3KUYA

Dna stretching in the nucleosome facilitates alkylation by an intercalating antitumor agent
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
96
structure length
96
Chain Sequence
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.2
publication title DNA stretching in the nucleosome facilitates alkylation by an intercalating antitumour agent
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Structural protein/dna
total genus 29
structure length 96
sequence length 96
chains with identical sequence E
ec nomenclature
pdb deposition date 2009-11-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3kuyA00
5B1MA 4Z2MG 3AZED 5B33B 5AVBD 3MGPC 1M1AB 5DNNA 3LELD 3AZHA 3LJAD 4ZBJB 5DNMD 5AV6B 3C1CA 1P3IB 1ZLAC 4CSRA 4XZQA 1P3PA 3AN2C 3MGQC 2BYMB 1P3BB 3KSYA 4XUJB 5B40C 4KUDD 5F99B 2NQBB 3X1TB 2HIOA 3AZLB 5AV5A 4AWLB 4J8XB 5B31A 3A6NB 4WNNA 3MNNC 5B24B 3AZMC 4J8WC 3WA9D 4NFTA 3W96A 2YFWA 4H9OA 5JA4B 3V9RB 1N1JA 5BNVA 2F8ND 3WAAB 5CPIC 3WTPC 2CV5D 3AV1A 2PYOA 3RELD 5B32D 3LZ0A 3KWQB 2BYKB 1M18C 4EO5B 3AZHB 3X1VD 4ZUXB 1P3FA 3UT9C 4Z66D 3AV2D 5B0YA 4QLCD 5CPJD 4G92B 1F66B 2L5AA 1P3OD 4XZQB 5AV9C 3TU4A 1P3PB 3REJD 3AZGD 2FJ7A 5GSUA 1P3MC 3C1BC 5AV8A 3KUYC 3AN2B 5AY8B 5B31B 3R45B 3REHA 4R8PA 4H9SC 5B0ZA 1P3GC 2NZDC 3VH6W 3REKD 1HQ3D 1P34C 3B6FD 5B1MD 3B6GC 2JSSA 3X1UC 5DNND 4WZSB 5GT3D 3MNNB 3AYWD 3AZMB 4X23C 4J8WB 1P3KD 4H9OB 3C1CD 4WU8C 3AZJC 2AROD 5BNVB 5AVBC 3LELC 3LJAC 3AV1B 2PYOB 3UTBA 1BH9A 5B2JD 3W97A 4WU9D 4CAYB 3AZKA 1P3LA 3WTPB 3X1SD 2HIOD 3W99D 5AV5D 3REID 2F8NH 5E5AA 5B0YB 3MVDA 4J8VA 1M18B 1M1AA 1KX5D 1S32D 4KUDC 1Q9CA 3TU4B 4YS3B 5AV6A 1P3IA 3UT9B 3W98B 1TZYC 2BYMA 3AZFB 3AZIA 3W96D 1P3BA 3LZ1A 5AV8B 4XUJA 3WA9C 2NQBA 5F99A 4R8PB 5B0ZB 3AZNB 2RVQD 4DRAA 4J8XA 1ID3A 1KU5A 1WWSA 3RELC 5B2IA 1P3FD 5B32C 4E45A 3KXBC 5JA4A 3X1VC 4J8UA 5AVCD 3V9RA 4Z66C 3AV2C 4QLCC 5CPJC 5B1LD 1KX3D 2FJ7D 3AZJB 5GSUD 4HGAB 1AOIB 3W97B 5AVBB 1P3OC 1P3LB 3REJC 2BYKA 5E5AB 3MVDB 4J8VB 4LD9A 3WKJD 4ZUXA 3AFAC 1F66A 4G91C 5JRGD 3MGPA 3UTAC 3REKC 1HQ3C 3AZIB 3LZ1B 5B1MC 2IO5B 5DNNC 5GT3C 1TZYB 3MGQA 3AYWC 3AN2A 5AY8A 1P3KC 3R45A 4JJND 1ID3B 4KGCB 5CPKD 5GT0D 2AROC 3AZKD 5CP6D 1M19D 2LY8A 1KX4D 4Z5TB 5B2IB 5C3IC 5B33D 3MGSC 3O62C 1M1AD 5GXQC 5B2JC 3MNNA 4WU9C 3AZMA 4J8WA 3X1SC 4DRBA 2HIOC 3W99C 5AV6D 3REIC 4J8UB 1P3ID 1KX5C 1S32C 4YM6C 1U35B 3KXBB 4UUZA 4XUJD 4H9RB 2NQBD 3VH5W 4CAYA 5CPIA 5CPJB 5BT1D 3X1TD 3WTPA 3AZLD 4LD9B 1P3AC 3W96C 4J8XD 3A6ND 5B24D 1M18A 4H9NB 3MGPB 4YS3A 2RVQC 3AFAB 3UT9A 3W98A 1EQZD 4G91B 4KHAA 4WV4B 1ZLAB 3AZFA 5AV9A 3UTAB 3MGQB 3MGRC 1H3OB 3WAAD 3AZNA 5B40B 1P3MA 3KWQD 5GT3B 5AVCC 5B1LC 1KX3C 1BFMA 5GSUC 4H9SA 3AZHD 1P3GA 2NZDA 1P34A 1F66D 3AZEC 3MGSB 4XZQD 1P3PD 3O62B 3X1UA 5GXQB 3NQUA 3WKJC 4X23A 5DNMC 4WU8A 4UUZB 3REIB 3AZJA 1AOIA 5JRGC 5AVBA 5CPIB 3AN2D 4YM6B 5AY8D 5B31D 4E44A 1P3AB 4JJNC 5CPKC 5GT0C 4KHAB 5CP6C 3AZMD 1M19C 1ULYA 3B0CW 1KX4C 5AV9B 5B32G 5B33C 3VH6T 1M1AC 1TZYA 3AV1D 2PYOD 4ZBJC 1P3MB 3LZ0D 5BS7C 3C1BB 3KUYB 4KGCA 3MGRB 1F1EA 3WA9A 2CV5C 2CWEA 4Z5TA 1P3GB 2NZDB 1P34B 5B0YD 4NE5A 4XUJC 3B6GB 4YS3D 3TU4D 3X1TC 1KX3B 3X1UB 3AZLC 3NQUB 4M6BA 1WWIA 4X23B 3UT9D 3W98D 5B32A 3A6NC 4WU8B 5B24C 3AZEB 3NQJA 3AZFD 1U35A 5AV8D 3KXBA 3LELB 3LJAB 5DNMB 4H9RA 4Z66A 3REHD 3AV2A 4QLCA 4R8PD 5CPJA 3AZGC 1EQZC 5B0ZD 3AZND 1P3OA 3REJA 3WAAC 4H9NA 1A7WA 4Z2MH 4KUDB 3KWQC 3AFAA 3B6FC 4H9PB 1ZLAA 5CPKB 4EO5C 3UTAA 3AZHC 1M19B 5BO0A 1H3OA 1HQ3A 3C1CC 4G92C 3REKA 3UTBD 1F66C 3AZJD 1AOID 3W97D 4XZQC 5KDMB 5B40A 1P3LD 1P3PC 3WA9B 5GT3A 3AYWA 1P3KA 5E5AD 3MVDD 1KX4B 1HTAA 3B0DC 4J8VD 2AROA 2F8NB 2CV5B 5AV5C 5AY8C 5B31C 3RELB 1JFIB 5B32B 1BH8A 3MGSA 3O62A 2HUEC 5B2JA 5GXQA 3NQJB 4WU9A 5BNXA 5FUGB 3AZID 1P3BD 3LZ1D 3X1SA 3W99A 3REIA 3X1VB 4Z66B 3AV2B 5F99D 4QLCB 1TZYD 1KX5A 1S32A 4YM6A 1P3OB 1ID3D 4KGCD 3REJB 1EQZB 1B67A 3AZGB 4Z5TD 3AV1C 2PYOC 5B2ID 1P3AA 3LZ0C 4J8UD 5BO0B 3REKB 1HQ3B 5G49A 5B0YC 1P3FC 3B6FB 5B1MB 1U35D 4YS3C 3TU4C 3KXBD 5DNNB 1R4VA 3C1BA 3KUYA 3AYWB 3MGRA 3W98C 1P3KB 3C1CB 2FJ7C 4LD9D 2AROB 3AZFC 4CSRB 4ZUXD 5AV8C 5AVCA 3B6GA 3REHC 5C3IB 1BH8B 4R8PC 5B1LA 3MGPD 3B0DB 1KX3A 5B2JB 5B0ZC 1B6WA 3AZNC 4WU9B 5BNXB 4H9QA 3VH5T 3X1SB 2HIOB 3AFAD 5AV5B 3W99B 1ZLAD 3AZEA 4WNNB 3UTAD 3MGQD 1KX5B 2HUEB 3LELA 1S32B 3WKJA 3LJAA 5DNMA 5JRGA 5B40D 2YFVA 3UTBC 3W96B 2YFWB 2F8NG 1AOIC 4HGAC 3MNND 1N1JB 3W97C 3AZKC 1P3LC 4J8WD 4KUDA 4H9PA 5E5AC 5G49B 3LZ0B 3VH5A 3MVDC 3MGSD 4JJNA 3O62D 4J8VC 5CPKA 5GXQD 5GT0A 1TAFA 4NE6A 5CP6A 1M19A 5AV6C 1KX4A 1P3IC 1P3FB 5B33A 5KDMA 5CPID 3WTPD 4YM6D 3WTPE 3AZIC 1P3BC 3LZ1C 2IO5C 5BS7A 5AVCB 1M18D 2F8NA 2NQBC 5F99C 5B1LB 5BT1C 2FJ7B 2CV5A 5GSUB 4AWLC 1P3AD 4J8XC 3B0BA 3RELA 4H9QB 1JFIA 1ID3C 4KGCC 3REHB 3VH6A 5FUGA 5AV9D 4Z5TC 3X1TA 5CHLB 3AZLA 5B2IC 3X1VA 3WKJB 3A6NA 5B24A 5JRGB 1P3MD 2YFVB 3KUYD 3C1BD 4J8UC 3MGRD 3B0CT 1EQZA 3AZGA 1U35C 1P3GD 2NZDD 1P34D 3B6GD 3UTBB 1BH9B 3WAAA 4JJNB 3X1UD 5GT0B 4LD9C 1TAFB 3AZKB 5CP6B 4NE3A 4ZUXC 4X23D 2F8NK 3KWQA 5B31G 4WU8D 3B6FA
