3KUYA

Dna stretching in the nucleosome facilitates alkylation by an intercalating antitumor agent
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
96
structure length
96
Chain Sequence
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords Histone H3.2
publication title DNA stretching in the nucleosome facilitates alkylation by an intercalating antitumour agent
pubmed doi rcsb
source organism Xenopus laevis
total genus 29
structure length 96
sequence length 96
chains with identical sequence E
ec nomenclature
pdb deposition date 2009-11-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3kuyA00
3O62C 1A7WA 2RVQD 3REIB 4XZQD 3A6NB 3B0CT 3MNNB 4YM6D 1ZLAB 3X1TD 2HIOD 5E5AD 1P3BD 4QLCC 5AV9D 3UT9B 3X1UC 1Q9CA 5AY8C 3VH5W 4WNNA 5CP6A 1P3MB 3W96B 4XUJA 5B0ZC 3C1CC 4ZBJB 5G49A 4KHAB 3WAAC 3AZGC 5B32B 1N1JB 3TU4C 3B0DB 1TAFB 1TZYC 1AOIB 5F99A 2BYMA 2NZDA 1M18A 4G92C 3KUYB 5B2IC 1P3OA 3AV1D 4WU9C 3O62D 2LY8A 3WKJB 1BH9B 3AZEA 5C3IB 3AZHC 3MGPB 5AV5A 1P3KB 1M1AC 4QLCD 3X1UD 5AY8D 2IO5B 1KX5C 4J8WC 5B0ZD 3MGSA 1KX3A 3WAAD 2JSSA 3AZGD 3TU4D 3R45B 4KUDB 1TZYD 2CV5C 5B40A 3B6FA 3W97C 4YS3A 1EQZC 3NQUB 5B2ID 3KWQA 4H9PB 3AN2A 4WU9D 3V9RB 1F66C 4Z5TA 3AZHD 5AV6A 5GT0B 1M1AD 5B1LB 5JA4A 5AVCC 3MVDD 4JJNA 5GT3C 1P3PC 3AZFA 1KX5D 4J8WD 5B0YA 3AZMB 2F8NK 3X1SC 1KX4C 4X23A 1P3FC 5AVBC 1U35B 2CV5D 4J8VA 5B31A 3W97D 4Z2MG 3RELB 1EQZD 5B1MC 3AYWC 3UTBB 5CPJB 2NQBB 4R8PB 4ZUXD 3KXBA 4NE3A 3LZ1B 1F66D 2PYOA 5B2JB 4E45A 2AROC 5AVCD 3REHB 5GT3D 5DNNC 1P3AA 1P3PD 1P3GA 5CPIC 3WTPB 3LJAC 5BO0A 3X1SD 3REIC 4H9SA 1KX4D 3A6NC 3MNNC 1P3IB 1P3FD 5AVBD 1ZLAC 3NQJA 3UT9C 5B1MD 3AYWD 1P3MC 3W96C 4J8UB 3REJA 3C1BA 3AZNB 4J8XB 4ZBJC 5B33A 1P3LA 5CPKB 3AZKA 2F8NA 3LELC 5B32C 2AROD 3B0DC 3AV2B 1S32B 5DNND 3UTAB 2BYKB 1AOIC 5DNMB 5CPID 3LJAD 3KUYC 3LZ0A 4Z66A 3WA9A 4KGCB 4LD9B 3REID 3A6ND 5C3IC 3MNND 3B0BA 1P34A 1ZLAD 1P3KC 1M19B 3UT9D 1P3MD 3W96D 2IO5C 3AFAA 2HUEB 1P3BC 5B32D 3AZIA 4WU8B 3REKB 3AZJA 4KUDC 4H9NA 1AOID 1ID3A 3C1BB 3W98A 4Z2MH 3WKJD 3VH6W 4CSRA 3W99B 3MGPD 4AWLB 5GT0C 1HQ3A 1P3KD 5B1LC 3AV1C 5BNXB 4DRAA 3AZMC 1BH8A 5BS7C 3X1VA 4H9RB 3B6GA 4H9QA 5B24A 3AZLA 1U35C 4KUDD 3MGQB 3UTBC 5CPJC 4UUZB 5KDMB 4EO5B 2NQBC 2YFVB 4CAYB 1BFMA 5FUGA 4R8PC 5GXQA 3LZ1C 5GT0D 4XZQA 5B2JC 1B67A 5AV8B 4YM6A 2FJ7B 5B1LD 5JRGA 3REHC 3X1TA 2HIOA 5E5AA 5AV9A 1WWSA 5GSUB 3WTPC 3AZMD 3MVDC 3MGRB 1P3IC 1U35D 2YFWA 3RELD 4J8UC 5CPJD 3UTBD 3AZNC 1WWIA 2NQBD 4J8XC 4R8PD 5CP6B 4WNNB 3LZ1D 3O62A 5CPKC 5B2JD 4XUJB 5G49B 3REHD 3AV2C 1S32C 3UTAC 4ZUXC 4QLCA 5DNMC 3X1UA 3WTPD 5AY8A 4KGCC 5F99B 2BYMB 4LD9C 5B0ZA 2NZDB 3C1CA 1M18B 1P3ID 1P3OB 5JRGB 3WAAA 3AZGA 3TU4A 3AZEB 1M19C 5AV5B 1TZYA 4J8UD 3AZND 2HUEC 5B2IA 4J8XD 4WU9A 5CPKD 4HGAB 3MGSB 5BNVA 3AZHA 1JFIA 3REKC 4WU8C 1KX3B 5B31G 3AV2D 1S32D 1M1AA 3UTAD 1H3OA 1B6WA 5DNMD 5B40B 1KX5A 4J8WA 3B6FB 4KGCD 4LD9D 4YS3B 3W99C 3KWQB 3AN2B 4AWLC 1M19D 4Z5TB 5AV6B 2CV5A 3W97A 5JA4B 1EQZA 3C1CB 4JJNB 3AZFB 5B0YB 1F66A 3REKD 4WU8D 4X23B 5AVCA 3C1BD 5GT3A 3MGQC 1P3PA 4J8VB 4EO5C 3WTPE 5B31B 3W99D 1HTAA 3B0CW 3X1SA 2F8NG 1KX4A 5AV8C 3KXBB 2FJ7C 1P3FA 5AVBA 3WKJC 2PYOB 1F1EA 3MGPC 5GSUC 5B1MA 3AYWA 1P3AB 1P34D 1P3GB 3MGRC 5BO0B 2AROA 5DNNA 4G91B 3MGQD 3NQJB 5CPIA 3LJAA 5CP6C 3REJB 3REIA 3A6NA 4XUJC 5AV8D 3MNNA 5B33B 1P3LB 2FJ7D 1ZLAA 3AZKB 2F8NB 3UT9A 5GSUD 4NE6A 1KU5A 1P3MA 3W96A 5F99C 4H9OA 2NZDC 3MGRD 1M18C 1P3OC 3LZ0B 4KHAA 4Z66B 3WA9B 3LELA 5B32A 1N1JA 3AZEC 1P34B 1TAFA 5AV5C 1AOIA 3KUYA 5CP6D 3AFAB 3RELC 4HGAC 4XUJD 5BT1C 3MGSC 1KX3C 1P3KA 3AZIB 3AZJB 4H9NB 1R4VA 2L5AA 5F99D 5B40C 1ID3B 3B6FC 2NZDD 4YS3C 1M18D 3W98B 3KSYA 3KWQC 1P3BA 1P3OD 5JRGD 3AN2C 2F8NH 3AZED 4CSRB 4Z5TC 3R45A 5AV5D 5AV6C 4KUDA 1HQ3B 4H9OB 3NQUA 4H9PA 4JJNC 3AZFC 3V9RA 5B0YC 1ULYA 5BT1D 3LELB 3MGSD 1BH8B 3X1VB 1KX3D 5GT0A 3B6GB 4X23C 4H9QB 5B1LA 3AV1A 5B24B 3AZLB 3VH6A 5B40D 3B6FD 4J8VC 5B31C 3AZMA 4YS3D 5BS7A 3KWQD 4E44A 3AN2D 5FUGB 3KXBC 4Z5TD 5GXQB 3VH6T 5AV6D 1U35A 2PYOC 4XZQB 4YM6B 3RELA 3C1CD 3X1TB 2HIOB 5E5AB 4JJND 3UTBA 5CPJA 1P3AC 3AZFD 1P3GC 3VH5A 5AV9B 1P3BB 2NQBA 5B0YD 4R8PA 3LZ1A 5B2JA 4H9SC 4X23D 3REHA 3VH5T 4G91C 2YFWB 3WTPA 4J8VD 5B31D 3REJC 3MVDA 3C1BC 1P3IA 4DRBA 3KXBD 5B33C 3AV1B 1P3LC 3O62B 3AZKC 2PYOD 4J8UA 1P3AD 3AZNA 1P3GD 4QLCB 3X1UB 4J8XA 5AY8B 5CPKA 3LZ0C 4Z66C 3WA9C 5B0ZB 1P34C 3AV2A 1S32A 3WAAB 3UTAA 4ZUXA 2BYKA 3AZGB 5DNMA 3TU4B 4NE5A 1TZYB 4KGCA 4LD9A 3REJD 3AFAC 4G92B 5B2IB 5B33D 1P3LD 4WU9B 3AZKD 1M19A 2F8ND 5BNVB 3AZHB 1JFIB 3AZIC 4M6BA 3AZJC 1M1AB 1H3OB 1ID3C 3MVDB 3W98C 3LZ0D 4Z66D 3WA9D 1KX5B 4J8WB 4WU8A 3REKA 1HQ3C 2CV5B 3AFAD 3W97B 1EQZB 3W99A 3X1VC 4WZSB 2CWEA 4NFTA 4ZUXB 1F66B 3B6GC 5BNXA 5B24C 3AZID 3AZLC 3AZJD 1ID3D 5AVCB 5GT3B 1P3PB 3W98D 4H9RA 5GXQC 3X1SB 2RVQC 1KX4B 4XZQC 1HQ3D 4YM6C 4WV4B 5JRGC 5AVBB 1P3FB 3MGQA 3X1TC 2HIOC 5E5AC 4UUZA 5KDMA 2YFVA 4CAYA 5AV9C 5B1MB 3LELD 5B32G 3AYWB 3X1VD 5AV8A 3B6GD 2FJ7A 5B24D 3WKJA 3AZLD 3KUYD 1BH9A 2AROB 3MGPA 5GSUA 5DNNB 5CPIB 5CHLB 3MGRA 3LJAB 5GXQD
