1ID3A 4QLCC 5BS7C 3KUYC 1B6WA 5AVCC 1JFIB 2CV5D 1P3MA 2IO5B 3X1VB 3AZIA 4JJNB 5CPKB 1P34C 3B6GA 3B0DC 3RELA 4KHAA 3MGQD 3UT9B 1ID3D 3LZ1D 4WU8C 4E45A 5BT1C 1TZYA 3X1UB 4DRBA 5AV5A 5F99C 4J8WB 4G92B 3AZEA 3REKC 3AV2C 3AZID 3AZGA 3WAAA 5AV9A 3AZED 5AV5D 3V9RB 2YFWA 5JRGC 5GXQA 4YM6A 3AZGD 3NQJA 3WAAD
chains in the Genus database with same CATH superfamily
2CV5C 5GXQD 4YM6D 3AZKB 3A6NC 4HGAC 3C1BA 4H9SC 1H3OA 3F6TA 5AY8A 4LD9A 3KWQA 3AZLB 1P3MC 3X1SB 2F8NH 3AZIC 3B6GC 3RELC 3UTBC 3C1BD 1P3IB 2UWXA 1TZYC 3AZEC 5AV5C 5AY8D 4LD9D 3KWQD 3WA9A 3C1CA 2AROA 2HUEC 4J8VB 3WAAC 5AV9C 3B0BA 1BH9A 3LZ0A 1KX3B 4G91B 3WA9D 3C1CD 5GXQC 1TAFA 2AROD 4YM6C 5B31C 5DNMB 1P3OA 3LJAB 5GT0A 3LZ0D 3VH5A 3FDDA 3W99D 3EPHA 2Y2MA 1R4VA 1M19B 5CP6B 3C1BC 1BFMA 2BG1A 4YS3D 1P3OD 3REIA 5AY8C 4Z2MG 2PYOA 1F66A 5B2JB 2Y2OA 1EQZB 3X1TB 4ZUXA 3MGPA 1B67A 3W98A 2ZM5A 3MGSA 3WA9C 3C1CC 2BYKB 1P3LB 2AROC 1P3PA 2PYOD 1F66D 4WNNB 5B33A 4H9RA 1M1AB 3WKJB 4KGCC 4ZUXD 2HIOB 3LZ0C 3MGPD 3WTPB 2G5HC 4CAYB 1P3PD 2CWEA 5B33D 1P3OC 5E5AA 5GT0C 4XZQB 4M6BA 3AV1A 1M18B 2RIQA 4CSRB 5BS7A 4Z66B 3AZNA 5E5AD 4X23D 3REIC 3W96B 3AL0C 3AZHB 3AV1D 5DNNB 2PYOC 2DF4C 1F66C 4QLCD 3KUYD 5F99A 3AZND 5AVCD 3REKA 1T3UA 2NZDA 3W98C 2Y2PA 3MGSC 3AN2B 1U35B 1ZLAB 3REHA 4Z5TA 5GT3A 4ZBJC 3REJC 1ULYA 3AZFA 5F99D 1P3GB 3REKD 4R8PC 3VH6A 5JA4B 3AV2D 5JRGA 1P3BA 5AVBA 3KXBB 3REHD 5AV8B 5GT3D 2F8NG 3AZFD 2F8NA 4J8UC 2Y2KA 1P34B 4J8XB 1KX5B 3UTAB 3B0DB 5JRGD 2J8PA 1P3BD 1N1JA 4WU8B 5CPIA 1S32A 2JSSA 3A6NA 2YFVB 4H9SA 4H9QA 1P3AB 5B0YB 2F8ND 3LELB 3AZNC 3X1VA 3A1KA 2XD5A 5CPID 1S32D 2FJ7B 3A6ND 3UTBA 3B6FA 3X1UA 1BH8B 5B1LA 3X1VD 2NZDC 1P3MD 4H9PB 4UUZA 3B6GD 3RELD 3REHC 4Z5TC 3UTBD 5GT3C 3B6FD 5C3IC 3X1UD 5B40B 1TZYD 3AZFC 2CV5B 4WJ3C 3IP4C 5B1LD 3EG5B 2NQBA 1P3BC 3MVDC 5GSUA 4HGAB 5B31G 2DQNC 5AVBC 5B31A 3LZ1B 3MGQB 1ID3B 3AZMB 5AV9D 1F1EA 1KX4B 2NQBD 4EO5B 5AV6B 3AYWA 4KHAB 5GSUD 1PZRA 5CPIC 1S32C 5B31D 3B0CT 4WU9A 3AZEB 5AV5B 4H9OA 5B32G 2BYMA 5B32A 3AZLA 2IO5C 4H9NB 3X1SA 3X1VC 3AZJA 3AYWD 3AZGB 5CPKC 1P3FA 3WAAB 4WU9D 3B6FC 3X1UC 4G92C 4J8WC 3VH6T 2Y2IA 3MNNB 1Q9CA 5GXQB 5B32D 5B1LC 4YM6B 3X1SD 4DQYB 3AZJD 2G5IC 1P3FD 3R45B 5CHLB 4J8VA 4KGCA 1KX3A 3VH5W 2NQBC 5GSUC 1HQ3A 3C1BB 3W97A 5DNMA 4LD9B 1Z2CB 3KWQB 3LJAA 4KGCD 5B2IA 1AOIA 3AYWC 5BNVA 1HQ3D 3W97D 5CP6A 4WU9C 3TU4A 5G49A 5B2ID 3C1CB 5GT0D 5B32C 3AZLC 3X1SC 3AZJC 1AOID 5CPJA 1P3FC 5CP6D 1EQZA 2Y2QA 3LZ0B 3TU4D 4KUDA 3REID 1TAFB 3W99B 3KFUG 2BYKA 5CPJD 3EPJA 4YS3B 3REJA 4J8VC 1P3OB 1M1AA 4KUDD 1KX3C 3WTPA 4G91C 4R8PA 3W98D 3MGSD 1HQ3C 3MGRA 3W97C 5BO0A 5DNMC 3REJD 3O62A 3LJAC 4J8UA 5B2IC 4XZQA 4R8PD 1AOIC 2PYOB 1M18A 1F66B 5BNXA 3NQUA 4CSRA 3MGRD 4Z66A 1M19C 5CP6C 5B1MA 4ZUXB 1W2EA 3MGPB 2FFFB 3O62D 3W96A 3TU4C 4J8UD 2VQRA 3AZHA 4XZQD 2ZY5A 5B0ZA 2F2AC 4XUJA 1P3PB 4ZBJB 2Y2HA 5B33B 5CPJC 4H9RB 2ZY4A 1EQZC 3X1TC 5B1MD 4KUDC 4AWLB 3VH6W 3AN2A 5B0ZD 4XUJD 1P3LC 5FUGA 2L5AA 5E5AB 4X23B 1KU5A 1WWSA 1P3KA 1M1AC 3AV1B 2HIOC 5JA4A 3WTPC 5B24A 2NZDD 3MVDA 4QLCB 3KUYB 3MGRC 5AV8A 4Z5TD 3AZNB 5AVCB 1P3KD 3O62C 4J8XA 1KX5A 3UTAA 4XZQC 5B24D 3AFAA 3MVDD 1M18C 3KSYA 5AVBD 3H0LC 4DRAA 4Z66C 5F99B 1P3AA 4NE6A 5B0YA 3REKB 5B1MC 3AV2B 1JFIA 3W96C 4J8XD 1KX5D 3AZHC 5B0ZC 4JJNA 5CPKA 4XUJC 3AFAD 3REHB 2FJ7A 2ZY3A 3UT9A 3AZFB 5B0YD 4J8WA 5JRGB 4NE3A 3AN2C 4JJND 5CPKD 1ZLAC 3UT9D 2F8NB 5B40A 5KDMB 4J8WD 1P3GC 1P3KC 3V9RA 2F8NK 5B24C 2W8SA 3LZ1A 3A6NB 3KXBC 4H9QB 5AV8C 3AZMA 5B40D 1P3MB 1KX4A 4J8XC 2RVQC 3AZIB 3UTAC 5AV6A 1KX5C 3B6GB 3RELB 4WV4B 3AFAC 3AZKA 3UTBB 3B6FB 1TZYB 1P3AC 3AZMD 5B0YC 5B1LB 3LELC 1KX4D 4H9NA 2Y2GA 4UUZB 5AV6D 4JJNC 2HUEB 3AZKD 2FJ7C 3UT9C 5AV9B 4WZSB 1P3IA 3MNNA 2NQBB 2Y2NA 2YFWB 5GSUB 3AZLD 5B31B 3NQJB 3R45A 1P3ID 5B40C 4NE5A 3MNND 3AYWB 3MGQC 1ID3C 4WU9B 3LZ1C 1WWIA 1H3OB 4J8VD 4H9OB 5AY8B 3AZMC 2BYMB 5B32B 2Y2JA 3AZJB 