chains in the Genus database with same CATH superfamily
5B1MA 4Z2MG 3AZED 5B33B 5AVBD 3MGPC 1M1AB 5DNNA 3LELD 3AZHA 3LJAD 4ZBJB 5DNMD 5AV6B 3C1CA 1P3IB 1ZLAC 2VQRA 4CSRA 4XZQA 1P3PA 3AN2C 3MGQC 2BYMB 1P3BB 3KSYA 4XUJB 2ZY2A 5B40C 4KUDD 5F99B 2NQBB 3X1TB 2HIOA 3AZLB 5AV5A 4AWLB 4J8XB 5B31A 3A6NB 4WNNA 3MNNC 5B24B 3AZMC 4J8WC 1W2EA 3F6TA 3WA9D 4NFTA 3W96A 2YFWA 4H9OA 5JA4B 3V9RB 1N1JA 5BNVA 2F8ND 3WAAB 5CPIC 3WTPC 2CV5D 3AV1A 2PYOA 3RELD 2ZY4A 5B32D 3LZ0A 3KWQB 2BYKB 1M18C 4EO5B 3AZHB 3X1VD 4ZUXB 2Y2MA 1P3FA 3UT9C 4Z66D 3AV2D 5B0YA 4QLCD 5CPJD 1PZRA 4G92B 1F66B 2L5AA 1P3OD 4XZQB 5AV9C 3TU4A 1P3PB 3REJD 3AZGD 2FJ7A 5GSUA 1P3MC 2JE5A 3H0LC 3C1BC 5AV8A 3KUYC 3AN2B 5AY8B 5B31B 3R45B 3REHA 4R8PA 4H9SC 5B0ZA 1P3GC 2NZDC 3VH6W 3REKD 1HQ3D 1P34C 3B6FD 5B1MD 3B6GC 2JSSA 3X1UC 5DNND 4WZSB 5GT3D 3MNNB 3AYWD 3AZMB 4X23C 4J8WB 1P3KD 4H9OB 3C1CD 4WU8C 3AZJC 2AROD 5BNVB 5AVBC 3LELC 4WJ3C 3LJAC 3AV1B 2PYOB 2DF4C 3UTBA 1BH9A 5B2JD 3W97A 4WU9D 4CAYB 3AZKA 1P3LA 3WTPB 3X1SD 2HIOD 3W99D 5AV5D 3REID 2F8NH 5E5AA 5B0YB 3MVDA 2ZM5A 4J8VA 1M18B 1M1AA 2G5IC 1S32D 1KX5D 4KUDC 1Q9CA 3TU4B 4YS3B 5AV6A 1P3IA 3UT9B 3W98B 1TZYC 2BYMA 3AZFB 3AZIA 3W96D 1P3BA 3LZ1A 5AV8B 2Y2OA 4XUJA 3WA9C 2NQBA 5F99A 4R8PB 5B0ZB 3AZNB 2RVQD 4DRAA 4J8XA 1ID3A 1KU5A 1WWSA 3EPKA 3RELC 5B2IA 1P3FD 5B32C 4E45A 3KXBC 5JA4A 3X1VC 4J8UA 5AVCD 3V9RA 4Z66C 3AV2C 4QLCC 5CPJC 5B1LD 1KX3D 2FJ7D 3AZJB 5GSUD 4HGAB 1AOIB 3W97B 5AVBB 1P3OC 1P3LB 3REJC 2BYKA 5E5AB 2Y2GA 3MVDB 4J8VB 4LD9A 3WKJD 4ZUXA 3AFAC 1F66A 4G91C 2RIQA 5JRGD 3MGPA 3UTAC 3REKC 1HQ3C 3AZIB 2Y2JA 3LZ1B 5B1MC 2IO5B 2Y2LA 5DNNC 2XD5A 1TZYB 5GT3C 3MGQA 3AYWC 3AN2A 5AY8A 1P3KC 3R45A 4JJND 1ID3B 4KGCB 5CPKD 5GT0D 2AROC 3AZKD 5CP6D 1M19D 2LY8A 1KX4D 3EPJA 4Z5TB 5B2IB 5C3IC 5B33D 3MGSC 3O62C 1M1AD 5GXQC 5B2JC 3MNNA 4WU9C 3AZMA 4J8WA 3X1SC 4DRBA 2HIOC 3W99C 5AV6D 3REIC 4J8UB 1P3ID 1KX5C 1S32C 4YM6C 1U35B 3KXBB 4UUZA 1T3UA 4XUJD 4H9RB 2NQBD 3VH5W 4CAYA 5CPIA 5CPJB 5BT1D 3X1TD 3WTPA 3AZLD 4LD9B 2Y2HA 1P3AC 3W96C 4J8XD 3A6ND 3H0RC 5B24D 1M18A 4H9NB 3MGPB 4YS3A 2F2AC 2RVQC 3AFAB 3UT9A 3W98A 1EQZD 4G91B 4KHAA 4WV4B 1ZLAB 3AZFA 2BG1A 5AV9A 3UTAB 3MGQB 3MGRC 1H3OB 3WAAD 2FFFB 3AZNA 5B40B 1P3MA 3KWQD 5GT3B 5AVCC 5B1LC 1KX3C 1BFMA 5GSUC 4H9SA 3AZHD 1P3GA 2Y2PA 2NZDA 1P34A 1F66D 3KFUG 2JCHA 3AZEC 3MGSB 4XZQD 1P3PD 3O62B 3X1UA 2W8SA 5GXQB 3NQUA 3WKJC 4X23A 5DNMC 4WU8A 4UUZB 3REIB 3AZJA 1AOIA 5JRGC 5AVBA 5CPIB 3AN2D 4YM6B 5AY8D 5B31D 3EPLA 4E44A 1P3AB 4JJNC 5CPKC 5GT0C 4KHAB 5CP6C 3AZMD 1M19C 1ULYA 3B0CW 1KX4C 5AV9B 5B32G 2Y2KA 5B33C 3VH6T 1M1AC 1TZYA 3AV1D 2PYOD 4ZBJC 1P3MB 3A1KA 3LZ0D 5BS7C 3C1BB 3KUYB 4KGCA 3MGRB 1F1EA 3WA9A 2CV5C 2CWEA 2DQNC 4Z5TA 1P3GB 2NZDB 1P34B 5B0YD 4NE5A 4XUJC 3B6GB 4YS3D 3TU4D 3X1TC 1KX3B 3X1UB 3AZLC 3NQUB 4M6BA 1WWIA 4X23B 3UT9D 3W98D 5B32A 3A6NC 4WU8B 5B24C 2J8PA 3AZEB 2Y2QA 3NQJA 3AZFD 1U35A 5AV8D 3KXBA 3LELB 3LJAB 5DNMB 4H9RA 4Z66A 3REHD 3AV2A 4QLCA 4R8PD 5CPJA 3AZGC 1EQZC 5B0ZD 3AZND 1P3OA 3REJA 3WAAC 3H0MC 4H9NA 3EG5B 1A7WA 4Z2MH 4KUDB 3KWQC 3AFAA 3B6FC 4H9PB 1ZLAA 5CPKB 4EO5C 3UTAA 3AZHC 1M19B 5BO0A 1H3OA 1HQ3A 3C1CC 4G92C 3REKA 3UTBD 1F66C 3AZJD 1AOID 3W97D 4XZQC 5KDMB 5B40A 1P3LD 1P3PC 3WA9B 2Y2NA 5GT3A 3AYWA 1P3KA 5E5AD 3MVDD 3AL0C 1KX4B 1HTAA 3B0DC 4J8VD 2AROA 2F8NB 2XD1A 4UPKA 2CV5B 5AV5C 5AY8C 5B31C 3RELB 1JFIB 5B32B 1BH8A 3MGSA 3O62A 2HUEC 5B2JA 5GXQA 3NQJB 3P5JB 5BNXA 5FUGB 3AZID 4WU9A 1P3BD 3LZ1D 3X1SA 3W99A 3REIA 3X1VB 4Z66B 3AV2B 5F99D 4QLCB 1TZYD 1KX5A 1S32A 4YM6A 1P3OB 1ID3D 4KGCD 3REJB 1EQZB 1B67A 3AZGB 4Z5TD 3AV1C 2PYOC 5B2ID 1P3AA 3LZ0C 4J8UD 5BO0B 3REKB 1HQ3B 2ZY3A 5G49A 5B0YC 1P3FC 3B6FB 5B1MB 1U35D 4YS3C 3TU4C 3KXBD 5DNNB 1R4VA 3C1BA 3KUYA 3AYWB 3MGRA 3W98C 1P3KB 3C1CB 2FJ7C 4LD9D 2AROB 3AZFC 4CSRB 4ZUXD 5AV8C 5AVCA 3B6GA 2Y2IA 5C3IB 3REHC 1BH8B 4R8PC 5B1LA 3MGPD 3B0DB 3FDDA 