chains in the Genus database with same CATH superfamily
3O62C 1A7WA 2RVQD 3REIB 4XZQD 3A6NB 2Y2JA 3B0CT 3MNNB 4YM6D 1ZLAB 3X1TD 2HIOD 5E5AD 1P3BD 4QLCC 5AV9D 3UT9B 3X1UC 4WJ3C 1Q9CA 5AY8C 3VH5W 4WNNA 5CP6A 1P3MB 3W96B 4XUJA 5B0ZC 3C1CC 4ZBJB 5G49A 4KHAB 3WAAC 3AZGC 5B32B 1N1JB 3TU4C 3B0DB 1TAFB 1TZYC 2F2AC 1AOIB 5F99A 2BYMA 2NZDA 1M18A 4G92C 3KUYB 5B2IC 1P3OA 3IP4C 2Y2IA 3AV1D 2J8PA 3O62D 2LY8A 1Z2CB 4WU9C 3WKJB 1BH9B 3AZEA 5C3IB 3AZHC 3MGPB 5AV5A 1P3KB 1M1AC 3P5JB 4QLCD 3X1UD 5AY8D 2IO5B 1KX5C 4J8WC 5B0ZD 3MGSA 1KX3A 3WAAD 2JSSA 2ZY3A 3AZGD 3TU4D 3R45B 4KUDB 1TZYD 2CV5C 5B40A 3B6FA 3W97C 4YS3A 1EQZC 3NQUB 5B2ID 3KWQA 4H9PB 3AN2A 2FFFB 4WU9D 3V9RB 1F66C 4Z5TA 3AZHD 5AV6A 5GT0B 4UPKA 1M1AD 5B1LB 5JA4A 5AVCC 3MVDD 4JJNA 5GT3C 1P3PC 3AZFA 1KX5D 4J8WD 5B0YA 3AZMB 2F8NK 3X1SC 1KX4C 4X23A 1P3FC 5AVBC 1U35B 2CV5D 4J8VA 5B31A 3W97D 4Z2MG 3RELB 1EQZD 5B1MC 3AYWC 3UTBB 5CPJB 2NQBB 4R8PB 4ZUXD 3KXBA 4NE3A 3LZ1B 1F66D 2ZY5A 2PYOA 2Y2NA 5B2JB 4E45A 2AROC 5AVCD 3REHB 5GT3D 5DNNC 1P3AA 1P3PD 1P3GA 5CPIC 3WTPB 3LJAC 5BO0A 3X1SD 3REIC 4H9SA 1KX4D 3A6NC 3MNNC 1P3IB 1P3FD 5AVBD 1ZLAC 3NQJA 2Y2HA 3UT9C 5B1MD 3AYWD 1P3MC 3W96C 4J8UB 3REJA 3C1BA 3AZNB 4J8XB 4ZBJC 5B33A 1P3LA 5CPKB 3AZKA 2F8NA 3LELC 5B32C 2AROD 3B0DC 3AV2B 1S32B 5DNND 3UTAB 2BYKB 1AOIC 5DNMB 5CPID 3LJAD 3KUYC 3LZ0A 4Z66A 3WA9A 4KGCB 4LD9B 3REID 3A6ND 5C3IC 3MNND 3B0BA 1P34A 1ZLAD 1P3KC 1M19B 3UT9D 1P3MD 3W96D 2IO5C 3AFAA 2HUEB 1P3BC 5B32D 3AZIA 4WU8B 3REKB 3AZJA 4KUDC 4H9NA 1AOID 1ID3A 3C1BB 3W98A 4Z2MH 3WKJD 3VH6W 4CSRA 3W99B 3MGPD 4AWLB 5GT0C 1HQ3A 1P3KD 5B1LC 3AV1C 5BNXB 4DRAA 2ZM5A 3AZMC 1BH8A 5BS7C 3X1VA 2Y2PA 4H9RB 3B6GA 4H9QA 5B24A 3EG5B 3AZLA 1U35C 4KUDD 3MGQB 3UTBC 5CPJC 4UUZB 5KDMB 4EO5B 2NQBC 2YFVB 4CAYB 1BFMA 5FUGA 4R8PC 5GXQA 3LZ1C 5GT0D 4XZQA 5B2JC 1B67A 5AV8B 4YM6A 2FJ7B 5B1LD 5JRGA 3REHC 3X1TA 2HIOA 5E5AA 5AV9A 1WWSA 5GSUB 3WTPC 3AZMD 2G5IC 3MVDC 3MGRB 1P3IC 1U35D 2YFWA 3RELD 4J8UC 5CPJD 2G5HC 3UTBD 3AZNC 1WWIA 2NQBD 4J8XC 4R8PD 5CP6B 4WNNB 3LZ1D 3O62A 5CPKC 4XUJB 5B2JD 3H0RC 5G49B 3REHD 3AV2C 1S32C 3UTAC 4ZUXC 5DNMC 4QLCA 2XD5A 3X1UA 3WTPD 4DQYB 5AY8A 4KGCC 5F99B 2BYMB 4LD9C 5B0ZA 2NZDB 3C1CA 2JE5A 1M18B 1P3ID 1P3OB 5JRGB 3WAAA 3AZGA 3TU4A 3AZEB 1M19C 2UWXA 1TZYA 5AV5B 4J8UD 3AZND 2HUEC 5B2IA 2VQRA 4J8XD 4WU9A 5CPKD 4HGAB 3MGSB 5BNVA 3AZHA 1JFIA 3REKC 4WU8C 1KX3B 5B31G 3AV2D 1S32D 1M1AA 3UTAD 1H3OA 1B6WA 5DNMD 5B40B 1KX5A 4J8WA 3B6FB 4KGCD 4LD9D 1PZRA 4YS3B 2Y2MA 2Y2LA 3W99C 3KWQB 2BG1A 3AN2B 4AWLC 1M19D 4Z5TB 3A1IA 2W8SA 5AV6B 2CV5A 2Y2QA 3W97A 5JA4B 1EQZA 3C1CB 4JJNB 3AZFB 5B0YB 1F66A 3REKD 4WU8D 4X23B 5AVCA 3C1BD 5GT3A 3MGQC 1P3PA 4J8VB 4EO5C 3WTPE 5B31B 3W99D 1HTAA 3B0CW 3X1SA 2F8NG 1KX4A 5AV8C 3KXBB 2FJ7C 1P3FA 5AVBA 3WKJC 2PYOB 1F1EA 1W2EA 3MGPC 5GSUC 2DQNC 5B1MA 3AYWA 1P3AB 1P34D 1P3GB 3MGRC 5BO0B 2AROA 2XD1A 5DNNA 4G91B 3MGQD 3AL0C 3NQJB 5CPIA 3EPHA 3LJAA 5CP6C 3REJB 3REIA 3A6NA 4XUJC 5AV8D 3MNNA 5B33B 1P3LB 2FJ7D 1T3UA 1ZLAA 3AZKB 2F8NB 3UT9A 5GSUD 4NE6A 1KU5A 1P3MA 3W96A 5F99C 4H9OA 2NZDC 3MGRD 1M18C 1P3OC 3LZ0B 4KHAA 4Z66B 3WA9B 3LELA 5B32A 1N1JA 3AZEC 1P34B 1TAFA 5AV5C 1AOIA 3KUYA 5CP6D 3AFAB 3EPJA 3RELC 4HGAC 4XUJD 5BT1C 3MGSC 3H0LC 1KX3C 1P3KA 3AZIB 3AZJB 2ZY2A 4H9NB 1R4VA 2L5AA 5F99D 5B40C 1ID3B 3B6FC 3KFUG 2NZDD 4YS3C 2Y2OA 1M18D 3W98B 3KSYA 3KWQC 1P3BA 1P3OD 5JRGD 3AN2C 2F8NH 3AZED 4CSRB 4Z5TC 2Y2GA 3R45A 5AV5D 5AV6C 4KUDA 3A1KA 1HQ3B 4H9OB 3NQUA 4H9PA 4JJNC 3AZFC 3V9RA 5B0YC 1ULYA 5BT1D 3LELB 3MGSD 1BH8B 3X1VB 1KX3D 3FDDA 5GT0A 3B6GB 4X23C 4H9QB 5B1LA 3AV1A 5B24B 3AZLB 3VH6A 5B40D 3B6FD 4J8VC 5B31C 3AZMA 4YS3D 5BS7A 3KWQD 4E44A 3AN2D 5FUGB 3KXBC 4Z5TD 5GXQB 3VH6T 5AV6D 1U35A 2PYOC 4XZQB 4YM6B 3RELA 3H0MC 3C1CD 3X1TB 2HIOB 5E5AB 4JJND 3UTBA 5CPJA 1P3AC 3AZFD 1P3GC 3VH5A 5AV9B 1P3BB 2NQBA 5B0YD 4R8PA 3LZ1A 3EPKA 5B2JA 4H9SC 4X23D 3REHA 3VH5T 