3AV2C

The human nucleosome structure containing the histone variant h3.3
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
105
structure length
105
Chain Sequence
b'AKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.3
molecule tags Structural protein/dna
source organism Homo sapiens
publication title Structures of human nucleosomes containing major histone H3 variants
pubmed doi rcsb
total genus 30
structure length 105
sequence length 105
chains with identical sequence G
ec nomenclature
pdb deposition date 2011-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3av2C00
5GXQA 1KX4C 5DNMC 2NZDC 3NQJB 3LELD 3WAAA 3W98C 5B0ZC 1F66A 4H9NA 4QLCD 5JRGB 4XUJB 3LJAA 1P3MD 3UTAB 4J8WA 1KX3B 3X1UC 4WZSB 1M19C 4NFTA 3W97B 3MVDC 3AZGC 3AYWC 2BYKA 5B0ZA 5B0ZD 3AV2A 3B6GB 3WA9C 1KX5B 2AROD 1AOIB 5CPIB 5GSUA 2PYOC 5FUGB 1P3PD 3X1SA 3R45B 5AV5C 3WTPC 5B31D 3MGQC 4J8XB 3AZMA 3LJAD 1P3PC 4XUJA 3LZ0B 3LELA 1P3FA 4DRBA 5B1MB 2F8NG 5B2IA 5BS7A 1P3OD 1BH8A 5GT3C 1M1AC 3W96C 4JJNC 3UTAD 4G91C 1P3BB 4ZUXB 4XUJD 3AZNC 5CPJC 4X23A 3B6FC 4YM6D 4KGCA 1M18B 3VH5A 3AZHD 3REJB 2RVQC 2AROA 5CP6A 1EQZD 5GT3D 3REKD 1F66C 3AZLA 3AFAA 2F8NA 5B1LB 3C1CA 3AV2D 4E44A 1P3BD 3UTBD 2F8NK 4LD9A 5DNMD 1P34D 1KX4A 1P3OB 2AROC 1P3FB 5CP6C 4J8UA 3LZ0D 1ID3A 5B0YB 5B31B 5AY8B 5CPIA 1M19A 3MGPC 2HIOC 5FUGA 4AWLC 1AOIA 5CPID 4KHAA 3AZEA 3AZGD 3X1UD 5B0ZB 3AZMB 4H9SC 3AZFB 1P3AC 5B2JB 5CPKA 4R8PD 2BYMA 4Z2MH 4J8UD 3O62D 4QLCC 5B33D 3X1SC 3A6NA 3REIA 3UTBA 4KUDA 3AV1A 1TZYD 4HGAC 3B6FA 3AZLD 3AV1D 4WU8C 4KGCB 5BS7C 5B33A 3AZKD 3UT9A 5E5AC 2CV5B 4KGCD 5AV6A 2FJ7C 3AZLB 1U35A 4X23C 5B31G 3AZFA 3W99C 3KXBC 2FJ7D 1P34B 5DNMB 5GT0C 3AZIB 1M19D 5B40A 5B31A 4DRAA 4M6BA 3AZFD 3W97C 1HTAA 5KDMB 3AZMD 1EQZB 3X1UB 3W98D 4WU9B 4Z5TB 5AV6D 3WKJD 3KUYA 1ULYA 1KX4D 5B40C 4ZUXD 5AVCB 5JA4B 5AY8D 5DNNB 3B0CW 5AY8A 2HIOA 3AFAD 5B1MD 3B0BA 4H9PB 3LZ0C 3REJA 3MGSD 4J8XC 5AY8C 4XZQA 1P3PB 4QLCA 2YFWB 5GT3B 5AV8C 2HIOB 2F8NB 3NQUB 3AZGA 3AZED 1P3LB 3UTBC 5BO0A 5AV6C 3A6NC 3REIC 2FJ7A 3REHA 1B6WA 2NQBD 1HQ3C 3AZMC 3MNNC 3MGRB 4R8PC 4XZQC 5B32A 1ZLAB 5B33C 5GSUC 2PYOA 2HUEB 5C3IC 4CSRB 3X1SB 1KX3D 5GXQC 2HIOD 3KXBA 3W99A 1P3FC 3AZEB 5B2IC 1P3LD 2F8ND 4Z5TA 3LZ1D 4J8WC 3RELD 3B0CT 5F99B 3AFAB 3KWQC 5B32B 1P34C 1P3OA 3X1VB 1P3KD 4J8UC 2BYKB 3V9RA 1KX4B 4G92B 3AZHC 5JRGD 4QLCB 1ID3D 4WU9D 2CV5A 1KU5A 3MVDD 3WTPA 3B0DC 4H9PA 1WWSA 3AZID 4WU8B 3MNNA 4J8XA 3NQJA 4JJND 1P3BA 4KHAB 3W96D 3LELC 4LD9D 4HGAB 3MNND 3AYWB 5AV8A 3KSYA 5E5AB 2YFWA 2CV5C 4KUDD 3WTPD 5CPKB 5B24D 3WA9B 2BYMB 5CPJA 4YS3B 2CV5D 4ZBJC 2PYOD 4YM6A 3KXBB 3AZJC 1JFIA 3W99B 5BNVA 5AV9A 5AV5B 3KUYB 1TAFA 5G49A 1F66D 1P3KA 5AV8B 4Z66A 5B2ID 4CSRA 1KX5A 5B1MC 5GXQD 1HQ3B 4CAYA 4WU8A 3MNNB 3AYWD 1U35D 1S32B 1P3GA 2YFVA 4R8PB 1M1AD 3RELA 4WU9C 1U35B 4Z5TC 3UT9C 1HQ3D 4J8VA 1BH9A 2LY8A 3WKJC 5B40B 3KWQD 5AV8D 5DNNC 1BH8B 5BT1C 1A7WA 1F66B 3KWQA 5B1LC 1KX3A 3AZEC 3MGSC 5B0YD 4WNNA 4YS3D 4H9OB 1P3AA 3WA9D 5B32D 5CPKD 1B67A 2JSSA 2NQBA 3TU4A 1S32A 1P3GB 3AV2B 3RELB 3AZKC 3C1BA 3REKB 3UTBB 3MGPB 3X1TD 4Z66D 4AWLB 3R45A 3AN2D 3REJD 4G92C 3AZHB 5C3IB 1M18D 5E5AA 4Z66B 1ID3B 5GSUB 5B2JC 4EO5B 2NZDD 3X1SD 4YM6B 1JFIB 3B0DB 5B24A 5AV9B 3O62C 3REHB 5KDMA 5GT0D 3AN2C 2NQBB 5GT3A 3W96A 4J8XD 4JJNA 4KGCC 3LJAB 3AZNA 4J8WB 4ZBJB 2YFVB 5B32C 1R4VA 4R8PA 3KUYC 3VH6T 4J8VC 3AFAC 3KWQB 1KX5D 3X1TA 3X1VC 5BT1D 5DNNA 3W97D 5GT0B 3MGSA 3MGRD 1S32C 1ZLAD 1P3AD 4H9RB 3UT9D 1EQZC 5CHLB 4UUZA 2L5AA 1P3MB 3WKJB 1P3IA 2IO5B 3B6GC 3B6FD 3TU4C 3VH6A 3LELB 1AOIC 2PYOB 4YS3C 3MGSB 3C1BB 3MGPD 3REKA 3AZJB 4H9SA 5CPKC 3O62A 3WTPB 3MGQB 1P3GD 5E5AD 1P3MA 3VH5W 3AN2A 3AYWA 4WU8D 3WAAD 3C1BD 4KUDC 5DNND 3LZ1C 3AZKB 5B24C 1P3BC 3AZNB 1P3LC 3B6FB 1M18C 3AV1B 5AV6B 1TZYB 3AZND 4Z66C 1U35C 3UT9B 1WWIA 4XZQB 3X1VA 1P3PA 5B33B 4YM6C 3V9RB 5B1MA 3AZJA 2F8NH 5AV9C 3O62B 3WAAB 4CAYB 1P3KC 1P3OC 5GXQB 1N1JB 5CP6D 1EQZA 3A6ND 4Z2MG 3REID 4UUZB 4H9QA 3AZJD 3WKJA 5B2IB 3AZHA 5JA4A 5B0YC 5AVCA 5BNXB 1P3GC 3W98A 4J8WD 5AV5D 3RELC 1BFMA 3REKC 3X1UA 3VH6W 3WTPE 4LD9C 4E45A 3AV2C 1P3IB 1P3FD 3TU4D 4H9QB 1P3AB 4WNNB 5JRGC 3B6GA 5B1LA 5AV5A 4J8UB 4H9OA 3UTAC 1KX3C 5AV9D 3MGQD 4YS3A 1ID3C 5CPJD 4XUJC 3AZKA 3WA9A 5GSUD 3MVDB 3NQUA 3AZGB 1P3LA 1P3MC 3AN2B 1H3OA 2NQBC 1TZYA 3X1TB 1KX5C 3C1BC 5AVBC 3X1VD 1HQ3A 4J8VD 4NE3A 1M18A 4WU9A 5F99D 1BH9B 3C1CC 3REHD 4J8VB 3AZIC 3LZ1B 2NZDB 1AOID 2CWEA 1F1EA 3W98B 4G91B 5F99A 5CPJB 1N1JA 1M19B 4ZUXC 2IO5C 5AVCC 3MGPA 5B0YA 5DNMA 3WAAC 1P34A 5GT0A 3TU4B 4NE5A 1P3ID 5BO0B 4ZUXA 5CPIC 1Q9CA 3MVDA 3KUYD 3MGRA 4H9NB 5JRGA 1ZLAA 2AROB 3UTAA 5B2JA 5CP6B 3B6GD 4X23D 5B40D 5B24B 5AVBA 3A6NB 3REIB 4KUDB 1P3IC 1H3OB 5AVBD 1TZYC 1M1AB 3MGRC 4XZQD 4JJNB 1S32D 1ZLAC 5B2JD 3W96B 3MGQA 3AV1C 2HUEC 4WV4B 4NE6A 5BNVB 3LZ0A 1TAFB 5AVCD 3REJC 3AZFC 3LZ1A 5BNXA 2RVQD 3VH5T 4EO5C 4Z5TD 3X1TC 3W99D 3KXBD 3C1CD 3REHC 1P3KB 4H9RA 5G49B 3AZIA 5AVBB 2NZDA 5F99C 2FJ7B 3AZLC 5B32G 3LJAC 1M1AA 4X23B 4LD9B 5B31C 5B1LD 3C1CB 3W97A