1KX3A 5B2JB 5B0ZC 1B6WA 3AZNC 4WU9B 5BNXB 4H9QA 3VH5T 3X1SB 2HIOB 3AFAD 5AV5B 3W99B 1ZLAD 3AZEA 4WNNB 3UTAD 3MGQD 1KX5B 2HUEB 3LELA 1S32B 3WKJA 3LJAA 2G5HC 5DNMA 2UWXA 5JRGA 5B40D 2YFVA 3A1IA 3UTBC 2YFWB 3W96B 2F8NG 1AOIC 4HGAC 3MNND 1N1JB 3W97C 3AZKC 1P3LC 4J8WD 4KUDA 4H9PA 5E5AC 5G49B 3LZ0B 3VH5A 3MVDC 3MGSD 4JJNA 3O62D 4J8VC 5CPKA 5GXQD 5GT0A 1TAFA 4NE6A 1Z2CB 5CP6A 1M19A 5AV6C 1KX4A 1P3IC 1P3FB 5B33A 5KDMA 5CPID 3WTPD 4YM6D 3WTPE 3AZIC 1P3BC 3LZ1C 2IO5C 5BS7A 5AVCB 4DQYB 1M18D 2F8NA 2NQBC 5F99C 5B1LB 5BT1C 2FJ7B 2CV5A 5GSUB 4AWLC 1P3AD 4J8XC 3B0BA 3RELA 4H9QB 1JFIA 1ID3C 4KGCC 3REHB 3VH6A 5FUGA 5AV9D 4Z5TC 3X1TA 5CHLB 3AZLA 5B2IC 3X1VA 3WKJB 3IP4C 3A6NA 5B24A 5JRGB 1P3MD 2YFVB 3KUYD 3C1BD 4J8UC 3MGRD 3B0CT 1EQZA 3AZGA 1U35C 1P3GD 2NZDD 1P34D 3B6GD 3UTBB 1BH9B 2ZY5A 4JJNB 3WAAA 3EPHA 3X1UD 5GT0B 4LD9C 1TAFB 3AZKB 5CP6B 4NE3A 4ZUXC 4X23D 2F8NK 3KWQA 5B31G 4WU8D 3B6FA
chains in the Genus database with same CATH topology
5B1MA 4Z2MG 3AZED 5B33B 5AVBD 3MGPC 1M1AB 5DNNA 3LELD 3AZHA 3LJAD 4ZBJB 5DNMD 5AV6B 3C1CA 1P3IB 1ZLAC 2VQRA 4CSRA 4XZQA 1P3PA 3AN2C 3MGQC 2BYMB 1P3BB 3KSYA 4XUJB 2ZY2A 5B40C 4KUDD 5F99B 2NQBB 3X1TB 2HIOA 3AZLB 5AV5A 4AWLB 4J8XB 5B31A 3A6NB 4WNNA 3MNNC 5B24B 3AZMC 4J8WC 1W2EA 3F6TA 3WA9D 4NFTA 3W96A 2YFWA 4H9OA 5JA4B 3V9RB 1N1JA 5BNVA 2F8ND 3WAAB 5CPIC 3WTPC 2CV5D 3AV1A 2PYOA 3RELD 2ZY4A 5B32D 3LZ0A 3KWQB 2BYKB 1M18C 4EO5B 3AZHB 3X1VD 4ZUXB 2Y2MA 1P3FA 3UT9C 4Z66D 3AV2D 5B0YA 4QLCD 5CPJD 1PZRA 4G92B 1F66B 2L5AA 1P3OD 4XZQB 5AV9C 3TU4A 1P3PB 3REJD 3AZGD 2FJ7A 5GSUA 1P3MC 2JE5A 3H0LC 3C1BC 5AV8A 3KUYC 3AN2B 5AY8B 5B31B 3R45B 3REHA 4R8PA 4H9SC 5B0ZA 1P3GC 2NZDC 3VH6W 3REKD 1HQ3D 1P34C 3B6FD 5B1MD 3B6GC 2JSSA 3X1UC 5DNND 4WZSB 5GT3D 3MNNB 3AYWD 3AZMB 4X23C 4J8WB 1P3KD 4H9OB 3C1CD 4WU8C 3AZJC 2AROD 5BNVB 5AVBC 3LELC 4WJ3C 3LJAC 3AV1B 2PYOB 2DF4C 3UTBA 1BH9A 5B2JD 3W97A 4WU9D 4CAYB 3AZKA 1P3LA 3WTPB 3X1SD 2HIOD 3W99D 5AV5D 3REID 2F8NH 5E5AA 5B0YB 3MVDA 2ZM5A 4J8VA 1M18B 1M1AA 2G5IC 1S32D 1KX5D 4KUDC 1Q9CA 3TU4B 4YS3B 5AV6A 1P3IA 3UT9B 3W98B 1TZYC 2BYMA 3AZFB 3AZIA 3W96D 1P3BA 3LZ1A 5AV8B 2Y2OA 4XUJA 3WA9C 2NQBA 5F99A 4R8PB 5B0ZB 3AZNB 2RVQD 4DRAA 4J8XA 1ID3A 1KU5A 1WWSA 3EPKA 3RELC 5B2IA 1P3FD 5B32C 4E45A 3KXBC 5JA4A 3X1VC 4J8UA 5AVCD 3V9RA 4Z66C 3AV2C 4QLCC 5CPJC 5B1LD 1KX3D 2FJ7D 3AZJB 5GSUD 4HGAB 1AOIB 3W97B 5AVBB 1P3OC 1P3LB 3REJC 2BYKA 5E5AB 2Y2GA 3MVDB 4J8VB 4LD9A 3WKJD 4ZUXA 3AFAC 1F66A 4G91C 2RIQA 5JRGD 3MGPA 3UTAC 3REKC 1HQ3C 3AZIB 2Y2JA 3LZ1B 5B1MC 2IO5B 2Y2LA 5DNNC 2XD5A 1TZYB 5GT3C 3MGQA 3AYWC 3AN2A 5AY8A 1P3KC 3R45A 4JJND 1ID3B 4KGCB 5CPKD 5GT0D 2AROC 3AZKD 5CP6D 1M19D 2LY8A 1KX4D 3EPJA 4Z5TB 5B2IB 5C3IC 5B33D 3MGSC 3O62C 1M1AD 5GXQC 5B2JC 3MNNA 4WU9C 3AZMA 4J8WA 3X1SC 4DRBA 2HIOC 3W99C 5AV6D 3REIC 4J8UB 1P3ID 1KX5C 1S32C 4YM6C 1U35B 3KXBB 4UUZA 1T3UA 4XUJD 4H9RB 2NQBD 3VH5W 4CAYA 5CPIA 5CPJB 5BT1D 3X1TD 3WTPA 3AZLD 4LD9B 2Y2HA 1P3AC 3W96C 4J8XD 3A6ND 3H0RC 5B24D 1M18A 4H9NB 3MGPB 4YS3A 2F2AC 2RVQC 3AFAB 3UT9A 3W98A 1EQZD 4G91B 4KHAA 4WV4B 1ZLAB 3AZFA 2BG1A 5AV9A 3UTAB 3MGQB 3MGRC 1H3OB 3WAAD 2FFFB 3AZNA 5B40B 1P3MA 3KWQD 5GT3B 5AVCC 5B1LC 1KX3C 1BFMA 5GSUC 4H9SA 3AZHD 1P3GA 2Y2PA 2NZDA 1P34A 1F66D 3KFUG 2JCHA 3AZEC 3MGSB 4XZQD 1P3PD 3O62B 3X1UA 2W8SA 5GXQB 3NQUA 3WKJC 4X23A 5DNMC 4WU8A 4UUZB 3REIB 3AZJA 1AOIA 5JRGC 5AVBA 5CPIB 3AN2D 4YM6B 5AY8D 5B31D 3EPLA 4E44A 1P3AB 4JJNC 5CPKC 5GT0C 4KHAB 5CP6C 3AZMD 1M19C 1ULYA 3B0CW 1KX4C 5AV9B 5B32G 2Y2KA 5B33C 3VH6T 1M1AC 1TZYA 3AV1D 2PYOD 4ZBJC 1P3MB 3A1KA 3LZ0D 5BS7C 3C1BB 3KUYB 4KGCA 3MGRB 1F1EA 3WA9A 2CV5C 2CWEA 2DQNC 4Z5TA 1P3GB 2NZDB 1P34B 5B0YD 4NE5A 4XUJC 3B6GB 4YS3D 3TU4D 3X1TC 1KX3B 3X1UB 3AZLC 3NQUB 4M6BA 1WWIA 4X23B 3UT9D 3W98D 5B32A 3A6NC 4WU8B 5B24C 2J8PA 3AZEB 2Y2QA 3NQJA 3AZFD 1U35A 5AV8D 3KXBA 3LELB 3LJAB 5DNMB 4H9RA 4Z66A 3REHD 3AV2A 4QLCA 4R8PD 5CPJA 3AZGC 1EQZC 5B0ZD 3AZND 1P3OA 3REJA 3WAAC 3H0MC 4H9NA 3EG5B 1A7WA 4Z2MH 4KUDB 3KWQC 3AFAA 3B6FC 4H9PB 1ZLAA 5CPKB 4EO5C 3UTAA 3AZHC 1M19B 5BO0A 1H3OA 1HQ3A 3C1CC 4G92C 3REKA 3UTBD 1F66C 3AZJD 1AOID 3W97D 4XZQC 5KDMB 5B40A 1P3LD 1P3PC 3WA9B 2Y2NA 5GT3A 3AYWA 1P3KA 5E5AD 3MVDD 3AL0C 1KX4B 1HTAA 3B0DC 4J8VD 2AROA 2F8NB 2XD1A 4UPKA 2CV5B 5AV5C 5AY8C 5B31C 3RELB 1JFIB 5B32B 1BH8A 3MGSA 3O62A 2HUEC 5B2JA 5GXQA 3NQJB 3P5JB 5BNXA 5FUGB 3AZID 4WU9A 1P3BD 3LZ1D 3X1SA 3W99A 3REIA 3X1VB 4Z66B 3AV2B 5F99D 4QLCB 1TZYD 1KX5A 1S32A 4YM6A 