1KX3D 1KX4C 4EO5C 5AV6C 1P3FB 3AZKC 1M19A 5DNMD 2LY8A 3LJAD 3WA9B 2AROB 3AZGC 3A1IA 4E44A 5B2JA 1M19D 4KGCB 3X1TA 1P3IC 1BH9B 3MNNC 3W99A 1HQ3B 3W97B 1P3LA 4YS3A 4WNNA 5B2JD 1EQZD 3X1TD 5B2IB 5GT0B 3WKJA 1AOIB 2HIOA 5BNVB 2ZY2A 1P3LD 4CAYA 3TU4B 5G49B 1HTAA 4LD9C 3REIB 3KWQC 1M1AD 3WKJD 2HIOD 3WTPD 5CPJB 3B0CW 4KUDB 3W98B 3EPKA 3MGSB 1M18D 5DNNA 3REJB 4Z66D 5B2JC 1A7WA 4R8PB 3W96D 3W99C 3AZHD 3MGRB 1U35A 3WTPE 5BO0B 1ZLAA 5DNND 4YS3C 4X23A 3O62B 4J8UB 1P3GA 3WKJC 5BNXB 3AN2D 3NQUB 4QLCA 1U35D 1ZLAD 3KUYA 3KXBA 5B1MB 5AVCA 1P3GD 5B0ZB 1P34A 4XUJB 4WU8A 3KXBD 5AV8D 2YFVA 4ZUXC 3MGPC 3AV2A 2NZDB 3LELA 1P34D 2RVQD 3UTAD 5FUGB 1P3PC 4WU8D 4Z5TB 5DNNC 5BT1D 4Z2MH 3P5JB 5C3IB 5GT3B 5B33C 1P3KB 3VH5T 1P3AD 1BH8A 3EPLA 5B24B 3LELD 1P3BB 4AWLC 3MVDB 4H9PA 5AVBB 1U35C 2Y2LA 2FJ7D 4NFTA 5E5AC 5KDMA 4X23C 2CV5A 3AV1C 3AFAB 2JCHA 1N1JB 5CPIB 1S32B 3MGQA 1ID3A 4QLCC 5BS7C 3KUYC 1B6WA 5AVCC 1JFIB 2CV5D 1P3MA 2IO5B 3X1VB 3AZIA 4JJNB 5CPKB 1P34C 3B6GA 3B0DC 3RELA 4KHAA 3MGQD 3UT9B 1ID3D 3LZ1D 4WU8C 4E45A 5BT1C 2XD1A 1TZYA 3X1UB 4DRBA 5AV5A 5F99C 4J8WB 4G92B 3AZEA 3REKC 3AV2C 3AZID 2JE5A 3AZGA 3H0MC 4UPKA 3WAAA 3H0RC 5AV9A 3AZED 5AV5D 3V9RB 2YFWA 5JRGC 5GXQA 4YM6A 3AZGD 3NQJA 3WAAD
chains in the Genus database with same CATH topology
2CV5C 5GXQD 4YM6D 3AZKB 3A6NC 4HGAC 3C1BA 4H9SC 1H3OA 3F6TA 5AY8A 4LD9A 3KWQA 3AZLB 1P3MC 3X1SB 2F8NH 3AZIC 3B6GC 3RELC 3UTBC 3C1BD 1P3IB 2UWXA 1TZYC 3AZEC 5AV5C 5AY8D 4LD9D 3KWQD 3WA9A 3C1CA 2AROA 2HUEC 4J8VB 3WAAC 5AV9C 3B0BA 1BH9A 3LZ0A 1KX3B 4G91B 3WA9D 3C1CD 5GXQC 1TAFA 2AROD 4YM6C 5B31C 5DNMB 1P3OA 3LJAB 5GT0A 3LZ0D 3VH5A 3FDDA 3W99D 3EPHA 2Y2MA 1R4VA 1M19B 5CP6B 3C1BC 1BFMA 2BG1A 4YS3D 1P3OD 3REIA 5AY8C 4Z2MG 2PYOA 1F66A 5B2JB 2Y2OA 1EQZB 3X1TB 4ZUXA 3MGPA 1B67A 3W98A 2ZM5A 3MGSA 3WA9C 3C1CC 2BYKB 1P3LB 2AROC 1P3PA 2PYOD 1F66D 4WNNB 5B33A 4H9RA 1M1AB 3WKJB 4KGCC 4ZUXD 2HIOB 3LZ0C 3MGPD 3WTPB 2G5HC 4CAYB 1P3PD 2CWEA 5B33D 1P3OC 5E5AA 5GT0C 4XZQB 4M6BA 3AV1A 1M18B 2RIQA 4CSRB 5BS7A 4Z66B 3AZNA 5E5AD 4X23D 3REIC 3W96B 3AL0C 3AZHB 3AV1D 5DNNB 2PYOC 2DF4C 1F66C 4QLCD 3KUYD 5F99A 3AZND 5AVCD 3REKA 1T3UA 2NZDA 3W98C 2Y2PA 3MGSC 3AN2B 1U35B 1ZLAB 3REHA 4Z5TA 5GT3A 4ZBJC 3REJC 1ULYA 3AZFA 5F99D 1P3GB 3REKD 4R8PC 3VH6A 5JA4B 3AV2D 5JRGA 1P3BA 5AVBA 3KXBB 3REHD 5AV8B 5GT3D 2F8NG 3AZFD 2F8NA 4J8UC 2Y2KA 1P34B 4J8XB 1KX5B 3UTAB 3B0DB 5JRGD 2J8PA 1P3BD 1N1JA 4WU8B 5CPIA 1S32A 2JSSA 3A6NA 2YFVB 4H9SA 4H9QA 1P3AB 5B0YB 2F8ND 3LELB 3AZNC 3X1VA 3A1KA 2XD5A 5CPID 1S32D 2FJ7B 3A6ND 3UTBA 3B6FA 3X1UA 1BH8B 5B1LA 3X1VD 2NZDC 1P3MD 4H9PB 4UUZA 3B6GD 3RELD 3REHC 4Z5TC 3UTBD 5GT3C 3B6FD 5C3IC 3X1UD 5B40B 1TZYD 3AZFC 2CV5B 4WJ3C 3IP4C 5B1LD 3EG5B 2NQBA 1P3BC 3MVDC 5GSUA 4HGAB 5B31G 2DQNC 5AVBC 5B31A 3LZ1B 3MGQB 1ID3B 3AZMB 5AV9D 1F1EA 1KX4B 2NQBD 4EO5B 5AV6B 3AYWA 4KHAB 5GSUD 1PZRA 5CPIC 1S32C 5B31D 3B0CT 4WU9A 3AZEB 5AV5B 4H9OA 5B32G 2BYMA 5B32A 3AZLA 2IO5C 4H9NB 3X1SA 3X1VC 3AZJA 3AYWD 3AZGB 5CPKC 1P3FA 3WAAB 4WU9D 3B6FC 3X1UC 4G92C 4J8WC 3VH6T 2Y2IA 3MNNB 1Q9CA 5GXQB 5B32D 5B1LC 4YM6B 3X1SD 4DQYB 3AZJD 2G5IC 1P3FD 3R45B 5CHLB 4J8VA 4KGCA 1KX3A 3VH5W 2NQBC 5GSUC 1HQ3A 3C1BB 3W97A 5DNMA 4LD9B 1Z2CB 3KWQB 3LJAA 4KGCD 5B2IA 1AOIA 3AYWC 5BNVA 1HQ3D 3W97D 5CP6A 4WU9C 3TU4A 5G49A 5B2ID 3C1CB 5GT0D 5B32C 3AZLC 3X1SC 3AZJC 1AOID 5CPJA 1P3FC 5CP6D 1EQZA 2Y2QA 3LZ0B 3TU4D 4KUDA 3REID 1TAFB 3W99B 3KFUG 2BYKA 5CPJD 3EPJA 4YS3B 3REJA 4J8VC 1P3OB 1M1AA 4KUDD 1KX3C 3WTPA 4G91C 4R8PA 3W98D 3MGSD 1HQ3C 3MGRA 3W97C 5BO0A 5DNMC 3REJD 3O62A 3LJAC 4J8UA 5B2IC 4XZQA 4R8PD 1AOIC 2PYOB 1M18A 1F66B 5BNXA 3NQUA 4CSRA 3MGRD 4Z66A 1M19C 5CP6C 5B1MA 4ZUXB 1W2EA 3MGPB 2FFFB 3O62D 3W96A 3TU4C 4J8UD 2VQRA 3AZHA 4XZQD 2ZY5A 5B0ZA 2F2AC 4XUJA 1P3PB 4ZBJB 2Y2HA 5B33B 5CPJC 4H9RB 2ZY4A 1EQZC 3X1TC 5B1MD 4KUDC 4AWLB 3VH6W 3AN2A 5B0ZD 4XUJD 1P3LC 