chains in the Genus database with same CATH superfamily
5GXQA 3KFUG 1KX4C 5DNMC 2NZDC 3NQJB 3LELD 3WAAA 2Y2HA 3W98C 5B0ZC 1F66A 4H9NA 4QLCD 5JRGB 4XUJB 3LJAA 1P3MD 3UTAB 4J8WA 1KX3B 3X1UC 4WZSB 1M19C 4NFTA 3W97B 3MVDC 3AZGC 3F6TA 3AYWC 2BYKA 5B0ZA 5B0ZD 3AV2A 3B6GB 3WA9C 1KX5B 2AROD 1AOIB 5CPIB 5GSUA 2JE5A 2PYOC 5FUGB 1P3PD 3X1SA 2ZY2A 3R45B 5AV5C 3WTPC 5B31D 2FFFB 3MGQC 4J8XB 3AZMA 3LJAD 1P3PC 4XUJA 3LZ0B 3LELA 1P3FA 4DRBA 5B1MB 2F8NG 5B2IA 5BS7A 1P3OD 1BH8A 5GT3C 1M1AC 3W96C 4JJNC 3UTAD 4G91C 1P3BB 4ZUXB 4XUJD 3AZNC 5CPJC 4X23A 3B6FC 4YM6D 4KGCA 1M18B 3VH5A 3AZHD 3REJB 2RVQC 2AROA 3FDDA 5CP6A 1EQZD 5GT3D 3REKD 1F66C 3AZLA 3AFAA 2F8NA 5B1LB 3C1CA 3AV2D 4E44A 1P3BD 3UTBD 2F8NK 4LD9A 5DNMD 1P34D 2RIQA 1P3OB 1KX4A 1T3UA 2AROC 1P3FB 5CP6C 4J8UA 3LZ0D 2Y2JA 1ID3A 5B0YB 5B31B 5AY8B 5CPIA 1M19A 3MGPC 2HIOC 5FUGA 4AWLC 1AOIA 5CPID 4KHAA 3AZEA 3AZGD 3X1UD 3H0MC 5B0ZB 3AZMB 4H9SC 3AZFB 1P3AC 5B2JB 5CPKA 4R8PD 2BYMA 4Z2MH 4J8UD 3O62D 4QLCC 5B33D 3X1SC 3A6NA 3REIA 3UTBA 4KUDA 3AV1A 1TZYD 2JCHA 4HGAC 3B6FA 3AZLD 3AV1D 4WU8C 4KGCB 5BS7C 5B33A 3AZKD 3UT9A 5E5AC 2CV5B 4KGCD 5AV6A 2FJ7C 3AZLB 1U35A 5B31G 4X23C 3AZFA 3W99C 3KXBC 2FJ7D 2F2AC 1P34B 5DNMB 5GT0C 3AZIB 1M19D 5B40A 5B31A 4DRAA 3IP4C 4M6BA 3AZFD 3W97C 1HTAA 5KDMB 3AZMD 1EQZB 3X1UB 2ZY3A 4WU9B 3W98D 4Z5TB 5AV6D 3WKJD 3KUYA 1ULYA 1KX4D 5B40C 4ZUXD 5AVCB 5JA4B 2Y2GA 5AY8D 5DNNB 3B0CW 3EPJA 5AY8A 2HIOA 3AFAD 5B1MD 3B0BA 4H9PB 3LZ0C 3REJA 3MGSD 4J8XC 4UPKA 5AY8C 4XZQA 4QLCA 2YFWB 1P3PB 5GT3B 5AV8C 2HIOB 2F8NB 3NQUB 3AZGA 3AZED 1P3LB 3UTBC 3EPHA 5BO0A 5AV6C 3A6NC 3REIC 2FJ7A 3REHA 1B6WA 3A1KA 1HQ3C 3AZMC 2NQBD 3MNNC 3MGRB 4R8PC 4XZQC 5B32A 1ZLAB 5B33C 5GSUC 2PYOA 2HUEB 3EPKA 5C3IC 4CSRB 3X1SB 1KX3D 5GXQC 2HIOD 2G5IC 3KXBA 3W99A 1P3FC 3AZEB 5B2IC 1P3LD 2F8ND 4Z5TA 3LZ1D 4J8WC 3RELD 3B0CT 5F99B 3AFAB 3KWQC 5B32B 1P34C 1P3OA 3X1VB 1P3KD 4J8UC 2BYKB 3V9RA 1KX4B 2VQRA 4G92B 3AZHC 5JRGD 4QLCB 1ID3D 4WU9D 2CV5A 2Y2QA 1KU5A 3MVDD 3WTPA 3B0DC 4H9PA 1WWSA 3AZID 4WU8B 3MNNA 4J8XA 3NQJA 4JJND 1P3BA 4KHAB 3W96D 3LELC 4LD9D 4HGAB 3MNND 3AYWB 5AV8A 3KSYA 5E5AB 2YFWA 2CV5C 4KUDD 3WTPD 5CPKB 5B24D 3WA9B 2BYMB 5CPJA 4YS3B 2CV5D 4ZBJC 2PYOD 4YM6A 3KXBB 3AZJC 1JFIA 3W99B 5BNVA 5AV9A 1W2EA 5AV5B 3KUYB 1TAFA 5G49A 1F66D 1P3KA 5AV8B 4Z66A 5B2ID 4CSRA 1KX5A 5B1MC 5GXQD 1HQ3B 4CAYA 4WU8A 3MNNB 3AYWD 1U35D 3H0RC 1S32B 2YFVA 4R8PB 1P3GA 1M1AD 3RELA 4WU9C 1U35B 4Z5TC 3UT9C 1HQ3D 4J8VA 1BH9A 2LY8A 3WKJC 5B40B 3KWQD 2Y2LA 5DNNC 5AV8D 1BH8B 5BT1C 1A7WA 1F66B 3KWQA 5B1LC 1KX3A 3AZEC 3MGSC 5B0YD 4WNNA 4YS3D 4H9OB 1P3AA 3WA9D 5B32D 5CPKD 1B67A 3EPLA 2JSSA 2NQBA 2BG1A 3TU4A 1S32A 1P3GB 2UWXA 3RELB 3AV2B 3AZKC 3C1BA 3REKB 3UTBB 3MGPB 3X1TD 4Z66D 4AWLB 3R45A 3AN2D 3REJD 4G92C 3AZHB 5C3IB 1M18D 2Y2PA 5E5AA 4Z66B 1ID3B 5GSUB 5B2JC 4EO5B 2NZDD 3X1SD 4YM6B 1JFIB 3B0DB 2Y2MA 5AV9B 5B24A 3O62C 3REHB 5KDMA 1Z2CB 5GT0D 2XD5A 3AN2C 2NQBB 5GT3A 3W96A 4J8XD 4JJNA 4KGCC 3LJAB 3AZNA 4J8WB 4ZBJB 2YFVB 5B32C 1R4VA 4R8PA 3KUYC 3VH6T 4J8VC 3AFAC 3KWQB 2Y2NA 1KX5D 3X1TA 3X1VC 5BT1D 5DNNA 3W97D 5GT0B 3MGSA 3MGRD 1S32C 1ZLAD 1P3AD 4H9RB 3UT9D 1EQZC 3AL0C 5CHLB 2Y2KA 4UUZA 2L5AA 1P3MB 3WKJB 1P3IA 2IO5B 3B6GC 3B6FD 3TU4C 3VH6A 3LELB 2ZY4A 1AOIC 2PYOB 4YS3C 3MGSB 3C1BB 3MGPD 3REKA 3AZJB 4H9SA 5CPKC 3O62A 3WTPB 3MGQB 1P3GD 5E5AD 3EG5B 3VH5W 1P3MA 2XD1A 3AN2A 3AYWA 4WU8D 3WAAD 2ZM5A 3C1BD 4KUDC 5DNND 3LZ1C 3AZKB 5B24C 1P3BC 3AZNB 1P3LC 3B6FB 1M18C 3AV1B 5AV6B 1TZYB 3AZND 4Z66C 1U35C 3UT9B 1WWIA 4XZQB 3X1VA 1P3PA 5B33B 4YM6C 3V9RB 2ZY5A 5B1MA 3AZJA 2F8NH 5AV9C 3O62B 3WAAB 4DQYB 4CAYB 1P3KC 1P3OC 5GXQB 1N1JB 5CP6D 1EQZA 3A6ND 4Z2MG 3REID 4UUZB 4H9QA 3AZJD 3WKJA 5B2IB 3AZHA 5JA4A 5B0YC 5AVCA 5BNXB 1P3GC 3W98A 4J8WD 5AV5D 3RELC 1BFMA 3REKC 3X1UA 3VH6W 3WTPE 4LD9C 4E45A 3AV2C 1P3IB 1P3FD 3TU4D 4H9QB 1P3AB 2W8SA 4WNNB 5JRGC 3B6GA 5B1LA 5AV5A 4J8UB 4H9OA 3UTAC 