1P3OB 1ID3D 4KGCD 3REJB 1EQZB 1B67A 3AZGB 4Z5TD 3AV1C 2PYOC 5B2ID 1P3AA 3LZ0C 4J8UD 5BO0B 3REKB 1HQ3B 2ZY3A 5G49A 5B0YC 1P3FC 3B6FB 5B1MB 1U35D 4YS3C 3TU4C 3KXBD 5DNNB 1R4VA 3C1BA 3KUYA 3AYWB 3MGRA 3W98C 1P3KB 3C1CB 2FJ7C 4LD9D 2AROB 3AZFC 4CSRB 4ZUXD 5AV8C 5AVCA 3B6GA 2Y2IA 5C3IB 3REHC 1BH8B 4R8PC 5B1LA 3MGPD 3B0DB 3FDDA 1KX3A 5B2JB 5B0ZC 1B6WA 3AZNC 4WU9B 5BNXB 4H9QA 3VH5T 3X1SB 2HIOB 3AFAD 5AV5B 3W99B 1ZLAD 3AZEA 4WNNB 3UTAD 3MGQD 1KX5B 2HUEB 3LELA 1S32B 3WKJA 3LJAA 2G5HC 5DNMA 2UWXA 5JRGA 5B40D 2YFVA 3A1IA 3UTBC 2YFWB 3W96B 2F8NG 1AOIC 4HGAC 3MNND 1N1JB 3W97C 3AZKC 1P3LC 4J8WD 4KUDA 4H9PA 5E5AC 5G49B 3LZ0B 3VH5A 3MVDC 3MGSD 4JJNA 3O62D 4J8VC 5CPKA 5GXQD 5GT0A 1TAFA 4NE6A 1Z2CB 5CP6A 1M19A 5AV6C 1KX4A 1P3IC 1P3FB 5B33A 5KDMA 5CPID 3WTPD 4YM6D 3WTPE 3AZIC 1P3BC 3LZ1C 2IO5C 5BS7A 5AVCB 4DQYB 1M18D 2F8NA 2NQBC 5F99C 5B1LB 5BT1C 2FJ7B 2CV5A 5GSUB 4AWLC 1P3AD 4J8XC 3B0BA 3RELA 4H9QB 1JFIA 1ID3C 4KGCC 3REHB 3VH6A 5FUGA 5AV9D 4Z5TC 3X1TA 5CHLB 3AZLA 5B2IC 3X1VA 3WKJB 3IP4C 3A6NA 5B24A 5JRGB 1P3MD 2YFVB 3KUYD 3C1BD 4J8UC 3MGRD 3B0CT 1EQZA 3AZGA 1U35C 1P3GD 2NZDD 1P34D 3B6GD 3UTBB 1BH9B 2ZY5A 4JJNB 3WAAA 3EPHA 3X1UD 5GT0B 4LD9C 1TAFB 3AZKB 5CP6B 4NE3A 4ZUXC 4X23D 2F8NK 3KWQA 5B31G 4WU8D 3B6FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5B1M A;  4Z2M G;  3AZE D;  5B33 B;  5AVB D;  3MGP C;  1M1A B;  5DNN A;  3LEL D;  3AZH A;  3LJA D;  4ZBJ B;  5DNM D;  5AV6 B;  3C1C A;  1P3I B;  1ZLA C;  4CSR A;  4XZQ A;  1P3P A;  3AN2 C;  3MGQ C;  2BYM B;  1P3B B;  3KSY A;  4XUJ B;  5B40 C;  4KUD D;  5F99 B;  2NQB B;  3X1T B;  2HIO A;  3AZL B;  5AV5 A;  4AWL B;  4J8X B;  5B31 A;  3A6N B;  4WNN A;  3MNN C;  5B24 B;  3AZM C;  4J8W C;  3WA9 D;  4NFT A;  3W96 A;  2YFW A;  4H9O A;  5JA4 B;  3V9R B;  1N1J A;  5BNV A;  2F8N D;  3WAA B;  5CPI C;  3WTP C;  2CV5 D;  3AV1 A;  2PYO A;  3REL D;  5B32 D;  3LZ0 A;  3KWQ B;  2BYK B;  1M18 C;  4EO5 B;  3AZH B;  3X1V D;  4ZUX B;  1P3F A;  3UT9 C;  4Z66 D;  3AV2 D;  5B0Y A;  4QLC D;  5CPJ D;  4G92 B;  1F66 B;  2L5A A;  1P3O D;  4XZQ B;  5AV9 C;  3TU4 A;  1P3P B;  3REJ D;  3AZG D;  2FJ7 A;  5GSU A;  1P3M C;  3C1B C;  5AV8 A;  3KUY C;  3AN2 B;  5AY8 B;  5B31 B;  3R45 B;  3REH A;  4R8P A;  4H9S C;  5B0Z A;  1P3G C;  2NZD C;  3VH6 W;  3REK D;  1HQ3 D;  1P34 C;  3B6F D;  5B1M D;  3B6G C;  2JSS A;  3X1U C;  5DNN D;  4WZS B;  5GT3 D;  3MNN B;  3AYW D;  3AZM B;  4X23 C;  4J8W B;  1P3K D;  4H9O B;  3C1C D;  4WU8 C;  3AZJ C;  2ARO D;  5BNV B;  5AVB C;  3LEL C;  3LJA C;  3AV1 B;  2PYO B;  3UTB A;  1BH9 A;  5B2J D;  3W97 A;  4WU9 D;  4CAY B;  3AZK A;  1P3L A;  3WTP B;  3X1S D;  2HIO D;  3W99 D;  5AV5 D;  3REI D;  2F8N H;  5E5A A;  5B0Y B;  3MVD A;  4J8V A;  1M18 B;  1M1A A;  1KX5 D;  1S32 D;  4KUD C;  1Q9C A;  3TU4 B;  4YS3 B;  5AV6 A;  1P3I A;  3UT9 B;  3W98 B;  1TZY C;  2BYM A;  3AZF B;  3AZI A;  3W96 D;  1P3B A;  3LZ1 A;  5AV8 B;  4XUJ A;  3WA9 C;  2NQB A;  5F99 A;  4R8P B;  5B0Z B;  3AZN B;  2RVQ D;  4DRA A;  4J8X A;  1ID3 A;  1KU5 A;  1WWS A;  3REL C;  5B2I A;  1P3F D;  5B32 C;  4E45 A;  3KXB C;  5JA4 A;  3X1V C;  4J8U A;  5AVC D;  3V9R A;  4Z66 C;  3AV2 C;  4QLC C;  5CPJ C;  5B1L D;  1KX3 D;  2FJ7 D;  3AZJ B;  5GSU D;  4HGA B;  1AOI B;  3W97 B;  5AVB B;  1P3O C;  1P3L B;  3REJ C;  2BYK A;  5E5A B;  3MVD B;  4J8V B;  4LD9 A;  3WKJ D;  4ZUX A;  3AFA C;  1F66 A;  4G91 C;  5JRG D;  3MGP A;  3UTA C;  3REK C;  1HQ3 C;  3AZI B;  3LZ1 B;  5B1M C;  2IO5 B;  5DNN C;  5GT3 C;  1TZY B;  3MGQ A;  3AYW C;  3AN2 A;  5AY8 A;  1P3K C;  3R45 A;  4JJN D;  1ID3 B;  4KGC B;  5CPK D;  5GT0 D;  2ARO C;  3AZK D;  5CP6 D;  1M19 D;  2LY8 A;  1KX4 D;  4Z5T B;  5B2I B;  5C3I C;  5B33 D;  3MGS C;  3O62 C;  1M1A D;  5GXQ C;  5B2J C;  3MNN A;  4WU9 C;  3AZM A;  4J8W A;  3X1S C;  4DRB A;  2HIO C;  3W99 C;  5AV6 D;  3REI C;  4J8U B;  1P3I D;  1KX5 C;  1S32 C;  4YM6 C;  1U35 B;  3KXB B;  4UUZ A;  4XUJ D;  4H9R B;  2NQB D;  3VH5 W;  4CAY A;  5CPI A;  5CPJ B;  5BT1 D;  3X1T D;  3WTP A;  3AZL D;  4LD9 B;  1P3A C;  3W96 C;  4J8X D;  3A6N D;  5B24 D;  1M18 A;  4H9N B;  3MGP B;  4YS3 A;  2RVQ C;  3AFA B;  3UT9 A;  3W98 A;  1EQZ D;  4G91 B;  4KHA A;  4WV4 B;  1ZLA B;  3AZF A;  5AV9 A;  3UTA B;  3MGQ B;  3MGR C;  1H3O B;  3WAA D;  3AZN A;  5B40 B;  1P3M A;  3KWQ D;  5GT3 B;  5AVC C;  5B1L C;  1KX3 C;  1BFM A;  5GSU C;  4H9S A;  3AZH D;  1P3G A;  2NZD A;  1P34 A;  1F66 D;  3AZE C;  3MGS B;  