3AV2C

The human nucleosome structure containing the histone variant h3.3
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
105
structure length
105
Chain Sequence
AKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.3
publication title Structures of human nucleosomes containing major histone H3 variants
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 30
structure length 105
sequence length 105
chains with identical sequence G
ec nomenclature
pdb deposition date 2011-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3av2C00
3AV1C 4WU8A 3X1VD 5JA4A 5E5AB 4J8UC 5DNMB 3AZFB 5AVCA 5CHLB 4YS3B 5AV5D 1U35B 3B0DC 1TZYA 4J8VB 4H9RB 3V9RB 3WA9D 3X1VA 3REID 5GT0C 1M18C 3W98B 4XZQB 1P3MD 5GSUB 3AFAB 3X1TD 3AV2B 3MGRB 5AV5A 3NQUB 4H9NA 3VH6T 5B0ZD 4H9QB 1HQ3D 3TU4C 3AZHC 3WA9A 3REIA 1BH9A 3A6NC 4KGCB 1P3MA 4LD9B 1KX4C 3REKB 1ID3D 3X1TA 5B1MD 3UT9B 5JRGC 3WTPB 5B0ZA 5AV6B 3O62D 1HQ3A 3LZ0B 3MVDD 4J8XC 2FJ7B 3KXBC 5C3IC 1ID3A 4KHAB 1P3PC 5B1MA 3VH6A 2NQBD 2L5AA 3O62A 4YM6D 5AVBC 3MVDA 2AROB 4JJND 2HUEC 5B32D 1P3OB 4XUJD 1JFIB 1M19C 2NQBA 5BO0B 4R8PB 3UTBC 3AZNB 2CV5D 4YM6A 4UUZA 4JJNA 1S32D 1M1AB 4ZUXD 5B32A 4XUJA 2YFVA 5CPJB 3KWQB 2F8ND 5DNNC 3MGSB 1Q9CA 5BNVB 5BS7C 2CV5A 1S32A 1P3FB 4CSRA 4ZUXA 3AYWD 3AV1B 3X1UC 4J8UB 2F8NA 3AZMC 3NQJB 3C1BC 3B0DB 3AYWA 5GXQB 4WNNB 4Z66D 4WU8C 5GT0B 3REHD 1M18B 5CP6D 4NE6A 3B6GD 4DRBA 1TZYC 2NZDD 5FUGB 4Z66A 3REJD 3AZHB 3REHA 1AOID 5CP6A 3A6NB 5AY8D 5B32G 1KX4B 5CPID 3W97D 3B6GA 4H9OB 5KDMA 5JRGB 3AN2D 2NZDA 5B0YD 3REJA 1EQZD 1AOIA 4J8XB 5AY8A 3KXBB 5CPIA 1P3MC 3W97A 5C3IB 4QLCC 3MGQD 3X1TC 2F8NG 2RVQD 4Z2MG 3AN2A 5B40B 5AVBB 5B1LD 5B0YA 1EQZA 2BYKA 2HUEB 5B33D 4NFTA 5CPKD 1M19B 