5B1LB

The mouse nucleosome structure containing h3t
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
78
structure length
78
Chain Sequence
NIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3t
publication title Testis-Specific Histone Variant H3t Gene Is Essential for Entry into Spermatogenesis
pubmed doi rcsb
source organism Mus musculus
molecule tags Structural protein/dna
total genus 27
structure length 78
sequence length 78
chains with identical sequence F
ec nomenclature
pdb deposition date 2015-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5b1lB00
5B40C 4QLCB 4KUDA 5JA4B 4X23B 2F8NH 4Z5TD 1P34A 5CPIB 1P3MD 1F66C 3AV2D 3VH6A 5GT3D 3REKD 1P3AC 3R45B 3MVDB 3X1SD 5B1LB 4J8UC 2NQBB 4ZUXA 5B0ZB 5BS7C 3AZNC 3UTAA 4J8VB 1BH8A 5F99B 3X1UA 1H3OB 1M1AA 1Q9CA 4WU8B 1M19A 1F66D 1P3AD 3MGQD 3LZ0B 4AWLB 4YM6C 5GSUA 4XUJA 5B24B 3AZND 1N1JA 3C1BC 5JRGD 3MVDC 5B1LC 5B31C 4LD9A 5AY8C 4DRBA 1AOIC 3REID 3AFAC 4Z66A 3KXBA 3VH6T 4CAYB 3AZIC 5AV8C 1TZYD 3AZFB 5GT0B 1WWIA 3RELB 5BT1C 3LZ0C 3B0CW 5B31D 5AV6D 3AV2A 5GT3A 5AVBD 3REKA 3AFAD 2PYOC 3X1SA 2RVQC 3WKJC 1P3BA 3MGPD 1A7WA 1JFIB 3LZ1A 3MNND 3AZID 5AV8D 1P3IC 5B2JD 3WTPE 4J8XD 3AZJC 5B1MA 3AZLD 2CV5A 2F8NG 3WAAB 5B2IC 2NZDC 4NE3A 3MGQA 5CP6D 2RVQD 3X1UB 1M19B 3AV1A 5G49A 3UT9D 1U35B 4KUDC 1P3OB 2AROB 5JRGA 4XUJB 3AZHB 1P34C 1HQ3D 1N1JB 5BNVA 5B2ID 2NZDD 4WNNA 3NQUA 3REIA 3WTPD 4ZUXC 4UUZB 4KUDD 1KX3A 3REHB 4Z66B 1WWSA 1P3PB 3KWQB 5B32D 1TZYA 3UTAC 4H9SA 5KDMB 1P34D 3NQJA 3X1UC 1M1AC 1M19C 3KUYA 5AV6A 2JSSA 5DNNA 5AVBA 1F1EA 4Z5TB 5CPKA 4H9RB 4ZUXD 3MGPA 1P3MB 4G91B 5AV5D 3MNNA 5GSUC 4XUJC 5B2JA 3O62A 4J8XA 3UTAD 1BH9B 1M1AD 2YFWA 3AZLA 4JJND 3W99A 4YS3A 4LD9C 1KU5A 5CP6A 4Z66C 3KXBC 1F66B 3UT9A 1P3AB 4H9PB 3B6FA 3MGQB 5B31G 1M18A 5G49B 3AZGD 1HQ3A 2CWEA 3AZNB 4LD9D 4G91C 4CSRA 4KHAA 3AV2C 5CHLB 4NE5A 5GT3C 5JRGB 3REKC 1KX5A 4NFTA 3WTPA 3KXBD 3X1SC 1P3BC 5C3IC 3LZ1C 3WA9D 4YM6B 4J8WD 2FJ7D 5B32A 5CPJA 3TU4A 5AV9D 1KX4A 5B1MC 2CV5C 1TZYB 3C1BB 3MGQC 3X1VD 3NQJB 4H9OB 3V9RB 1P3BD 1B6WA 3LZ1D 3AYWA 5B31B 5AV6B 1ULYA 3W97A 5AV5A 5AY8B 3AV1C 4WU9A 1AOIB 3AFAB 5DNMD 3LJAD 1HTAA 5JRGC 5AVCA 3MNNB 5AV8B 3AZIB 5B1MD 2CV5D 1P3KD 4J8XB 3LELD 3A6NA 4JJNA 3REIC 2F8NK 3AZLB 3AV1D 4R8PA 2PYOB 3W96A 1KX3C 3WKJB 3X1TA 1TZYC 4H9SC 3AZGA 1P3IB 2BYKB 3AZJB 5AV6C 5DNNC 5AVBC 5CPKC 3MGPC 3MNNC 4KHAB 5B2IB 1S32D 3WA9A 1KX3D 2NZDB 3B6GA 5B2JC 3O62C 4J8XC 4J8WA 3UTBD 2FJ7A 3W98D 5AV9A 3AZEA 2HUEC 4KUDB 3AZLC 3KUYD 3AZMA 5DNND 3W99C 5B32B 4YS3C 1ID3D 5CPKD 3X1VA 5CP6C 1P34B 3VH5A 3UT9C 5GXQA 4QLCD 3O62D 5BNXA 3B6FC 5B33A 5DNMA 4ZUXB 1M18C 3LJAA 1P3KA 1HQ3C 3LELA 3W99D 3UTAB 4YS3D 1KX5C 5B0YA 1BH8B 3MGRA 3WTPC 3VH6W 1M1AB 2HIOD 4KGCA 3AZKA 3B6FD 2LY8A 1M18D 5B32C 5CPJC 4H9QA 1P3LA 5GSUB 3TU4C 1KX4C 3KSYA 1BFMA 1KX5D 2YFVA 1P3FA 1P3GA 2BYMA 3AYWC 4WU9C 4LD9B 3REJA 5AV5C 3W97C 1S32A 4NE6A 5B24D 3KXBB 3UTBA 3VH5T 3MGSA 5CPJD 3TU4D 3W98A 5AVCC 4XZQA 1KX4D 4G92C 4H9NA 3A6NC 4JJNC 1ID3A 3B0DC 5BO0A 4WU9D 3AYWD 1TAFA 4R8PC 3AV2B 3W97D 5GT3B 3REKB 3W96C 1ZLAA 4QLCA 3X1SB 3X1VB 3X1TC 1P3BB 5C3IB 1EQZD 3LZ1B 5AVCD 5GT0D 4X23A 3RELD 3AZGC 2L5AA 3A6ND 5CPIA 3LJAB 5B1MB 3R45A 2CV5B 1P3KB 2HIOA 4HGAC 4R8PD 2NQBA 3W96D 3WA9C 5B0ZA 3X1TD 3B6GC 4J8WC 2FJ7C 3AN2D 3AV1B 3C1CD 5AV9C 3AZEC 4ZBJC 4J8VA 5F99A 3AZMC 4WU8A 3X1VC 5BNVB 4WNNB 2YFVB 3NQUB 3REIB 5GXQC 3B6GD 5B24A 5DNMC 5B33C 1P3OD 2BYMB 3LJAC 3AZED 1KX3B 1P3KC 3AZMD 3LELC 3UTBB 3W98B 5B0YC 3MGRC 4H9NB 3KUYB 4KGCC 5DNNB 4CAYA 3AZKC 5GXQD 5AVBB 5BO0B 5CPKB 5E5AD 5B33D 3REHD 3MGPB 1EQZA 1P3LC 3AZFA 5GT0A 3RELA 4E44A 5B2JB 3O62B 2F8ND 5B0YD 3MGRD 2HUEB 1P3FC 5B32G 2YFWB 1P3GC 4KGCD 3W99B 3AZKD 4YS3B 1JFIA 3REJC 1S32C 5CP6B 3UTBC 3MGSC 2HIOB 3AN2A 1P3LD 3C1CA 3W98C 3UT9B 4XZQC 5B40D 3B6FB 3KUYC 1M18B 1ID3C 1P3FD 2IO5C 1P3GD 3WAAA 1HQ3B 4EO5C 4CSRB 3REJD 1KX5B 3B0CT 4WZSB 1ZLAC 4QLCC 3WTPB 1U35A 3MGSD 4J8UD 1P3OA 2AROA 4XZQD 4X23C 3AZHA 5CPIC 5CPJB 3TU4B 1KX4B 2HIOC 2NQBC 5FUGA 1ZLAD 4UUZA 4Z2MG 5B0ZC 5E5AA 3REHA 4YM6D 3AYWB 4WU9B 3KWQA 1P3PA 5AV5B 4X23D 3W97B 4J8VC 5KDMA 5F99C 5CPID 2F8NA 4WU8C 1EQZB 5AVCB 3C1BD 4Z5TA 3MVDD 4G92B 5B1LD 3A6NB 4H9RA 4AWLC 2NQBD 4JJNB 1P3MA 3B0DB 5AY8D 1AOID 5B0ZD 5B24C 4R8PB 1BH9A 4J8VD 5B40A 3W96B 5F99D 4DRAA 4M6BA 3X1TB 4WU8D 3AN2B 3C1CB 3AZGB 5BT1D 3LZ0D 1F66A 1P3AA 2PYOD 4H9PA 4J8UA 4HGAB 3WKJD 1EQZC 3AZFC 5GT0C 3RELC 3WA9B 3B6GB 5BS7A 1P3ID 4J8WB 2FJ7B 3AZNA 3AZJD 3B0BA 5AV9B 3AZEB 4ZBJB 3AZMB 5JA4A 4YM6A 3AN2C 3AZFD 5FUGB 3C1CC 5GXQB 4WV4B 5BNXB 5E5AB 5B33B 5DNMB 3C1BA 3WAAC 3MVDA 5B1LA 1R4VA 4H9OA 3V9RA 3LELB 2F8NB 5B0YB 5B31A 3MGRB 5AY8A 1AOIA 3VH5W 1U35C 3AFAA 1P3OC 4KGCB 2AROC 3AZKB 3AZIA 5AV8A 3AZHC 1H3OA 4H9QB 4E45A 1P3LB 3WAAD 5B40B 4Z2MH 3X1UD 3LZ0A 1M19D 1P3FB 1P3GB 1U35D 2PYOA 5E5AC 3REHC 2AROD 3WKJA 1P3PC 3KWQC 3REJB 1S32B 5GSUD 4XUJD 3AZHD 1P3IA 3MGSB 4J8UB 2BYKA 3AZJA 4XZQB 1B67A 4Z5TC 1ID3B 1P3MC 2IO5B 5B2IA 2NZDA 4EO5B 4Z66D 1P3PD 1TAFB 3KWQD 1ZLAB