4XZQ D;  1P3P D;  3O62 B;  3X1U A;  5GXQ B;  3NQU A;  3WKJ C;  4X23 A;  5DNM C;  4WU8 A;  4UUZ B;  3REI B;  3AZJ A;  1AOI A;  5JRG C;  5AVB A;  5CPI B;  3AN2 D;  4YM6 B;  5AY8 D;  5B31 D;  4E44 A;  1P3A B;  4JJN C;  5CPK C;  5GT0 C;  4KHA B;  5CP6 C;  3AZM D;  1M19 C;  1ULY A;  3B0C W;  1KX4 C;  5AV9 B;  5B32 G;  5B33 C;  3VH6 T;  1M1A C;  1TZY A;  3AV1 D;  2PYO D;  4ZBJ C;  1P3M B;  3LZ0 D;  5BS7 C;  3C1B B;  3KUY B;  4KGC A;  3MGR B;  1F1E A;  3WA9 A;  2CV5 C;  2CWE A;  4Z5T A;  1P3G B;  2NZD B;  1P34 B;  5B0Y D;  4NE5 A;  4XUJ C;  3B6G B;  4YS3 D;  3TU4 D;  3X1T C;  1KX3 B;  3X1U B;  3AZL C;  3NQU B;  4M6B A;  1WWI A;  4X23 B;  3UT9 D;  3W98 D;  5B32 A;  3A6N C;  4WU8 B;  5B24 C;  3AZE B;  3NQJ A;  3AZF D;  1U35 A;  5AV8 D;  3KXB A;  3LEL B;  3LJA B;  5DNM B;  4H9R A;  4Z66 A;  3REH D;  3AV2 A;  4QLC A;  4R8P D;  5CPJ A;  3AZG C;  1EQZ C;  5B0Z D;  3AZN D;  1P3O A;  3REJ A;  3WAA C;  4H9N A;  1A7W A;  4Z2M H;  4KUD B;  3KWQ C;  3AFA A;  3B6F C;  4H9P B;  1ZLA A;  5CPK B;  4EO5 C;  3UTA A;  3AZH C;  1M19 B;  5BO0 A;  1H3O A;  1HQ3 A;  3C1C C;  4G92 C;  3REK A;  3UTB D;  1F66 C;  3AZJ D;  1AOI D;  3W97 D;  4XZQ C;  5KDM B;  5B40 A;  1P3L D;  1P3P C;  3WA9 B;  5GT3 A;  3AYW A;  1P3K A;  5E5A D;  3MVD D;  1KX4 B;  1HTA A;  3B0D C;  4J8V D;  2ARO A;  2F8N B;  2CV5 B;  5AV5 C;  5AY8 C;  5B31 C;  3REL B;  1JFI B;  5B32 B;  1BH8 A;  3MGS A;  3O62 A;  2HUE C;  5B2J A;  5GXQ A;  3NQJ B;  4WU9 A;  5BNX A;  5FUG B;  3AZI D;  1P3B D;  3LZ1 D;  3X1S A;  3W99 A;  3REI A;  3X1V B;  4Z66 B;  3AV2 B;  5F99 D;  4QLC B;  1TZY D;  1KX5 A;  1S32 A;  4YM6 A;  1P3O B;  1ID3 D;  4KGC D;  3REJ B;  1EQZ B;  1B67 A;  3AZG B;  4Z5T D;  3AV1 C;  2PYO C;  5B2I D;  1P3A A;  3LZ0 C;  4J8U D;  5BO0 B;  3REK B;  1HQ3 B;  5G49 A;  5B0Y C;  1P3F C;  3B6F B;  5B1M B;  1U35 D;  4YS3 C;  3TU4 C;  3KXB D;  5DNN B;  1R4V A;  3C1B A;  3KUY A;  3AYW B;  3MGR A;  3W98 C;  1P3K B;  3C1C B;  2FJ7 C;  4LD9 D;  2ARO B;  3AZF C;  4CSR B;  4ZUX D;  5AV8 C;  5AVC A;  3B6G A;  3REH C;  5C3I B;  1BH8 B;  4R8P C;  5B1L A;  3MGP D;  3B0D B;  1KX3 A;  5B2J B;  5B0Z C;  1B6W A;  3AZN C;  4WU9 B;  5BNX B;  4H9Q A;  3VH5 T;  3X1S B;  2HIO B;  3AFA D;  5AV5 B;  3W99 B;  1ZLA D;  3AZE A;  4WNN B;  3UTA D;  3MGQ D;  1KX5 B;  2HUE B;  3LEL A;  1S32 B;  3WKJ A;  3LJA A;  5DNM A;  5JRG A;  5B40 D;  2YFV A;  3UTB C;  3W96 B;  2YFW B;  2F8N G;  1AOI C;  4HGA C;  3MNN D;  1N1J B;  3W97 C;  3AZK C;  1P3L C;  4J8W D;  4KUD A;  4H9P A;  5E5A C;  5G49 B;  3LZ0 B;  3VH5 A;  3MVD C;  3MGS D;  4JJN A;  3O62 D;  4J8V C;  5CPK A;  5GXQ D;  5GT0 A;  1TAF A;  4NE6 A;  5CP6 A;  1M19 A;  5AV6 C;  1KX4 A;  1P3I C;  1P3F B;  5B33 A;  5KDM A;  5CPI D;  3WTP D;  4YM6 D;  3WTP E;  3AZI C;  1P3B C;  3LZ1 C;  2IO5 C;  5BS7 A;  5AVC B;  1M18 D;  2F8N A;  2NQB C;  5F99 C;  5B1L B;  5BT1 C;  2FJ7 B;  2CV5 A;  5GSU B;  4AWL C;  1P3A D;  4J8X C;  3B0B A;  3REL A;  4H9Q B;  1JFI A;  1ID3 C;  4KGC C;  3REH B;  3VH6 A;  5FUG A;  5AV9 D;  4Z5T C;  3X1T A;  5CHL B;  3AZL A;  5B2I C;  3X1V A;  3WKJ B;  3A6N A;  5B24 A;  5JRG B;  1P3M D;  2YFV B;  3KUY D;  3C1B D;  4J8U C;  3MGR D;  3B0C T;  1EQZ A;  3AZG A;  1U35 C;  1P3G D;  2NZD D;  1P34 D;  3B6G D;  3UTB B;  1BH9 B;  3WAA A;  4JJN B;  3X1U D;  5GT0 B;  4LD9 C;  1TAF B;  3AZK B;  5CP6 B;  4NE3 A;  4ZUX C;  4X23 D;  2F8N K;  3KWQ A;  5B31 G;  4WU8 D;  3B6F A; 
#chains in the Genus database with same CATH topology
 5B1M A;  4Z2M G;  3AZE D;  5B33 B;  5AVB D;  3MGP C;  1M1A B;  5DNN A;  3LEL D;  3AZH A;  3LJA D;  4ZBJ B;  5DNM D;  5AV6 B;  3C1C A;  1P3I B;  1ZLA C;  2VQR A;  4CSR A;  4XZQ A;  1P3P A;  3AN2 C;  3MGQ C;  2BYM B;  1P3B B;  3KSY A;  4XUJ B;  2ZY2 A;  5B40 C;  4KUD D;  5F99 B;  2NQB B;  3X1T B;  2HIO A;  3AZL B;  5AV5 A;  4AWL B;  4J8X B;  5B31 A;  3A6N B;  4WNN A;  3MNN C;  5B24 B;  3AZM C;  4J8W C;  1W2E A;  3F6T A;  3WA9 D;  4NFT A;  3W96 A;  2YFW A;  4H9O A;  5JA4 B;  3V9R B;  1N1J A;  5BNV A;  2F8N D;  3WAA B;  5CPI C;  3WTP C;  2CV5 D;  3AV1 A;  2PYO A;  3REL D;  2ZY4 A;  5B32 D;  3LZ0 A;  3KWQ B;  2BYK B;  1M18 C;  4EO5 B;  3AZH B;  3X1V D;  4ZUX B;  2Y2M A;  1P3F A;  3UT9 C;  4Z66 D;  3AV2 D;  5B0Y A;  4QLC D;  5CPJ D;  1PZR A;  4G92 B;  1F66 B;  2L5A A;  1P3O D;  4XZQ B;  5AV9 C;  3TU4 A;  1P3P B;  3REJ D;  3AZG D;  2FJ7 A;  5GSU A;  1P3M C;  2JE5 A;  3H0L C;  3C1B C;  5AV8 A;  3KUY