5FUGA 2L5AA 5E5AB 4X23B 1KU5A 1WWSA 1P3KA 1M1AC 3AV1B 2HIOC 5JA4A 3WTPC 5B24A 2NZDD 3MVDA 4QLCB 3KUYB 3MGRC 5AV8A 4Z5TD 3AZNB 5AVCB 1P3KD 3O62C 4J8XA 1KX5A 3UTAA 4XZQC 5B24D 3AFAA 3MVDD 1M18C 3KSYA 5AVBD 3H0LC 4DRAA 4Z66C 5F99B 1P3AA 4NE6A 5B0YA 3REKB 5B1MC 3AV2B 1JFIA 3W96C 4J8XD 1KX5D 3AZHC 5B0ZC 4JJNA 5CPKA 4XUJC 3AFAD 3REHB 2FJ7A 2ZY3A 3UT9A 3AZFB 5B0YD 4J8WA 5JRGB 4NE3A 3AN2C 4JJND 5CPKD 1ZLAC 3UT9D 2F8NB 5B40A 5KDMB 4J8WD 1P3GC 1P3KC 3V9RA 2F8NK 5B24C 2W8SA 3LZ1A 3A6NB 3KXBC 4H9QB 5AV8C 3AZMA 5B40D 1P3MB 1KX4A 4J8XC 2RVQC 3AZIB 3UTAC 5AV6A 1KX5C 3B6GB 3RELB 4WV4B 3AFAC 3AZKA 3UTBB 3B6FB 1TZYB 1P3AC 3AZMD 5B0YC 5B1LB 3LELC 1KX4D 4H9NA 2Y2GA 4UUZB 5AV6D 4JJNC 2HUEB 3AZKD 2FJ7C 3UT9C 5AV9B 4WZSB 1P3IA 3MNNA 2NQBB 2Y2NA 2YFWB 5GSUB 3AZLD 5B31B 3NQJB 3R45A 1P3ID 5B40C 4NE5A 3MNND 3AYWB 3MGQC 1ID3C 4WU9B 3LZ1C 1WWIA 1H3OB 4J8VD 4H9OB 5AY8B 3AZMC 2BYMB 5B32B 2Y2JA 3AZJB 1KX3D 1KX4C 4EO5C 5AV6C 1P3FB 3AZKC 1M19A 5DNMD 2LY8A 3LJAD 3WA9B 2AROB 3AZGC 3A1IA 4E44A 5B2JA 1M19D 4KGCB 3X1TA 1P3IC 1BH9B 3MNNC 3W99A 1HQ3B 3W97B 1P3LA 4YS3A 4WNNA 5B2JD 1EQZD 3X1TD 5B2IB 5GT0B 3WKJA 1AOIB 2HIOA 5BNVB 2ZY2A 1P3LD 4CAYA 3TU4B 5G49B 1HTAA 4LD9C 3REIB 3KWQC 1M1AD 3WKJD 2HIOD 3WTPD 5CPJB 3B0CW 4KUDB 3W98B 3EPKA 3MGSB 1M18D 5DNNA 3REJB 4Z66D 5B2JC 1A7WA 4R8PB 3W96D 3W99C 3AZHD 3MGRB 1U35A 3WTPE 5BO0B 1ZLAA 5DNND 4YS3C 4X23A 3O62B 4J8UB 1P3GA 3WKJC 5BNXB 3AN2D 3NQUB 4QLCA 1U35D 1ZLAD 3KUYA 3KXBA 5B1MB 5AVCA 1P3GD 5B0ZB 1P34A 4XUJB 4WU8A 3KXBD 5AV8D 2YFVA 4ZUXC 3MGPC 3AV2A 2NZDB 3LELA 1P34D 2RVQD 3UTAD 5FUGB 1P3PC 4WU8D 4Z5TB 5DNNC 5BT1D 4Z2MH 3P5JB 5C3IB 5GT3B 5B33C 1P3KB 3VH5T 1P3AD 1BH8A 3EPLA 5B24B 3LELD 1P3BB 4AWLC 3MVDB 4H9PA 5AVBB 1U35C 2Y2LA 2FJ7D 4NFTA 5E5AC 5KDMA 4X23C 2CV5A 3AV1C 3AFAB 2JCHA 1N1JB 5CPIB 1S32B 3MGQA 1ID3A 4QLCC 5BS7C 3KUYC 1B6WA 5AVCC 1JFIB 2CV5D 1P3MA 2IO5B 3X1VB 3AZIA 4JJNB 5CPKB 1P34C 3B6GA 3B0DC 3RELA 4KHAA 3MGQD 3UT9B 1ID3D 3LZ1D 4WU8C 4E45A 5BT1C 2XD1A 1TZYA 3X1UB 4DRBA 5AV5A 5F99C 4J8WB 4G92B 3AZEA 3REKC 3AV2C 3AZID 2JE5A 3AZGA 3H0MC 4UPKA 3WAAA 3H0RC 5AV9A 3AZED 5AV5D 3V9RB 2YFWA 5JRGC 5GXQA 4YM6A 3AZGD 3NQJA 3WAAD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CV5 C;  5GXQ D;  4YM6 D;  3AZK B;  3A6N C;  4HGA C;  3C1B A;  4H9S C;  1H3O A;  5AY8 A;  4LD9 A;  3KWQ A;  3AZL B;  1P3M C;  3X1S B;  2F8N H;  3AZI C;  3B6G C;  3REL C;  3UTB C;  3C1B D;  1P3I B;  1TZY C;  3AZE C;  5AV5 C;  5AY8 D;  4LD9 D;  3KWQ D;  3WA9 A;  3C1C A;  2ARO A;  2HUE C;  4J8V B;  3WAA C;  5AV9 C;  3B0B A;  1BH9 A;  3LZ0 A;  1KX3 B;  4G91 B;  3WA9 D;  3C1C D;  5GXQ C;  1TAF A;  2ARO D;  4YM6 C;  5B31 C;  5DNM B;  1P3O A;  3LJA B;  5GT0 A;  3LZ0 D;  3VH5 A;  3W99 D;  1R4V A;  1M19 B;  5CP6 B;  3C1B C;  1BFM A;  4YS3 D;  1P3O D;  3REI A;  5AY8 C;  4Z2M G;  2PYO A;  1F66 A;  5B2J B;  1EQZ B;  3X1T B;  4ZUX A;  3MGP A;  1B67 A;  3W98 A;  3MGS A;  3WA9 C;  3C1C C;  2BYK B;  1P3L B;  2ARO C;  1P3P A;  2PYO D;  1F66 D;  4WNN B;  5B33 A;  4H9R A;  1M1A B;  3WKJ B;  4KGC C;  4ZUX D;  2HIO B;  3LZ0 C;  3MGP D;  3WTP B;  4CAY B;  1P3P D;  2CWE A;  5B33 D;  1P3O C;  5E5A A;  5GT0 C;  4XZQ B;  4M6B A;  3AV1 A;  1M18 B;  4CSR B;  5BS7 A;  4Z66 B;  3AZN A;  5E5A D;  4X23 D;  3REI C;  3W96 B;  3AZH B;  3AV1 D;  5DNN B;  2PYO C;  1F66 C;  4QLC D;  3KUY D;  5F99 A;  3AZN D;  5AVC D;  3REK A;  2NZD A;  3W98 C;  3MGS C;  3AN2 B;  1U35 B;  1ZLA B;  3REH A;  4Z5T A;  5GT3 A;  4ZBJ C;  3REJ C;  1ULY A;  3AZF A;  5F99 D;  1P3G B;  3REK D;  4R8P C;  3VH6 A;  5JA4 B;  3AV2 D;  5JRG A;  1P3B A;  5AVB A;  3KXB B;  3REH D;  5AV8 B;  5GT3 D;  2F8N G;  3AZF D;  2F8N A;  4J8U C;  1P34 B;  4J8X B;  1KX5 B;  3UTA B;  3B0D B;  5JRG D;  1P3B D;  4WU8 B;  1N1J A;  5CPI A;  1S32 A;  2JSS A;  3A6N A;  2YFV B;  4H9S A;  4H9Q A;  1P3A B;  5B0Y B;  2F8N D;  