3MGQA 3UTBB 5AV9D 4G91C 3O62C 5B1LA 3WAAD 3MVDC 4H9PB 5B33A 4Z5TD 5G49A 5CPKA 3MNND 5DNNB 2NQBC 5AV9A 3WAAA 5B2ID 3WTPE 4JJNC 4Z5TA 3X1UB 1P3KD 4EO5C 3MNNA 1HTAA 4WU9D 1F66C 3AZKD 3AZMB 1BH8A 3C1BB 2CV5C 3MGPD 3AZGC 5B2IA 1S32C 4ZUXC 1P3KA 4WU8B 5JA4B 4G92C 4WU9A 3AZKA 1P34D 4KUDC 3MGPA 1N1JA 3LELC 3W99D 5B31G 5BNXA 3AYWC 1H3OA 3RELD 1P34A 5GT3B 1KX5B 3AZLD 3W99A 5B2JC 3AZFD 4Z66C 3REHC 3RELA 1P3LC 1TAFA 1P3MB 4YS3D 4NE3A 1KU5A 4QLCB 3AZLA 3X1TB 1U35D 3B6GC 3WKJD 2PYOD 2NZDC 4J8WC 3AZFA 3W98D 5GSUD 1AOIC 5AY8C 4YS3A 5CPIC 3AV2D 3MGRD 1P3GD 1U35A 3AZID 4H9RA 3V9RA 3WKJA 4G91B 2PYOA 3O62B 1KX3D 3W98A 4KGCD 4LD9D 5GSUA 3MVDB 3REKD 3B6FD 3AV2A 1P3GA 3MGRA 3UT9D 4X23C 3WTPD 3MGQC 1P3BD 3AZIA 5AV6D 2NQBB 4H9QA 3B0BA 3X1SD 1KX3A 4UUZB 4KGCA 4LD9A 5B1LC 3REKA 4JJNB 3B6FA 2YFVB 3W96C 3UT9A 4EO5B 3LZ1B 3WTPA 1P3BA 1F66B 5AV6A 3X1SA 5F99C 2CV5B 3AZGB 1P3OD 5B24B 3LJAD 1S32B 4KHAA 4ZUXB 3UTAC 4G92B 3AZND 4KUDB 3KUYD 4NE5A 1M1AD 1P3OA 3LELB 5CPJD 5B2IC 3LJAA 1JFIA 3C1CC 1A7WA 1P3KC 5BO0A 3MGSD 1ZLAD 3AZNA 4WU9C 4WV4B 3AZKC 3KUYA 1P3FD 1M1AA 5AVCC 3AV1D 5CPJA 5B2JB 4Z66B 3REHB 1P3LB 3MGSA 4H9SA 5BNVA 3TU4B 1ZLAA 1P3ID 5AV8D 3X1VC 1P34C 1P3FA 3B6GB 5KDMB 3AV1A 5GXQD 1M18D 5AV5C 4J8WB 2YFWB 3B0CW 1AOIB 3AZJD 3RELC 5AY8B 1P3IA 5AV8A 5CPIB 3REIC 3WA9C 5GXQA 1P3PB 4WNNA 3AZHD 1M18A 3A6ND 3AZFC 5B31D 5B0ZC 1KX4D 2BYKB 3AZJA 1HQ3C 3AZED 4X23B 3MGQB 1ID3C 5FUGA 3AZHA 5B1MC 3WKJC 4CAYB 3A6NA 4J8XD 2PYOC 3W98C 1KX4A 5B31A 3KXBD 2IO5C 5GSUC 3W96B 1P3GC 3AZEA 3AZIC 5B40D 5F99B 4J8XA 1P3AD 1KX3C 3KXBA 4YM6C 3UTAB 1M19D 3B6FC 1B6WA 3UT9C 1R4VA 5B32C 4XUJC 3WTPC 1P3BC 5B40A 3X1SC 2HIOD 1P3AA 5B2IB 3C1CB 2F8NK 1M19A 2F8NH 3R45B 4Z2MH 5DNND 5BT1D 