4G91C 2YFWB 3WTPA 4J8VD 5B31D 3REJC 3MVDA 3EPLA 3C1BC 1P3IA 4DRBA 3KXBD 5B33C 3AV1B 1P3LC 3O62B 3AZKC 2PYOD 2JCHA 4J8UA 1P3AD 3AZNA 1P3GD 4QLCB 3X1UB 4J8XA 5AY8B 5CPKA 3LZ0C 4Z66C 3WA9C 5B0ZB 1P34C 3AV2A 1S32A 3WAAB 3UTAA 4ZUXA 2BYKA 3AZGB 2ZY4A 5DNMA 3TU4B 4NE5A 1TZYB 4KGCA 4LD9A 3REJD 3AFAC 4G92B 5B2IB 5B33D 1P3LD 4WU9B 3AZKD 1M19A 2F8ND 5BNVB 3AZHB 1JFIB 3AZIC 4M6BA 3AZJC 1M1AB 1H3OB 1ID3C 2Y2KA 3MVDB 3W98C 3LZ0D 4Z66D 2RIQA 3WA9D 1KX5B 4J8WB 4WU8A 3REKA 1HQ3C 3F6TA 2DF4C 2CV5B 3AFAD 3W97B 1EQZB 3W99A 3X1VC 4WZSB 2CWEA 4NFTA 4ZUXB 1F66B 3B6GC 5BNXA 5B24C 3AZID 3AZLC 3AZJD 1ID3D 5AVCB 5GT3B 1P3PB 3W98D 4H9RA 5GXQC 3X1SB 2RVQC 1KX4B 4XZQC 1HQ3D 4YM6C 4WV4B 5JRGC 5AVBB 1P3FB 3MGQA 3X1TC 2HIOC 5E5AC 4UUZA 5KDMA 2YFVA 4CAYA 5AV9C 5B1MB 3LELD 5B32G 3AYWB 3X1VD 5AV8A 3B6GD 2FJ7A 5B24D 3WKJA 3AZLD 3KUYD 1BH9A 2AROB 3MGPA 5GSUA 5DNNB 5CPIB 5CHLB 3MGRA 3LJAB 5GXQD
chains in the Genus database with same CATH topology
3O62C 1A7WA 2RVQD 3REIB 4XZQD 3A6NB 2Y2JA 3B0CT 3MNNB 4YM6D 1ZLAB 3X1TD 2HIOD 5E5AD 1P3BD 4QLCC 5AV9D 3UT9B 3X1UC 4WJ3C 1Q9CA 5AY8C 3VH5W 4WNNA 5CP6A 1P3MB 3W96B 4XUJA 5B0ZC 3C1CC 4ZBJB 5G49A 4KHAB 3WAAC 3AZGC 5B32B 1N1JB 3TU4C 3B0DB 1TAFB 1TZYC 2F2AC 1AOIB 5F99A 2BYMA 2NZDA 1M18A 4G92C 3KUYB 5B2IC 1P3OA 3IP4C 2Y2IA 3AV1D 2J8PA 3O62D 2LY8A 1Z2CB 4WU9C 3WKJB 1BH9B 3AZEA 5C3IB 3AZHC 3MGPB 5AV5A 1P3KB 1M1AC 3P5JB 4QLCD 3X1UD 5AY8D 2IO5B 1KX5C 4J8WC 5B0ZD 3MGSA 1KX3A 3WAAD 2JSSA 2ZY3A 3AZGD 3TU4D 3R45B 4KUDB 1TZYD 2CV5C 5B40A 3B6FA 3W97C 4YS3A 1EQZC 3NQUB 5B2ID 3KWQA 4H9PB 3AN2A 2FFFB 4WU9D 3V9RB 1F66C 4Z5TA 3AZHD 5AV6A 5GT0B 4UPKA 1M1AD 5B1LB 5JA4A 5AVCC 3MVDD 4JJNA 5GT3C 1P3PC 3AZFA 1KX5D 4J8WD 5B0YA 3AZMB 2F8NK 3X1SC 1KX4C 4X23A 1P3FC 5AVBC 1U35B 2CV5D 4J8VA 5B31A 3W97D 4Z2MG 3RELB 1EQZD 5B1MC 3AYWC 3UTBB 5CPJB 2NQBB 4R8PB 4ZUXD 3KXBA 4NE3A 3LZ1B 1F66D 2ZY5A 2PYOA 2Y2NA 5B2JB 4E45A 2AROC 5AVCD 3REHB 5GT3D 5DNNC 1P3AA 1P3PD 1P3GA 5CPIC 3WTPB 3LJAC 5BO0A 3X1SD 3REIC 4H9SA 1KX4D 3A6NC 3MNNC 1P3IB 1P3FD 5AVBD 1ZLAC 3NQJA 2Y2HA 3UT9C 5B1MD 3AYWD 1P3MC 3W96C 4J8UB 3REJA 3C1BA 3AZNB 4J8XB 4ZBJC 5B33A 1P3LA 5CPKB 3AZKA 2F8NA 3LELC 5B32C 2AROD 3B0DC 3AV2B 1S32B 5DNND 3UTAB 2BYKB 1AOIC 5DNMB 5CPID 3LJAD 3KUYC 3LZ0A 4Z66A 3WA9A 4KGCB 4LD9B 3REID 3A6ND 5C3IC 3MNND 3B0BA 1P34A 1ZLAD 1P3KC 1M19B 3UT9D 1P3MD 3W96D 2IO5C 3AFAA 2HUEB 1P3BC 5B32D 3AZIA 4WU8B 3REKB 3AZJA 4KUDC 4H9NA 1AOID 1ID3A 3C1BB 3W98A 4Z2MH 3WKJD 3VH6W 4CSRA 3W99B 3MGPD 4AWLB 5GT0C 1HQ3A 1P3KD 5B1LC 3AV1C 5BNXB 4DRAA 2ZM5A 3AZMC 1BH8A 5BS7C 3X1VA 2Y2PA 4H9RB 3B6GA 4H9QA 5B24A 3EG5B 3AZLA 1U35C 4KUDD 3MGQB 3UTBC 5CPJC 4UUZB 5KDMB 4EO5B 2NQBC 2YFVB 4CAYB 1BFMA 5FUGA 4R8PC 5GXQA 3LZ1C 5GT0D 4XZQA 5B2JC 1B67A 5AV8B 4YM6A 2FJ7B 5B1LD 5JRGA 3REHC 3X1TA 2HIOA 5E5AA 5AV9A 1WWSA 5GSUB 3WTPC 3AZMD 2G5IC 3MVDC 3MGRB 1P3IC 1U35D 2YFWA 3RELD 4J8UC 5CPJD 2G5HC 3UTBD 3AZNC 1WWIA 2NQBD 4J8XC 4R8PD 5CP6B 4WNNB 3LZ1D 3O62A 5CPKC 4XUJB 5B2JD 3H0RC 5G49B 3REHD 3AV2C 1S32C 3UTAC 4ZUXC 5DNMC 4QLCA 2XD5A 3X1UA 3WTPD 4DQYB 5AY8A 4KGCC 5F99B 2BYMB 4LD9C 5B0ZA 2NZDB 3C1CA 2JE5A 1M18B 1P3ID 1P3OB 5JRGB 3WAAA 3AZGA 3TU4A 3AZEB 1M19C 2UWXA 1TZYA 5AV5B 4J8UD 3AZND 2HUEC 5B2IA 2VQRA 4J8XD 4WU9A 5CPKD 4HGAB 3MGSB 5BNVA 3AZHA 1JFIA 3REKC 4WU8C 1KX3B 5B31G 3AV2D 1S32D 1M1AA 3UTAD 1H3OA 1B6WA 5DNMD 5B40B 1KX5A 4J8WA 3B6FB 4KGCD 4LD9D 1PZRA 4YS3B 2Y2MA 2Y2LA 3W99C 3KWQB 2BG1A 3AN2B 4AWLC 1M19D 4Z5TB 3A1IA 2W8SA 5AV6B 2CV5A 2Y2QA 3W97A 5JA4B 1EQZA 3C1CB 4JJNB 3AZFB 5B0YB 1F66A 3REKD 4WU8D 4X23B 5AVCA 3C1BD 5GT3A 3MGQC 1P3PA 4J8VB 4EO5C 3WTPE 5B31B 3W99D 1HTAA 3B0CW 3X1SA 2F8NG 1KX4A 5AV8C 3KXBB 2FJ7C 1P3FA 5AVBA 3WKJC 2PYOB 1F1EA 1W2EA 3MGPC 5GSUC 2DQNC 5B1MA 3AYWA 1P3AB 1P34D 1P3GB 3MGRC 5BO0B 2AROA 2XD1A 5DNNA 4G91B 3MGQD 3AL0C 3NQJB 5CPIA 3EPHA 3LJAA 5CP6C 3REJB 3REIA 3A6NA 4XUJC 5AV8D 3MNNA 5B33B 1P3LB 2FJ7D 1T3UA 1ZLAA 3AZKB 2F8NB 3UT9A 5GSUD 4NE6A 1KU5A 1P3MA 3W96A 5F99C 4H9OA 2NZDC 3MGRD 1M18C 1P3OC 3LZ0B 4KHAA 4Z66B 3WA9B 3LELA 5B32A 1N1JA 3AZEC 1P34B 1TAFA 5AV5C 1AOIA 3KUYA 5CP6D 3AFAB 3EPJA 3RELC 4HGAC 4XUJD 5BT1C 3MGSC 3H0LC 1KX3C 1P3KA 3AZIB 3AZJB 2ZY2A 4H9NB 1R4VA 2L5AA 5F99D 5B40C 1ID3B 3B6FC 3KFUG 2NZDD 4YS3C 2Y2OA 1M18D 3W98B 3KSYA 3KWQC 1P3BA 1P3OD 5JRGD 3AN2C 2F8NH 3AZED 4CSRB 4Z5TC 2Y2GA 3R45A 5AV5D 5AV6C 4KUDA 3A1KA 1HQ3B 4H9OB 3NQUA 4H9PA 4JJNC 3AZFC 3V9RA 5B0YC 1ULYA 5BT1D 3LELB 3MGSD 1BH8B 3X1VB 1KX3D 3FDDA 