1KX3C 5AV9D 4WJ3C 3MGQD 4YS3A 1ID3C 5CPJD 4XUJC 3AZKA 3WA9A 5GSUD 3A1IA 3P5JB 3MVDB 3NQUA 3AZGB 1P3LA 1P3MC 3H0LC 3AN2B 1H3OA 2NQBC 1TZYA 3X1TB 1KX5C 3C1BC 5AVBC 3X1VD 1HQ3A 4J8VD 4NE3A 1M18A 4WU9A 5F99D 1BH9B 3C1CC 3REHD 4J8VB 3AZIC 3LZ1B 2NZDB 1AOID 2CWEA 1F1EA 3W98B 4G91B 5F99A 5CPJB 1N1JA 1M19B 4ZUXC 2IO5C 5AVCC 3MGPA 5B0YA 2Y2IA 3WAAC 5DNMA 1P34A 5GT0A 3TU4B 4NE5A 1P3ID 1PZRA 2DQNC 5BO0B 4ZUXA 5CPIC 1Q9CA 3MVDA 3KUYD 3MGRA 4H9NB 5JRGA 2G5HC 1ZLAA 2AROB 3UTAA 5B2JA 5CP6B 3B6GD 4X23D 5B40D 5B24B 5AVBA 3A6NB 3REIB 4KUDB 1P3IC 1H3OB 5AVBD 1TZYC 1M1AB 3MGRC 4XZQD 4JJNB 1S32D 1ZLAC 2J8PA 5B2JD 3MGQA 3W96B 3AV1C 2HUEC 4WV4B 4NE6A 5BNVB 3LZ0A 1TAFB 5AVCD 3REJC 3AZFC 3LZ1A 5BNXA 2Y2OA 2RVQD 3VH5T 4EO5C 4Z5TD 3X1TC 3W99D 3KXBD 3C1CD 3REHC 1P3KB 4H9RA 5G49B 3AZIA 2DF4C 5AVBB 2NZDA 5F99C 2FJ7B 3AZLC 5B32G 3LJAC 1M1AA 4X23B 4LD9B 5B31C 5B1LD 3C1CB 3W97A
chains in the Genus database with same CATH topology
5GXQA 3KFUG 1KX4C 5DNMC 2NZDC 3NQJB 3LELD 3WAAA 2Y2HA 3W98C 5B0ZC 1F66A 4H9NA 4QLCD 5JRGB 4XUJB 3LJAA 1P3MD 3UTAB 4J8WA 1KX3B 3X1UC 4WZSB 1M19C 4NFTA 3W97B 3MVDC 3AZGC 3F6TA 3AYWC 2BYKA 5B0ZA 5B0ZD 3AV2A 3B6GB 3WA9C 1KX5B 2AROD 1AOIB 5CPIB 5GSUA 2JE5A 2PYOC 5FUGB 1P3PD 3X1SA 2ZY2A 3R45B 5AV5C 3WTPC 5B31D 2FFFB 3MGQC 4J8XB 3AZMA 3LJAD 1P3PC 4XUJA 3LZ0B 3LELA 1P3FA 4DRBA 5B1MB 2F8NG 5B2IA 5BS7A 1P3OD 1BH8A 5GT3C 1M1AC 3W96C 4JJNC 3UTAD 4G91C 1P3BB 4ZUXB 4XUJD 3AZNC 5CPJC 4X23A 3B6FC 4YM6D 4KGCA 1M18B 3VH5A 3AZHD 3REJB 2RVQC 2AROA 3FDDA 5CP6A 1EQZD 5GT3D 3REKD 1F66C 3AZLA 3AFAA 2F8NA 5B1LB 3C1CA 3AV2D 4E44A 1P3BD 3UTBD 2F8NK 4LD9A 5DNMD 1P34D 2RIQA 1P3OB 1KX4A 1T3UA 2AROC 1P3FB 5CP6C 4J8UA 3LZ0D 2Y2JA 1ID3A 5B0YB 5B31B 5AY8B 5CPIA 1M19A 3MGPC 2HIOC 5FUGA 4AWLC 1AOIA 5CPID 4KHAA 3AZEA 3AZGD 3X1UD 3H0MC 5B0ZB 3AZMB 4H9SC 3AZFB 1P3AC 5B2JB 5CPKA 4R8PD 2BYMA 4Z2MH 4J8UD 3O62D 4QLCC 5B33D 3X1SC 3A6NA 3REIA 3UTBA 4KUDA 3AV1A 1TZYD 2JCHA 4HGAC 3B6FA 3AZLD 3AV1D 4WU8C 4KGCB 5BS7C 5B33A 3AZKD 3UT9A 5E5AC 2CV5B 4KGCD 5AV6A 2FJ7C 3AZLB 1U35A 5B31G 4X23C 3AZFA 3W99C 3KXBC 2FJ7D 2F2AC 1P34B 5DNMB 5GT0C 3AZIB 1M19D 5B40A 5B31A 4DRAA 3IP4C 4M6BA 3AZFD 3W97C 1HTAA 5KDMB 3AZMD 1EQZB 3X1UB 2ZY3A 4WU9B 3W98D 4Z5TB 5AV6D 3WKJD 3KUYA 1ULYA 1KX4D 5B40C 4ZUXD 5AVCB 5JA4B 2Y2GA 5AY8D 5DNNB 3B0CW 3EPJA 5AY8A 2HIOA 3AFAD 5B1MD 3B0BA 4H9PB 3LZ0C 3REJA 3MGSD 4J8XC 4UPKA 5AY8C 4XZQA 4QLCA 2YFWB 1P3PB 5GT3B 5AV8C 2HIOB 2F8NB 3NQUB 3AZGA 3AZED 1P3LB 3UTBC 3EPHA 5BO0A 5AV6C 3A6NC 3REIC 2FJ7A 3REHA 1B6WA 3A1KA 1HQ3C 3AZMC 2NQBD 3MNNC 3MGRB 4R8PC 4XZQC 5B32A 1ZLAB 5B33C 5GSUC 2PYOA 2HUEB 3EPKA 5C3IC 4CSRB 3X1SB 1KX3D 5GXQC 2HIOD 2G5IC 3KXBA 3W99A 1P3FC 3AZEB 5B2IC 1P3LD 2F8ND 4Z5TA 3LZ1D 4J8WC 3RELD 3B0CT 5F99B 3AFAB 3KWQC 5B32B 1P34C 1P3OA 3X1VB 1P3KD 4J8UC 2BYKB 3V9RA 1KX4B 2VQRA 4G92B 3AZHC 5JRGD 4QLCB 1ID3D 4WU9D 2CV5A 2Y2QA 1KU5A 3MVDD 3WTPA 3B0DC 4H9PA 1WWSA 3AZID 4WU8B 3MNNA 4J8XA 3NQJA 4JJND 1P3BA 4KHAB 3W96D 3LELC 4LD9D 4HGAB 3MNND 3AYWB 5AV8A 3KSYA 5E5AB 2YFWA 2CV5C 4KUDD 3WTPD 5CPKB 5B24D 3WA9B 2BYMB 5CPJA 4YS3B 2CV5D 4ZBJC 2PYOD 4YM6A 3KXBB 3AZJC 1JFIA 3W99B 5BNVA 5AV9A 1W2EA 5AV5B 3KUYB 1TAFA 5G49A 1F66D 1P3KA 5AV8B 4Z66A 5B2ID 4CSRA 1KX5A 5B1MC 5GXQD 1HQ3B 4CAYA 4WU8A 3MNNB 3AYWD 1U35D 3H0RC 1S32B 2YFVA 4R8PB 1P3GA 1M1AD 3RELA 4WU9C 1U35B 4Z5TC 3UT9C 1HQ3D 4J8VA 1BH9A 2LY8A 3WKJC 5B40B 3KWQD 2Y2LA 5DNNC 5AV8D 1BH8B 5BT1C 1A7WA 1F66B 3KWQA 5B1LC 1KX3A 3AZEC 3MGSC 5B0YD 4WNNA 4YS3D 4H9OB 1P3AA 3WA9D 5B32D 5CPKD 1B67A 3EPLA 2JSSA 2NQBA 2BG1A 3TU4A 1S32A 1P3GB 2UWXA 3RELB 3AV2B 3AZKC 3C1BA 3REKB 3UTBB 3MGPB 3X1TD 4Z66D 4AWLB 3R45A 3AN2D 3REJD 4G92C 3AZHB 5C3IB 1M18D 2Y2PA 5E5AA 4Z66B 1ID3B 5GSUB 5B2JC 4EO5B 2NZDD 3X1SD 4YM6B 1JFIB 3B0DB 2Y2MA 5AV9B 5B24A 3O62C 3REHB 5KDMA 1Z2CB 5GT0D 2XD5A 3AN2C 2NQBB 5GT3A 3W96A 4J8XD 4JJNA 4KGCC 3LJAB 3AZNA 4J8WB 4ZBJB 2YFVB 5B32C 1R4VA 4R8PA 3KUYC 3VH6T 4J8VC 3AFAC 3KWQB 2Y2NA 1KX5D 3X1TA 3X1VC 5BT1D 5DNNA 3W97D 5GT0B 3MGSA 3MGRD 1S32C 1ZLAD 1P3AD 4H9RB 3UT9D 1EQZC 3AL0C 5CHLB 2Y2KA 4UUZA 2L5AA 1P3MB 3WKJB 1P3IA 2IO5B 3B6GC 3B6FD 3TU4C 3VH6A 3LELB 2ZY4A 1AOIC 2PYOB 4YS3C 3MGSB 3C1BB 3MGPD 3REKA 3AZJB 4H9SA 5CPKC 3O62A 3WTPB 3MGQB 1P3GD 5E5AD 3EG5B 3VH5W 1P3MA 2XD1A 3AN2A 3AYWA 4WU8D 3WAAD 2ZM5A 3C1BD 4KUDC 5DNND 3LZ1C 3AZKB 5B24C 1P3BC 3AZNB 1P3LC 3B6FB 1M18C 3AV1B 5AV6B 1TZYB 3AZND 4Z66C 1U35C 3UT9B 1WWIA 4XZQB 3X1VA 1P3PA 5B33B 4YM6C 3V9RB 2ZY5A 5B1MA 