chains in the Genus database with same CATH superfamily
5B40C 4QLCB 4KUDA 5JA4B 4X23B 1T3UA 2F8NH 4Z5TD 1P34A 5CPIB 1P3MD 1F66C 3AV2D 3VH6A 5GT3D 3REKD 1P3AC 3R45B 3MVDB 3X1SD 5B1LB 4J8UC 2ZY2A 2NQBB 4ZUXA 3KFUG 3EPJA 5B0ZB 5BS7C 3AZNC 3UTAA 4J8VB 1BH8A 5F99B 3X1UA 1H3OB 1M1AA 1Q9CA 4WU8B 1M19A 2JE5A 1F66D 1P3AD 3MGQD 3LZ0B 4AWLB 4YM6C 5GSUA 2DF4C 4XUJA 5B24B 3AZND 1N1JA 3EPHA 3C1BC 5JRGD 3MVDC 5B1LC 5B31C 4LD9A 5AY8C 4DRBA 1AOIC 3REID 3AFAC 4Z66A 3KXBA 3VH6T 4CAYB 2UWXA 3AZIC 5AV8C 1TZYD 4DQYB 3AZFB 5GT0B 1WWIA 3RELB 5BT1C 3LZ0C 3B0CW 5B31D 5AV6D 3AV2A 5GT3A 2J8PA 5AVBD 3AFAD 3REKA 2PYOC 3X1SA 2RVQC 3WKJC 1P3BA 3MGPD 1A7WA 1JFIB 3LZ1A 3MNND 3AZID 5AV8D 1P3IC 5B2JD 3WTPE 4J8XD 3AZJC 5B1MA 3AZLD 2CV5A 2F8NG 3WAAB 5B2IC 2NZDC 4NE3A 3MGQA 5CP6D 2RVQD 2G5IC 3X1UB 1M19B 2JCHA 3AV1A 5G49A 3UT9D 1U35B 4KUDC 1P3OB 2XD5A 2AROB 2Y2KA 5JRGA 4XUJB 3AZHB 1P34C 1HQ3D 1N1JB 5BNVA 5B2ID 2NZDD 4WNNA 3NQUA 3REIA 3WTPD 4ZUXC 4UUZB 4KUDD 1KX3A 3REHB 3H0LC 4Z66B 1WWSA 1P3PB 3KWQB 5B32D 1TZYA 3UTAC 4H9SA 5KDMB 1P34D 3NQJA 3X1UC 1M1AC 1M19C 3KUYA 5AV6A 2JSSA 5DNNA 5AVBA 1F1EA 4Z5TB 5CPKA 1PZRA 4H9RB 4ZUXD 3MGPA 1P3MB 4G91B 5AV5D 3MNNA 5GSUC 4XUJC 5B2JA 3O62A 4J8XA 3UTAD 1BH9B 1M1AD 2YFWA 3AZLA 4JJND 3W99A 4YS3A 4LD9C 1KU5A 2XD1A 5CP6A 4Z66C 3KXBC 1F66B 3UT9A 1P3AB 4H9PB 3B6FA 3MGQB 5B31G 1M18A 2Y2GA 5G49B 3AZGD 1HQ3A 2CWEA 3AZNB 4LD9D 4G91C 4CSRA 4KHAA 3AV2C 5CHLB 4NE5A 5GT3C 5JRGB 3REKC 1KX5A 4NFTA 3WTPA 3KXBD 3X1SC 1P3BC 5C3IC 3LZ1C 3WA9D 4YM6B 4J8WD 2FJ7D 5B32A 5CPJA 2W8SA 3TU4A 5AV9D 1KX4A 5B1MC 2Y2LA 2CV5C 1TZYB 3C1BB 3MGQC 3X1VD 3NQJB 4H9OB 3V9RB 1P3BD 1B6WA 3LZ1D 3AYWA 5AV6B 5B31B 1ULYA 3W97A 5AV5A 5AY8B 3AV1C 4WU9A 1AOIB 3AFAB 5DNMD 3LJAD 1HTAA 5JRGC 5AVCA 3MNNB 5AV8B 3AZIB 5B1MD 2CV5D 1P3KD 4J8XB 3LELD 3A6NA 4JJNA 3REIC 2F8NK 3AZLB 3AV1D 4R8PA 2PYOB 3W96A 1KX3C 3WKJB 3X1TA 1TZYC 4H9SC 3AZGA 1P3IB 2BYKB 3AZJB 5AV6C 5DNNC 5AVBC 5CPKC 3FDDA 2FFFB 3MGPC 3MNNC 4KHAB 5B2IB 1S32D 3WA9A 1KX3D 2NZDB 3B6GA 5B2JC 3O62C 4J8XC 4J8WA 3UTBD 2FJ7A 3W98D 5AV9A 3AZEA 2HUEC 4KUDB 3AZLC 3KUYD 3AZMA 5DNND 3W99C 5B32B 4YS3C 1ID3D 5CPKD 3X1VA 5CP6C 1P34B 3VH5A 3UT9C 5GXQA 4QLCD 3O62D 5BNXA 3B6FC 5B33A 5DNMA 4ZUXB 1M18C 3LJAA 2ZY5A 2DQNC 1P3KA 1HQ3C 3LELA 3W99D 3UTAB 4YS3D 1KX5C 5B0YA 1BH8B 3MGRA 3VH6W 3WTPC 1M1AB 2HIOD 4KGCA 3AZKA 3B6FD 2LY8A 2Y2NA 1M18D 5B32C 5CPJC 4H9QA 1P3LA 5GSUB 3TU4C 1KX4C 3KSYA 1BFMA 1KX5D 2YFVA 1P3FA 1P3GA 2BYMA 3AYWC 4WU9C 4LD9B 3REJA 5AV5C 3W97C 1S32A 4NE6A 3H0MC 5B24D 3KXBB 3UTBA 2BG1A 3VH5T 5CPJD 3MGSA 3TU4D 3W98A 5AVCC 4XZQA 1KX4D 4G92C 4H9NA 3A6NC 4JJNC 1ID3A 3B0DC 5BO0A 3EPLA 4WU9D 3AYWD 1TAFA 4R8PC 3AV2B 3W97D 5GT3B 3REKB 3W96C 1ZLAA 4QLCA 3X1SB 3X1VB 3X1TC 1P3BB 5C3IB 1EQZD 3LZ1B 5AVCD 5GT0D 4X23A 3RELD 3AZGC 2L5AA 3A6ND 5CPIA 3LJAB 5B1MB 3R45A 2CV5B 1P3KB 2HIOA 4HGAC 4R8PD 2NQBA 3W96D 3A1IA 3WA9C 5B0ZA 3X1TD 3B6GC 4J8WC 2FJ7C 3AN2D 3AV1B 3C1CD 5AV9C 3AZEC 4ZBJC 4J8VA 3EPKA 5F99A 3AZMC 4WU8A 3AL0C 3X1VC 2Y2QA 5BNVB 4WNNB 2YFVB 3NQUB 3REIB 5GXQC 3B6GD 5B24A 5DNMC 5B33C 1P3OD 2BYMB 3LJAC 3AZED 1KX3B 1P3KC 3AZMD 3LELC 3UTBB 3W98B 5B0YC 2ZY4A 3MGRC 4H9NB 3KUYB 4KGCC 5DNNB 4CAYA 3AZKC 5GXQD 5AVBB 5BO0B 5CPKB 5E5AD 5B33D 3REHD 3MGPB 1EQZA 1P3LC 3AZFA 5GT0A 3RELA 4E44A 5B2JB 3O62B 2F8ND 5B0YD 3MGRD 2HUEB 1P3FC 5B32G 2YFWB 1P3GC 4KGCD 2ZM5A 3W99B 3AZKD 4YS3B 1JFIA 3REJC 1S32C 3A1KA 5CP6B 4UPKA 3UTBC 3MGSC 2HIOB 3AN2A 1P3LD 3C1CA 3W98C 3UT9B 4XZQC 5B40D 3B6FB 2Y2HA 3KUYC 1M18B 2Y2JA 1ID3C 2Y2OA 2IO5C 1P3GD 1P3FD 3WAAA 2Y2MA 1HQ3B 4EO5C 4CSRB 3REJD 1KX5B 3B0CT 4WZSB 1ZLAC 4QLCC 3WTPB 1U35A 3MGSD 4J8UD 1P3OA 2AROA 4XZQD 4X23C 3AZHA 5CPIC 5CPJB 3TU4B 1KX4B 3P5JB 2G5HC 2HIOC 2NQBC 5FUGA 4WJ3C 1ZLAD 4UUZA 4Z2MG 5B0ZC 5E5AA 3REHA 4YM6D 3AYWB 4WU9B 3KWQA 1P3PA 5AV5B 4X23D 3W97B 4J8VC 5KDMA 5F99C 5CPID 2F8NA 4WU8C 1EQZB 5AVCB 3C1BD 4Z5TA 3MVDD 4G92B 5B1LD 3A6NB 