5GT0A 3B6GB 4X23C 4H9QB 5B1LA 3AV1A 5B24B 3AZLB 3VH6A 5B40D 3B6FD 4J8VC 5B31C 3AZMA 4YS3D 5BS7A 3KWQD 4E44A 3AN2D 5FUGB 3KXBC 4Z5TD 5GXQB 3VH6T 5AV6D 1U35A 2PYOC 4XZQB 4YM6B 3RELA 3H0MC 3C1CD 3X1TB 2HIOB 5E5AB 4JJND 3UTBA 5CPJA 1P3AC 3AZFD 1P3GC 3VH5A 5AV9B 1P3BB 2NQBA 5B0YD 4R8PA 3LZ1A 3EPKA 5B2JA 4H9SC 4X23D 3REHA 3VH5T 4G91C 2YFWB 3WTPA 4J8VD 5B31D 3REJC 3MVDA 3EPLA 3C1BC 1P3IA 4DRBA 3KXBD 5B33C 3AV1B 1P3LC 3O62B 3AZKC 2PYOD 2JCHA 4J8UA 1P3AD 3AZNA 1P3GD 4QLCB 3X1UB 4J8XA 5AY8B 5CPKA 3LZ0C 4Z66C 3WA9C 5B0ZB 1P34C 3AV2A 1S32A 3WAAB 3UTAA 4ZUXA 2BYKA 3AZGB 2ZY4A 5DNMA 3TU4B 4NE5A 1TZYB 4KGCA 4LD9A 3REJD 3AFAC 4G92B 5B2IB 5B33D 1P3LD 4WU9B 3AZKD 1M19A 2F8ND 5BNVB 3AZHB 1JFIB 3AZIC 4M6BA 3AZJC 1M1AB 1H3OB 1ID3C 2Y2KA 3MVDB 3W98C 3LZ0D 4Z66D 2RIQA 3WA9D 1KX5B 4J8WB 4WU8A 3REKA 1HQ3C 3F6TA 2DF4C 2CV5B 3AFAD 3W97B 1EQZB 3W99A 3X1VC 4WZSB 2CWEA 4NFTA 4ZUXB 1F66B 3B6GC 5BNXA 5B24C 3AZID 3AZLC 3AZJD 1ID3D 5AVCB 5GT3B 1P3PB 3W98D 4H9RA 5GXQC 3X1SB 2RVQC 1KX4B 4XZQC 1HQ3D 4YM6C 4WV4B 5JRGC 5AVBB 1P3FB 3MGQA 3X1TC 2HIOC 5E5AC 4UUZA 5KDMA 2YFVA 4CAYA 5AV9C 5B1MB 3LELD 5B32G 3AYWB 3X1VD 5AV8A 3B6GD 2FJ7A 5B24D 3WKJA 3AZLD 3KUYD 1BH9A 2AROB 3MGPA 5GSUA 5DNNB 5CPIB 5CHLB 3MGRA 3LJAB 5GXQD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3O62 C;  1A7W A;  2RVQ D;  3REI B;  4XZQ D;  3A6N B;  3B0C T;  3MNN B;  4YM6 D;  1ZLA B;  3X1T D;  2HIO D;  5E5A D;  1P3B D;  4QLC C;  5AV9 D;  3UT9 B;  3X1U C;  1Q9C A;  5AY8 C;  3VH5 W;  4WNN A;  5CP6 A;  1P3M B;  3W96 B;  4XUJ A;  5B0Z C;  3C1C C;  4ZBJ B;  5G49 A;  4KHA B;  3WAA C;  3AZG C;  5B32 B;  1N1J B;  3TU4 C;  3B0D B;  1TAF B;  1TZY C;  1AOI B;  5F99 A;  2BYM A;  2NZD A;  1M18 A;  4G92 C;  3KUY B;  5B2I C;  1P3O A;  3AV1 D;  4WU9 C;  3O62 D;  2LY8 A;  3WKJ B;  1BH9 B;  3AZE A;  5C3I B;  3AZH C;  3MGP B;  5AV5 A;  1P3K B;  1M1A C;  4QLC D;  3X1U D;  5AY8 D;  2IO5 B;  1KX5 C;  4J8W C;  5B0Z D;  3MGS A;  1KX3 A;  3WAA D;  2JSS A;  3AZG D;  3TU4 D;  3R45 B;  4KUD B;  1TZY D;  2CV5 C;  5B40 A;  3B6F A;  3W97 C;  4YS3 A;  1EQZ C;  3NQU B;  5B2I D;  3KWQ A;  4H9P B;  3AN2 A;  4WU9 D;  3V9R B;  1F66 C;  4Z5T A;  3AZH D;  5AV6 A;  5GT0 B;  1M1A D;  5B1L B;  5JA4 A;  5AVC C;  3MVD D;  4JJN A;  5GT3 C;  1P3P C;  3AZF A;  1KX5 D;  4J8W D;  5B0Y A;  3AZM B;  2F8N K;  3X1S C;  1KX4 C;  4X23 A;  1P3F C;  5AVB C;  1U35 B;  2CV5 D;  4J8V A;  5B31 A;  3W97 D;  4Z2M G;  3REL B;  1EQZ D;  5B1M C;  3AYW C;  3UTB B;  5CPJ B;  2NQB B;  4R8P B;  4ZUX D;  3KXB A;  4NE3 A;  3LZ1 B;  1F66 D;  2PYO A;  5B2J B;  4E45 A;  2ARO C;  5AVC D;  3REH B;  5GT3 D;  5DNN C;  1P3A A;  1P3P D;  1P3G A;  5CPI C;  3WTP B;  3LJA C;  5BO0 A;  3X1S D;  3REI C;  4H9S A;  1KX4 D;  3A6N C;  3MNN C;  1P3I B;  1P3F D;  5AVB D;  1ZLA C;  3NQJ A;  3UT9 C;  5B1M D;  3AYW D;  1P3M C;  3W96 C;  4J8U B;  3REJ A;  3C1B A;  3AZN B;  4J8X B;  4ZBJ C;  5B33 A;  1P3L A;  5CPK B;  3AZK A;  2F8N A;  3LEL C;  5B32 C;  2ARO D;  3B0D C;  3AV2 B;  1S32 B;  5DNN D;  3UTA B;  2BYK B;  1AOI C;  5DNM B;  5CPI D;  3LJA D;  3KUY C;  3LZ0 A;  4Z66 A;  3WA9 A;  4KGC B;  4LD9 B;  3REI D;  3A6N D;  5C3I C;  3MNN D;  3B0B A;  1P34 A;  1ZLA D;  1P3K C;  1M19 B;  3UT9 D;  1P3M D;  3W96 D;  2IO5 C;  3AFA A;  2HUE B;  1P3B C;  5B32 D;  3AZI A;  4WU8 B;  3REK B;  3AZJ A;  4KUD C;  4H9N A;  1AOI D;  1ID3 A;  3C1B B;  3W98 A;  4Z2M H;  3WKJ D;  3VH6 W;  4CSR A;  3W99 B;  3MGP D;  4AWL B;  5GT0 C;  1HQ3 A;  1P3K D;  5B1L C;  3AV1 C;  5BNX B;  4DRA A;  3AZM C;  1BH8 A;  5BS7 C;  3X1V A;  4H9R B;  3B6G A;  4H9Q A;  5B24 A;  3AZL A;  1U35 C;  4KUD D;  3MGQ B;  3UTB C;  5CPJ C;  4UUZ B;  5KDM B;  4EO5 B;  2NQB C;  2YFV B;  4CAY B;  1BFM A;  5FUG A;  4R8P C;  5GXQ A;  3LZ1 C;  5GT0 D;  4XZQ A;  5B2J C;  1B67 A;  5AV8 B;  4YM6 A;  2FJ7 B;  5B1L D;  5JRG A;  3REH C;  3X1T A;  2HIO A;  5E5A A;  5AV9 A;  1WWS A;  5GSU B;  3WTP C;  3AZM D;  3MVD C;  3MGR B;  1P3I C;  1U35 D;  2YFW A;  3REL D;  4J8U C;  5CPJ D;  3UTB D;  3AZN C;  1WWI A;  2NQB D;  4J8X C;  4R8P D;  5CP6 B;  4WNN B;  3LZ1 D;  3O62 A;  5CPK C;  5B2J D;  4XUJ B;  5G49 B;  3REH D;  3AV2 C;  1S32 C;  3UTA C;  4ZUX C;  4QLC A;  5DNM C;  3X1U A;  3WTP D;  5AY8 A;  4KGC C;  5F99 B;  2BYM B;  4LD9 C;  5B0Z A;  2NZD B;  3C1C A;  1M18 B;  1P3I D;  1P3O B;  5JRG B;  3WAA A;  3AZG A;  3TU4 A;  3AZE B;  1M19 C;  5AV5 B;  1TZY A;  4J8U D;  3AZN D;  2HUE C;  5B2I A;  