3AZJA 2F8NH 5AV9C 3O62B 3WAAB 4DQYB 4CAYB 1P3KC 1P3OC 5GXQB 1N1JB 5CP6D 1EQZA 3A6ND 4Z2MG 3REID 4UUZB 4H9QA 3AZJD 3WKJA 5B2IB 3AZHA 5JA4A 5B0YC 5AVCA 5BNXB 1P3GC 3W98A 4J8WD 5AV5D 3RELC 1BFMA 3REKC 3X1UA 3VH6W 3WTPE 4LD9C 4E45A 3AV2C 1P3IB 1P3FD 3TU4D 4H9QB 1P3AB 2W8SA 4WNNB 5JRGC 3B6GA 5B1LA 5AV5A 4J8UB 4H9OA 3UTAC 1KX3C 5AV9D 4WJ3C 3MGQD 4YS3A 1ID3C 5CPJD 4XUJC 3AZKA 3WA9A 5GSUD 3A1IA 3P5JB 3MVDB 3NQUA 3AZGB 1P3LA 1P3MC 3H0LC 3AN2B 1H3OA 2NQBC 1TZYA 3X1TB 1KX5C 3C1BC 5AVBC 3X1VD 1HQ3A 4J8VD 4NE3A 1M18A 4WU9A 5F99D 1BH9B 3C1CC 3REHD 4J8VB 3AZIC 3LZ1B 2NZDB 1AOID 2CWEA 1F1EA 3W98B 4G91B 5F99A 5CPJB 1N1JA 1M19B 4ZUXC 2IO5C 5AVCC 3MGPA 5B0YA 2Y2IA 3WAAC 5DNMA 1P34A 5GT0A 3TU4B 4NE5A 1P3ID 1PZRA 2DQNC 5BO0B 4ZUXA 5CPIC 1Q9CA 3MVDA 3KUYD 3MGRA 4H9NB 5JRGA 2G5HC 1ZLAA 2AROB 3UTAA 5B2JA 5CP6B 3B6GD 4X23D 5B40D 5B24B 5AVBA 3A6NB 3REIB 4KUDB 1P3IC 1H3OB 5AVBD 1TZYC 1M1AB 3MGRC 4XZQD 4JJNB 1S32D 1ZLAC 2J8PA 5B2JD 3MGQA 3W96B 3AV1C 2HUEC 4WV4B 4NE6A 5BNVB 3LZ0A 1TAFB 5AVCD 3REJC 3AZFC 3LZ1A 5BNXA 2Y2OA 2RVQD 3VH5T 4EO5C 4Z5TD 3X1TC 3W99D 3KXBD 3C1CD 3REHC 1P3KB 4H9RA 5G49B 3AZIA 2DF4C 5AVBB 2NZDA 5F99C 2FJ7B 3AZLC 5B32G 3LJAC 1M1AA 4X23B 4LD9B 5B31C 5B1LD 3C1CB 3W97A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GXQ A;  1KX4 C;  5DNM C;  2NZD C;  3NQJ B;  3LEL D;  3WAA A;  3W98 C;  5B0Z C;  1F66 A;  4H9N A;  4QLC D;  5JRG B;  4XUJ B;  3LJA A;  1P3M D;  3UTA B;  4J8W A;  1KX3 B;  3X1U C;  4WZS B;  1M19 C;  4NFT A;  3W97 B;  3MVD C;  3AZG C;  3AYW C;  2BYK A;  5B0Z A;  5B0Z D;  3AV2 A;  3B6G B;  3WA9 C;  1KX5 B;  2ARO D;  1AOI B;  5CPI B;  5GSU A;  2PYO C;  5FUG B;  1P3P D;  3X1S A;  3R45 B;  5AV5 C;  3WTP C;  5B31 D;  3MGQ C;  4J8X B;  3AZM A;  3LJA D;  1P3P C;  4XUJ A;  3LZ0 B;  3LEL A;  1P3F A;  4DRB A;  5B1M B;  2F8N G;  5B2I A;  5BS7 A;  1P3O D;  1BH8 A;  5GT3 C;  1M1A C;  3W96 C;  4JJN C;  3UTA D;  4G91 C;  1P3B B;  4ZUX B;  4XUJ D;  3AZN C;  5CPJ C;  4X23 A;  3B6F C;  4YM6 D;  4KGC A;  1M18 B;  3VH5 A;  3AZH D;  3REJ B;  2RVQ C;  2ARO A;  5CP6 A;  1EQZ D;  5GT3 D;  3REK D;  1F66 C;  3AZL A;  3AFA A;  2F8N A;  5B1L B;  3C1C A;  3AV2 D;  4E44 A;  1P3B D;  3UTB D;  2F8N K;  4LD9 A;  5DNM D;  1P34 D;  1KX4 A;  1P3O B;  2ARO C;  1P3F B;  5CP6 C;  4J8U A;  3LZ0 D;  1ID3 A;  5B0Y B;  5B31 B;  5AY8 B;  5CPI A;  1M19 A;  3MGP C;  2HIO C;  5FUG A;  4AWL C;  1AOI A;  5CPI D;  4KHA A;  3AZE A;  3AZG D;  3X1U D;  5B0Z B;  3AZM B;  4H9S C;  3AZF B;  1P3A C;  5B2J B;  5CPK A;  4R8P D;  2BYM A;  4Z2M H;  4J8U D;  3O62 D;  4QLC C;  5B33 D;  3X1S C;  3A6N A;  3REI A;  3UTB A;  4KUD A;  3AV1 A;  1TZY D;  4HGA C;  3B6F A;  3AZL D;  3AV1 D;  4WU8 C;  4KGC B;  5BS7 C;  5B33 A;  3AZK D;  3UT9 A;  5E5A C;  2CV5 B;  4KGC D;  5AV6 A;  2FJ7 C;  3AZL B;  1U35 A;  4X23 C;  5B31 G;  3AZF A;  3W99 C;  3KXB C;  2FJ7 D;  1P34 B;  5DNM B;  5GT0 C;  3AZI B;  1M19 D;  5B40 A;  5B31 A;  4DRA A;  4M6B A;  3AZF D;  3W97 C;  1HTA A;  5KDM B;  3AZM D;  1EQZ B;  3X1U B;  3W98 D;  4WU9 B;  4Z5T B;  5AV6 D;  3WKJ D;  3KUY A;  1ULY A;  1KX4 D;  5B40 C;  4ZUX D;  5AVC B;  5JA4 B;  5AY8 D;  5DNN B;  3B0C W;  5AY8 A;  2HIO A;  3AFA D;  5B1M D;  3B0B A;  4H9P B;  3LZ0 C;  3REJ A;  3MGS D;  4J8X C;  5AY8 C;  4XZQ A;  1P3P B;  4QLC A;  2YFW B;  5GT3 B;  5AV8 C;  2HIO B;  2F8N B;  3NQU B;  3AZG A;  3AZE D;  1P3L B;  3UTB C;  5BO0 A;  5AV6 C;  3A6N C;  3REI C;  2FJ7 A;  3REH A;  1B6W A;  2NQB D;  1HQ3 C;  3AZM C;  3MNN C;  3MGR B;  4R8P C;  4XZQ C;  5B32 A;  1ZLA B;  5B33 C;  5GSU C;  2PYO A;  2HUE B;  5C3I C;  4CSR B;  3X1S B;  1KX3 D;  5GXQ C;  2HIO D;  3KXB A;  3W99 A;  1P3F C;  3AZE B;  5B2I C;  1P3L D;  2F8N D;  4Z5T A;  3LZ1 D;  4J8W C;  3REL D;  3B0C T;  5F99 B;  3AFA B;  3KWQ C;  5B32 B;  1P34 C;  1P3O A;  3X1V B;  1P3K D;  4J8U C;  2BYK B;  3V9R A;  1KX4 B;  4G92 B;  3AZH C;  5JRG D;  4QLC B;  1ID3 D;  4WU9 D;  2CV5 A;  1KU5 A;  3MVD D;  3WTP A;  3B0D C;  4H9P A;  1WWS A;  3AZI D;  4WU8 B;  3MNN A;  4J8X A;  3NQJ A;  4JJN D;  1P3B A;  4KHA B;  3W96 D;  3LEL C;  4LD9 D;  4HGA B;  3MNN D;  3AYW B;  5AV8 A;  3KSY A;  5E5A B;  2YFW A;  2CV5 C;  4KUD D;  3WTP D;  5CPK B;  5B24 D;  3WA9 B;  2BYM B;  5CPJ A;  4YS3 B;  2CV5 D;  4ZBJ C;  2PYO D;  4YM6 A;  3KXB B;  3AZJ C;  1JFI A;  3W99 B;  5BNV A;  5AV9 A;  5AV5 B;  3KUY B;  1TAF A;  5G49 A;  1F66 D;  1P3K A;  5AV8 B;  4Z66 A;  5B2I D;  4CSR A;  