4H9RA 4AWLC 2NQBD 4JJNB 1P3MA 3B0DB 5AY8D 1AOID 5B0ZD 5B24C 1W2EA 4R8PB 2Y2PA 1BH9A 4J8VD 5B40A 3W96B 5F99D 4DRAA 4M6BA 3X1TB 4WU8D 3AN2B 3C1CB 3AZGB 5BT1D 3LZ0D 1F66A 1P3AA 2PYOD 4H9PA 4J8UA 4HGAB 3WKJD 1EQZC 3AZFC 5GT0C 3RELC 3WA9B 3B6GB 5BS7A 1P3ID 1Z2CB 4J8WB 2FJ7B 3AZNA 2F2AC 3AZJD 3B0BA 5AV9B 3AZEB 4ZBJB 3AZMB 5JA4A 2Y2IA 4YM6A 3AN2C 3AZFD 5FUGB 3C1CC 2RIQA 5GXQB 4WV4B 5BNXB 5E5AB 5B33B 5DNMB 3C1BA 3WAAC 3MVDA 5B1LA 1R4VA 4H9OA 3V9RA 3LELB 2F8NB 5B0YB 5B31A 3MGRB 5AY8A 1AOIA 3VH5W 1U35C 3AFAA 1P3OC 4KGCB 2AROC 3AZKB 3H0RC 2ZY3A 3AZIA 5AV8A 3AZHC 1H3OA 4H9QB 4E45A 1P3LB 3WAAD 5B40B 4Z2MH 3X1UD 3LZ0A 3EG5B 1M19D 1P3FB 1P3GB 1U35D 2PYOA 2VQRA 5E5AC 3REHC 2AROD 3IP4C 3WKJA 1P3PC 3KWQC 3REJB 1S32B 5GSUD 4XUJD 3AZHD 1P3IA 3MGSB 4J8UB 2BYKA 3AZJA 4XZQB 1B67A 4Z5TC 1ID3B 1P3MC 2IO5B 5B2IA 2NZDA 4EO5B 4Z66D 1P3PD 1TAFB 3KWQD 3F6TA 1ZLAB
chains in the Genus database with same CATH topology
5B40C 4QLCB 4KUDA 5JA4B 4X23B 1T3UA 2F8NH 4Z5TD 1P34A 5CPIB 1P3MD 1F66C 3AV2D 3VH6A 5GT3D 3REKD 1P3AC 3R45B 3MVDB 3X1SD 5B1LB 4J8UC 2ZY2A 2NQBB 4ZUXA 3KFUG 3EPJA 5B0ZB 5BS7C 3AZNC 3UTAA 4J8VB 1BH8A 5F99B 3X1UA 1H3OB 1M1AA 1Q9CA 4WU8B 1M19A 2JE5A 1F66D 1P3AD 3MGQD 3LZ0B 4AWLB 4YM6C 5GSUA 2DF4C 4XUJA 5B24B 3AZND 1N1JA 3EPHA 3C1BC 5JRGD 3MVDC 5B1LC 5B31C 4LD9A 5AY8C 4DRBA 1AOIC 3REID 3AFAC 4Z66A 3KXBA 3VH6T 4CAYB 2UWXA 3AZIC 5AV8C 1TZYD 4DQYB 3AZFB 5GT0B 1WWIA 3RELB 5BT1C 3LZ0C 3B0CW 5B31D 5AV6D 3AV2A 5GT3A 2J8PA 5AVBD 3AFAD 3REKA 2PYOC 3X1SA 2RVQC 3WKJC 1P3BA 3MGPD 1A7WA 1JFIB 3LZ1A 3MNND 3AZID 5AV8D 1P3IC 5B2JD 3WTPE 4J8XD 3AZJC 5B1MA 3AZLD 2CV5A 2F8NG 3WAAB 5B2IC 2NZDC 4NE3A 3MGQA 5CP6D 2RVQD 2G5IC 3X1UB 1M19B 2JCHA 3AV1A 5G49A 3UT9D 1U35B 4KUDC 1P3OB 2XD5A 2AROB 2Y2KA 5JRGA 4XUJB 3AZHB 1P34C 1HQ3D 1N1JB 5BNVA 5B2ID 2NZDD 4WNNA 3NQUA 3REIA 3WTPD 4ZUXC 4UUZB 4KUDD 1KX3A 3REHB 3H0LC 4Z66B 1WWSA 1P3PB 3KWQB 5B32D 1TZYA 3UTAC 4H9SA 5KDMB 1P34D 3NQJA 3X1UC 1M1AC 1M19C 3KUYA 5AV6A 2JSSA 5DNNA 5AVBA 1F1EA 4Z5TB 5CPKA 1PZRA 4H9RB 4ZUXD 3MGPA 1P3MB 4G91B 5AV5D 3MNNA 5GSUC 4XUJC 5B2JA 3O62A 4J8XA 3UTAD 1BH9B 1M1AD 2YFWA 3AZLA 4JJND 3W99A 4YS3A 4LD9C 1KU5A 2XD1A 5CP6A 4Z66C 3KXBC 1F66B 3UT9A 1P3AB 4H9PB 3B6FA 3MGQB 5B31G 1M18A 2Y2GA 5G49B 3AZGD 1HQ3A 2CWEA 3AZNB 4LD9D 4G91C 4CSRA 4KHAA 3AV2C 5CHLB 4NE5A 5GT3C 5JRGB 3REKC 1KX5A 4NFTA 3WTPA 3KXBD 3X1SC 1P3BC 5C3IC 3LZ1C 3WA9D 4YM6B 4J8WD 2FJ7D 5B32A 5CPJA 2W8SA 3TU4A 5AV9D 1KX4A 5B1MC 2Y2LA 2CV5C 1TZYB 3C1BB 3MGQC 3X1VD 3NQJB 4H9OB 3V9RB 1P3BD 1B6WA 3LZ1D 3AYWA 5AV6B 5B31B 1ULYA 3W97A 5AV5A 5AY8B 3AV1C 4WU9A 1AOIB 3AFAB 5DNMD 3LJAD 1HTAA 5JRGC 5AVCA 3MNNB 5AV8B 3AZIB 5B1MD 2CV5D 1P3KD 4J8XB 3LELD 3A6NA 4JJNA 3REIC 2F8NK 3AZLB 3AV1D 4R8PA 2PYOB 3W96A 1KX3C 3WKJB 3X1TA 1TZYC 4H9SC 3AZGA 1P3IB 2BYKB 3AZJB 5AV6C 5DNNC 5AVBC 5CPKC 3FDDA 2FFFB 3MGPC 3MNNC 4KHAB 5B2IB 1S32D 3WA9A 1KX3D 2NZDB 3B6GA 5B2JC 3O62C 4J8XC 4J8WA 3UTBD 2FJ7A 3W98D 5AV9A 3AZEA 2HUEC 4KUDB 3AZLC 3KUYD 3AZMA 5DNND 3W99C 5B32B 4YS3C 1ID3D 5CPKD 3X1VA 5CP6C 1P34B 3VH5A 3UT9C 5GXQA 4QLCD 3O62D 5BNXA 3B6FC 5B33A 5DNMA 4ZUXB 1M18C 3LJAA 2ZY5A 2DQNC 1P3KA 1HQ3C 3LELA 3W99D 3UTAB 4YS3D 1KX5C 5B0YA 1BH8B 3MGRA 3VH6W 3WTPC 1M1AB 2HIOD 4KGCA 3AZKA 3B6FD 2LY8A 2Y2NA 1M18D 5B32C 5CPJC 4H9QA 1P3LA 5GSUB 3TU4C 1KX4C 3KSYA 1BFMA 1KX5D 2YFVA 1P3FA 1P3GA 2BYMA 3AYWC 4WU9C 4LD9B 3REJA 5AV5C 3W97C 1S32A 4NE6A 3H0MC 5B24D 3KXBB 3UTBA 2BG1A 3VH5T 5CPJD 3MGSA 3TU4D 3W98A 5AVCC 4XZQA 1KX4D 4G92C 4H9NA 3A6NC 4JJNC 1ID3A 3B0DC 5BO0A 3EPLA 4WU9D 3AYWD 1TAFA 4R8PC 3AV2B 3W97D 5GT3B 3REKB 3W96C 1ZLAA 4QLCA 3X1SB 3X1VB 3X1TC 1P3BB 5C3IB 1EQZD 3LZ1B 5AVCD 5GT0D 4X23A 3RELD 3AZGC 2L5AA 3A6ND 5CPIA 3LJAB 5B1MB 3R45A 2CV5B 1P3KB 2HIOA 4HGAC 4R8PD 2NQBA 3W96D 3A1IA 3WA9C 5B0ZA 3X1TD 3B6GC 4J8WC 2FJ7C 3AN2D 3AV1B 3C1CD 5AV9C 3AZEC 4ZBJC 4J8VA 3EPKA 5F99A 3AZMC 4WU8A 3AL0C 3X1VC 2Y2QA 5BNVB 4WNNB 2YFVB 3NQUB 3REIB 5GXQC 3B6GD 5B24A 5DNMC 5B33C 1P3OD 2BYMB 3LJAC 3AZED 1KX3B 1P3KC 3AZMD 3LELC 3UTBB 3W98B 5B0YC 2ZY4A 3MGRC 4H9NB 3KUYB 4KGCC 5DNNB 4CAYA 3AZKC 5GXQD 5AVBB 5BO0B 5CPKB 5E5AD 5B33D 3REHD 3MGPB 1EQZA 1P3LC 3AZFA 5GT0A 3RELA 4E44A 5B2JB 3O62B 2F8ND 5B0YD 3MGRD 2HUEB 1P3FC 5B32G 2YFWB 1P3GC 4KGCD 2ZM5A 3W99B 3AZKD 4YS3B 1JFIA 3REJC 1S32C 3A1KA 5CP6B 4UPKA 3UTBC 3MGSC 2HIOB 3AN2A 1P3LD 3C1CA 3W98C 3UT9B 4XZQC 5B40D 3B6FB 2Y2HA 3KUYC 1M18B 2Y2JA 1ID3C 2Y2OA 2IO5C 1P3GD 1P3FD 3WAAA 2Y2MA 1HQ3B 4EO5C 