2BYMA 4WU9B 3AZKB 4H9PA 2HIOA 5AVCB 1WWIA 2LY8A 3LJAC 4AWLC 3B0CT 5DNNA 1TZYB 1H3OB 3AZMD 3X1VB 1P34B 3KUYC 5AV5B 4H9NB 3AZMA 5E5AD 1TAFB 4H9SC 5DNMD 1ZLAC 3WA9B 3REIB 1BH9B 5CP6C 1P3FC 4J8VD 5B0ZB 5E5AA 1HQ3B 4DRAA 5GT3D 4XZQD 5DNMA 3REJC 1P3IC 5AV8C 4E44A 1KX5D 3AFAD 3W97C 1ID3B 5GXQC 5B1MB 4J8VA 3WKJB 2PYOB 3AN2C 2IO5B 5GT3A 3AZJC 1KX5A 4XZQA 4QLCD 5B0YC 1EQZC 1P3GB 4HGAC 3AFAA 3AZIB 3NQUA 2RVQC 1KX3B 3LZ0D 5B31C 4YM6B 4QLCA 2FJ7D 4E45A 3B6FB 3VH5W 3AZEC 5B33C 5B32B 4XUJB 1P3BB 5CPKC 3X1SB 3LZ0A 5AV9C 2AROD 2FJ7A 3WAAC 4CSRB 4ZBJC 4Z5TC 1F1EA 4R8PD 5B40C 3MNNC 2F8NB 1P3AC 2AROA 3LJAB 4AWLB 3LZ1D 1F66D 1B67A 3KWQD 3AYWB 3KSYA 3AZGD 4R8PA 5B24D 3KUYB 2HIOC 3LZ1A 3MGPC 1F66A 3KWQA 2CWEA 4J8UD 4KUDD 1ZLAB 5BT1C 3AZGA 5CP6B 5B24A 3LELD 4M6BA 3W99C 5GT0D 4J8UA 4KUDA 2NZDB 3REJB 1P3IB 5AV8B 3NQJA 3LELA 5B2JD 3W97B 3AZLC 1P3LD 3TU4D 3AN2B 5GT0A 3AZJB 5E5AC 5B0YB 5DNMC 3VH5T 1EQZB 4HGAB 5B2JA 4YS3C 5JRGD 4J8WD 1U35C 4J8VC 1P3LA 3TU4A 5B31B 5GT3C 1KX5C 5B1LB 4XZQC 3AZEB 5B33B 3AFAC 1P3PD 5G49B 4WZSB 3AV2C 4H9OA 3MGRC 5JRGA 5CPKB 4J8WA 2YFWA 5AVBD 5AV9B 3VH5A 4X23D 4KGCC 3WAAB 4LD9C 3REKC 4ZBJB 1P3PA 4Z5TB 3UTBD 3MNNB 3VH6W 5AV6C 1P3AB 5AVBA 3LZ0C 1ULYA 3W96D 1BH8B 4X23A 2FJ7C 5F99D 1P3KB 2BYMB 2JSSA 4CAYA 3UTBA 2HIOB 3UTAD 3W96A 2AROC 3X1UD 1N1JB 3MGPB 1P3OC 5BNXB 5F99A 5BS7A 4R8PC 3AZNC 3C1BD 3C1CD 3UTAA 1M1AC 3X1UA 3LZ1C 5CPJC 4WU8D 3W99B 1WWSA 3KWQC 5AVCD 3RELB 3MGSC 5B24C 3C1BA 3C1CA 1BFMA 3R45A 3AZLB 1TZYD
chains in the Genus database with same CATH superfamily