1KX5 A;  5B1M C;  5GXQ D;  1HQ3 B;  4CAY A;  4WU8 A;  3MNN B;  3AYW D;  1U35 D;  1S32 B;  1P3G A;  2YFV A;  4R8P B;  1M1A D;  3REL A;  4WU9 C;  1U35 B;  4Z5T C;  3UT9 C;  1HQ3 D;  4J8V A;  1BH9 A;  2LY8 A;  3WKJ C;  5B40 B;  3KWQ D;  5AV8 D;  5DNN C;  1BH8 B;  5BT1 C;  1A7W A;  1F66 B;  3KWQ A;  5B1L C;  1KX3 A;  3AZE C;  3MGS C;  5B0Y D;  4WNN A;  4YS3 D;  4H9O B;  1P3A A;  3WA9 D;  5B32 D;  5CPK D;  1B67 A;  2JSS A;  2NQB A;  3TU4 A;  1S32 A;  1P3G B;  3AV2 B;  3REL B;  3AZK C;  3C1B A;  3REK B;  3UTB B;  3MGP B;  3X1T D;  4Z66 D;  4AWL B;  3R45 A;  3AN2 D;  3REJ D;  4G92 C;  3AZH B;  5C3I B;  1M18 D;  5E5A A;  4Z66 B;  1ID3 B;  5GSU B;  5B2J C;  4EO5 B;  2NZD D;  3X1S D;  4YM6 B;  1JFI B;  3B0D B;  5B24 A;  5AV9 B;  3O62 C;  3REH B;  5KDM A;  5GT0 D;  3AN2 C;  2NQB B;  5GT3 A;  3W96 A;  4J8X D;  4JJN A;  4KGC C;  3LJA B;  3AZN A;  4J8W B;  4ZBJ B;  2YFV B;  5B32 C;  1R4V A;  4R8P A;  3KUY C;  3VH6 T;  4J8V C;  3AFA C;  3KWQ B;  1KX5 D;  3X1T A;  3X1V C;  5BT1 D;  5DNN A;  3W97 D;  5GT0 B;  3MGS A;  3MGR D;  1S32 C;  1ZLA D;  1P3A D;  4H9R B;  3UT9 D;  1EQZ C;  5CHL B;  4UUZ A;  2L5A A;  1P3M B;  3WKJ B;  1P3I A;  2IO5 B;  3B6G C;  3B6F D;  3TU4 C;  3VH6 A;  3LEL B;  1AOI C;  2PYO B;  4YS3 C;  3MGS B;  3C1B B;  3MGP D;  3REK A;  3AZJ B;  4H9S A;  5CPK C;  3O62 A;  3WTP B;  3MGQ B;  1P3G D;  5E5A D;  1P3M A;  3VH5 W;  3AN2 A;  3AYW A;  4WU8 D;  3WAA D;  3C1B D;  4KUD C;  5DNN D;  3LZ1 C;  3AZK B;  5B24 C;  1P3B C;  3AZN B;  1P3L C;  3B6F B;  1M18 C;  3AV1 B;  5AV6 B;  1TZY B;  3AZN D;  4Z66 C;  1U35 C;  3UT9 B;  1WWI A;  4XZQ B;  3X1V A;  1P3P A;  5B33 B;  4YM6 C;  3V9R B;  5B1M A;  3AZJ A;  2F8N H;  5AV9 C;  3O62 B;  3WAA B;  4CAY B;  1P3K C;  1P3O C;  5GXQ B;  1N1J B;  5CP6 D;  1EQZ A;  3A6N D;  4Z2M G;  3REI D;  4UUZ B;  4H9Q A;  3AZJ D;  3WKJ A;  5B2I B;  3AZH A;  5JA4 A;  5B0Y C;  5AVC A;  5BNX B;  1P3G C;  3W98 A;  4J8W D;  5AV5 D;  3REL C;  1BFM A;  3REK C;  3X1U A;  3VH6 W;  3WTP E;  4LD9 C;  4E45 A;  3AV2 C;  1P3I B;  1P3F D;  3TU4 D;  4H9Q B;  1P3A B;  4WNN B;  5JRG C;  3B6G A;  5B1L A;  5AV5 A;  4J8U B;  4H9O A;  3UTA C;  1KX3 C;  5AV9 D;  3MGQ D;  4YS3 A;  1ID3 C;  5CPJ D;  4XUJ C;  3AZK A;  3WA9 A;  5GSU D;  3MVD B;  3NQU A;  3AZG B;  1P3L A;  1P3M C;  3AN2 B;  1H3O A;  2NQB C;  1TZY A;  3X1T B;  1KX5 C;  3C1B C;  5AVB C;  3X1V D;  1HQ3 A;  4J8V D;  4NE3 A;  1M18 A;  4WU9 A;  5F99 D;  1BH9 B;  3C1C C;  3REH D;  4J8V B;  3AZI C;  3LZ1 B;  2NZD B;  1AOI D;  2CWE A;  1F1E A;  3W98 B;  4G91 B;  5F99 A;  5CPJ B;  1N1J A;  1M19 B;  4ZUX C;  2IO5 C;  5AVC C;  3MGP A;  5B0Y A;  5DNM A;  3WAA C;  1P34 A;  5GT0 A;  3TU4 B;  4NE5 A;  1P3I D;  5BO0 B;  4ZUX A;  5CPI C;  1Q9C A;  3MVD A;  3KUY D;  3MGR A;  4H9N B;  5JRG A;  1ZLA A;  2ARO B;  3UTA A;  5B2J A;  5CP6 B;  3B6G D;  4X23 D;  5B40 D;  5B24 B;  5AVB A;  3A6N B;  3REI B;  4KUD B;  1P3I C;  1H3O B;  5AVB D;  1TZY C;  1M1A B;  3MGR C;  4XZQ D;  4JJN B;  1S32 D;  1ZLA C;  5B2J D;  3W96 B;  3MGQ A;  3AV1 C;  2HUE C;  4WV4 B;  4NE6 A;  5BNV B;  3LZ0 A;  1TAF B;  5AVC D;  3REJ C;  3AZF C;  3LZ1 A;  5BNX A;  2RVQ D;  3VH5 T;  4EO5 C;  4Z5T D;  3X1T C;  3W99 D;  3KXB D;  3C1C D;  3REH C;  1P3K B;  4H9R A;  5G49 B;  3AZI A;  5AVB B;  2NZD A;  5F99 C;  2FJ7 B;  3AZL C;  5B32 G;  3LJA C;  1M1A A;  4X23 B;  4LD9 B;  5B31 C;  5B1L D;  3C1C B;  3W97 A; 
#chains in the Genus database with same CATH topology
 5GXQ A;  3KFU G;  1KX4 C;  5DNM C;  2NZD C;  3NQJ B;  3LEL D;  3WAA A;  2Y2H A;  3W98 C;  5B0Z C;  1F66 A;  4H9N A;  4QLC D;  5JRG B;  4XUJ B;  3LJA A;  1P3M D;  3UTA B;  4J8W A;  1KX3 B;  3X1U C;  4WZS B;  1M19 C;  4NFT A;  3W97 B;  3MVD C;  3AZG C;  3F6T A;  3AYW C;  2BYK A;  5B0Z A;  5B0Z D;  3AV2 A;  3B6G B;  3WA9 C;  1KX5 B;  2ARO D;  1AOI B;  5CPI B;  5GSU A;  2JE5 A;  2PYO C;  5FUG B;  1P3P D;  3X1S A;  2ZY2 A;  3R45 B;  5AV5 C;  3WTP C;  5B31 D;  2FFF B;  3MGQ C;  4J8X B;  3AZM A;  3LJA D;  1P3P C;  4XUJ A;  3LZ0 B;  3LEL A;  1P3F A;  4DRB A;  5B1M B;  2F8N G;  5B2I A;  5BS7 A;  1P3O D;  1BH8 A;  5GT3 C;  1M1A C;  3W96 C;  4JJN C;  3UTA D;  4G91 C;  1P3B B;  4ZUX B;  4XUJ D;  3AZN C;  5CPJ C;  4X23 A;  3B6F C;  4YM6 D;  4KGC A;  1M18 B;  3VH5 A;  3AZH D;  3REJ B;  2RVQ C;  2ARO A;  3FDD A;  5CP6 A;  1EQZ D;  5GT3 D;  3REK D;  1F66 C;  3AZL A;  3AFA A;  2F8N A;  5B1L B;  3C1C A;  3AV2 D;  4E44 A;  