4CSRB 3REJD 1KX5B 3B0CT 4WZSB 1ZLAC 4QLCC 3WTPB 1U35A 3MGSD 4J8UD 1P3OA 2AROA 4XZQD 4X23C 3AZHA 5CPIC 5CPJB 3TU4B 1KX4B 3P5JB 2G5HC 2HIOC 2NQBC 5FUGA 4WJ3C 1ZLAD 4UUZA 4Z2MG 5B0ZC 5E5AA 3REHA 4YM6D 3AYWB 4WU9B 3KWQA 1P3PA 5AV5B 4X23D 3W97B 4J8VC 5KDMA 5F99C 5CPID 2F8NA 4WU8C 1EQZB 5AVCB 3C1BD 4Z5TA 3MVDD 4G92B 5B1LD 3A6NB 4H9RA 4AWLC 2NQBD 4JJNB 1P3MA 3B0DB 5AY8D 1AOID 5B0ZD 5B24C 1W2EA 4R8PB 2Y2PA 1BH9A 4J8VD 5B40A 3W96B 5F99D 4DRAA 4M6BA 3X1TB 4WU8D 3AN2B 3C1CB 3AZGB 5BT1D 3LZ0D 1F66A 1P3AA 2PYOD 4H9PA 4J8UA 4HGAB 3WKJD 1EQZC 3AZFC 5GT0C 3RELC 3WA9B 3B6GB 5BS7A 1P3ID 1Z2CB 4J8WB 2FJ7B 3AZNA 2F2AC 3AZJD 3B0BA 5AV9B 3AZEB 4ZBJB 3AZMB 5JA4A 2Y2IA 4YM6A 3AN2C 3AZFD 5FUGB 3C1CC 2RIQA 5GXQB 4WV4B 5BNXB 5E5AB 5B33B 5DNMB 3C1BA 3WAAC 3MVDA 5B1LA 1R4VA 4H9OA 3V9RA 3LELB 2F8NB 5B0YB 5B31A 3MGRB 5AY8A 1AOIA 3VH5W 1U35C 3AFAA 1P3OC 4KGCB 2AROC 3AZKB 3H0RC 2ZY3A 3AZIA 5AV8A 3AZHC 1H3OA 4H9QB 4E45A 1P3LB 3WAAD 5B40B 4Z2MH 3X1UD 3LZ0A 3EG5B 1M19D 1P3FB 1P3GB 1U35D 2PYOA 2VQRA 5E5AC 3REHC 2AROD 3IP4C 3WKJA 1P3PC 3KWQC 3REJB 1S32B 5GSUD 4XUJD 3AZHD 1P3IA 3MGSB 4J8UB 2BYKA 3AZJA 4XZQB 1B67A 4Z5TC 1ID3B 1P3MC 2IO5B 5B2IA 2NZDA 4EO5B 4Z66D 1P3PD 1TAFB 3KWQD 3F6TA 1ZLAB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5B40 C;  4QLC B;  4KUD A;  5JA4 B;  4X23 B;  2F8N H;  4Z5T D;  1P34 A;  5CPI B;  1P3M D;  1F66 C;  3AV2 D;  3VH6 A;  5GT3 D;  3REK D;  1P3A C;  3R45 B;  3MVD B;  3X1S D;  5B1L B;  4J8U C;  2NQB B;  4ZUX A;  5B0Z B;  5BS7 C;  3AZN C;  3UTA A;  4J8V B;  1BH8 A;  5F99 B;  3X1U A;  1H3O B;  1M1A A;  1Q9C A;  4WU8 B;  1M19 A;  1F66 D;  1P3A D;  3MGQ D;  3LZ0 B;  4AWL B;  4YM6 C;  5GSU A;  4XUJ A;  5B24 B;  3AZN D;  1N1J A;  3C1B C;  5JRG D;  3MVD C;  5B1L C;  5B31 C;  4LD9 A;  5AY8 C;  4DRB A;  1AOI C;  3REI D;  3AFA C;  4Z66 A;  3KXB A;  3VH6 T;  4CAY B;  3AZI C;  5AV8 C;  1TZY D;  3AZF B;  5GT0 B;  1WWI A;  3REL B;  5BT1 C;  3LZ0 C;  3B0C W;  5B31 D;  5AV6 D;  3AV2 A;  5GT3 A;  5AVB D;  3REK A;  3AFA D;  2PYO C;  3X1S A;  2RVQ C;  3WKJ C;  1P3B A;  3MGP D;  1A7W A;  1JFI B;  3LZ1 A;  3MNN D;  3AZI D;  5AV8 D;  1P3I C;  5B2J D;  3WTP E;  4J8X D;  3AZJ C;  5B1M A;  3AZL D;  2CV5 A;  2F8N G;  3WAA B;  5B2I C;  2NZD C;  4NE3 A;  3MGQ A;  5CP6 D;  2RVQ D;  3X1U B;  1M19 B;  3AV1 A;  5G49 A;  3UT9 D;  1U35 B;  4KUD C;  1P3O B;  2ARO B;  5JRG A;  4XUJ B;  3AZH B;  1P34 C;  1HQ3 D;  1N1J B;  5BNV A;  5B2I D;  2NZD D;  4WNN A;  3NQU A;  3REI A;  3WTP D;  4ZUX C;  4UUZ B;  4KUD D;  1KX3 A;  3REH B;  4Z66 B;  1WWS A;  1P3P B;  3KWQ B;  5B32 D;  1TZY A;  3UTA C;  4H9S A;  5KDM B;  1P34 D;  3NQJ A;  3X1U C;  1M1A C;  1M19 C;  3KUY A;  5AV6 A;  2JSS A;  5DNN A;  5AVB A;  1F1E A;  4Z5T B;  5CPK A;  4H9R B;  4ZUX D;  3MGP A;  1P3M B;  4G91 B;  5AV5 D;  3MNN A;  5GSU C;  4XUJ C;  5B2J A;  3O62 A;  4J8X A;  3UTA D;  1BH9 B;  1M1A D;  2YFW A;  3AZL A;  4JJN D;  3W99 A;  4YS3 A;  4LD9 C;  1KU5 A;  5CP6 A;  4Z66 C;  3KXB C;  1F66 B;  3UT9 A;  1P3A B;  4H9P B;  3B6F A;  3MGQ B;  5B31 G;  1M18 A;  5G49 B;  3AZG D;  1HQ3 A;  2CWE A;  3AZN B;  4LD9 D;  4G91 C;  4CSR A;  4KHA A;  3AV2 C;  5CHL B;  4NE5 A;  5GT3 C;  5JRG B;  3REK C;  1KX5 A;  4NFT A;  3WTP A;  3KXB D;  3X1S C;  1P3B C;  5C3I C;  3LZ1 C;  3WA9 D;  4YM6 B;  4J8W D;  2FJ7 D;  5B32 A;  5CPJ A;  3TU4 A;  5AV9 D;  1KX4 A;  5B1M C;  2CV5 C;  1TZY B;  3C1B B;  3MGQ C;  3X1V D;  3NQJ B;  4H9O B;  3V9R B;  1P3B D;  1B6W A;  3LZ1 D;  3AYW A;  5B31 B;  5AV6 B;  1ULY A;  3W97 A;  5AV5 A;  5AY8 B;  3AV1 C;  4WU9 A;  1AOI B;  3AFA B;  5DNM D;  3LJA D;  1HTA A;  5JRG C;  5AVC A;  3MNN B;  5AV8 B;  3AZI B;  5B1M D;  2CV5 D;  1P3K D;  4J8X B;  3LEL D;  3A6N A;  4JJN A;  3REI C;  2F8N K;  3AZL B;  3AV1 D;  4R8P A;  2PYO B;  3W96 A;  1KX3 C;  3WKJ B;  3X1T A;  1TZY C;  4H9S C;  3AZG A;  1P3I B;  2BYK B;  3AZJ B;  5AV6 C;  5DNN C;  5AVB C;  5CPK C;  3MGP C;  3MNN C;  4KHA B;  5B2I B;  1S32 D;  3WA9 A;  1KX3 D;  2NZD B;  3B6G A;  5B2J C;  3O62 C;  4J8X C;  4J8W A;  3UTB D;  2FJ7 A;  3W98 D;  5AV9 A;  3AZE A;  2HUE C;  4KUD B;  3AZL C;  3KUY D;  3AZM A;  5DNN D;  3W99 C;  5B32 B;  4YS3 C;  1ID3 D;  5CPK D;  3X1V A;  5CP6 C;  1P34 B;  3VH5 A;  3UT9 C;  5GXQ A;  4QLC D;  3O62 D;  5BNX A;  3B6F C;  5B33 A;  5DNM A;  4ZUX B;  1M18 C;  3LJA A;  1P3K A;  1HQ3 C;  3LEL A;  3W99 D;  3UTA B;  4YS3 D;  1KX5 C;  5B0Y A;  1BH8 B;  3MGR A;  3WTP C;  