3LEL B;  3AZN C;  3X1V A;  5CPI D;  1S32 D;  2FJ7 B;  3A6N D;  3UTB A;  3B6F A;  3X1U A;  1BH8 B;  5B1L A;  3X1V D;  2NZD C;  1P3M D;  4H9P B;  4UUZ A;  3B6G D;  3REL D;  3REH C;  4Z5T C;  3UTB D;  5GT3 C;  3B6F D;  5C3I C;  3X1U D;  5B40 B;  1TZY D;  3AZF C;  2CV5 B;  5B1L D;  2NQB A;  1P3B C;  3MVD C;  5GSU A;  4HGA B;  5B31 G;  3LZ1 B;  5AVB C;  5B31 A;  3MGQ B;  1ID3 B;  3AZM B;  5AV9 D;  1F1E A;  1KX4 B;  2NQB D;  4EO5 B;  5AV6 B;  3AYW A;  4KHA B;  5GSU D;  5CPI C;  1S32 C;  5B31 D;  3B0C T;  4WU9 A;  3AZE B;  5AV5 B;  4H9O A;  5B32 G;  2BYM A;  5B32 A;  3AZL A;  2IO5 C;  4H9N B;  3X1S A;  3X1V C;  3AZJ A;  3AYW D;  3AZG B;  5CPK C;  1P3F A;  3WAA B;  4WU9 D;  3B6F C;  3X1U C;  4G92 C;  4J8W C;  3VH6 T;  3MNN B;  1Q9C A;  5GXQ B;  5B32 D;  5B1L C;  4YM6 B;  3X1S D;  3AZJ D;  1P3F D;  3R45 B;  5CHL B;  4J8V A;  4KGC A;  1KX3 A;  3VH5 W;  2NQB C;  5GSU C;  1HQ3 A;  3C1B B;  3W97 A;  5DNM A;  4LD9 B;  3KWQ B;  3LJA A;  4KGC D;  5B2I A;  1AOI A;  3AYW C;  5BNV A;  1HQ3 D;  3W97 D;  5CP6 A;  4WU9 C;  3TU4 A;  5G49 A;  5B2I D;  3C1C B;  5GT0 D;  5B32 C;  3AZL C;  3X1S C;  3AZJ C;  1AOI D;  5CPJ A;  1P3F C;  5CP6 D;  1EQZ A;  3LZ0 B;  3TU4 D;  4KUD A;  3REI D;  1TAF B;  3W99 B;  2BYK A;  5CPJ D;  4YS3 B;  3REJ A;  4J8V C;  1P3O B;  1M1A A;  4KUD D;  1KX3 C;  3WTP A;  4G91 C;  4R8P A;  3W98 D;  3MGS D;  1HQ3 C;  3MGR A;  3W97 C;  5BO0 A;  5DNM C;  3REJ D;  3O62 A;  3LJA C;  4J8U A;  5B2I C;  4XZQ A;  4R8P D;  1AOI C;  2PYO B;  1M18 A;  1F66 B;  5BNX A;  3NQU A;  4CSR A;  3MGR D;  4Z66 A;  1M19 C;  5CP6 C;  5B1M A;  4ZUX B;  3MGP B;  3TU4 C;  3O62 D;  3W96 A;  4J8U D;  3AZH A;  4XZQ D;  5B0Z A;  1P3P B;  4XUJ A;  4ZBJ B;  5B33 B;  5CPJ C;  4H9R B;  1EQZ C;  3X1T C;  5B1M D;  4KUD C;  4AWL B;  3VH6 W;  3AN2 A;  5B0Z D;  4XUJ D;  1P3L C;  5FUG A;  2L5A A;  5E5A B;  4X23 B;  1KU5 A;  1WWS A;  1P3K A;  1M1A C;  3AV1 B;  2HIO C;  5JA4 A;  3WTP C;  5B24 A;  2NZD D;  3MVD A;  4QLC B;  3KUY B;  3MGR C;  5AV8 A;  4Z5T D;  3AZN B;  5AVC B;  1P3K D;  3O62 C;  4J8X A;  1KX5 A;  3UTA A;  4XZQ C;  5B24 D;  3AFA A;  3MVD D;  1M18 C;  3KSY A;  5AVB D;  4DRA A;  4Z66 C;  5F99 B;  1P3A A;  4NE6 A;  5B0Y A;  3REK B;  5B1M C;  3AV2 B;  1JFI A;  3W96 C;  4J8X D;  1KX5 D;  3AZH C;  5B0Z C;  4JJN A;  5CPK A;  4XUJ C;  3AFA D;  3REH B;  2FJ7 A;  3UT9 A;  3AZF B;  5B0Y D;  4J8W A;  5JRG B;  4NE3 A;  3AN2 C;  4JJN D;  5CPK D;  1ZLA C;  3UT9 D;  2F8N B;  5B40 A;  5KDM B;  4J8W D;  1P3G C;  1P3K C;  3V9R A;  2F8N K;  5B24 C;  3LZ1 A;  3A6N B;  3KXB C;  4H9Q B;  5AV8 C;  3AZM A;  5B40 D;  1P3M B;  1KX4 A;  4J8X C;  2RVQ C;  3AZI B;  3UTA C;  5AV6 A;  1KX5 C;  3B6G B;  3REL B;  4WV4 B;  3AFA C;  3AZK A;  3UTB B;  3B6F B;  1TZY B;  1P3A C;  3AZM D;  5B0Y C;  5B1L B;  3LEL C;  1KX4 D;  4H9N A;  4UUZ B;  5AV6 D;  4JJN C;  2HUE B;  3AZK D;  2FJ7 C;  3UT9 C;  5AV9 B;  4WZS B;  1P3I A;  3MNN A;  2NQB B;  2YFW B;  5GSU B;  3AZL D;  5B31 B;  3NQJ B;  3R45 A;  1P3I D;  5B40 C;  4NE5 A;  3MNN D;  3AYW B;  3MGQ C;  1ID3 C;  4WU9 B;  3LZ1 C;  1WWI A;  1H3O B;  4J8V D;  4H9O B;  5AY8 B;  3AZM C;  2BYM B;  5B32 B;  3AZJ B;  1KX3 D;  1KX4 C;  4EO5 C;  5AV6 C;  1P3F B;  3AZK C;  1M19 A;  5DNM D;  2LY8 A;  3LJA D;  3WA9 B;  2ARO B;  3AZG C;  4E44 A;  5B2J A;  1M19 D;  4KGC B;  3X1T A;  1P3I C;  1BH9 B;  3MNN C;  3W99 A;  1HQ3 B;  3W97 B;  1P3L A;  4YS3 A;  4WNN A;  5B2J D;  1EQZ D;  3X1T D;  5B2I B;  5GT0 B;  3WKJ A;  1AOI B;  2HIO A;  5BNV B;  1P3L D;  4CAY A;  3TU4 B;  5G49 B;  1HTA A;  4LD9 C;  3REI B;  3KWQ C;  1M1A D;  3WKJ D;  2HIO D;  3WTP D;  5CPJ B;  3B0C W;  4KUD B;  3W98 B;  3MGS B;  1M18 D;  5DNN A;  3REJ B;  4Z66 D;  5B2J C;  1A7W A;  4R8P B;  3W96 D;  3W99 C;  3AZH D;  3MGR B;  1U35 A;  3WTP E;  5BO0 B;  1ZLA A;  5DNN D;  4YS3 C;  4X23 A;  