C;  3AN2 B;  5AY8 B;  5B31 B;  3R45 B;  3REH A;  4R8P A;  4H9S C;  5B0Z A;  1P3G C;  2NZD C;  3VH6 W;  3REK D;  1HQ3 D;  1P34 C;  3B6F D;  5B1M D;  3B6G C;  2JSS A;  3X1U C;  5DNN D;  4WZS B;  5GT3 D;  3MNN B;  3AYW D;  3AZM B;  4X23 C;  4J8W B;  1P3K D;  4H9O B;  3C1C D;  4WU8 C;  3AZJ C;  2ARO D;  5BNV B;  5AVB C;  3LEL C;  4WJ3 C;  3LJA C;  3AV1 B;  2PYO B;  2DF4 C;  3UTB A;  1BH9 A;  5B2J D;  3W97 A;  4WU9 D;  4CAY B;  3AZK A;  1P3L A;  3WTP B;  3X1S D;  2HIO D;  3W99 D;  5AV5 D;  3REI D;  2F8N H;  5E5A A;  5B0Y B;  3MVD A;  2ZM5 A;  4J8V A;  1M18 B;  1M1A A;  2G5I C;  1S32 D;  1KX5 D;  4KUD C;  1Q9C A;  3TU4 B;  4YS3 B;  5AV6 A;  1P3I A;  3UT9 B;  3W98 B;  1TZY C;  2BYM A;  3AZF B;  3AZI A;  3W96 D;  1P3B A;  3LZ1 A;  5AV8 B;  2Y2O A;  4XUJ A;  3WA9 C;  2NQB A;  5F99 A;  4R8P B;  5B0Z B;  3AZN B;  2RVQ D;  4DRA A;  4J8X A;  1ID3 A;  1KU5 A;  1WWS A;  3EPK A;  3REL C;  5B2I A;  1P3F D;  5B32 C;  4E45 A;  3KXB C;  5JA4 A;  3X1V C;  4J8U A;  5AVC D;  3V9R A;  4Z66 C;  3AV2 C;  4QLC C;  5CPJ C;  5B1L D;  1KX3 D;  2FJ7 D;  3AZJ B;  5GSU D;  4HGA B;  1AOI B;  3W97 B;  5AVB B;  1P3O C;  1P3L B;  3REJ C;  2BYK A;  5E5A B;  2Y2G A;  3MVD B;  4J8V B;  4LD9 A;  3WKJ D;  4ZUX A;  3AFA C;  1F66 A;  4G91 C;  2RIQ A;  5JRG D;  3MGP A;  3UTA C;  3REK C;  1HQ3 C;  3AZI B;  2Y2J A;  3LZ1 B;  5B1M C;  2IO5 B;  2Y2L A;  5DNN C;  2XD5 A;  1TZY B;  5GT3 C;  3MGQ A;  3AYW C;  3AN2 A;  5AY8 A;  1P3K C;  3R45 A;  4JJN D;  1ID3 B;  4KGC B;  5CPK D;  5GT0 D;  2ARO C;  3AZK D;  5CP6 D;  1M19 D;  2LY8 A;  1KX4 D;  3EPJ A;  4Z5T B;  5B2I B;  5C3I C;  5B33 D;  3MGS C;  3O62 C;  1M1A D;  5GXQ C;  5B2J C;  3MNN A;  4WU9 C;  3AZM A;  4J8W A;  3X1S C;  4DRB A;  2HIO C;  3W99 C;  5AV6 D;  3REI C;  4J8U B;  1P3I D;  1KX5 C;  1S32 C;  4YM6 C;  1U35 B;  3KXB B;  4UUZ A;  1T3U A;  4XUJ D;  4H9R B;  2NQB D;  3VH5 W;  4CAY A;  5CPI A;  5CPJ B;  5BT1 D;  3X1T D;  3WTP A;  3AZL D;  4LD9 B;  2Y2H A;  1P3A C;  3W96 C;  4J8X D;  3A6N D;  3H0R C;  5B24 D;  1M18 A;  4H9N B;  3MGP B;  4YS3 A;  2F2A C;  2RVQ C;  3AFA B;  3UT9 A;  3W98 A;  1EQZ D;  4G91 B;  4KHA A;  4WV4 B;  1ZLA B;  3AZF A;  2BG1 A;  5AV9 A;  3UTA B;  3MGQ B;  3MGR C;  1H3O B;  3WAA D;  2FFF B;  3AZN A;  5B40 B;  1P3M A;  3KWQ D;  5GT3 B;  5AVC C;  5B1L C;  1KX3 C;  1BFM A;  5GSU C;  4H9S A;  3AZH D;  1P3G A;  2Y2P A;  2NZD A;  1P34 A;  1F66 D;  3KFU G;  2JCH A;  3AZE C;  3MGS B;  4XZQ D;  1P3P D;  3O62 B;  3X1U A;  2W8S A;  5GXQ B;  3NQU A;  3WKJ C;  4X23 A;  5DNM C;  4WU8 A;  4UUZ B;  3REI B;  3AZJ A;  1AOI A;  5JRG C;  5AVB A;  5CPI B;  3AN2 D;  4YM6 B;  5AY8 D;  5B31 D;  3EPL A;  4E44 A;  1P3A B;  4JJN C;  5CPK C;  5GT0 C;  4KHA B;  5CP6 C;  3AZM D;  1M19 C;  1ULY A;  3B0C W;  1KX4 C;  5AV9 B;  5B32 G;  2Y2K A;  5B33 C;  3VH6 T;  1M1A C;  1TZY A;  3AV1 D;  2PYO D;  4ZBJ C;  1P3M B;  3A1K A;  3LZ0 D;  5BS7 C;  3C1B B;  3KUY B;  4KGC A;  3MGR B;  1F1E A;  3WA9 A;  2CV5 C;  2CWE A;  2DQN C;  4Z5T A;  1P3G B;  2NZD B;  1P34 B;  5B0Y D;  4NE5 A;  4XUJ C;  3B6G B;  4YS3 D;  3TU4 D;  3X1T C;  1KX3 B;  3X1U B;  3AZL C;  3NQU B;  4M6B A;  1WWI A;  4X23 B;  3UT9 D;  3W98 D;  5B32 A;  3A6N C;  4WU8 B;  5B24 C;  2J8P A;  3AZE B;  2Y2Q A;  3NQJ A;  3AZF D;  1U35 A;  5AV8 D;  3KXB A;  3LEL B;  3LJA B;  5DNM B;  4H9R A;  4Z66 A;  3REH D;  3AV2 A;  4QLC A;  4R8P D;  5CPJ A;  3AZG C;  1EQZ C;  5B0Z D;  3AZN D;  1P3O A;  3REJ A;  3WAA C;  3H0M C;  4H9N A;  3EG5 B;  1A7W A;  4Z2M H;  4KUD B;  3KWQ C;  3AFA A;  3B6F C;  4H9P B;  1ZLA A;  5CPK B;  4EO5 C;  3UTA A;  3AZH C;  1M19 B;  5BO0 A;  1H3O A;  1HQ3 A;  3C1C C;  4G92 C;  3REK A;  3UTB D;  1F66 C;  3AZJ D;  1AOI D;  3W97 D;  4XZQ C;  5KDM B;  5B40 A;  1P3L D;  1P3P C;  3WA9 B;  2Y2N A;  5GT3 A;  3AYW A;  1P3K A;  5E5A D;  3MVD D;  3AL0 C;  1KX4 B;  1HTA A;  3B0D C;  4J8V D;  2ARO A;  2F8N B;  2XD1 A;  4UPK A;  2CV5 B;  5AV5 C;  5AY8 C;  5B31 C;  3REL B;  1JFI B;  5B32 B;  1BH8 A;  3MGS A;  3O62 A;  2HUE C;  5B2J A;  5GXQ A;  3NQJ B;  3P5J B;  5BNX A;  5FUG B;  3AZI D;  4WU9 A;  1P3B D;  3LZ1 D;  3X1S A;  3W99 A;  3REI A;  3X1V B;  4Z66 B;  3AV2 B;  5F99 D;  4QLC B;  1TZY D;  1KX5 A;  1S32 A;  4YM6 A;  1P3O B;  1ID3 D;  4KGC D;  3REJ B;  1EQZ B;  1B67 A;  3AZG B;  4Z5T D;  3AV1 C;  2PYO C;  5B2I D;  1P3A A;  3LZ0 C;  4J8U D;  5BO0 B;  3REK B;  1HQ3 B;  2ZY3 A;  5G49 A;  5B0Y C;  1P3F C;  3B6F B;  