3VH6 W;  1M1A B;  2HIO D;  4KGC A;  3AZK A;  3B6F D;  2LY8 A;  1M18 D;  5B32 C;  5CPJ C;  4H9Q A;  1P3L A;  5GSU B;  3TU4 C;  1KX4 C;  3KSY A;  1BFM A;  1KX5 D;  2YFV A;  1P3F A;  1P3G A;  2BYM A;  3AYW C;  4WU9 C;  4LD9 B;  3REJ A;  5AV5 C;  3W97 C;  1S32 A;  4NE6 A;  5B24 D;  3KXB B;  3UTB A;  3VH5 T;  3MGS A;  5CPJ D;  3TU4 D;  3W98 A;  5AVC C;  4XZQ A;  1KX4 D;  4G92 C;  4H9N A;  3A6N C;  4JJN C;  1ID3 A;  3B0D C;  5BO0 A;  4WU9 D;  3AYW D;  1TAF A;  4R8P C;  3AV2 B;  3W97 D;  5GT3 B;  3REK B;  3W96 C;  1ZLA A;  4QLC A;  3X1S B;  3X1V B;  3X1T C;  1P3B B;  5C3I B;  1EQZ D;  3LZ1 B;  5AVC D;  5GT0 D;  4X23 A;  3REL D;  3AZG C;  2L5A A;  3A6N D;  5CPI A;  3LJA B;  5B1M B;  3R45 A;  2CV5 B;  1P3K B;  2HIO A;  4HGA C;  4R8P D;  2NQB A;  3W96 D;  3WA9 C;  5B0Z A;  3X1T D;  3B6G C;  4J8W C;  2FJ7 C;  3AN2 D;  3AV1 B;  3C1C D;  5AV9 C;  3AZE C;  4ZBJ C;  4J8V A;  5F99 A;  3AZM C;  4WU8 A;  3X1V C;  5BNV B;  4WNN B;  2YFV B;  3NQU B;  3REI B;  5GXQ C;  3B6G D;  5B24 A;  5DNM C;  5B33 C;  1P3O D;  2BYM B;  3LJA C;  3AZE D;  1KX3 B;  1P3K C;  3AZM D;  3LEL C;  3UTB B;  3W98 B;  5B0Y C;  3MGR C;  4H9N B;  3KUY B;  4KGC C;  5DNN B;  4CAY A;  3AZK C;  5GXQ D;  5AVB B;  5BO0 B;  5CPK B;  5E5A D;  5B33 D;  3REH D;  3MGP B;  1EQZ A;  1P3L C;  3AZF A;  5GT0 A;  3REL A;  4E44 A;  5B2J B;  3O62 B;  2F8N D;  5B0Y D;  3MGR D;  2HUE B;  1P3F C;  5B32 G;  2YFW B;  1P3G C;  4KGC D;  3W99 B;  3AZK D;  4YS3 B;  1JFI A;  3REJ C;  1S32 C;  5CP6 B;  3UTB C;  3MGS C;  2HIO B;  3AN2 A;  1P3L D;  3C1C A;  3W98 C;  3UT9 B;  4XZQ C;  5B40 D;  3B6F B;  3KUY C;  1M18 B;  1ID3 C;  1P3F D;  2IO5 C;  1P3G D;  3WAA A;  1HQ3 B;  4EO5 C;  4CSR B;  3REJ D;  1KX5 B;  3B0C T;  4WZS B;  1ZLA C;  4QLC C;  3WTP B;  1U35 A;  3MGS D;  4J8U D;  1P3O A;  2ARO A;  4XZQ D;  4X23 C;  3AZH A;  5CPI C;  5CPJ B;  3TU4 B;  1KX4 B;  2HIO C;  2NQB C;  5FUG A;  1ZLA D;  4UUZ A;  4Z2M G;  5B0Z C;  5E5A A;  3REH A;  4YM6 D;  3AYW B;  4WU9 B;  3KWQ A;  1P3P A;  5AV5 B;  4X23 D;  3W97 B;  4J8V C;  5KDM A;  5F99 C;  5CPI D;  2F8N A;  4WU8 C;  1EQZ B;  5AVC B;  3C1B D;  4Z5T A;  3MVD D;  4G92 B;  5B1L D;  3A6N B;  4H9R A;  4AWL C;  2NQB D;  4JJN B;  1P3M A;  3B0D B;  5AY8 D;  1AOI D;  5B0Z D;  5B24 C;  4R8P B;  1BH9 A;  4J8V D;  5B40 A;  3W96 B;  5F99 D;  4DRA A;  4M6B A;  3X1T B;  4WU8 D;  3AN2 B;  3C1C B;  3AZG B;  5BT1 D;  3LZ0 D;  1F66 A;  1P3A A;  2PYO D;  4H9P A;  4J8U A;  4HGA B;  3WKJ D;  1EQZ C;  3AZF C;  5GT0 C;  3REL C;  3WA9 B;  3B6G B;  5BS7 A;  1P3I D;  4J8W B;  2FJ7 B;  3AZN A;  3AZJ D;  3B0B A;  5AV9 B;  3AZE B;  4ZBJ B;  3AZM B;  5JA4 A;  4YM6 A;  3AN2 C;  3AZF D;  5FUG B;  3C1C C;  5GXQ B;  4WV4 B;  5BNX B;  5E5A B;  5B33 B;  5DNM B;  3C1B A;  3WAA C;  3MVD A;  5B1L A;  1R4V A;  4H9O A;  3V9R A;  3LEL B;  2F8N B;  5B0Y B;  5B31 A;  3MGR B;  5AY8 A;  1AOI A;  3VH5 W;  1U35 C;  3AFA A;  1P3O C;  4KGC B;  2ARO C;  3AZK B;  3AZI A;  5AV8 A;  3AZH C;  1H3O A;  4H9Q B;  4E45 A;  1P3L B;  3WAA D;  5B40 B;  4Z2M H;  3X1U D;  3LZ0 A;  1M19 D;  1P3F B;  1P3G B;  1U35 D;  2PYO A;  5E5A C;  3REH C;  2ARO D;  3WKJ A;  1P3P C;  3KWQ C;  3REJ B;  1S32 B;  5GSU D;  4XUJ D;  3AZH D;  1P3I A;  3MGS B;  4J8U B;  2BYK A;  3AZJ A;  4XZQ B;  1B67 A;  4Z5T C;  1ID3 B;  1P3M C;  2IO5 B;  5B2I A;  2NZD A;  4EO5 B;  4Z66 D;  1P3P D;  1TAF B;  3KWQ D;  1ZLA B; 
#chains in the Genus database with same CATH topology
 5B40 C;  4QLC B;  4KUD A;  5JA4 B;  4X23 B;  1T3U A;  2F8N H;  4Z5T D;  1P34 A;  5CPI B;  1P3M D;  1F66 C;  3AV2 D;  3VH6 A;  5GT3 D;  3REK D;  1P3A C;  3R45 B;  3MVD B;  3X1S D;  5B1L B;  4J8U C;  2ZY2 A;  2NQB B;  4ZUX A;  3KFU G;  3EPJ A;  5B0Z B;  5BS7 C;  3AZN C;  3UTA A;  4J8V B;  1BH8 A;  5F99 B;  3X1U A;  1H3O B;  1M1A A;  1Q9C A;  4WU8 B;  1M19 A;  2JE5 A;  1F66 D;  1P3A D;  3MGQ D;  3LZ0 B;  4AWL B;  4YM6 C;  5GSU A;  2DF4 C;  4XUJ A;  5B24 B;  3AZN D;  1N1J A;  3EPH A;  3C1B C;  5JRG D;  3MVD C;  5B1L C;  5B31 C;  4LD9 A;  5AY8 C;  4DRB A;  1AOI C;  3REI D;  3AFA C;  4Z66 A;  3KXB A;  3VH6 T;  4CAY B;  2UWX A;  3AZI C;  5AV8 C;  1TZY D;  4DQY B;  3AZF B;  5GT0 B;  1WWI A;  3REL B;  5BT1 C;  3LZ0 C;  3B0C W;  5B31 D;  5AV6 D;  3AV2 A;  5GT3 A;  2J8P A;  5AVB D;  3AFA D;  3REK A;  2PYO C;  3X1S A;  2RVQ C;  3WKJ C;  1P3B A;  3MGP D;  1A7W A;  1JFI B;  3LZ1 A;  3MNN D;  3AZI D;  5AV8 D;  1P3I C;  5B2J