3AV1C 4WJ3C 4WU8A 3X1VD 5JA4A 5E5AB 4J8UC 5DNMB 3AZFB 5AVCA 5CHLB 4YS3B 5AV5D 1U35B 3B0DC 1TZYA 4J8VB 4H9RB 3V9RB 3WA9D 3X1VA 3REID 5GT0C 1M18C 3W98B 4XZQB 1P3MD 5GSUB 3AFAB 3X1TD 3AV2B 3MGRB 5AV5A 3NQUB 4H9NA 3VH6T 5B0ZD 4H9QB 1HQ3D 3TU4C 3AZHC 3WA9A 3REIA 1BH9A 3A6NC 4KGCB 1P3MA 4LD9B 1KX4C 3REKB 1ID3D 3X1TA 5B1MD 3UT9B 5JRGC 3WTPB 5B0ZA 3P5JB 5AV6B 3O62D 1HQ3A 3LZ0B 3MVDD 4J8XC 2FJ7B 3KXBC 5C3IC 1ID3A 4KHAB 1P3PC 5B1MA 3VH6A 2NQBD 2L5AA 3O62A 2Y2KA 4YM6D 5AVBC 3MVDA 2AROB 4JJND 2HUEC 5B32D 1P3OB 4XUJD 1JFIB 1M19C 2NQBA 5BO0B 4R8PB 3UTBC 3AZNB 2CV5D 4YM6A 4UUZA 4JJNA 1S32D 1M1AB 4ZUXD 5B32A 4XUJA 2YFVA 5CPJB 3KWQB 2F8ND 5DNNC 3MGSB 1Q9CA 5BNVB 5BS7C 2CV5A 1S32A 1P3FB 4CSRA 4ZUXA 3AYWD 3AV1B 3X1UC 4UPKA 2UWXA 4J8UB 2F8NA 3AZMC 3NQJB 1T3UA 3C1BC 3B0DB 3AYWA 5GXQB 4WNNB 4Z66D 4WU8C 5GT0B 3REHD 1M18B 5CP6D 4NE6A 3B6GD 2XD1A 4DRBA 1TZYC 2NZDD 5FUGB 4Z66A 3REJD 3AZHB 3REHA 1AOID 5CP6A 3A6NB 5AY8D 5B32G 1KX4B 5CPID 3W97D 2DQNC 3B6GA 4H9OB 5KDMA 5JRGB 3AN2D 2NZDA 5B0YD 3REJA 2Y2JA 1EQZD 1AOIA 4J8XB 5AY8A 3KXBB 5CPIA 1P3MC 3A1IA 3W97A 5C3IB 4QLCC 3MGQD 3X1TC 2F8NG 2RVQD 2J8PA 4Z2MG 1Z2CB 3AN2A 3KFUG 5B40B 5AVBB 5B1LD 5B0YA 1EQZA 2BYKA 2HUEB 5B33D 4NFTA 5CPKD 1M19B 3MGQA 3UTBB 5AV9D 4G91C 3O62C 5B1LA 3WAAD 3MVDC 4H9PB 1PZRA 5B33A 4Z5TD 5G49A 5CPKA 3MNND 5DNNB 2NQBC 5AV9A 2Y2QA 3WAAA 5B2ID 3WTPE 3EPLA 4JJNC 4Z5TA 3X1UB 1P3KD 4EO5C 3MNNA 1HTAA 4WU9D 1F66C 3AZKD 3AZMB 1BH8A 3C1BB 2CV5C 3MGPD 3AZGC 5B2IA 2ZY3A 1S32C 2JCHA 4ZUXC 1P3KA 4WU8B 5JA4B 4G92C 4WU9A 3AZKA 1P34D 4KUDC 2RIQA 3MGPA 1N1JA 3LELC 3W99D 5B31G 5BNXA 3AYWC 1H3OA 3RELD 1P34A 5GT3B 1KX5B 3AZLD 3H0LC 3W99A 5B2JC 3AZFD 4Z66C 3REHC 3RELA 1P3LC 1TAFA 3EPHA 1P3MB 4YS3D 4NE3A 1KU5A 4QLCB 3AZLA 3X1TB 1U35D 3B6GC 3WKJD 2PYOD 2NZDC 4J8WC 3AZFA 3W98D 5GSUD 1AOIC 5AY8C 4YS3A 5CPIC 3AV2D 3MGRD 1P3GD 1U35A 3AZID 4H9RA 3V9RA 2Y2MA 3WKJA 4G91B 2PYOA 3O62B 1KX3D 3W98A 4KGCD 2F2AC 4LD9D 5GSUA 3MVDB 3REKD 3B6FD 3AV2A 1P3GA 3MGRA 3UT9D 4X23C 3WTPD 3MGQC 1P3BD 2Y2NA 3AZIA 5AV6D 2NQBB 4H9QA 3B0BA 3X1SD 2Y2IA 1KX3A 4UUZB 4KGCA 4LD9A 5B1LC 3REKA 4JJNB 3B6FA 1W2EA 2YFVB 3W96C 3UT9A 4EO5B 3LZ1B 3WTPA 2Y2HA 1P3BA 1F66B 5AV6A 3X1SA 5F99C 2CV5B 3AZGB 1P3OD 5B24B 3LJAD 1S32B 4KHAA 4ZUXB 3UTAC 2Y2GA 4G92B 3AZND 4KUDB 3KUYD 4NE5A 1M1AD 1P3OA 3LELB 5CPJD 5B2IC 3LJAA 1JFIA 3C1CC 1A7WA 1P3KC 3A1KA 5BO0A 3MGSD 1ZLAD 3AZNA 4WU9C 4WV4B 3AZKC 3KUYA 1P3FD 1M1AA 5AVCC 3AV1D 3H0MC 5CPJA 5B2JB 2BG1A 4Z66B 3REHB 1P3LB 3MGSA 4H9SA 5BNVA 3TU4B 1ZLAA 1P3ID 5AV8D 3X1VC 1P34C 1P3FA 3B6GB 5KDMB 3AV1A 5GXQD 1M18D 5AV5C 4J8WB 2YFWB 3B0CW 1AOIB 3AZJD 3RELC 5AY8B 1P3IA 5AV8A 5CPIB 3EG5B 3REIC 2G5HC 3WA9C 5GXQA 1P3PB 4WNNA 3AZHD 1M18A 3A6ND 3AZFC 5B31D 5B0ZC 1KX4D 2BYKB 3AZJA 1HQ3C 3AZED 4X23B 3MGQB 1ID3C 5FUGA 3AZHA 5B1MC 3WKJC 4CAYB 3A6NA 4J8XD 2PYOC 3W98C 1KX4A 5B31A 3KXBD 2IO5C 5GSUC 2Y2LA 3W96B 1P3GC 3AZEA 3AZIC 5B40D 5F99B 4J8XA 1P3AD 1KX3C 3KXBA 4YM6C 3UTAB 1M19D 3B6FC 1B6WA 3UT9C 1R4VA 5B32C 4XUJC 3WTPC 1P3BC 2W8SA 5B40A 3X1SC 2HIOD 1P3AA 5B2IB 3C1CB 2F8NK 1M19A 2F8NH 3R45B 4Z2MH 5DNND 5BT1D 2BYMA 4WU9B 3AZKB 3EPKA 2JE5A 4H9PA 2HIOA 5AVCB 1WWIA 2LY8A 3LJAC 4AWLC 3B0CT 5DNNA 1TZYB 1H3OB 3AZMD 3X1VB 1P34B 3KUYC 2ZY4A 5AV5B 4H9NB 3AZMA 5E5AD 1TAFB 4H9SC 5DNMD 1ZLAC 3WA9B 3REIB 1BH9B 5CP6C 1P3FC 4J8VD 2DF4C 5B0ZB 5E5AA 1HQ3B 4DRAA 5GT3D 5DNMA 4XZQD 3REJC 1P3IC 5AV8C 4E44A 1KX5D 3AFAD 3W97C 1ID3B 5GXQC 5B1MB 4J8VA 3WKJB 2PYOB 3H0RC 3AN2C 4DQYB 2IO5B 5GT3A 3AZJC 1KX5A 4XZQA 4QLCD 5B0YC 1EQZC 1P3GB 2VQRA 4HGAC 2Y2OA 3AFAA 3AZIB 3NQUA 2RVQC 1KX3B 3LZ0D 5B31C 4YM6B 4QLCA 2FJ7D 4E45A 3B6FB 