4J8X D;  4WU9 A;  5CPK D;  4HGA B;  3MGS B;  5BNV A;  3AZH A;  1JFI A;  3REK C;  4WU8 C;  1KX3 B;  5B31 G;  3AV2 D;  1S32 D;  1M1A A;  3UTA D;  1H3O A;  1B6W A;  5DNM D;  5B40 B;  1KX5 A;  4J8W A;  3B6F B;  4KGC D;  4LD9 D;  4YS3 B;  3W99 C;  3KWQ B;  3AN2 B;  4AWL C;  1M19 D;  4Z5T B;  5AV6 B;  2CV5 A;  3W97 A;  5JA4 B;  1EQZ A;  3C1C B;  4JJN B;  3AZF B;  5B0Y B;  1F66 A;  3REK D;  4WU8 D;  4X23 B;  5AVC A;  3C1B D;  5GT3 A;  3MGQ C;  1P3P A;  4J8V B;  4EO5 C;  3WTP E;  5B31 B;  3W99 D;  1HTA A;  3B0C W;  3X1S A;  2F8N G;  1KX4 A;  5AV8 C;  3KXB B;  2FJ7 C;  1P3F A;  5AVB A;  3WKJ C;  2PYO B;  1F1E A;  3MGP C;  5GSU C;  5B1M A;  3AYW A;  1P3A B;  1P34 D;  1P3G B;  3MGR C;  5BO0 B;  2ARO A;  5DNN A;  4G91 B;  3MGQ D;  3NQJ B;  5CPI A;  3LJA A;  5CP6 C;  3REJ B;  3REI A;  3A6N A;  4XUJ C;  5AV8 D;  3MNN A;  5B33 B;  1P3L B;  2FJ7 D;  1ZLA A;  3AZK B;  2F8N B;  3UT9 A;  5GSU D;  4NE6 A;  1KU5 A;  1P3M A;  3W96 A;  5F99 C;  4H9O A;  2NZD C;  3MGR D;  1M18 C;  1P3O C;  3LZ0 B;  4KHA A;  4Z66 B;  3WA9 B;  3LEL A;  5B32 A;  1N1J A;  3AZE C;  1P34 B;  1TAF A;  5AV5 C;  1AOI A;  3KUY A;  5CP6 D;  3AFA B;  3REL C;  4HGA C;  4XUJ D;  5BT1 C;  3MGS C;  1KX3 C;  1P3K A;  3AZI B;  3AZJ B;  4H9N B;  1R4V A;  2L5A A;  5F99 D;  5B40 C;  1ID3 B;  3B6F C;  2NZD D;  4YS3 C;  1M18 D;  3W98 B;  3KSY A;  3KWQ C;  1P3B A;  1P3O D;  5JRG D;  3AN2 C;  2F8N H;  3AZE D;  4CSR B;  4Z5T C;  3R45 A;  5AV5 D;  5AV6 C;  4KUD A;  1HQ3 B;  4H9O B;  3NQU A;  4H9P A;  4JJN C;  3AZF C;  3V9R A;  5B0Y C;  1ULY A;  5BT1 D;  3LEL B;  3MGS D;  1BH8 B;  3X1V B;  1KX3 D;  5GT0 A;  3B6G B;  4X23 C;  4H9Q B;  5B1L A;  3AV1 A;  5B24 B;  3AZL B;  3VH6 A;  5B40 D;  3B6F D;  4J8V C;  5B31 C;  3AZM A;  4YS3 D;  5BS7 A;  3KWQ D;  4E44 A;  3AN2 D;  5FUG B;  3KXB C;  4Z5T D;  5GXQ B;  3VH6 T;  5AV6 D;  1U35 A;  2PYO C;  4XZQ B;  4YM6 B;  3REL A;  3C1C D;  3X1T B;  2HIO B;  5E5A B;  4JJN D;  3UTB A;  5CPJ A;  1P3A C;  3AZF D;  1P3G C;  3VH5 A;  5AV9 B;  1P3B B;  2NQB A;  5B0Y D;  4R8P A;  3LZ1 A;  5B2J A;  4H9S C;  4X23 D;  3REH A;  3VH5 T;  4G91 C;  2YFW B;  3WTP A;  4J8V D;  5B31 D;  3REJ C;  3MVD A;  3C1B C;  1P3I A;  4DRB A;  3KXB D;  5B33 C;  3AV1 B;  1P3L C;  3O62 B;  3AZK C;  2PYO D;  4J8U A;  1P3A D;  3AZN A;  1P3G D;  4QLC B;  3X1U B;  4J8X A;  5AY8 B;  5CPK A;  3LZ0 C;  4Z66 C;  3WA9 C;  5B0Z B;  1P34 C;  3AV2 A;  1S32 A;  3WAA B;  3UTA A;  4ZUX A;  2BYK A;  3AZG B;  5DNM A;  3TU4 B;  4NE5 A;  1TZY B;  4KGC A;  4LD9 A;  3REJ D;  3AFA C;  4G92 B;  5B2I B;  5B33 D;  1P3L D;  4WU9 B;  3AZK D;  1M19 A;  2F8N D;  5BNV B;  3AZH B;  1JFI B;  3AZI C;  4M6B A;  3AZJ C;  1M1A B;  1H3O B;  1ID3 C;  3MVD B;  3W98 C;  3LZ0 D;  4Z66 D;  3WA9 D;  1KX5 B;  4J8W B;  4WU8 A;  3REK A;  1HQ3 C;  2CV5 B;  3AFA D;  3W97 B;  1EQZ B;  3W99 A;  3X1V C;  4WZS B;  2CWE A;  4NFT A;  4ZUX B;  1F66 B;  3B6G C;  5BNX A;  5B24 C;  3AZI D;  3AZL C;  3AZJ D;  1ID3 D;  5AVC B;  5GT3 B;  1P3P B;  3W98 D;  4H9R A;  5GXQ C;  3X1S B;  2RVQ C;  1KX4 B;  4XZQ C;  1HQ3 D;  4YM6 C;  4WV4 B;  5JRG C;  5AVB B;  1P3F B;  3MGQ A;  3X1T C;  2HIO C;  5E5A C;  4UUZ A;  5KDM A;  2YFV A;  4CAY A;  5AV9 C;  5B1M B;  3LEL D;  5B32 G;  3AYW B;  3X1V D;  5AV8 A;  3B6G D;  2FJ7 A;  5B24 D;  3WKJ A;  3AZL D;  3KUY D;  1BH9 A;  2ARO B;  3MGP A;  5GSU A;  5DNN B;  5CPI B;  5CHL B;  3MGR A;  3LJA B;  5GXQ D; 
#chains in the Genus database with same CATH topology
 3O62 C;  1A7W A;  2RVQ D;  3REI B;  4XZQ D;  3A6N B;  2Y2J A;  3B0C T;  3MNN B;  4YM6 D;  1ZLA B;  3X1T D;  2HIO D;  5E5A D;  1P3B D;  4QLC C;  5AV9 D;  3UT9 B;  3X1U C;  4WJ3 C;  1Q9C A;  5AY8 C;  3VH5 W;  4WNN A;  5CP6 A;  1P3M B;  3W96 B;  4XUJ A;  5B0Z C;  3C1C C;  4ZBJ B;  5G49 A;  4KHA B;  3WAA C;  3AZG C;  5B32 B;  1N1J B;  3TU4 C;  3B0D B;  1TAF B;  1TZY C;  2F2A C;  1AOI B;  5F99 A;  2BYM A;  2NZD A;  1M18 A;  4G92 C;  3KUY B;  5B2I C;  1P3O A;  3IP4 C;  2Y2I A;  3AV1 D;  2J8P A;  3O62 D;  2LY8 A;  1Z2C B;  4WU9 C;  3WKJ B;  1BH9 B;  3AZE A;  5C3I B;  3AZH C;  3MGP B;  5AV5 A;  1P3K B;  1M1A C;  3P5J B;  4QLC D;  3X1U D;  5AY8 D;  2IO5 B;  1KX5 C;  4J8W C;  5B0Z D;  3MGS A;  1KX3 A;  3WAA D;  2JSS A;  2ZY3 A;  3AZG D;  3TU4 D;  3R45 B;  4KUD B;  1TZY D;  2CV5 C;  5B40 A;  3B6F A;  3W97 C;  4YS3 A;  1EQZ C;  3NQU B;  5B2I D;  3KWQ A;  4H9P B;  3AN2 A;  2FFF B;  4WU9 D;  3V9R B;  1F66 C;  