1P3B D;  3UTB D;  2F8N K;  4LD9 A;  5DNM D;  1P34 D;  2RIQ A;  1P3O B;  1KX4 A;  1T3U A;  2ARO C;  1P3F B;  5CP6 C;  4J8U A;  3LZ0 D;  2Y2J A;  1ID3 A;  5B0Y B;  5B31 B;  5AY8 B;  5CPI A;  1M19 A;  3MGP C;  2HIO C;  5FUG A;  4AWL C;  1AOI A;  5CPI D;  4KHA A;  3AZE A;  3AZG D;  3X1U D;  3H0M C;  5B0Z B;  3AZM B;  4H9S C;  3AZF B;  1P3A C;  5B2J B;  5CPK A;  4R8P D;  2BYM A;  4Z2M H;  4J8U D;  3O62 D;  4QLC C;  5B33 D;  3X1S C;  3A6N A;  3REI A;  3UTB A;  4KUD A;  3AV1 A;  1TZY D;  2JCH A;  4HGA C;  3B6F A;  3AZL D;  3AV1 D;  4WU8 C;  4KGC B;  5BS7 C;  5B33 A;  3AZK D;  3UT9 A;  5E5A C;  2CV5 B;  4KGC D;  5AV6 A;  2FJ7 C;  3AZL B;  1U35 A;  5B31 G;  4X23 C;  3AZF A;  3W99 C;  3KXB C;  2FJ7 D;  2F2A C;  1P34 B;  5DNM B;  5GT0 C;  3AZI B;  1M19 D;  5B40 A;  5B31 A;  4DRA A;  3IP4 C;  4M6B A;  3AZF D;  3W97 C;  1HTA A;  5KDM B;  3AZM D;  1EQZ B;  3X1U B;  2ZY3 A;  4WU9 B;  3W98 D;  4Z5T B;  5AV6 D;  3WKJ D;  3KUY A;  1ULY A;  1KX4 D;  5B40 C;  4ZUX D;  5AVC B;  5JA4 B;  2Y2G A;  5AY8 D;  5DNN B;  3B0C W;  3EPJ A;  5AY8 A;  2HIO A;  3AFA D;  5B1M D;  3B0B A;  4H9P B;  3LZ0 C;  3REJ A;  3MGS D;  4J8X C;  4UPK A;  5AY8 C;  4XZQ A;  4QLC A;  2YFW B;  1P3P B;  5GT3 B;  5AV8 C;  2HIO B;  2F8N B;  3NQU B;  3AZG A;  3AZE D;  1P3L B;  3UTB C;  3EPH A;  5BO0 A;  5AV6 C;  3A6N C;  3REI C;  2FJ7 A;  3REH A;  1B6W A;  3A1K A;  1HQ3 C;  3AZM C;  2NQB D;  3MNN C;  3MGR B;  4R8P C;  4XZQ C;  5B32 A;  1ZLA B;  5B33 C;  5GSU C;  2PYO A;  2HUE B;  3EPK A;  5C3I C;  4CSR B;  3X1S B;  1KX3 D;  5GXQ C;  2HIO D;  2G5I C;  3KXB A;  3W99 A;  1P3F C;  3AZE B;  5B2I C;  1P3L D;  2F8N D;  4Z5T A;  3LZ1 D;  4J8W C;  3REL D;  3B0C T;  5F99 B;  3AFA B;  3KWQ C;  5B32 B;  1P34 C;  1P3O A;  3X1V B;  1P3K D;  4J8U C;  2BYK B;  3V9R A;  1KX4 B;  2VQR A;  4G92 B;  3AZH C;  5JRG D;  4QLC B;  1ID3 D;  4WU9 D;  2CV5 A;  2Y2Q A;  1KU5 A;  3MVD D;  3WTP A;  3B0D C;  4H9P A;  1WWS A;  3AZI D;  4WU8 B;  3MNN A;  4J8X A;  3NQJ A;  4JJN D;  1P3B A;  4KHA B;  3W96 D;  3LEL C;  4LD9 D;  4HGA B;  3MNN D;  3AYW B;  5AV8 A;  3KSY A;  5E5A B;  2YFW A;  2CV5 C;  4KUD D;  3WTP D;  5CPK B;  5B24 D;  3WA9 B;  2BYM B;  5CPJ A;  4YS3 B;  2CV5 D;  4ZBJ C;  2PYO D;  4YM6 A;  3KXB B;  3AZJ C;  1JFI A;  3W99 B;  5BNV A;  5AV9 A;  1W2E A;  5AV5 B;  3KUY B;  1TAF A;  5G49 A;  1F66 D;  1P3K A;  5AV8 B;  4Z66 A;  5B2I D;  4CSR A;  1KX5 A;  5B1M C;  5GXQ D;  1HQ3 B;  4CAY A;  4WU8 A;  3MNN B;  3AYW D;  1U35 D;  3H0R C;  1S32 B;  2YFV A;  4R8P B;  1P3G A;  1M1A D;  3REL A;  4WU9 C;  1U35 B;  4Z5T C;  3UT9 C;  1HQ3 D;  4J8V A;  1BH9 A;  2LY8 A;  3WKJ C;  5B40 B;  3KWQ D;  2Y2L A;  5DNN C;  5AV8 D;  1BH8 B;  5BT1 C;  1A7W A;  1F66 B;  3KWQ A;  5B1L C;  1KX3 A;  3AZE C;  3MGS C;  5B0Y D;  4WNN A;  4YS3 D;  4H9O B;  1P3A A;  3WA9 D;  5B32 D;  5CPK D;  1B67 A;  3EPL A;  2JSS A;  2NQB A;  2BG1 A;  3TU4 A;  1S32 A;  1P3G B;  2UWX A;  3REL B;  3AV2 B;  3AZK C;  3C1B A;  3REK B;  3UTB B;  3MGP B;  3X1T D;  4Z66 D;  4AWL B;  3R45 A;  3AN2 D;  3REJ D;  4G92 C;  3AZH B;  5C3I B;  1M18 D;  2Y2P A;  5E5A A;  4Z66 B;  1ID3 B;  5GSU B;  5B2J C;  4EO5 B;  2NZD D;  3X1S D;  4YM6 B;  1JFI B;  3B0D B;  2Y2M A;  5AV9 B;  5B24 A;  3O62 C;  3REH B;  5KDM A;  1Z2C B;  5GT0 D;  2XD5 A;  3AN2 C;  2NQB B;  5GT3 A;  3W96 A;  4J8X D;  4JJN A;  4KGC C;  3LJA B;  3AZN A;  4J8W B;  4ZBJ B;  2YFV B;  5B32 C;  1R4V A;  4R8P A;  3KUY C;  3VH6 T;  4J8V C;  3AFA C;  3KWQ B;  2Y2N A;  1KX5 D;  3X1T A;  3X1V C;  5BT1 D;  5DNN A;  3W97 D;  5GT0 B;  3MGS A;  3MGR D;  1S32 C;  1ZLA D;  1P3A D;  4H9R B;  3UT9 D;  1EQZ C;  3AL0 C;  5CHL B;  2Y2K A;  4UUZ A;  2L5A A;  1P3M B;  3WKJ B;  1P3I A;  2IO5 B;  3B6G C;  3B6F D;  3TU4 C;  3VH6 A;  3LEL B;  2ZY4 A;  1AOI C;  2PYO B;  4YS3 C;  3MGS B;  3C1B B;  3MGP D;  3REK A;  3AZJ B;  4H9S A;  5CPK C;  3O62 A;  3WTP B;  3MGQ B;  1P3G D;  5E5A D;  3EG5 B;  3VH5 W;  1P3M A;  2XD1 A;  3AN2 A;  3AYW A;  4WU8 D;  3WAA D;  2ZM5 A;  3C1B D;  4KUD C;  5DNN D;  3LZ1 C;  3AZK B;  5B24 C;  1P3B C;  3AZN B;  1P3L C;  3B6F B;  1M18 C;  3AV1 B;  5AV6 B;  1TZY B;  3AZN D;  4Z66 C;  1U35 C;  3UT9 B;  1WWI A;  4XZQ B;  3X1V A;  1P3P A;  5B33 B;  4YM6 C;  3V9R B;  2ZY5 A;  5B1M A;  3AZJ A;  2F8N H;  5AV9 C;  3O62 B;  3WAA B;  4DQY B;  4CAY B;  1P3K C;  1P3O C;  5GXQ B;  1N1J B;  5CP6 D;  1EQZ A;  3A6N D;  4Z2M G;  3REI D;  4UUZ B;  4H9Q A;  