D;  3WTP E;  4J8X D;  3AZJ C;  5B1M A;  3AZL D;  2CV5 A;  2F8N G;  3WAA B;  5B2I C;  2NZD C;  4NE3 A;  3MGQ A;  5CP6 D;  2RVQ D;  2G5I C;  3X1U B;  1M19 B;  2JCH A;  3AV1 A;  5G49 A;  3UT9 D;  1U35 B;  4KUD C;  1P3O B;  2XD5 A;  2ARO B;  2Y2K A;  5JRG A;  4XUJ B;  3AZH B;  1P34 C;  1HQ3 D;  1N1J B;  5BNV A;  5B2I D;  2NZD D;  4WNN A;  3NQU A;  3REI A;  3WTP D;  4ZUX C;  4UUZ B;  4KUD D;  1KX3 A;  3REH B;  3H0L C;  4Z66 B;  1WWS A;  1P3P B;  3KWQ B;  5B32 D;  1TZY A;  3UTA C;  4H9S A;  5KDM B;  1P34 D;  3NQJ A;  3X1U C;  1M1A C;  1M19 C;  3KUY A;  5AV6 A;  2JSS A;  5DNN A;  5AVB A;  1F1E A;  4Z5T B;  5CPK A;  1PZR A;  4H9R B;  4ZUX D;  3MGP A;  1P3M B;  4G91 B;  5AV5 D;  3MNN A;  5GSU C;  4XUJ C;  5B2J A;  3O62 A;  4J8X A;  3UTA D;  1BH9 B;  1M1A D;  2YFW A;  3AZL A;  4JJN D;  3W99 A;  4YS3 A;  4LD9 C;  1KU5 A;  2XD1 A;  5CP6 A;  4Z66 C;  3KXB C;  1F66 B;  3UT9 A;  1P3A B;  4H9P B;  3B6F A;  3MGQ B;  5B31 G;  1M18 A;  2Y2G A;  5G49 B;  3AZG D;  1HQ3 A;  2CWE A;  3AZN B;  4LD9 D;  4G91 C;  4CSR A;  4KHA A;  3AV2 C;  5CHL B;  4NE5 A;  5GT3 C;  5JRG B;  3REK C;  1KX5 A;  4NFT A;  3WTP A;  3KXB D;  3X1S C;  1P3B C;  5C3I C;  3LZ1 C;  3WA9 D;  4YM6 B;  4J8W D;  2FJ7 D;  5B32 A;  5CPJ A;  2W8S A;  3TU4 A;  5AV9 D;  1KX4 A;  5B1M C;  2Y2L A;  2CV5 C;  1TZY B;  3C1B B;  3MGQ C;  3X1V D;  3NQJ B;  4H9O B;  3V9R B;  1P3B D;  1B6W A;  3LZ1 D;  3AYW A;  5AV6 B;  5B31 B;  1ULY A;  3W97 A;  5AV5 A;  5AY8 B;  3AV1 C;  4WU9 A;  1AOI B;  3AFA B;  5DNM D;  3LJA D;  1HTA A;  5JRG C;  5AVC A;  3MNN B;  5AV8 B;  3AZI B;  5B1M D;  2CV5 D;  1P3K D;  4J8X B;  3LEL D;  3A6N A;  4JJN A;  3REI C;  2F8N K;  3AZL B;  3AV1 D;  4R8P A;  2PYO B;  3W96 A;  1KX3 C;  3WKJ B;  3X1T A;  1TZY C;  4H9S C;  3AZG A;  1P3I B;  2BYK B;  3AZJ B;  5AV6 C;  5DNN C;  5AVB C;  5CPK C;  3FDD A;  2FFF B;  3MGP C;  3MNN C;  4KHA B;  5B2I B;  1S32 D;  3WA9 A;  1KX3 D;  2NZD B;  3B6G A;  5B2J C;  3O62 C;  4J8X C;  4J8W A;  3UTB D;  2FJ7 A;  3W98 D;  5AV9 A;  3AZE A;  2HUE C;  4KUD B;  3AZL C;  3KUY D;  3AZM A;  5DNN D;  3W99 C;  5B32 B;  4YS3 C;  1ID3 D;  5CPK D;  3X1V A;  5CP6 C;  1P34 B;  3VH5 A;  3UT9 C;  5GXQ A;  4QLC D;  3O62 D;  5BNX A;  3B6F C;  5B33 A;  5DNM A;  4ZUX B;  1M18 C;  3LJA A;  2ZY5 A;  2DQN C;  1P3K A;  1HQ3 C;  3LEL A;  3W99 D;  3UTA B;  4YS3 D;  1KX5 C;  5B0Y A;  1BH8 B;  3MGR A;  3VH6 W;  3WTP C;  1M1A B;  2HIO D;  4KGC A;  3AZK A;  3B6F D;  2LY8 A;  2Y2N A;  1M18 D;  5B32 C;  5CPJ C;  4H9Q A;  1P3L A;  5GSU B;  3TU4 C;  1KX4 C;  3KSY A;  1BFM A;  1KX5 D;  2YFV A;  1P3F A;  1P3G A;  2BYM A;  3AYW C;  4WU9 C;  4LD9 B;  3REJ A;  5AV5 C;  3W97 C;  1S32 A;  4NE6 A;  3H0M C;  5B24 D;  3KXB B;  3UTB A;  2BG1 A;  3VH5 T;  5CPJ D;  3MGS A;  3TU4 D;  3W98 A;  5AVC C;  4XZQ A;  1KX4 D;  4G92 C;  4H9N A;  3A6N C;  4JJN C;  1ID3 A;  3B0D C;  5BO0 A;  3EPL A;  4WU9 D;  3AYW D;  1TAF A;  4R8P C;  3AV2 B;  3W97 D;  5GT3 B;  3REK B;  3W96 C;  1ZLA A;  4QLC A;  3X1S B;  3X1V B;  3X1T C;  1P3B B;  5C3I B;  1EQZ D;  3LZ1 B;  5AVC D;  5GT0 D;  4X23 A;  3REL D;  3AZG C;  2L5A A;  3A6N D;  5CPI A;  3LJA B;  5B1M B;  3R45 A;  2CV5 B;  1P3K B;  2HIO A;  4HGA C;  4R8P D;  2NQB A;  3W96 D;  3A1I A;  3WA9 C;  5B0Z A;  3X1T D;  3B6G C;  4J8W C;  2FJ7 C;  3AN2 D;  3AV1 B;  3C1C D;  5AV9 C;  3AZE C;  4ZBJ C;  4J8V A;  3EPK A;  5F99 A;  3AZM C;  4WU8 A;  3AL0 C;  3X1V C;  2Y2Q A;  5BNV B;  4WNN B;  2YFV B;  3NQU B;  3REI B;  5GXQ C;  3B6G D;  5B24 A;  5DNM C;  5B33 C;  1P3O D;  2BYM B;  3LJA C;  3AZE D;  1KX3 B;  1P3K C;  3AZM D;  3LEL C;  3UTB B;  3W98 B;  5B0Y C;  2ZY4 A;  3MGR C;  4H9N B;  3KUY B;  4KGC C;  5DNN B;  4CAY A;  3AZK C;  5GXQ D;  5AVB B;  5BO0 B;  5CPK B;  5E5A D;  5B33 D;  3REH D;  3MGP B;  1EQZ A;  1P3L C;  3AZF A;  5GT0 A;  3REL A;  4E44 A;  5B2J B;  3O62 B;  2F8N D;  5B0Y D;  3MGR D;  2HUE B;  1P3F C;  5B32 G;  2YFW B;  1P3G C;  4KGC D;  2ZM5 A;  3W99 B;  3AZK D;  4YS3 B;  1JFI A;  3REJ C;  1S32 C;  3A1K A;  5CP6 B;  4UPK A;  3UTB C;  3MGS C;  2HIO B;  3AN2 A;  1P3L D;  3C1C A;  3W98 C;  3UT9 B;  4XZQ C;  5B40 D;  3B6F B;  2Y2H A;  3KUY C;  1M18 B;  2Y2J A;  1ID3 C;  2Y2O A;  2IO5 C;  1P3G D;  1P3F D;  3WAA A;  2Y2M A;  1HQ3 B;  4EO5 C;  4CSR B;  3REJ D;  1KX5 B;  3B0C T;  4WZS B;  1ZLA C;  4QLC C;  3WTP B;  1U35 A;  3MGS D;  4J8U D;  1P3O A;  2ARO A;  4XZQ D;  4X23 C;  3AZH A;  5CPI C;  5CPJ B;  3TU4 B;  1KX4 B;  3P5J B;  2G5H C;  2HIO C;  2NQB C;  5FUG A;  4WJ3 C;  1ZLA D;  4UUZ A;  4Z2M G;  5B0Z C;  5E5A A;  3REH A;  4YM6 D;  3AYW B;  4WU9 B;  3KWQ A;  1P3P A;  5AV5 B;  4X23 D;  3W97 B;  4J8V C;  5KDM A;  5F99 C;  5CPI D;  2F8N A;  4WU8 C;  1EQZ B;  5AVC B;  3C1B D;  4Z5T A;  3MVD D;  4G92 B;  5B1L D;  3A6N B;  4H9R A;  4AWL C;  2NQB D;  4JJN B;  1P3M A;  3B0D B;  5AY8 D;  1AOI D;  5B0Z D;  5B24 C;  1W2E A;  4R8P B;  2Y2P A;  1BH9 A;  4J8V D;  5B40 A;  3W96 B;  5F99 D;  4DRA A;  4M6B A;  3X1T B;  4WU8 D;  3AN2 B;  3C1C B;  3AZG B;  5BT1 D;  3LZ0 D;  1F66 A;  1P3A A;  2PYO D;  4H9P A;  4J8U A;  4HGA B;  3WKJ D;  1EQZ C;  3AZF C;  5GT0 C;  3REL C;  3WA9 B;  3B6G B;  5BS7 A;  1P3I D;  1Z2C B;  4J8W B;  2FJ7 B;  3AZN A;  2F2A C;  3AZJ D;  3B0B A;  5AV9 B;  3AZE B;  4ZBJ B;  3AZM B;  5JA4 A;  2Y2I A;  4YM6 A;  3AN2 C;  3AZF D;  5FUG B;  3C1C C;  2RIQ A;  5GXQ B;  4WV4 B;  5BNX B;  5E5A B;  5B33 B;  5DNM B;  3C1B A;  3WAA C;  3MVD A;  5B1L A;  1R4V A;  4H9O A;  3V9R A;  3LEL B;  2F8N B;  5B0Y B;  5B31 A;  3MGR B;  5AY8 A;  1AOI A;  3VH5 W;  1U35 C;  3AFA A;  1P3O C;  4KGC B;  2ARO C;  3AZK B;  3H0R C;  2ZY3 A;  3AZI A;  5AV8 A;  3AZH C;  1H3O A;  4H9Q B;  4E45 A;  1P3L B;  3WAA D;  5B40 B;  4Z2M H;  3X1U D;  3LZ0 A;  3EG5 B;  1M19 D;  1P3F B;  1P3G B;  1U35 D;  2PYO A;  2VQR A;  5E5A C;  3REH C;  2ARO D;  3IP4 C;  3WKJ A;  1P3P C;  3KWQ C;  3REJ B;  1S32 B;  5GSU D;  4XUJ D;  3AZH D;  1P3I A;  3MGS B;  4J8U B;  2BYK A;  3AZJ A;  4XZQ B;  1B67 A;  4Z5T C;  1ID3 B;  1P3M C;  2IO5 B;  5B2I A;  2NZD A;  4EO5 B;  4Z66 D;  1P3P D;  1TAF B;  3KWQ D;  3F6T A;  1ZLA B; 
#chains in the Genus database with same CATH homology
 5B40 C;  4QLC B;  4KUD A;  5JA4 B;  4X23 B;  1T3U A;  2F8N H;  4Z5T D;  1P34 A;  5CPI B;  1P3M D;  1F66 C;  3AV2 D;  3VH6 A;  5GT3 D;  3REK D;  1P3A C;  3R45 B;  3MVD B;  3X1S D;  5B1L B;  4J8U C;  2ZY2 A;  2NQB B;  4ZUX A;  3KFU G;  3EPJ A;  5B0Z B;  5BS7 C;  3AZN C;  3UTA A;  4J8V B;  1BH8 A;  5F99 B;  3X1U A;  1H3O B;  1M1A A;  1Q9C A;  4WU8 B;  1M19 A;  2JE5 A;  1F66 D;  1P3A D;  3MGQ D;  3LZ0 B;  4AWL B;  4YM6 C;  5GSU A;  2DF4 C;  4XUJ A;  5B24 B;  3AZN D;  1N1J A;  3EPH A;  3C1B C;  5JRG D;  3MVD C;  5B1L C;  5B31 C;  4LD9 A;  5AY8 C;  4DRB A;  1AOI C;  3REI D;  3AFA C;  4Z66 A;  3KXB A;  3VH6 T;  4CAY B;  2UWX A;  3AZI C;  5AV8 C;  1TZY D;  4DQY B;  3AZF B;  5GT0 B;  1WWI A;  3REL B;  5BT1 C;  3LZ0 C;  3B0C W;  5B31 D;  5AV6 D;  3AV2 A;  5GT3 A;  2J8P A;  5AVB D;  3AFA D;  3REK A;  2PYO C;  3X1S A;  2RVQ C;  3WKJ C;  1P3B A;  3MGP D;  1A7W A;  1JFI B;  3LZ1 A;  3MNN D;  3AZI D;  5AV8 D;  1P3I C;  5B2J D;  3WTP E;  4J8X D;  3AZJ C;  5B1M A;  3AZL D;  2CV5 A;  2F8N G;  3WAA B;  5B2I C;  2NZD C;  4NE3 A;  3MGQ A;  5CP6 D;  2RVQ D;  2G5I C;  3X1U B;  1M19 B;  2JCH A;  3AV1 A;  5G49 A;  3UT9 D;  1U35 B;  4KUD C;  1P3O B;  2XD5 A;  2ARO B;  2Y2K A;  5JRG A;  4XUJ B;  3AZH B;  1P34 C;  1HQ3 D;  1N1J B;  5BNV A;  5B2I D;  2NZD D;  4WNN A;  3NQU A;  3REI A;  3WTP D;  4ZUX C;  4UUZ B;  4KUD D;  1KX3 A;  3REH B;  3H0L C;  4Z66 B;  1WWS A;  1P3P B;  3KWQ B;  5B32 D;  1TZY A;  3UTA C;  4H9S A;  5KDM B;  1P34 D;  3NQJ A;  3X1U C;  1M1A C;  1M19 C;  3KUY A;  5AV6 A;  2JSS A;  5DNN A;  5AVB A;  1F1E A;  4Z5T B;  5CPK A;  1PZR A;  4H9R B;  4ZUX D;  3MGP A;  1P3M B;  4G91 B;  5AV5 D;  3MNN A;  5GSU C;  4XUJ C;  5B2J A;  3O62 A;  4J8X A;  3UTA D;  1BH9 B;  1M1A D;  2YFW A;  3AZL A;  4JJN D;  3W99 A;  4YS3 A;  4LD9 C;  1KU5 A;  2XD1 A;  5CP6 A;  4Z66 C;  3KXB C;  1F66 B;  3UT9 A;  1P3A B;  4H9P B;  3B6F A;  3MGQ B;  5B31 G;  1M18 A;  2Y2G A;  5G49 B;  3AZG D;  1HQ3 A;  2CWE A;  3AZN B;  4LD9 D;  4G91 C;  4CSR A;  4KHA A;  3AV2 C;  5CHL B;  4NE5 A;  5GT3 C;  5JRG B;  3REK C;  1KX5 A;  4NFT A;  3WTP A;  3KXB D;  3X1S C;  1P3B C;  5C3I C;  3LZ1 C;  3WA9 D;  4YM6 B;  4J8W D;  2FJ7 D;  5B32 A;  5CPJ A;  2W8S A;  3TU4 A;  5AV9 D;  1KX4 A;  5B1M C;  2Y2L A;  2CV5 C;  1TZY B;  3C1B B;  3MGQ C;  3X1V D;  3NQJ B;  4H9O B;  3V9R B;  1P3B D;  1B6W A;  3LZ1 D;  3AYW A;  5AV6 B;  5B31 B;  1ULY A;  3W97 A;  5AV5 A;  5AY8 B;  3AV1 C;  4WU9 A;  1AOI B;  3AFA B;  5DNM D;  3LJA D;  1HTA A;  5JRG C;  5AVC A;  3MNN B;  5AV8 B;  3AZI B;  5B1M D;  2CV5 D;  1P3K D;  4J8X B;  3LEL D;  3A6N A;  4JJN A;  3REI C;  2F8N K;  3AZL B;  3AV1 D;  4R8P A;  2PYO B;  3W96 A;  