4Z5T A;  3AZH D;  5AV6 A;  5GT0 B;  4UPK A;  1M1A D;  5B1L B;  5JA4 A;  5AVC C;  3MVD D;  4JJN A;  5GT3 C;  1P3P C;  3AZF A;  1KX5 D;  4J8W D;  5B0Y A;  3AZM B;  2F8N K;  3X1S C;  1KX4 C;  4X23 A;  1P3F C;  5AVB C;  1U35 B;  2CV5 D;  4J8V A;  5B31 A;  3W97 D;  4Z2M G;  3REL B;  1EQZ D;  5B1M C;  3AYW C;  3UTB B;  5CPJ B;  2NQB B;  4R8P B;  4ZUX D;  3KXB A;  4NE3 A;  3LZ1 B;  1F66 D;  2ZY5 A;  2PYO A;  2Y2N A;  5B2J B;  4E45 A;  2ARO C;  5AVC D;  3REH B;  5GT3 D;  5DNN C;  1P3A A;  1P3P D;  1P3G A;  5CPI C;  3WTP B;  3LJA C;  5BO0 A;  3X1S D;  3REI C;  4H9S A;  1KX4 D;  3A6N C;  3MNN C;  1P3I B;  1P3F D;  5AVB D;  1ZLA C;  3NQJ A;  2Y2H A;  3UT9 C;  5B1M D;  3AYW D;  1P3M C;  3W96 C;  4J8U B;  3REJ A;  3C1B A;  3AZN B;  4J8X B;  4ZBJ C;  5B33 A;  1P3L A;  5CPK B;  3AZK A;  2F8N A;  3LEL C;  5B32 C;  2ARO D;  3B0D C;  3AV2 B;  1S32 B;  5DNN D;  3UTA B;  2BYK B;  1AOI C;  5DNM B;  5CPI D;  3LJA D;  3KUY C;  3LZ0 A;  4Z66 A;  3WA9 A;  4KGC B;  4LD9 B;  3REI D;  3A6N D;  5C3I C;  3MNN D;  3B0B A;  1P34 A;  1ZLA D;  1P3K C;  1M19 B;  3UT9 D;  1P3M D;  3W96 D;  2IO5 C;  3AFA A;  2HUE B;  1P3B C;  5B32 D;  3AZI A;  4WU8 B;  3REK B;  3AZJ A;  4KUD C;  4H9N A;  1AOI D;  1ID3 A;  3C1B B;  3W98 A;  4Z2M H;  3WKJ D;  3VH6 W;  4CSR A;  3W99 B;  3MGP D;  4AWL B;  5GT0 C;  1HQ3 A;  1P3K D;  5B1L C;  3AV1 C;  5BNX B;  4DRA A;  2ZM5 A;  3AZM C;  1BH8 A;  5BS7 C;  3X1V A;  2Y2P A;  4H9R B;  3B6G A;  4H9Q A;  5B24 A;  3EG5 B;  3AZL A;  1U35 C;  4KUD D;  3MGQ B;  3UTB C;  5CPJ C;  4UUZ B;  5KDM B;  4EO5 B;  2NQB C;  2YFV B;  4CAY B;  1BFM A;  5FUG A;  4R8P C;  5GXQ A;  3LZ1 C;  5GT0 D;  4XZQ A;  5B2J C;  1B67 A;  5AV8 B;  4YM6 A;  2FJ7 B;  5B1L D;  5JRG A;  3REH C;  3X1T A;  2HIO A;  5E5A A;  5AV9 A;  1WWS A;  5GSU B;  3WTP C;  3AZM D;  2G5I C;  3MVD C;  3MGR B;  1P3I C;  1U35 D;  2YFW A;  3REL D;  4J8U C;  5CPJ D;  2G5H C;  3UTB D;  3AZN C;  1WWI A;  2NQB D;  4J8X C;  4R8P D;  5CP6 B;  4WNN B;  3LZ1 D;  3O62 A;  5CPK C;  4XUJ B;  5B2J D;  3H0R C;  5G49 B;  3REH D;  3AV2 C;  1S32 C;  3UTA C;  4ZUX C;  5DNM C;  4QLC A;  2XD5 A;  3X1U A;  3WTP D;  4DQY B;  5AY8 A;  4KGC C;  5F99 B;  2BYM B;  4LD9 C;  5B0Z A;  2NZD B;  3C1C A;  2JE5 A;  1M18 B;  1P3I D;  1P3O B;  5JRG B;  3WAA A;  3AZG A;  3TU4 A;  3AZE B;  1M19 C;  2UWX A;  1TZY A;  5AV5 B;  4J8U D;  3AZN D;  2HUE C;  5B2I A;  2VQR A;  4J8X D;  4WU9 A;  5CPK D;  4HGA B;  3MGS B;  5BNV A;  3AZH A;  1JFI A;  3REK C;  4WU8 C;  1KX3 B;  5B31 G;  3AV2 D;  1S32 D;  1M1A A;  3UTA D;  1H3O A;  1B6W A;  5DNM D;  5B40 B;  1KX5 A;  4J8W A;  3B6F B;  4KGC D;  4LD9 D;  1PZR A;  4YS3 B;  2Y2M A;  2Y2L A;  3W99 C;  3KWQ B;  2BG1 A;  3AN2 B;  4AWL C;  1M19 D;  4Z5T B;  3A1I A;  2W8S A;  5AV6 B;  2CV5 A;  2Y2Q A;  3W97 A;  5JA4 B;  1EQZ A;  3C1C B;  4JJN B;  3AZF B;  5B0Y B;  1F66 A;  3REK D;  4WU8 D;  4X23 B;  5AVC A;  3C1B D;  5GT3 A;  3MGQ C;  1P3P A;  4J8V B;  4EO5 C;  3WTP E;  5B31 B;  3W99 D;  1HTA A;  3B0C W;  3X1S A;  2F8N G;  1KX4 A;  5AV8 C;  3KXB B;  2FJ7 C;  1P3F A;  5AVB A;  3WKJ C;  2PYO B;  1F1E A;  1W2E A;  3MGP C;  5GSU C;  2DQN C;  5B1M A;  3AYW A;  1P3A B;  1P34 D;  1P3G B;  3MGR C;  5BO0 B;  2ARO A;  2XD1 A;  5DNN A;  4G91 B;  3MGQ D;  3AL0 C;  3NQJ B;  5CPI A;  3EPH A;  3LJA A;  5CP6 C;  3REJ B;  3REI A;  3A6N A;  4XUJ C;  5AV8 D;  3MNN A;  5B33 B;  1P3L B;  2FJ7 D;  1T3U A;  1ZLA A;  3AZK B;  2F8N B;  3UT9 A;  5GSU D;  4NE6 A;  1KU5 A;  1P3M A;  3W96 A;  5F99 C;  4H9O A;  2NZD C;  3MGR D;  1M18 C;  1P3O C;  3LZ0 B;  4KHA A;  4Z66 B;  3WA9 B;  3LEL A;  5B32 A;  1N1J A;  3AZE C;  1P34 B;  1TAF A;  5AV5 C;  1AOI A;  3KUY A;  5CP6 D;  3AFA B;  3EPJ A;  3REL C;  4HGA C;  4XUJ D;  5BT1 C;  3MGS C;  3H0L C;  1KX3 C;  1P3K A;  3AZI B;  3AZJ B;  2ZY2 A;  4H9N B;  1R4V A;  2L5A A;  5F99 D;  5B40 C;  1ID3 B;  3B6F C;  3KFU G;  2NZD D;  4YS3 C;  2Y2O A;  1M18 D;  3W98 B;  3KSY A;  3KWQ C;  1P3B A;  1P3O D;  5JRG D;  3AN2 C;  2F8N H;  3AZE D;  4CSR B;  4Z5T C;  2Y2G A;  3R45 A;  5AV5 D;  5AV6 C;  4KUD A;  3A1K A;  1HQ3 B;  4H9O B;  3NQU A;  4H9P A;  4JJN C;  3AZF C;  3V9R A;  5B0Y C;  1ULY A;  5BT1 D;  3LEL B;  3MGS D;  1BH8 B;  3X1V B;  1KX3 D;  3FDD A;  5GT0 A;  3B6G B;  4X23 C;  4H9Q B;  5B1L A;  3AV1 A;  5B24 B;  3AZL B;  3VH6 A;  5B40 D;  3B6F D;  4J8V C;  5B31 C;  3AZM A;  4YS3 D;  5BS7 A;  3KWQ D;  4E44 A;  3AN2 D;  5FUG B;  3KXB