3O62 B;  4J8U B;  1P3G A;  3WKJ C;  5BNX B;  3AN2 D;  3NQU B;  4QLC A;  1U35 D;  1ZLA D;  3KUY A;  3KXB A;  5B1M B;  5AVC A;  1P3G D;  5B0Z B;  1P34 A;  4XUJ B;  4WU8 A;  3KXB D;  5AV8 D;  2YFV A;  4ZUX C;  3MGP C;  3AV2 A;  2NZD B;  3LEL A;  1P34 D;  2RVQ D;  3UTA D;  5FUG B;  1P3P C;  4WU8 D;  4Z5T B;  5DNN C;  5BT1 D;  4Z2M H;  5C3I B;  5GT3 B;  5B33 C;  1P3K B;  3VH5 T;  1P3A D;  1BH8 A;  5B24 B;  3LEL D;  1P3B B;  4AWL C;  3MVD B;  4H9P A;  5AVB B;  1U35 C;  2FJ7 D;  4NFT A;  5E5A C;  5KDM A;  4X23 C;  2CV5 A;  3AV1 C;  3AFA B;  1N1J B;  5CPI B;  1S32 B;  3MGQ A;  1ID3 A;  4QLC C;  5BS7 C;  3KUY C;  1B6W A;  5AVC C;  1JFI B;  2CV5 D;  1P3M A;  2IO5 B;  3X1V B;  3AZI A;  4JJN B;  5CPK B;  1P34 C;  3B6G A;  3B0D C;  3REL A;  4KHA A;  3MGQ D;  3UT9 B;  1ID3 D;  3LZ1 D;  4WU8 C;  4E45 A;  5BT1 C;  1TZY A;  3X1U B;  4DRB A;  5AV5 A;  5F99 C;  4J8W B;  4G92 B;  3AZE A;  3REK C;  3AV2 C;  3AZI D;  3AZG A;  3WAA A;  5AV9 A;  3AZE D;  5AV5 D;  3V9R B;  2YFW A;  5JRG C;  5GXQ A;  4YM6 A;  3AZG D;  3NQJ A;  3WAA D; 
#chains in the Genus database with same CATH topology
 2CV5 C;  5GXQ D;  4YM6 D;  3AZK B;  3A6N C;  4HGA C;  3C1B A;  4H9S C;  1H3O A;  3F6T A;  5AY8 A;  4LD9 A;  3KWQ A;  3AZL B;  1P3M C;  3X1S B;  2F8N H;  3AZI C;  3B6G C;  3REL C;  3UTB C;  3C1B D;  1P3I B;  2UWX A;  1TZY C;  3AZE C;  5AV5 C;  5AY8 D;  4LD9 D;  3KWQ D;  3WA9 A;  3C1C A;  2ARO A;  2HUE C;  4J8V B;  3WAA C;  5AV9 C;  3B0B A;  1BH9 A;  3LZ0 A;  1KX3 B;  4G91 B;  3WA9 D;  3C1C D;  5GXQ C;  1TAF A;  2ARO D;  4YM6 C;  5B31 C;  5DNM B;  1P3O A;  3LJA B;  5GT0 A;  3LZ0 D;  3VH5 A;  3FDD A;  3W99 D;  3EPH A;  2Y2M A;  1R4V A;  1M19 B;  5CP6 B;  3C1B C;  1BFM A;  2BG1 A;  4YS3 D;  1P3O D;  3REI A;  5AY8 C;  4Z2M G;  2PYO A;  1F66 A;  5B2J B;  2Y2O A;  1EQZ B;  3X1T B;  4ZUX A;  3MGP A;  1B67 A;  3W98 A;  2ZM5 A;  3MGS A;  3WA9 C;  3C1C C;  2BYK B;  1P3L B;  2ARO C;  1P3P A;  2PYO D;  1F66 D;  4WNN B;  5B33 A;  4H9R A;  1M1A B;  3WKJ B;  4KGC C;  4ZUX D;  2HIO B;  3LZ0 C;  3MGP D;  3WTP B;  2G5H C;  4CAY B;  1P3P D;  2CWE A;  5B33 D;  1P3O C;  5E5A A;  5GT0 C;  4XZQ B;  4M6B A;  3AV1 A;  1M18 B;  2RIQ A;  4CSR B;  5BS7 A;  4Z66 B;  3AZN A;  5E5A D;  4X23 D;  3REI C;  3W96 B;  3AL0 C;  3AZH B;  3AV1 D;  5DNN B;  2PYO C;  2DF4 C;  1F66 C;  4QLC D;  3KUY D;  5F99 A;  3AZN D;  5AVC D;  3REK A;  1T3U A;  2NZD A;  3W98 C;  2Y2P A;  3MGS C;  3AN2 B;  1U35 B;  1ZLA B;  3REH A;  4Z5T A;  5GT3 A;  4ZBJ C;  3REJ C;  1ULY A;  3AZF A;  5F99 D;  1P3G B;  3REK D;  4R8P C;  3VH6 A;  5JA4 B;  3AV2 D;  5JRG A;  1P3B A;  5AVB A;  3KXB B;  3REH D;  5AV8 B;  5GT3 D;  2F8N G;  3AZF D;  2F8N A;  4J8U C;  2Y2K A;  1P34 B;  4J8X B;  1KX5 B;  3UTA B;  3B0D B;  5JRG D;  2J8P A;  1P3B D;  1N1J A;  4WU8 B;  5CPI A;  1S32 A;  2JSS A;  3A6N A;  2YFV B;  4H9S A;  4H9Q A;  1P3A B;  5B0Y B;  2F8N D;  3LEL B;  3AZN C;  3X1V A;  3A1K A;  2XD5 A;  5CPI D;  1S32 D;  2FJ7 B;  3A6N D;  3UTB A;  3B6F A;  3X1U A;  1BH8 B;  5B1L A;  3X1V D;  2NZD C;  1P3M D;  4H9P B;  4UUZ A;  3B6G D;  3REL D;  3REH C;  4Z5T C;  3UTB D;  5GT3 C;  3B6F D;  5C3I C;  3X1U D;  5B40 B;  1TZY D;  3AZF C;  2CV5 B;  4WJ3 C;  3IP4 C;  5B1L D;  3EG5 B;  2NQB A;  1P3B C;  3MVD C;  5GSU A;  4HGA B;  5B31 G;  2DQN C;  5AVB C;  5B31 A;  3LZ1 B;  3MGQ B;  1ID3 B;  3AZM B;  5AV9 D;  1F1E A;  1KX4 B;  2NQB D;  4EO5 B;  5AV6 B;  3AYW A;  4KHA B;  5GSU D;  1PZR A;  5CPI C;  1S32 C;  5B31 D;  3B0C T;  4WU9 A;  3AZE B;  5AV5 B;  4H9O A;  5B32 G;  2BYM A;  5B32 A;  3AZL A;  2IO5 C;  4H9N B;  3X1S A;  3X1V C;  3AZJ A;  3AYW D;  3AZG B;  5CPK C;  1P3F A;  3WAA B;  4WU9 D;  3B6F C;  3X1U C;  4G92 C;  4J8W C;  3VH6 T;  2Y2I A;  3MNN B;  1Q9C A;  5GXQ B;  5B32 D;  5B1L C;  4YM6 B;  3X1S D;  4DQY B;  3AZJ D;  2G5I C;  1P3F D;  