5B1M B;  1U35 D;  4YS3 C;  3TU4 C;  3KXB D;  5DNN B;  1R4V A;  3C1B A;  3KUY A;  3AYW B;  3MGR A;  3W98 C;  1P3K B;  3C1C B;  2FJ7 C;  4LD9 D;  2ARO B;  3AZF C;  4CSR B;  4ZUX D;  5AV8 C;  5AVC A;  3B6G A;  2Y2I A;  5C3I B;  3REH C;  1BH8 B;  4R8P C;  5B1L A;  3MGP D;  3B0D B;  3FDD A;  1KX3 A;  5B2J B;  5B0Z C;  1B6W A;  3AZN C;  4WU9 B;  5BNX B;  4H9Q A;  3VH5 T;  3X1S B;  2HIO B;  3AFA D;  5AV5 B;  3W99 B;  1ZLA D;  3AZE A;  4WNN B;  3UTA D;  3MGQ D;  1KX5 B;  2HUE B;  3LEL A;  1S32 B;  3WKJ A;  3LJA A;  2G5H C;  5DNM A;  2UWX A;  5JRG A;  5B40 D;  2YFV A;  3A1I A;  3UTB C;  2YFW B;  3W96 B;  2F8N G;  1AOI C;  4HGA C;  3MNN D;  1N1J B;  3W97 C;  3AZK C;  1P3L C;  4J8W D;  4KUD A;  4H9P A;  5E5A C;  5G49 B;  3LZ0 B;  3VH5 A;  3MVD C;  3MGS D;  4JJN A;  3O62 D;  4J8V C;  5CPK A;  5GXQ D;  5GT0 A;  1TAF A;  4NE6 A;  1Z2C B;  5CP6 A;  1M19 A;  5AV6 C;  1KX4 A;  1P3I C;  1P3F B;  5B33 A;  5KDM A;  5CPI D;  3WTP D;  4YM6 D;  3WTP E;  3AZI C;  1P3B C;  3LZ1 C;  2IO5 C;  5BS7 A;  5AVC B;  4DQY B;  1M18 D;  2F8N A;  2NQB C;  5F99 C;  5B1L B;  5BT1 C;  2FJ7 B;  2CV5 A;  5GSU B;  4AWL C;  1P3A D;  4J8X C;  3B0B A;  3REL A;  4H9Q B;  1JFI A;  1ID3 C;  4KGC C;  3REH B;  3VH6 A;  5FUG A;  5AV9 D;  4Z5T C;  3X1T A;  5CHL B;  3AZL A;  5B2I C;  3X1V A;  3WKJ B;  3IP4 C;  3A6N A;  5B24 A;  5JRG B;  1P3M D;  2YFV B;  3KUY D;  3C1B D;  4J8U C;  3MGR D;  3B0C T;  1EQZ A;  3AZG A;  1U35 C;  1P3G D;  2NZD D;  1P34 D;  3B6G D;  3UTB B;  1BH9 B;  2ZY5 A;  4JJN B;  3WAA A;  3EPH A;  3X1U D;  5GT0 B;  4LD9 C;  1TAF B;  3AZK B;  5CP6 B;  4NE3 A;  4ZUX C;  4X23 D;  2F8N K;  3KWQ A;  5B31 G;  4WU8 D;  3B6F A; 
#chains in the Genus database with same CATH homology
 5B1M A;  4Z2M G;  3AZE D;  5B33 B;  5AVB D;  3MGP C;  1M1A B;  5DNN A;  3LEL D;  3AZH A;  3LJA D;  4ZBJ B;  5DNM D;  5AV6 B;  3C1C A;  1P3I B;  1ZLA C;  2VQR A;  4CSR A;  4XZQ A;  1P3P A;  3AN2 C;  3MGQ C;  2BYM B;  1P3B B;  3KSY A;  4XUJ B;  2ZY2 A;  5B40 C;  4KUD D;  5F99 B;  2NQB B;  3X1T B;  2HIO A;  3AZL B;  5AV5 A;  4AWL B;  4J8X B;  5B31 A;  3A6N B;  4WNN A;  3MNN C;  5B24 B;  3AZM C;  4J8W C;  1W2E A;  3F6T A;  3WA9 D;  4NFT A;  3W96 A;  2YFW A;  4H9O A;  5JA4 B;  3V9R B;  1N1J A;  5BNV A;  2F8N D;  3WAA B;  5CPI C;  3WTP C;  2CV5 D;  3AV1 A;  2PYO A;  3REL D;  2ZY4 A;  5B32 D;  3LZ0 A;  3KWQ B;  2BYK B;  1M18 C;  4EO5 B;  3AZH B;  3X1V D;  4ZUX B;  2Y2M A;  1P3F A;  3UT9 C;  4Z66 D;  3AV2 D;  5B0Y A;  4QLC D;  5CPJ D;  1PZR A;  4G92 B;  1F66 B;  2L5A A;  1P3O D;  4XZQ B;  5AV9 C;  3TU4 A;  1P3P B;  3REJ D;  3AZG D;  2FJ7 A;  5GSU A;  1P3M C;  2JE5 A;  3H0L C;  3C1B C;  5AV8 A;  3KUY C;  3AN2 B;  5AY8 B;  5B31 B;  3R45 B;  3REH A;  4R8P A;  4H9S C;  5B0Z A;  1P3G C;  2NZD C;  3VH6 W;  3REK D;  1HQ3 D;  1P34 C;  3B6F D;  5B1M D;  3B6G C;  2JSS A;  3X1U C;  5DNN D;  4WZS B;  5GT3 D;  3MNN B;  3AYW D;  3AZM B;  4X23 C;  4J8W B;  1P3K D;  4H9O B;  3C1C D;  4WU8 C;  3AZJ C;  2ARO D;  5BNV B;  5AVB C;  3LEL C;  4WJ3 C;  3LJA C;  3AV1 B;  2PYO B;  2DF4 C;  3UTB A;  1BH9 A;  5B2J D;  3W97 A;  4WU9 D;  4CAY B;  3AZK A;  1P3L A;  3WTP B;  3X1S D;  2HIO D;  3W99 D;  5AV5 D;  3REI D;  2F8N H;  5E5A A;  5B0Y B;  3MVD A;  2ZM5 A;  4J8V A;  1M18 B;  1M1A A;  2G5I C;  1S32 D;  1KX5 D;  4KUD C;  1Q9C A;  3TU4 B;  4YS3 B;  5AV6 A;  1P3I A;  3UT9 B;  3W98 B;  1TZY C;  2BYM A;  3AZF B;  3AZI A;  3W96 D;  1P3B A;  3LZ1 A;  5AV8 B;  2Y2O A;  4XUJ A;  3WA9 C;  2NQB A;  5F99 A;  4R8P B;  5B0Z B;  3AZN B;  2RVQ D;  4DRA A;  4J8X A;  1ID3 A;  1KU5 A;  1WWS A;  3EPK A;  3REL C;  5B2I A;  1P3F D;  5B32 C;  4E45 A;  3KXB C;  5JA4 A;  3X1V C;  4J8U A;  5AVC D;  3V9R A;  4Z66 C;  3AV2 C;  4QLC C;  5CPJ C;  5B1L D;  1KX3 D;  2FJ7 D;  3AZJ B;  5GSU D;  4HGA B;  1AOI B;  3W97 B;  5AVB B;  1P3O C;  1P3L B;  3REJ C;  2BYK A;  5E5A B;  2Y2G A;  3MVD B;  4J8V B;  4LD9 A;  3WKJ D;  4ZUX A;  3AFA C;  1F66 A;  4G91 C;  2RIQ A;  5JRG D;  3MGP A;  3UTA C;  3REK C;  1HQ3 C;  3AZI B;  2Y2J A;  3LZ1 B;  5B1M C;  2IO5 B;  2Y2L A;  5DNN C;  2XD5 A;  1TZY B;  5GT3 C;  3MGQ A;  3AYW C;  3AN2 A;  5AY8 A;  1P3K C;  3R45 A;  4JJN D;  1ID3 B;  4KGC B;  5CPK D;  5GT0 D;  2ARO C;  3AZK D;  5CP6 D;  1M19 D;  2LY8 A;  1KX4 D;  3EPJ A;  4Z5T B;  5B2I B;  5C3I C;  5B33 D;  3MGS C;  3O62 C;  1M1A D;  5GXQ C;  5B2J C;  3MNN A;  4WU9 C;  3AZM A;  4J8W A;  3X1S C;  4DRB A;  