C;  4Z5T D;  5GXQ B;  3VH6 T;  5AV6 D;  1U35 A;  2PYO C;  4XZQ B;  4YM6 B;  3REL A;  3H0M C;  3C1C D;  3X1T B;  2HIO B;  5E5A B;  4JJN D;  3UTB A;  5CPJ A;  1P3A C;  3AZF D;  1P3G C;  3VH5 A;  5AV9 B;  1P3B B;  2NQB A;  5B0Y D;  4R8P A;  3LZ1 A;  3EPK A;  5B2J A;  4H9S C;  4X23 D;  3REH A;  3VH5 T;  4G91 C;  2YFW B;  3WTP A;  4J8V D;  5B31 D;  3REJ C;  3MVD A;  3EPL A;  3C1B C;  1P3I A;  4DRB A;  3KXB D;  5B33 C;  3AV1 B;  1P3L C;  3O62 B;  3AZK C;  2PYO D;  2JCH A;  4J8U A;  1P3A D;  3AZN A;  1P3G D;  4QLC B;  3X1U B;  4J8X A;  5AY8 B;  5CPK A;  3LZ0 C;  4Z66 C;  3WA9 C;  5B0Z B;  1P34 C;  3AV2 A;  1S32 A;  3WAA B;  3UTA A;  4ZUX A;  2BYK A;  3AZG B;  2ZY4 A;  5DNM A;  3TU4 B;  4NE5 A;  1TZY B;  4KGC A;  4LD9 A;  3REJ D;  3AFA C;  4G92 B;  5B2I B;  5B33 D;  1P3L D;  4WU9 B;  3AZK D;  1M19 A;  2F8N D;  5BNV B;  3AZH B;  1JFI B;  3AZI C;  4M6B A;  3AZJ C;  1M1A B;  1H3O B;  1ID3 C;  2Y2K A;  3MVD B;  3W98 C;  3LZ0 D;  4Z66 D;  2RIQ A;  3WA9 D;  1KX5 B;  4J8W B;  4WU8 A;  3REK A;  1HQ3 C;  3F6T A;  2DF4 C;  2CV5 B;  3AFA D;  3W97 B;  1EQZ B;  3W99 A;  3X1V C;  4WZS B;  2CWE A;  4NFT A;  4ZUX B;  1F66 B;  3B6G C;  5BNX A;  5B24 C;  3AZI D;  3AZL C;  3AZJ D;  1ID3 D;  5AVC B;  5GT3 B;  1P3P B;  3W98 D;  4H9R A;  5GXQ C;  3X1S B;  2RVQ C;  1KX4 B;  4XZQ C;  1HQ3 D;  4YM6 C;  4WV4 B;  5JRG C;  5AVB B;  1P3F B;  3MGQ A;  3X1T C;  2HIO C;  5E5A C;  4UUZ A;  5KDM A;  2YFV A;  4CAY A;  5AV9 C;  5B1M B;  3LEL D;  5B32 G;  3AYW B;  3X1V D;  5AV8 A;  3B6G D;  2FJ7 A;  5B24 D;  3WKJ A;  3AZL D;  3KUY D;  1BH9 A;  2ARO B;  3MGP A;  5GSU A;  5DNN B;  5CPI B;  5CHL B;  3MGR A;  3LJA B;  5GXQ D; 
#chains in the Genus database with same CATH homology
 3O62 C;  1A7W A;  2RVQ D;  3REI B;  4XZQ D;  3A6N B;  2Y2J A;  3B0C T;  3MNN B;  4YM6 D;  1ZLA B;  3X1T D;  2HIO D;  5E5A D;  1P3B D;  4QLC C;  5AV9 D;  3UT9 B;  3X1U C;  4WJ3 C;  1Q9C A;  5AY8 C;  3VH5 W;  4WNN A;  5CP6 A;  1P3M B;  3W96 B;  4XUJ A;  5B0Z C;  3C1C C;  4ZBJ B;  5G49 A;  4KHA B;  3WAA C;  3AZG C;  5B32 B;  1N1J B;  3TU4 C;  3B0D B;  1TAF B;  1TZY C;  2F2A C;  1AOI B;  5F99 A;  2BYM A;  2NZD A;  1M18 A;  4G92 C;  3KUY B;  5B2I C;  1P3O A;  3IP4 C;  2Y2I A;  3AV1 D;  2J8P A;  3O62 D;  2LY8 A;  1Z2C B;  4WU9 C;  3WKJ B;  1BH9 B;  3AZE A;  5C3I B;  3AZH C;  3MGP B;  5AV5 A;  1P3K B;  1M1A C;  3P5J B;  4QLC D;  3X1U D;  5AY8 D;  2IO5 B;  1KX5 C;  4J8W C;  5B0Z D;  3MGS A;  1KX3 A;  3WAA D;  2JSS A;  2ZY3 A;  3AZG D;  3TU4 D;  3R45 B;  4KUD B;  1TZY D;  2CV5 C;  5B40 A;  3B6F A;  3W97 C;  4YS3 A;  1EQZ C;  3NQU B;  5B2I D;  3KWQ A;  4H9P B;  3AN2 A;  2FFF B;  4WU9 D;  3V9R B;  1F66 C;  4Z5T A;  3AZH D;  5AV6 A;  5GT0 B;  4UPK A;  1M1A D;  5B1L B;  5JA4 A;  5AVC C;  3MVD D;  4JJN A;  5GT3 C;  1P3P C;  3AZF A;  1KX5 D;  4J8W D;  5B0Y A;  3AZM B;  2F8N K;  3X1S C;  1KX4 C;  4X23 A;  1P3F C;  5AVB C;  1U35 B;  2CV5 D;  4J8V A;  5B31 A;  3W97 D;  4Z2M G;  3REL B;  1EQZ D;  5B1M C;  3AYW C;  3UTB B;  5CPJ B;  2NQB B;  4R8P B;  4ZUX D;  3KXB A;  4NE3 A;  3LZ1 B;  1F66 D;  2ZY5 A;  2PYO A;  2Y2N A;  5B2J B;  4E45 A;  2ARO C;  5AVC D;  3REH B;  5GT3 D;  5DNN C;  1P3A A;  1P3P D;  1P3G A;  5CPI C;  3WTP B;  3LJA C;  5BO0 A;  3X1S D;  3REI C;  4H9S A;  1KX4 D;  3A6N C;  3MNN C;  1P3I B;  1P3F D;  5AVB D;  1ZLA C;  3NQJ A;  2Y2H A;  3UT9 C;  5B1M D;  3AYW D;  1P3M C;  3W96 C;  4J8U B;  3REJ A;  3C1B A;  3AZN B;  4J8X B;  4ZBJ C;  5B33 A;  1P3L A;  5CPK B;  3AZK A;  2F8N A;  3LEL C;  5B32 C;  2ARO D;  3B0D C;  3AV2 B;  1S32 B;  5DNN D;  3UTA B;  2BYK B;  1AOI C;  5DNM B;  5CPI D;  3LJA D;  3KUY C;  3LZ0 A;  4Z66 A;  3WA9 A;  4KGC B;  4LD9 B;  3REI D;  3A6N D;  5C3I C;  3MNN D;  3B0B A;  1P34 A;  1ZLA D;  1P3K C;  1M19 B;  3UT9 D;  1P3M D;  3W96 D;  2IO5 C;  3AFA A;  2HUE B;  1P3B C;  5B32 D;  3AZI A;  4WU8 B;  3REK B;  3AZJ A;  4KUD C;  4H9N A;  1AOI D;  1ID3 A;  3C1B B;  3W98 A;  4Z2M H;  3WKJ D;  3VH6 W;  4CSR A;  3W99 B;  3MGP D;  4AWL B;  5GT0 C;  1HQ3 A;  1P3K D;  5B1L C;  3AV1 C;  5BNX B;  4DRA A;  2ZM5 A;  3AZM C;  1BH8 A;  5BS7 C;  3X1V A;  2Y2P A;  4H9R B;  3B6G A;  4H9Q A;  5B24 A;  3EG5 B;  3AZL A;  1U35 C;  4KUD D;  3MGQ B;  3UTB C;  5CPJ C;  4UUZ B;  5KDM B;  4EO5 B;  2NQB C;  2YFV B;  4CAY B;  1BFM A;  5FUG A;  4R8P C;  5GXQ A;  3LZ1 C;  5GT0 D;  4XZQ A;  5B2J C;  1B67 A;  5AV8 B;  4YM6 A;  2FJ7 B;  5B1L D;  5JRG