3R45 B;  5CHL B;  4J8V A;  4KGC A;  1KX3 A;  3VH5 W;  2NQB C;  5GSU C;  1HQ3 A;  3C1B B;  3W97 A;  5DNM A;  4LD9 B;  1Z2C B;  3KWQ B;  3LJA A;  4KGC D;  5B2I A;  1AOI A;  3AYW C;  5BNV A;  1HQ3 D;  3W97 D;  5CP6 A;  4WU9 C;  3TU4 A;  5G49 A;  5B2I D;  3C1C B;  5GT0 D;  5B32 C;  3AZL C;  3X1S C;  3AZJ C;  1AOI D;  5CPJ A;  1P3F C;  5CP6 D;  1EQZ A;  2Y2Q A;  3LZ0 B;  3TU4 D;  4KUD A;  3REI D;  1TAF B;  3W99 B;  3KFU G;  2BYK A;  5CPJ D;  3EPJ A;  4YS3 B;  3REJ A;  4J8V C;  1P3O B;  1M1A A;  4KUD D;  1KX3 C;  3WTP A;  4G91 C;  4R8P A;  3W98 D;  3MGS D;  1HQ3 C;  3MGR A;  3W97 C;  5BO0 A;  5DNM C;  3REJ D;  3O62 A;  3LJA C;  4J8U A;  5B2I C;  4XZQ A;  4R8P D;  1AOI C;  2PYO B;  1M18 A;  1F66 B;  5BNX A;  3NQU A;  4CSR A;  3MGR D;  4Z66 A;  1M19 C;  5CP6 C;  5B1M A;  4ZUX B;  1W2E A;  3MGP B;  2FFF B;  3O62 D;  3W96 A;  3TU4 C;  4J8U D;  2VQR A;  3AZH A;  4XZQ D;  2ZY5 A;  5B0Z A;  2F2A C;  4XUJ A;  1P3P B;  4ZBJ B;  2Y2H A;  5B33 B;  5CPJ C;  4H9R B;  2ZY4 A;  1EQZ C;  3X1T C;  5B1M D;  4KUD C;  4AWL B;  3VH6 W;  3AN2 A;  5B0Z D;  4XUJ D;  1P3L C;  5FUG A;  2L5A A;  5E5A B;  4X23 B;  1KU5 A;  1WWS A;  1P3K A;  1M1A C;  3AV1 B;  2HIO C;  5JA4 A;  3WTP C;  5B24 A;  2NZD D;  3MVD A;  4QLC B;  3KUY B;  3MGR C;  5AV8 A;  4Z5T D;  3AZN B;  5AVC B;  1P3K D;  3O62 C;  4J8X A;  1KX5 A;  3UTA A;  4XZQ C;  5B24 D;  3AFA A;  3MVD D;  1M18 C;  3KSY A;  5AVB D;  3H0L C;  4DRA A;  4Z66 C;  5F99 B;  1P3A A;  4NE6 A;  5B0Y A;  3REK B;  5B1M C;  3AV2 B;  1JFI A;  3W96 C;  4J8X D;  1KX5 D;  3AZH C;  5B0Z C;  4JJN A;  5CPK A;  4XUJ C;  3AFA D;  3REH B;  2FJ7 A;  2ZY3 A;  3UT9 A;  3AZF B;  5B0Y D;  4J8W A;  5JRG B;  4NE3 A;  3AN2 C;  4JJN D;  5CPK D;  1ZLA C;  3UT9 D;  2F8N B;  5B40 A;  5KDM B;  4J8W D;  1P3G C;  1P3K C;  3V9R A;  2F8N K;  5B24 C;  2W8S A;  3LZ1 A;  3A6N B;  3KXB C;  4H9Q B;  5AV8 C;  3AZM A;  5B40 D;  1P3M B;  1KX4 A;  4J8X C;  2RVQ C;  3AZI B;  3UTA C;  5AV6 A;  1KX5 C;  3B6G B;  3REL B;  4WV4 B;  3AFA C;  3AZK A;  3UTB B;  3B6F B;  1TZY B;  1P3A C;  3AZM D;  5B0Y C;  5B1L B;  3LEL C;  1KX4 D;  4H9N A;  2Y2G A;  4UUZ B;  5AV6 D;  4JJN C;  2HUE B;  3AZK D;  2FJ7 C;  3UT9 C;  5AV9 B;  4WZS B;  1P3I A;  3MNN A;  2NQB B;  2Y2N A;  2YFW B;  5GSU B;  3AZL D;  5B31 B;  3NQJ B;  3R45 A;  1P3I D;  5B40 C;  4NE5 A;  3MNN D;  3AYW B;  3MGQ C;  1ID3 C;  4WU9 B;  3LZ1 C;  1WWI A;  1H3O B;  4J8V D;  4H9O B;  5AY8 B;  3AZM C;  2BYM B;  5B32 B;  2Y2J A;  3AZJ B;  1KX3 D;  1KX4 C;  4EO5 C;  5AV6 C;  1P3F B;  3AZK C;  1M19 A;  5DNM D;  2LY8 A;  3LJA D;  3WA9 B;  2ARO B;  3AZG C;  3A1I A;  4E44 A;  5B2J A;  1M19 D;  4KGC B;  3X1T A;  1P3I C;  1BH9 B;  3MNN C;  3W99 A;  1HQ3 B;  3W97 B;  1P3L A;  4YS3 A;  4WNN A;  5B2J D;  1EQZ D;  3X1T D;  5B2I B;  5GT0 B;  3WKJ A;  1AOI B;  2HIO A;  5BNV B;  2ZY2 A;  1P3L D;  4CAY A;  3TU4 B;  5G49 B;  1HTA A;  4LD9 C;  3REI B;  3KWQ C;  1M1A D;  3WKJ D;  2HIO D;  3WTP D;  5CPJ B;  3B0C W;  4KUD B;  3W98 B;  3EPK A;  3MGS B;  1M18 D;  5DNN A;  3REJ B;  4Z66 D;  5B2J C;  1A7W A;  4R8P B;  3W96 D;  3W99 C;  3AZH D;  3MGR B;  1U35 A;  3WTP E;  5BO0 B;  1ZLA A;  5DNN D;  4YS3 C;  4X23 A;  3O62 B;  4J8U B;  1P3G A;  3WKJ C;  5BNX B;  3AN2 D;  3NQU B;  4QLC A;  1U35 D;  1ZLA D;  3KUY A;  3KXB A;  5B1M B;  5AVC A;  1P3G D;  5B0Z B;  1P34 A;  4XUJ B;  4WU8 A;  3KXB D;  5AV8 D;  2YFV A;  4ZUX C;  3MGP C;  3AV2 A;  2NZD B;  3LEL A;  1P34 D;  2RVQ D;  3UTA D;  5FUG B;  1P3P C;  4WU8 D;  4Z5T B;  5DNN C;  5BT1 D;  4Z2M H;  3P5J B;  5C3I B;  5GT3 B;  5B33 C;  1P3K B;  3VH5 T;  1P3A D;  1BH8 A;  3EPL A;  5B24 B;  3LEL D;  1P3B B;  4AWL C;  3MVD B;  4H9P A;  5AVB B;  1U35 C;  2Y2L A;  2FJ7 D;  4NFT A;  5E5A C;  5KDM A;  4X23 C;  2CV5 A;  3AV1 C;  3AFA B;  2JCH A;  1N1J B;  5CPI B;  1S32 B;  3MGQ A;  1ID3 A;  4QLC C;  5BS7 C;  3KUY C;  1B6W A;  5AVC C;  1JFI B;  2CV5 D;  1P3M A;  2IO5 B;  3X1V B;  3AZI A;  4JJN B;  5CPK B;  1P34 C;  3B6G A;  3B0D C;  3REL A;  4KHA A;  3MGQ D;  3UT9 B;  1ID3 D;  3LZ1 D;  4WU8 C;  4E45 A;  5BT1 C;  2XD1 A;  1TZY A;  3X1U B;  4DRB A;  5AV5 A;  5F99 C;  4J8W B;  4G92 B;  3AZE A;  3REK C;  3AV2 C;  3AZI D;  2JE5 A;  3AZG A;  3H0M C;  4UPK A;  3WAA A;  3H0R C;  5AV9 A;  3AZE D;  5AV5 D;  3V9R B;  2YFW A;  5JRG C;  5GXQ A;  4YM6 A;  3AZG D;  3NQJ A;  3WAA D; 