2HIO C;  3W99 C;  5AV6 D;  3REI C;  4J8U B;  1P3I D;  1KX5 C;  1S32 C;  4YM6 C;  1U35 B;  3KXB B;  4UUZ A;  1T3U A;  4XUJ D;  4H9R B;  2NQB D;  3VH5 W;  4CAY A;  5CPI A;  5CPJ B;  5BT1 D;  3X1T D;  3WTP A;  3AZL D;  4LD9 B;  2Y2H A;  1P3A C;  3W96 C;  4J8X D;  3A6N D;  3H0R C;  5B24 D;  1M18 A;  4H9N B;  3MGP B;  4YS3 A;  2F2A C;  2RVQ C;  3AFA B;  3UT9 A;  3W98 A;  1EQZ D;  4G91 B;  4KHA A;  4WV4 B;  1ZLA B;  3AZF A;  2BG1 A;  5AV9 A;  3UTA B;  3MGQ B;  3MGR C;  1H3O B;  3WAA D;  2FFF B;  3AZN A;  5B40 B;  1P3M A;  3KWQ D;  5GT3 B;  5AVC C;  5B1L C;  1KX3 C;  1BFM A;  5GSU C;  4H9S A;  3AZH D;  1P3G A;  2Y2P A;  2NZD A;  1P34 A;  1F66 D;  3KFU G;  2JCH A;  3AZE C;  3MGS B;  4XZQ D;  1P3P D;  3O62 B;  3X1U A;  2W8S A;  5GXQ B;  3NQU A;  3WKJ C;  4X23 A;  5DNM C;  4WU8 A;  4UUZ B;  3REI B;  3AZJ A;  1AOI A;  5JRG C;  5AVB A;  5CPI B;  3AN2 D;  4YM6 B;  5AY8 D;  5B31 D;  3EPL A;  4E44 A;  1P3A B;  4JJN C;  5CPK C;  5GT0 C;  4KHA B;  5CP6 C;  3AZM D;  1M19 C;  1ULY A;  3B0C W;  1KX4 C;  5AV9 B;  5B32 G;  2Y2K A;  5B33 C;  3VH6 T;  1M1A C;  1TZY A;  3AV1 D;  2PYO D;  4ZBJ C;  1P3M B;  3A1K A;  3LZ0 D;  5BS7 C;  3C1B B;  3KUY B;  4KGC A;  3MGR B;  1F1E A;  3WA9 A;  2CV5 C;  2CWE A;  2DQN C;  4Z5T A;  1P3G B;  2NZD B;  1P34 B;  5B0Y D;  4NE5 A;  4XUJ C;  3B6G B;  4YS3 D;  3TU4 D;  3X1T C;  1KX3 B;  3X1U B;  3AZL C;  3NQU B;  4M6B A;  1WWI A;  4X23 B;  3UT9 D;  3W98 D;  5B32 A;  3A6N C;  4WU8 B;  5B24 C;  2J8P A;  3AZE B;  2Y2Q A;  3NQJ A;  3AZF D;  1U35 A;  5AV8 D;  3KXB A;  3LEL B;  3LJA B;  5DNM B;  4H9R A;  4Z66 A;  3REH D;  3AV2 A;  4QLC A;  4R8P D;  5CPJ A;  3AZG C;  1EQZ C;  5B0Z D;  3AZN D;  1P3O A;  3REJ A;  3WAA C;  3H0M C;  4H9N A;  3EG5 B;  1A7W A;  4Z2M H;  4KUD B;  3KWQ C;  3AFA A;  3B6F C;  4H9P B;  1ZLA A;  5CPK B;  4EO5 C;  3UTA A;  3AZH C;  1M19 B;  5BO0 A;  1H3O A;  1HQ3 A;  3C1C C;  4G92 C;  3REK A;  3UTB D;  1F66 C;  3AZJ D;  1AOI D;  3W97 D;  4XZQ C;  5KDM B;  5B40 A;  1P3L D;  1P3P C;  3WA9 B;  2Y2N A;  5GT3 A;  3AYW A;  1P3K A;  5E5A D;  3MVD D;  3AL0 C;  1KX4 B;  1HTA A;  3B0D C;  4J8V D;  2ARO A;  2F8N B;  2XD1 A;  4UPK A;  2CV5 B;  5AV5 C;  5AY8 C;  5B31 C;  3REL B;  1JFI B;  5B32 B;  1BH8 A;  3MGS A;  3O62 A;  2HUE C;  5B2J A;  5GXQ A;  3NQJ B;  3P5J B;  5BNX A;  5FUG B;  3AZI D;  4WU9 A;  1P3B D;  3LZ1 D;  3X1S A;  3W99 A;  3REI A;  3X1V B;  4Z66 B;  3AV2 B;  5F99 D;  4QLC B;  1TZY D;  1KX5 A;  1S32 A;  4YM6 A;  1P3O B;  1ID3 D;  4KGC D;  3REJ B;  1EQZ B;  1B67 A;  3AZG B;  4Z5T D;  3AV1 C;  2PYO C;  5B2I D;  1P3A A;  3LZ0 C;  4J8U D;  5BO0 B;  3REK B;  1HQ3 B;  2ZY3 A;  5G49 A;  5B0Y C;  1P3F C;  3B6F B;  5B1M B;  1U35 D;  4YS3 C;  3TU4 C;  3KXB D;  5DNN B;  1R4V A;  3C1B A;  3KUY A;  3AYW B;  3MGR A;  3W98 C;  1P3K B;  3C1C B;  2FJ7 C;  4LD9 D;  2ARO B;  3AZF C;  4CSR B;  4ZUX D;  5AV8 C;  5AVC A;  3B6G A;  2Y2I A;  5C3I B;  3REH C;  1BH8 B;  4R8P C;  5B1L A;  3MGP D;  3B0D B;  3FDD A;  1KX3 A;  5B2J B;  5B0Z C;  1B6W A;  3AZN C;  4WU9 B;  5BNX B;  4H9Q A;  3VH5 T;  3X1S B;  2HIO B;  3AFA D;  5AV5 B;  3W99 B;  1ZLA D;  3AZE A;  4WNN B;  3UTA D;  3MGQ D;  1KX5 B;  2HUE B;  3LEL A;  1S32 B;  3WKJ A;  3LJA A;  2G5H C;  5DNM A;  2UWX A;  5JRG A;  5B40 D;  2YFV A;  3A1I A;  3UTB C;  2YFW B;  3W96 B;  2F8N G;  1AOI C;  4HGA C;  3MNN D;  1N1J B;  3W97 C;  3AZK C;  1P3L C;  4J8W D;  4KUD A;  4H9P A;  5E5A C;  5G49 B;  3LZ0 B;  3VH5 A;  3MVD C;  3MGS D;  4JJN A;  3O62 D;  4J8V C;  5CPK A;  5GXQ D;  5GT0 A;  1TAF A;  4NE6 A;  1Z2C B;  5CP6 A;  1M19 A;  5AV6 C;  1KX4 A;  1P3I C;  1P3F B;  5B33 A;  5KDM A;  5CPI D;  3WTP D;  4YM6 D;  3WTP E;  3AZI C;  1P3B C;  3LZ1 C;  2IO5 C;  5BS7 A;  5AVC B;  4DQY B;  1M18 D;  2F8N A;  2NQB C;  5F99 C;  5B1L B;  5BT1 C;  2FJ7 B;  2CV5 A;  5GSU B;  4AWL C;  1P3A D;  4J8X C;  3B0B A;  3REL A;  4H9Q B;  1JFI A;  1ID3 C;  4KGC C;  3REH B;  3VH6 A;  5FUG A;  5AV9 D;  4Z5T C;  3X1T A;  5CHL B;  3AZL A;  5B2I C;  3X1V A;  3WKJ B;  3IP4 C;  3A6N A;  5B24 A;  5JRG B;  1P3M D;  2YFV B;  3KUY D;  3C1B D;  4J8U C;  3MGR D;  3B0C T;  1EQZ A;  3AZG A;  1U35 C;  1P3G D;  2NZD D;  1P34 D;  3B6G D;  3UTB B;  1BH9 B;  2ZY5 A;  4JJN B;  3WAA A;  3EPH A;  3X1U D;  5GT0 B;  4LD9 C;  1TAF B;  3AZK B;  5CP6 B;  4NE3 A;  4ZUX C;  4X23 D;  2F8N K;  3KWQ A;  5B31 G;  4WU8 D;  3B6F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...