A;  3REH C;  3X1T A;  2HIO A;  5E5A A;  5AV9 A;  1WWS A;  5GSU B;  3WTP C;  3AZM D;  2G5I C;  3MVD C;  3MGR B;  1P3I C;  1U35 D;  2YFW A;  3REL D;  4J8U C;  5CPJ D;  2G5H C;  3UTB D;  3AZN C;  1WWI A;  2NQB D;  4J8X C;  4R8P D;  5CP6 B;  4WNN B;  3LZ1 D;  3O62 A;  5CPK C;  4XUJ B;  5B2J D;  3H0R C;  5G49 B;  3REH D;  3AV2 C;  1S32 C;  3UTA C;  4ZUX C;  5DNM C;  4QLC A;  2XD5 A;  3X1U A;  3WTP D;  4DQY B;  5AY8 A;  4KGC C;  5F99 B;  2BYM B;  4LD9 C;  5B0Z A;  2NZD B;  3C1C A;  2JE5 A;  1M18 B;  1P3I D;  1P3O B;  5JRG B;  3WAA A;  3AZG A;  3TU4 A;  3AZE B;  1M19 C;  2UWX A;  1TZY A;  5AV5 B;  4J8U D;  3AZN D;  2HUE C;  5B2I A;  2VQR A;  4J8X D;  4WU9 A;  5CPK D;  4HGA B;  3MGS B;  5BNV A;  3AZH A;  1JFI A;  3REK C;  4WU8 C;  1KX3 B;  5B31 G;  3AV2 D;  1S32 D;  1M1A A;  3UTA D;  1H3O A;  1B6W A;  5DNM D;  5B40 B;  1KX5 A;  4J8W A;  3B6F B;  4KGC D;  4LD9 D;  1PZR A;  4YS3 B;  2Y2M A;  2Y2L A;  3W99 C;  3KWQ B;  2BG1 A;  3AN2 B;  4AWL C;  1M19 D;  4Z5T B;  3A1I A;  2W8S A;  5AV6 B;  2CV5 A;  2Y2Q A;  3W97 A;  5JA4 B;  1EQZ A;  3C1C B;  4JJN B;  3AZF B;  5B0Y B;  1F66 A;  3REK D;  4WU8 D;  4X23 B;  5AVC A;  3C1B D;  5GT3 A;  3MGQ C;  1P3P A;  4J8V B;  4EO5 C;  3WTP E;  5B31 B;  3W99 D;  1HTA A;  3B0C W;  3X1S A;  2F8N G;  1KX4 A;  5AV8 C;  3KXB B;  2FJ7 C;  1P3F A;  5AVB A;  3WKJ C;  2PYO B;  1F1E A;  1W2E A;  3MGP C;  5GSU C;  2DQN C;  5B1M A;  3AYW A;  1P3A B;  1P34 D;  1P3G B;  3MGR C;  5BO0 B;  2ARO A;  2XD1 A;  5DNN A;  4G91 B;  3MGQ D;  3AL0 C;  3NQJ B;  5CPI A;  3EPH A;  3LJA A;  5CP6 C;  3REJ B;  3REI A;  3A6N A;  4XUJ C;  5AV8 D;  3MNN A;  5B33 B;  1P3L B;  2FJ7 D;  1T3U A;  1ZLA A;  3AZK B;  2F8N B;  3UT9 A;  5GSU D;  4NE6 A;  1KU5 A;  1P3M A;  3W96 A;  5F99 C;  4H9O A;  2NZD C;  3MGR D;  1M18 C;  1P3O C;  3LZ0 B;  4KHA A;  4Z66 B;  3WA9 B;  3LEL A;  5B32 A;  1N1J A;  3AZE C;  1P34 B;  1TAF A;  5AV5 C;  1AOI A;  3KUY A;  5CP6 D;  3AFA B;  3EPJ A;  3REL C;  4HGA C;  4XUJ D;  5BT1 C;  3MGS C;  3H0L C;  1KX3 C;  1P3K A;  3AZI B;  3AZJ B;  2ZY2 A;  4H9N B;  1R4V A;  2L5A A;  5F99 D;  5B40 C;  1ID3 B;  3B6F C;  3KFU G;  2NZD D;  4YS3 C;  2Y2O A;  1M18 D;  3W98 B;  3KSY A;  3KWQ C;  1P3B A;  1P3O D;  5JRG D;  3AN2 C;  2F8N H;  3AZE D;  4CSR B;  4Z5T C;  2Y2G A;  3R45 A;  5AV5 D;  5AV6 C;  4KUD A;  3A1K A;  1HQ3 B;  4H9O B;  3NQU A;  4H9P A;  4JJN C;  3AZF C;  3V9R A;  5B0Y C;  1ULY A;  5BT1 D;  3LEL B;  3MGS D;  1BH8 B;  3X1V B;  1KX3 D;  3FDD A;  5GT0 A;  3B6G B;  4X23 C;  4H9Q B;  5B1L A;  3AV1 A;  5B24 B;  3AZL B;  3VH6 A;  5B40 D;  3B6F D;  4J8V C;  5B31 C;  3AZM A;  4YS3 D;  5BS7 A;  3KWQ D;  4E44 A;  3AN2 D;  5FUG B;  3KXB C;  4Z5T D;  5GXQ B;  3VH6 T;  5AV6 D;  1U35 A;  2PYO C;  4XZQ B;  4YM6 B;  3REL A;  3H0M C;  3C1C D;  3X1T B;  2HIO B;  5E5A B;  4JJN D;  3UTB A;  5CPJ A;  1P3A C;  3AZF D;  1P3G C;  3VH5 A;  5AV9 B;  1P3B B;  2NQB A;  5B0Y D;  4R8P A;  3LZ1 A;  3EPK A;  5B2J A;  4H9S C;  4X23 D;  3REH A;  3VH5 T;  4G91 C;  2YFW B;  3WTP A;  4J8V D;  5B31 D;  3REJ C;  3MVD A;  3EPL A;  3C1B C;  1P3I A;  4DRB A;  3KXB D;  5B33 C;  3AV1 B;  1P3L C;  3O62 B;  3AZK C;  2PYO D;  2JCH A;  4J8U A;  1P3A D;  3AZN A;  1P3G D;  4QLC B;  3X1U B;  4J8X A;  5AY8 B;  5CPK A;  3LZ0 C;  4Z66 C;  3WA9 C;  5B0Z B;  1P34 C;  3AV2 A;  1S32 A;  3WAA B;  3UTA A;  4ZUX A;  2BYK A;  3AZG B;  2ZY4 A;  5DNM A;  3TU4 B;  4NE5 A;  1TZY B;  4KGC A;  4LD9 A;  3REJ D;  3AFA C;  4G92 B;  5B2I B;  5B33 D;  1P3L D;  4WU9 B;  3AZK D;  1M19 A;  2F8N D;  5BNV B;  3AZH B;  1JFI B;  3AZI C;  4M6B A;  3AZJ C;  1M1A B;  1H3O B;  1ID3 C;  2Y2K A;  3MVD B;  3W98 C;  3LZ0 D;  4Z66 D;  2RIQ A;  3WA9 D;  1KX5 B;  4J8W B;  4WU8 A;  3REK A;  1HQ3 C;  3F6T A;  2DF4 C;  2CV5 B;  3AFA D;  3W97 B;  1EQZ B;  3W99 A;  3X1V C;  4WZS B;  2CWE A;  4NFT A;  4ZUX B;  1F66 B;  3B6G C;  5BNX A;  5B24 C;  3AZI D;  3AZL C;  3AZJ D;  1ID3 D;  5AVC B;  5GT3 B;  1P3P B;  3W98 D;  4H9R A;  5GXQ C;  3X1S B;  2RVQ C;  1KX4 B;  4XZQ C;  1HQ3 D;  4YM6 C;  4WV4 B;  5JRG C;  5AVB B;  1P3F B;  3MGQ A;  3X1T C;  2HIO C;  5E5A C;  4UUZ A;  5KDM A;  2YFV A;  4CAY A;  5AV9 C;  5B1M B;  3LEL D;  5B32 G;  3AYW B;  3X1V D;  5AV8 A;  3B6G D;  2FJ7 A;  5B24 D;  3WKJ A;  3AZL D;  3KUY D;  1BH9 A;  2ARO B;  3MGP A;  5GSU A;  5DNN B;  5CPI B;  5CHL B;  3MGR A;  3LJA B;  5GXQ D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...