3AZJ D;  3WKJ A;  5B2I B;  3AZH A;  5JA4 A;  5B0Y C;  5AVC A;  5BNX B;  1P3G C;  3W98 A;  4J8W D;  5AV5 D;  3REL C;  1BFM A;  3REK C;  3X1U A;  3VH6 W;  3WTP E;  4LD9 C;  4E45 A;  3AV2 C;  1P3I B;  1P3F D;  3TU4 D;  4H9Q B;  1P3A B;  2W8S A;  4WNN B;  5JRG C;  3B6G A;  5B1L A;  5AV5 A;  4J8U B;  4H9O A;  3UTA C;  1KX3 C;  5AV9 D;  4WJ3 C;  3MGQ D;  4YS3 A;  1ID3 C;  5CPJ D;  4XUJ C;  3AZK A;  3WA9 A;  5GSU D;  3A1I A;  3P5J B;  3MVD B;  3NQU A;  3AZG B;  1P3L A;  1P3M C;  3H0L C;  3AN2 B;  1H3O A;  2NQB C;  1TZY A;  3X1T B;  1KX5 C;  3C1B C;  5AVB C;  3X1V D;  1HQ3 A;  4J8V D;  4NE3 A;  1M18 A;  4WU9 A;  5F99 D;  1BH9 B;  3C1C C;  3REH D;  4J8V B;  3AZI C;  3LZ1 B;  2NZD B;  1AOI D;  2CWE A;  1F1E A;  3W98 B;  4G91 B;  5F99 A;  5CPJ B;  1N1J A;  1M19 B;  4ZUX C;  2IO5 C;  5AVC C;  3MGP A;  5B0Y A;  2Y2I A;  3WAA C;  5DNM A;  1P34 A;  5GT0 A;  3TU4 B;  4NE5 A;  1P3I D;  1PZR A;  2DQN C;  5BO0 B;  4ZUX A;  5CPI C;  1Q9C A;  3MVD A;  3KUY D;  3MGR A;  4H9N B;  5JRG A;  2G5H C;  1ZLA A;  2ARO B;  3UTA A;  5B2J A;  5CP6 B;  3B6G D;  4X23 D;  5B40 D;  5B24 B;  5AVB A;  3A6N B;  3REI B;  4KUD B;  1P3I C;  1H3O B;  5AVB D;  1TZY C;  1M1A B;  3MGR C;  4XZQ D;  4JJN B;  1S32 D;  1ZLA C;  2J8P A;  5B2J D;  3MGQ A;  3W96 B;  3AV1 C;  2HUE C;  4WV4 B;  4NE6 A;  5BNV B;  3LZ0 A;  1TAF B;  5AVC D;  3REJ C;  3AZF C;  3LZ1 A;  5BNX A;  2Y2O A;  2RVQ D;  3VH5 T;  4EO5 C;  4Z5T D;  3X1T C;  3W99 D;  3KXB D;  3C1C D;  3REH C;  1P3K B;  4H9R A;  5G49 B;  3AZI A;  2DF4 C;  5AVB B;  2NZD A;  5F99 C;  2FJ7 B;  3AZL C;  5B32 G;  3LJA C;  1M1A A;  4X23 B;  4LD9 B;  5B31 C;  5B1L D;  3C1C B;  3W97 A; 
#chains in the Genus database with same CATH homology
 5GXQ A;  3KFU G;  1KX4 C;  5DNM C;  2NZD C;  3NQJ B;  3LEL D;  3WAA A;  2Y2H A;  3W98 C;  5B0Z C;  1F66 A;  4H9N A;  4QLC D;  5JRG B;  4XUJ B;  3LJA A;  1P3M D;  3UTA B;  4J8W A;  1KX3 B;  3X1U C;  4WZS B;  1M19 C;  4NFT A;  3W97 B;  3MVD C;  3AZG C;  3F6T A;  3AYW C;  2BYK A;  5B0Z A;  5B0Z D;  3AV2 A;  3B6G B;  3WA9 C;  1KX5 B;  2ARO D;  1AOI B;  5CPI B;  5GSU A;  2JE5 A;  2PYO C;  5FUG B;  1P3P D;  3X1S A;  2ZY2 A;  3R45 B;  5AV5 C;  3WTP C;  5B31 D;  2FFF B;  3MGQ C;  4J8X B;  3AZM A;  3LJA D;  1P3P C;  4XUJ A;  3LZ0 B;  3LEL A;  1P3F A;  4DRB A;  5B1M B;  2F8N G;  5B2I A;  5BS7 A;  1P3O D;  1BH8 A;  5GT3 C;  1M1A C;  3W96 C;  4JJN C;  3UTA D;  4G91 C;  1P3B B;  4ZUX B;  4XUJ D;  3AZN C;  5CPJ C;  4X23 A;  3B6F C;  4YM6 D;  4KGC A;  1M18 B;  3VH5 A;  3AZH D;  3REJ B;  2RVQ C;  2ARO A;  3FDD A;  5CP6 A;  1EQZ D;  5GT3 D;  3REK D;  1F66 C;  3AZL A;  3AFA A;  2F8N A;  5B1L B;  3C1C A;  3AV2 D;  4E44 A;  1P3B D;  3UTB D;  2F8N K;  4LD9 A;  5DNM D;  1P34 D;  2RIQ A;  1P3O B;  1KX4 A;  1T3U A;  2ARO C;  1P3F B;  5CP6 C;  4J8U A;  3LZ0 D;  2Y2J A;  1ID3 A;  5B0Y B;  5B31 B;  5AY8 B;  5CPI A;  1M19 A;  3MGP C;  2HIO C;  5FUG A;  4AWL C;  1AOI A;  5CPI D;  4KHA A;  3AZE A;  3AZG D;  3X1U D;  3H0M C;  5B0Z B;  3AZM B;  4H9S C;  3AZF B;  1P3A C;  5B2J B;  5CPK A;  4R8P D;  2BYM A;  4Z2M H;  4J8U D;  3O62 D;  4QLC C;  5B33 D;  3X1S C;  3A6N A;  3REI A;  3UTB A;  4KUD A;  3AV1 A;  1TZY D;  2JCH A;  4HGA C;  3B6F A;  3AZL D;  3AV1 D;  4WU8 C;  4KGC B;  5BS7 C;  5B33 A;  3AZK D;  3UT9 A;  5E5A C;  2CV5 B;  4KGC D;  5AV6 A;  2FJ7 C;  3AZL B;  1U35 A;  5B31 G;  4X23 C;  3AZF A;  3W99 C;  3KXB C;  2FJ7 D;  2F2A C;  1P34 B;  5DNM B;  5GT0 C;  3AZI B;  1M19 D;  5B40 A;  5B31 A;  4DRA A;  3IP4 C;  4M6B A;  3AZF D;  3W97 C;  1HTA A;  5KDM B;  3AZM D;  1EQZ B;  3X1U B;  2ZY3 A;  4WU9 B;  3W98 D;  4Z5T B;  5AV6 D;  3WKJ D;  3KUY A;  1ULY A;  1KX4 D;  5B40 C;  4ZUX D;  5AVC B;  5JA4 B;  2Y2G A;  5AY8 D;  5DNN B;  3B0C W;  3EPJ A;  5AY8 A;  2HIO A;  3AFA D;  5B1M D;  3B0B A;  4H9P B;  3LZ0 C;  3REJ A;  3MGS D;  4J8X C;  4UPK A;  5AY8 C;  4XZQ A;  4QLC A;  2YFW B;  1P3P B;  5GT3 B;  5AV8 C;  2HIO B;  2F8N B;  3NQU B;  3AZG A;  3AZE D;  1P3L B;  3UTB C;  3EPH A;  5BO0 A;  5AV6 C;  3A6N C;  3REI C;  2FJ7 A;  3REH A;  1B6W A;  3A1K A;  1HQ3 C;  3AZM C;  2NQB D;  3MNN C;  3MGR B;  4R8P C;  4XZQ C;  5B32 A;  1ZLA B;  5B33 C;  5GSU C;  2PYO A;  2HUE B;  3EPK A;  5C3I C;  4CSR B;  3X1S B;  1KX3 D;  5GXQ C;  2HIO D;  2G5I C;  3KXB A;  3W99 A;  1P3F C;  3AZE B;  5B2I C;  1P3L D;  2F8N D;  4Z5T A;  3LZ1 D;  4J8W C;  3REL D;  3B0C T;  5F99 B;  3AFA B;  3KWQ C;  