#chains in the Genus database with same CATH homology
 2CV5 C;  5GXQ D;  4YM6 D;  3AZK B;  3A6N C;  4HGA C;  3C1B A;  4H9S C;  1H3O A;  3F6T A;  5AY8 A;  4LD9 A;  3KWQ A;  3AZL B;  1P3M C;  3X1S B;  2F8N H;  3AZI C;  3B6G C;  3REL C;  3UTB C;  3C1B D;  1P3I B;  2UWX A;  1TZY C;  3AZE C;  5AV5 C;  5AY8 D;  4LD9 D;  3KWQ D;  3WA9 A;  3C1C A;  2ARO A;  2HUE C;  4J8V B;  3WAA C;  5AV9 C;  3B0B A;  1BH9 A;  3LZ0 A;  1KX3 B;  4G91 B;  3WA9 D;  3C1C D;  5GXQ C;  1TAF A;  2ARO D;  4YM6 C;  5B31 C;  5DNM B;  1P3O A;  3LJA B;  5GT0 A;  3LZ0 D;  3VH5 A;  3FDD A;  3W99 D;  3EPH A;  2Y2M A;  1R4V A;  1M19 B;  5CP6 B;  3C1B C;  1BFM A;  2BG1 A;  4YS3 D;  1P3O D;  3REI A;  5AY8 C;  4Z2M G;  2PYO A;  1F66 A;  5B2J B;  2Y2O A;  1EQZ B;  3X1T B;  4ZUX A;  3MGP A;  1B67 A;  3W98 A;  2ZM5 A;  3MGS A;  3WA9 C;  3C1C C;  2BYK B;  1P3L B;  2ARO C;  1P3P A;  2PYO D;  1F66 D;  4WNN B;  5B33 A;  4H9R A;  1M1A B;  3WKJ B;  4KGC C;  4ZUX D;  2HIO B;  3LZ0 C;  3MGP D;  3WTP B;  2G5H C;  4CAY B;  1P3P D;  2CWE A;  5B33 D;  1P3O C;  5E5A A;  5GT0 C;  4XZQ B;  4M6B A;  3AV1 A;  1M18 B;  2RIQ A;  4CSR B;  5BS7 A;  4Z66 B;  3AZN A;  5E5A D;  4X23 D;  3REI C;  3W96 B;  3AL0 C;  3AZH B;  3AV1 D;  5DNN B;  2PYO C;  2DF4 C;  1F66 C;  4QLC D;  3KUY D;  5F99 A;  3AZN D;  5AVC D;  3REK A;  1T3U A;  2NZD A;  3W98 C;  2Y2P A;  3MGS C;  3AN2 B;  1U35 B;  1ZLA B;  3REH A;  4Z5T A;  5GT3 A;  4ZBJ C;  3REJ C;  1ULY A;  3AZF A;  5F99 D;  1P3G B;  3REK D;  4R8P C;  3VH6 A;  5JA4 B;  3AV2 D;  5JRG A;  1P3B A;  5AVB A;  3KXB B;  3REH D;  5AV8 B;  5GT3 D;  2F8N G;  3AZF D;  2F8N A;  4J8U C;  2Y2K A;  1P34 B;  4J8X B;  1KX5 B;  3UTA B;  3B0D B;  5JRG D;  2J8P A;  1P3B D;  1N1J A;  4WU8 B;  5CPI A;  1S32 A;  2JSS A;  3A6N A;  2YFV B;  4H9S A;  4H9Q A;  1P3A B;  5B0Y B;  2F8N D;  3LEL B;  3AZN C;  3X1V A;  3A1K A;  2XD5 A;  5CPI D;  1S32 D;  2FJ7 B;  3A6N D;  3UTB A;  3B6F A;  3X1U A;  1BH8 B;  5B1L A;  3X1V D;  2NZD C;  1P3M D;  4H9P B;  4UUZ A;  3B6G D;  3REL D;  3REH C;  4Z5T C;  3UTB D;  5GT3 C;  3B6F D;  5C3I C;  3X1U D;  5B40 B;  1TZY D;  3AZF C;  2CV5 B;  4WJ3 C;  3IP4 C;  5B1L D;  3EG5 B;  2NQB A;  1P3B C;  3MVD C;  5GSU A;  4HGA B;  5B31 G;  2DQN C;  5AVB C;  5B31 A;  3LZ1 B;  3MGQ B;  1ID3 B;  3AZM B;  5AV9 D;  1F1E A;  1KX4 B;  2NQB D;  4EO5 B;  5AV6 B;  3AYW A;  4KHA B;  5GSU D;  1PZR A;  5CPI C;  1S32 C;  5B31 D;  3B0C T;  4WU9 A;  3AZE B;  5AV5 B;  4H9O A;  5B32 G;  2BYM A;  5B32 A;  3AZL A;  2IO5 C;  4H9N B;  3X1S A;  3X1V C;  3AZJ A;  3AYW D;  3AZG B;  5CPK C;  1P3F A;  3WAA B;  4WU9 D;  3B6F C;  3X1U C;  4G92 C;  4J8W C;  3VH6 T;  2Y2I A;  3MNN B;  1Q9C A;  5GXQ B;  5B32 D;  5B1L C;  4YM6 B;  3X1S D;  4DQY B;  3AZJ D;  2G5I C;  1P3F D;  3R45 B;  5CHL B;  4J8V A;  4KGC A;  1KX3 A;  3VH5 W;  2NQB C;  5GSU C;  1HQ3 A;  3C1B B;  3W97 A;  5DNM A;  4LD9 B;  1Z2C B;  3KWQ B;  3LJA A;  4KGC D;  5B2I A;  1AOI A;  3AYW C;  5BNV A;  1HQ3 D;  3W97 D;  5CP6 A;  4WU9 C;  3TU4 A;  5G49 A;  5B2I D;  3C1C B;  5GT0 D;  5B32 C;  3AZL C;  3X1S C;  3AZJ C;  1AOI D;  5CPJ A;  1P3F C;  5CP6 D;  1EQZ A;  2Y2Q A;  3LZ0 B;  3TU4 D;  4KUD A;  3REI D;  1TAF B;  3W99 B;  3KFU G;  2BYK A;  5CPJ D;  3EPJ A;  4YS3 B;  3REJ A;  4J8V C;  1P3O B;  1M1A A;  4KUD D;  1KX3 C;  3WTP A;  4G91 C;  4R8P A;  