1KX3 C;  3WKJ B;  3X1T A;  1TZY C;  4H9S C;  3AZG A;  1P3I B;  2BYK B;  3AZJ B;  5AV6 C;  5DNN C;  5AVB C;  5CPK C;  3FDD A;  2FFF B;  3MGP C;  3MNN C;  4KHA B;  5B2I B;  1S32 D;  3WA9 A;  1KX3 D;  2NZD B;  3B6G A;  5B2J C;  3O62 C;  4J8X C;  4J8W A;  3UTB D;  2FJ7 A;  3W98 D;  5AV9 A;  3AZE A;  2HUE C;  4KUD B;  3AZL C;  3KUY D;  3AZM A;  5DNN D;  3W99 C;  5B32 B;  4YS3 C;  1ID3 D;  5CPK D;  3X1V A;  5CP6 C;  1P34 B;  3VH5 A;  3UT9 C;  5GXQ A;  4QLC D;  3O62 D;  5BNX A;  3B6F C;  5B33 A;  5DNM A;  4ZUX B;  1M18 C;  3LJA A;  2ZY5 A;  2DQN C;  1P3K A;  1HQ3 C;  3LEL A;  3W99 D;  3UTA B;  4YS3 D;  1KX5 C;  5B0Y A;  1BH8 B;  3MGR A;  3VH6 W;  3WTP C;  1M1A B;  2HIO D;  4KGC A;  3AZK A;  3B6F D;  2LY8 A;  2Y2N A;  1M18 D;  5B32 C;  5CPJ C;  4H9Q A;  1P3L A;  5GSU B;  3TU4 C;  1KX4 C;  3KSY A;  1BFM A;  1KX5 D;  2YFV A;  1P3F A;  1P3G A;  2BYM A;  3AYW C;  4WU9 C;  4LD9 B;  3REJ A;  5AV5 C;  3W97 C;  1S32 A;  4NE6 A;  3H0M C;  5B24 D;  3KXB B;  3UTB A;  2BG1 A;  3VH5 T;  5CPJ D;  3MGS A;  3TU4 D;  3W98 A;  5AVC C;  4XZQ A;  1KX4 D;  4G92 C;  4H9N A;  3A6N C;  4JJN C;  1ID3 A;  3B0D C;  5BO0 A;  3EPL A;  4WU9 D;  3AYW D;  1TAF A;  4R8P C;  3AV2 B;  3W97 D;  5GT3 B;  3REK B;  3W96 C;  1ZLA A;  4QLC A;  3X1S B;  3X1V B;  3X1T C;  1P3B B;  5C3I B;  1EQZ D;  3LZ1 B;  5AVC D;  5GT0 D;  4X23 A;  3REL D;  3AZG C;  2L5A A;  3A6N D;  5CPI A;  3LJA B;  5B1M B;  3R45 A;  2CV5 B;  1P3K B;  2HIO A;  4HGA C;  4R8P D;  2NQB A;  3W96 D;  3A1I A;  3WA9 C;  5B0Z A;  3X1T D;  3B6G C;  4J8W C;  2FJ7 C;  3AN2 D;  3AV1 B;  3C1C D;  5AV9 C;  3AZE C;  4ZBJ C;  4J8V A;  3EPK A;  5F99 A;  3AZM C;  4WU8 A;  3AL0 C;  3X1V C;  2Y2Q A;  5BNV B;  4WNN B;  2YFV B;  3NQU B;  3REI B;  5GXQ C;  3B6G D;  5B24 A;  5DNM C;  5B33 C;  1P3O D;  2BYM B;  3LJA C;  3AZE D;  1KX3 B;  1P3K C;  3AZM D;  3LEL C;  3UTB B;  3W98 B;  5B0Y C;  2ZY4 A;  3MGR C;  4H9N B;  3KUY B;  4KGC C;  5DNN B;  4CAY A;  3AZK C;  5GXQ D;  5AVB B;  5BO0 B;  5CPK B;  5E5A D;  5B33 D;  3REH D;  3MGP B;  1EQZ A;  1P3L C;  3AZF A;  5GT0 A;  3REL A;  4E44 A;  5B2J B;  3O62 B;  2F8N D;  5B0Y D;  3MGR D;  2HUE B;  1P3F C;  5B32 G;  2YFW B;  1P3G C;  4KGC D;  2ZM5 A;  3W99 B;  3AZK D;  4YS3 B;  1JFI A;  3REJ C;  1S32 C;  3A1K A;  5CP6 B;  4UPK A;  3UTB C;  3MGS C;  2HIO B;  3AN2 A;  1P3L D;  3C1C A;  3W98 C;  3UT9 B;  4XZQ C;  5B40 D;  3B6F B;  2Y2H A;  3KUY C;  1M18 B;  2Y2J A;  1ID3 C;  2Y2O A;  2IO5 C;  1P3G D;  1P3F D;  3WAA A;  2Y2M A;  1HQ3 B;  4EO5 C;  4CSR B;  3REJ D;  1KX5 B;  3B0C T;  4WZS B;  1ZLA C;  4QLC C;  3WTP B;  1U35 A;  3MGS D;  4J8U D;  1P3O A;  2ARO A;  4XZQ D;  4X23 C;  3AZH A;  5CPI C;  5CPJ B;  3TU4 B;  1KX4 B;  3P5J B;  2G5H C;  2HIO C;  2NQB C;  5FUG A;  4WJ3 C;  1ZLA D;  4UUZ A;  4Z2M G;  5B0Z C;  5E5A A;  3REH A;  4YM6 D;  3AYW B;  4WU9 B;  3KWQ A;  1P3P A;  5AV5 B;  4X23 D;  3W97 B;  4J8V C;  5KDM A;  5F99 C;  5CPI D;  2F8N A;  4WU8 C;  1EQZ B;  5AVC B;  3C1B D;  4Z5T A;  3MVD D;  4G92 B;  5B1L D;  3A6N B;  4H9R A;  4AWL C;  2NQB D;  4JJN B;  1P3M A;  3B0D B;  5AY8 D;  1AOI D;  5B0Z D;  5B24 C;  1W2E A;  4R8P B;  2Y2P A;  1BH9 A;  4J8V D;  5B40 A;  3W96 B;  5F99 D;  4DRA A;  4M6B A;  3X1T B;  4WU8 D;  3AN2 B;  3C1C B;  3AZG B;  5BT1 D;  3LZ0 D;  1F66 A;  1P3A A;  2PYO D;  4H9P A;  4J8U A;  4HGA B;  3WKJ D;  1EQZ C;  3AZF C;  5GT0 C;  3REL C;  3WA9 B;  3B6G B;  5BS7 A;  1P3I D;  1Z2C B;  4J8W B;  2FJ7 B;  3AZN A;  2F2A C;  3AZJ D;  3B0B A;  5AV9 B;  3AZE B;  4ZBJ B;  3AZM B;  5JA4 A;  2Y2I A;  4YM6 A;  3AN2 C;  3AZF D;  5FUG B;  3C1C C;  2RIQ A;  5GXQ B;  4WV4 B;  5BNX B;  5E5A B;  5B33 B;  5DNM B;  3C1B A;  3WAA C;  3MVD A;  5B1L A;  1R4V A;  4H9O A;  3V9R A;  3LEL B;  2F8N B;  5B0Y B;  5B31 A;  3MGR B;  5AY8 A;  1AOI A;  3VH5 W;  1U35 C;  3AFA A;  1P3O C;  4KGC B;  2ARO C;  3AZK B;  3H0R C;  2ZY3 A;  3AZI A;  5AV8 A;  3AZH C;  1H3O A;  4H9Q B;  4E45 A;  1P3L B;  3WAA D;  5B40 B;  4Z2M H;  3X1U D;  3LZ0 A;  3EG5 B;  1M19 D;  1P3F B;  1P3G B;  1U35 D;  2PYO A;  2VQR A;  5E5A C;  3REH C;  2ARO D;  3IP4 C;  3WKJ A;  1P3P C;  3KWQ C;  3REJ B;  1S32 B;  5GSU D;  4XUJ D;  3AZH D;  1P3I A;  3MGS B;  4J8U B;  2BYK A;  3AZJ A;  4XZQ B;  1B67 A;  4Z5T C;  1ID3 B;  1P3M C;  2IO5 B;  5B2I A;  2NZD A;  4EO5 B;  4Z66 D;  1P3P D;  1TAF B;  3KWQ D;  3F6T A;  1ZLA B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...