5B32 B;  1P34 C;  1P3O A;  3X1V B;  1P3K D;  4J8U C;  2BYK B;  3V9R A;  1KX4 B;  2VQR A;  4G92 B;  3AZH C;  5JRG D;  4QLC B;  1ID3 D;  4WU9 D;  2CV5 A;  2Y2Q A;  1KU5 A;  3MVD D;  3WTP A;  3B0D C;  4H9P A;  1WWS A;  3AZI D;  4WU8 B;  3MNN A;  4J8X A;  3NQJ A;  4JJN D;  1P3B A;  4KHA B;  3W96 D;  3LEL C;  4LD9 D;  4HGA B;  3MNN D;  3AYW B;  5AV8 A;  3KSY A;  5E5A B;  2YFW A;  2CV5 C;  4KUD D;  3WTP D;  5CPK B;  5B24 D;  3WA9 B;  2BYM B;  5CPJ A;  4YS3 B;  2CV5 D;  4ZBJ C;  2PYO D;  4YM6 A;  3KXB B;  3AZJ C;  1JFI A;  3W99 B;  5BNV A;  5AV9 A;  1W2E A;  5AV5 B;  3KUY B;  1TAF A;  5G49 A;  1F66 D;  1P3K A;  5AV8 B;  4Z66 A;  5B2I D;  4CSR A;  1KX5 A;  5B1M C;  5GXQ D;  1HQ3 B;  4CAY A;  4WU8 A;  3MNN B;  3AYW D;  1U35 D;  3H0R C;  1S32 B;  2YFV A;  4R8P B;  1P3G A;  1M1A D;  3REL A;  4WU9 C;  1U35 B;  4Z5T C;  3UT9 C;  1HQ3 D;  4J8V A;  1BH9 A;  2LY8 A;  3WKJ C;  5B40 B;  3KWQ D;  2Y2L A;  5DNN C;  5AV8 D;  1BH8 B;  5BT1 C;  1A7W A;  1F66 B;  3KWQ A;  5B1L C;  1KX3 A;  3AZE C;  3MGS C;  5B0Y D;  4WNN A;  4YS3 D;  4H9O B;  1P3A A;  3WA9 D;  5B32 D;  5CPK D;  1B67 A;  3EPL A;  2JSS A;  2NQB A;  2BG1 A;  3TU4 A;  1S32 A;  1P3G B;  2UWX A;  3REL B;  3AV2 B;  3AZK C;  3C1B A;  3REK B;  3UTB B;  3MGP B;  3X1T D;  4Z66 D;  4AWL B;  3R45 A;  3AN2 D;  3REJ D;  4G92 C;  3AZH B;  5C3I B;  1M18 D;  2Y2P A;  5E5A A;  4Z66 B;  1ID3 B;  5GSU B;  5B2J C;  4EO5 B;  2NZD D;  3X1S D;  4YM6 B;  1JFI B;  3B0D B;  2Y2M A;  5AV9 B;  5B24 A;  3O62 C;  3REH B;  5KDM A;  1Z2C B;  5GT0 D;  2XD5 A;  3AN2 C;  2NQB B;  5GT3 A;  3W96 A;  4J8X D;  4JJN A;  4KGC C;  3LJA B;  3AZN A;  4J8W B;  4ZBJ B;  2YFV B;  5B32 C;  1R4V A;  4R8P A;  3KUY C;  3VH6 T;  4J8V C;  3AFA C;  3KWQ B;  2Y2N A;  1KX5 D;  3X1T A;  3X1V C;  5BT1 D;  5DNN A;  3W97 D;  5GT0 B;  3MGS A;  3MGR D;  1S32 C;  1ZLA D;  1P3A D;  4H9R B;  3UT9 D;  1EQZ C;  3AL0 C;  5CHL B;  2Y2K A;  4UUZ A;  2L5A A;  1P3M B;  3WKJ B;  1P3I A;  2IO5 B;  3B6G C;  3B6F D;  3TU4 C;  3VH6 A;  3LEL B;  2ZY4 A;  1AOI C;  2PYO B;  4YS3 C;  3MGS B;  3C1B B;  3MGP D;  3REK A;  3AZJ B;  4H9S A;  5CPK C;  3O62 A;  3WTP B;  3MGQ B;  1P3G D;  5E5A D;  3EG5 B;  3VH5 W;  1P3M A;  2XD1 A;  3AN2 A;  3AYW A;  4WU8 D;  3WAA D;  2ZM5 A;  3C1B D;  4KUD C;  5DNN D;  3LZ1 C;  3AZK B;  5B24 C;  1P3B C;  3AZN B;  1P3L C;  3B6F B;  1M18 C;  3AV1 B;  5AV6 B;  1TZY B;  3AZN D;  4Z66 C;  1U35 C;  3UT9 B;  1WWI A;  4XZQ B;  3X1V A;  1P3P A;  5B33 B;  4YM6 C;  3V9R B;  2ZY5 A;  5B1M A;  3AZJ A;  2F8N H;  5AV9 C;  3O62 B;  3WAA B;  4DQY B;  4CAY B;  1P3K C;  1P3O C;  5GXQ B;  1N1J B;  5CP6 D;  1EQZ A;  3A6N D;  4Z2M G;  3REI D;  4UUZ B;  4H9Q A;  3AZJ D;  3WKJ A;  5B2I B;  3AZH A;  5JA4 A;  5B0Y C;  5AVC A;  5BNX B;  1P3G C;  3W98 A;  4J8W D;  5AV5 D;  3REL C;  1BFM A;  3REK C;  3X1U A;  3VH6 W;  3WTP E;  4LD9 C;  4E45 A;  3AV2 C;  1P3I B;  1P3F D;  3TU4 D;  4H9Q B;  1P3A B;  2W8S A;  4WNN B;  5JRG C;  3B6G A;  5B1L A;  5AV5 A;  4J8U B;  4H9O A;  3UTA C;  1KX3 C;  5AV9 D;  4WJ3 C;  3MGQ D;  4YS3 A;  1ID3 C;  5CPJ D;  4XUJ C;  3AZK A;  3WA9 A;  5GSU D;  3A1I A;  3P5J B;  3MVD B;  3NQU A;  3AZG B;  1P3L A;  1P3M C;  3H0L C;  3AN2 B;  1H3O A;  2NQB C;  1TZY A;  3X1T B;  1KX5 C;  3C1B C;  5AVB C;  3X1V D;  1HQ3 A;  4J8V D;  4NE3 A;  1M18 A;  4WU9 A;  5F99 D;  1BH9 B;  3C1C C;  3REH D;  4J8V B;  3AZI C;  3LZ1 B;  2NZD B;  1AOI D;  2CWE A;  1F1E A;  3W98 B;  4G91 B;  5F99 A;  5CPJ B;  1N1J A;  1M19 B;  4ZUX C;  2IO5 C;  5AVC C;  3MGP A;  5B0Y A;  2Y2I A;  3WAA C;  5DNM A;  1P34 A;  5GT0 A;  3TU4 B;  4NE5 A;  1P3I D;  1PZR A;  2DQN C;  5BO0 B;  4ZUX A;  5CPI C;  1Q9C A;  3MVD A;  3KUY D;  3MGR A;  4H9N B;  5JRG A;  2G5H C;  1ZLA A;  2ARO B;  3UTA A;  5B2J A;  5CP6 B;  3B6G D;  4X23 D;  5B40 D;  5B24 B;  5AVB A;  3A6N B;  3REI B;  4KUD B;  1P3I C;  1H3O B;  5AVB D;  1TZY C;  1M1A B;  3MGR C;  4XZQ D;  4JJN B;  1S32 D;  1ZLA C;  2J8P A;  5B2J D;  3MGQ A;  3W96 B;  3AV1 C;  2HUE C;  4WV4 B;  4NE6 A;  5BNV B;  3LZ0 A;  1TAF B;  5AVC D;  3REJ C;  3AZF C;  3LZ1 A;  5BNX A;  2Y2O A;  2RVQ D;  3VH5 T;  4EO5 C;  4Z5T D;  3X1T C;  3W99 D;  3KXB D;  3C1C D;  3REH C;  1P3K B;  4H9R A;  5G49 B;  3AZI A;  2DF4 C;  5AVB B;  2NZD A;  5F99 C;  2FJ7 B;  3AZL C;  5B32 G;  3LJA C;  1M1A A;  4X23 B;  4LD9 B;  5B31 C;  5B1L D;  3C1C B;  3W97 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...