3W98 D;  3MGS D;  1HQ3 C;  3MGR A;  3W97 C;  5BO0 A;  5DNM C;  3REJ D;  3O62 A;  3LJA C;  4J8U A;  5B2I C;  4XZQ A;  4R8P D;  1AOI C;  2PYO B;  1M18 A;  1F66 B;  5BNX A;  3NQU A;  4CSR A;  3MGR D;  4Z66 A;  1M19 C;  5CP6 C;  5B1M A;  4ZUX B;  1W2E A;  3MGP B;  2FFF B;  3O62 D;  3W96 A;  3TU4 C;  4J8U D;  2VQR A;  3AZH A;  4XZQ D;  2ZY5 A;  5B0Z A;  2F2A C;  4XUJ A;  1P3P B;  4ZBJ B;  2Y2H A;  5B33 B;  5CPJ C;  4H9R B;  2ZY4 A;  1EQZ C;  3X1T C;  5B1M D;  4KUD C;  4AWL B;  3VH6 W;  3AN2 A;  5B0Z D;  4XUJ D;  1P3L C;  5FUG A;  2L5A A;  5E5A B;  4X23 B;  1KU5 A;  1WWS A;  1P3K A;  1M1A C;  3AV1 B;  2HIO C;  5JA4 A;  3WTP C;  5B24 A;  2NZD D;  3MVD A;  4QLC B;  3KUY B;  3MGR C;  5AV8 A;  4Z5T D;  3AZN B;  5AVC B;  1P3K D;  3O62 C;  4J8X A;  1KX5 A;  3UTA A;  4XZQ C;  5B24 D;  3AFA A;  3MVD D;  1M18 C;  3KSY A;  5AVB D;  3H0L C;  4DRA A;  4Z66 C;  5F99 B;  1P3A A;  4NE6 A;  5B0Y A;  3REK B;  5B1M C;  3AV2 B;  1JFI A;  3W96 C;  4J8X D;  1KX5 D;  3AZH C;  5B0Z C;  4JJN A;  5CPK A;  4XUJ C;  3AFA D;  3REH B;  2FJ7 A;  2ZY3 A;  3UT9 A;  3AZF B;  5B0Y D;  4J8W A;  5JRG B;  4NE3 A;  3AN2 C;  4JJN D;  5CPK D;  1ZLA C;  3UT9 D;  2F8N B;  5B40 A;  5KDM B;  4J8W D;  1P3G C;  1P3K C;  3V9R A;  2F8N K;  5B24 C;  2W8S A;  3LZ1 A;  3A6N B;  3KXB C;  4H9Q B;  5AV8 C;  3AZM A;  5B40 D;  1P3M B;  1KX4 A;  4J8X C;  2RVQ C;  3AZI B;  3UTA C;  5AV6 A;  1KX5 C;  3B6G B;  3REL B;  4WV4 B;  3AFA C;  3AZK A;  3UTB B;  3B6F B;  1TZY B;  1P3A C;  3AZM D;  5B0Y C;  5B1L B;  3LEL C;  1KX4 D;  4H9N A;  2Y2G A;  4UUZ B;  5AV6 D;  4JJN C;  2HUE B;  3AZK D;  2FJ7 C;  3UT9 C;  5AV9 B;  4WZS B;  1P3I A;  3MNN A;  2NQB B;  2Y2N A;  2YFW B;  5GSU B;  3AZL D;  5B31 B;  3NQJ B;  3R45 A;  1P3I D;  5B40 C;  4NE5 A;  3MNN D;  3AYW B;  3MGQ C;  1ID3 C;  4WU9 B;  3LZ1 C;  1WWI A;  1H3O B;  4J8V D;  4H9O B;  5AY8 B;  3AZM C;  2BYM B;  5B32 B;  2Y2J A;  3AZJ B;  1KX3 D;  1KX4 C;  4EO5 C;  5AV6 C;  1P3F B;  3AZK C;  1M19 A;  5DNM D;  2LY8 A;  3LJA D;  3WA9 B;  2ARO B;  3AZG C;  3A1I A;  4E44 A;  5B2J A;  1M19 D;  4KGC B;  3X1T A;  1P3I C;  1BH9 B;  3MNN C;  3W99 A;  1HQ3 B;  3W97 B;  1P3L A;  4YS3 A;  4WNN A;  5B2J D;  1EQZ D;  3X1T D;  5B2I B;  5GT0 B;  3WKJ A;  1AOI B;  2HIO A;  5BNV B;  2ZY2 A;  1P3L D;  4CAY A;  3TU4 B;  5G49 B;  1HTA A;  4LD9 C;  3REI B;  3KWQ C;  1M1A D;  3WKJ D;  2HIO D;  3WTP D;  5CPJ B;  3B0C W;  4KUD B;  3W98 B;  3EPK A;  3MGS B;  1M18 D;  5DNN A;  3REJ B;  4Z66 D;  5B2J C;  1A7W A;  4R8P B;  3W96 D;  3W99 C;  3AZH D;  3MGR B;  1U35 A;  3WTP E;  5BO0 B;  1ZLA A;  5DNN D;  4YS3 C;  4X23 A;  3O62 B;  4J8U B;  1P3G A;  3WKJ C;  5BNX B;  3AN2 D;  3NQU B;  4QLC A;  1U35 D;  1ZLA D;  3KUY A;  3KXB A;  5B1M B;  5AVC A;  1P3G D;  5B0Z B;  1P34 A;  4XUJ B;  4WU8 A;  3KXB D;  5AV8 D;  2YFV A;  4ZUX C;  3MGP C;  3AV2 A;  2NZD B;  3LEL A;  1P34 D;  2RVQ D;  3UTA D;  5FUG B;  1P3P C;  4WU8 D;  4Z5T B;  5DNN C;  5BT1 D;  4Z2M H;  3P5J B;  5C3I B;  5GT3 B;  5B33 C;  1P3K B;  3VH5 T;  1P3A D;  1BH8 A;  3EPL A;  5B24 B;  3LEL D;  1P3B B;  4AWL C;  3MVD B;  4H9P A;  5AVB B;  1U35 C;  2Y2L A;  2FJ7 D;  4NFT A;  5E5A C;  5KDM A;  4X23 C;  2CV5 A;  3AV1 C;  3AFA B;  2JCH A;  1N1J B;  5CPI B;  1S32 B;  3MGQ A;  1ID3 A;  4QLC C;  5BS7 C;  3KUY C;  1B6W A;  5AVC C;  1JFI B;  2CV5 D;  1P3M A;  2IO5 B;  3X1V B;  3AZI A;  4JJN B;  5CPK B;  1P34 C;  3B6G A;  3B0D C;  3REL A;  4KHA A;  3MGQ D;  3UT9 B;  1ID3 D;  3LZ1 D;  4WU8 C;  4E45 A;  5BT1 C;  2XD1 A;  1TZY A;  3X1U B;  4DRB A;  5AV5 A;  5F99 C;  4J8W B;  4G92 B;  3AZE A;  3REK C;  3AV2 C;  3AZI D;  2JE5 A;  3AZG A;  3H0M C;  4UPK A;  3WAA A;  3H0R C;  5AV9 A;  3AZE D;  5AV5 D;  3V9R B;  2YFW A;  5JRG C;  5GXQ A;  4YM6 A;  3AZG D;  3NQJ A;  3WAA D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...