3VH5W 3AZEC 5B33C 5B32B 4XUJB 1P3BB 5CPKC 3X1SB 3LZ0A 5AV9C 2AROD 2FJ7A 3WAAC 4CSRB 4ZBJC 4Z5TC 1F1EA 3EPJA 4R8PD 5B40C 3MNNC 2F8NB 1P3AC 2AROA 3LJAB 4AWLB 3LZ1D 1F66D 1B67A 3KWQD 3AYWB 3KSYA 3AZGD 4R8PA 5B24D 3KUYB 3FDDA 2HIOC 3LZ1A 3MGPC 1F66A 3KWQA 2CWEA 4J8UD 4KUDD 1ZLAB 5BT1C 3AZGA 5CP6B 5B24A 3LELD 4M6BA 2ZY2A 3W99C 5GT0D 4J8UA 4KUDA 2NZDB 3REJB 1P3IB 5AV8B 3NQJA 3LELA 3AL0C 5B2JD 3W97B 3AZLC 1P3LD 3TU4D 3AN2B 2Y2PA 5GT0A 3AZJB 5E5AC 5B0YB 5DNMC 3VH5T 1EQZB 4HGAB 5B2JA 4YS3C 5JRGD 4J8WD 1U35C 4J8VC 1P3LA 3TU4A 5B31B 5GT3C 1KX5C 5B1LB 4XZQC 3IP4C 3AZEB 5B33B 3AFAC 1P3PD 5G49B 4WZSB 3AV2C 4H9OA 3MGRC 5JRGA 5CPKB 4J8WA 2YFWA 3F6TA 5AVBD 5AV9B 3VH5A 2FFFB 4X23D 4KGCC 3WAAB 4LD9C 3REKC 4ZBJB 1P3PA 4Z5TB 3UTBD 3MNNB 5AV6C 3VH6W 1P3AB 5AVBA 3LZ0C 1ULYA 2ZY5A 3W96D 1BH8B 4X23A 2FJ7C 5F99D 1P3KB 2BYMB 2JSSA 4CAYA 3UTBA 2XD5A 2HIOB 3UTAD 3W96A 2AROC 3X1UD 1N1JB 3MGPB 1P3OC 2ZM5A 5BNXB 5F99A 5BS7A 4R8PC 3AZNC 3C1BD 3C1CD 3UTAA 1M1AC 3X1UA 3LZ1C 5CPJC 4WU8D 3W99B 1WWSA 3KWQC 2G5IC 5AVCD 3RELB 3MGSC 5B24C 3C1BA 3C1CA 1BFMA 3R45A 3AZLB 1TZYD
chains in the Genus database with same CATH topology
3AV1C 4WJ3C 4WU8A 3X1VD 5JA4A 5E5AB 4J8UC 5DNMB 3AZFB 5AVCA 5CHLB 4YS3B 5AV5D 1U35B 3B0DC 1TZYA 4J8VB 4H9RB 3V9RB 3WA9D 3X1VA 3REID 5GT0C 1M18C 3W98B 4XZQB 1P3MD 5GSUB 3AFAB 3X1TD 3AV2B 3MGRB 5AV5A 3NQUB 4H9NA 3VH6T 5B0ZD 4H9QB 1HQ3D 3TU4C 3AZHC 3WA9A 3REIA 1BH9A 3A6NC 4KGCB 1P3MA 4LD9B 1KX4C 3REKB 1ID3D 3X1TA 5B1MD 3UT9B 5JRGC 3WTPB 5B0ZA 3P5JB 5AV6B 3O62D 1HQ3A 3LZ0B 3MVDD 4J8XC 2FJ7B 3KXBC 5C3IC 1ID3A 4KHAB 1P3PC 5B1MA 3VH6A 2NQBD 2L5AA 3O62A 2Y2KA 4YM6D 5AVBC 3MVDA 2AROB 4JJND 2HUEC 5B32D 1P3OB 4XUJD 1JFIB 1M19C 2NQBA 5BO0B 4R8PB 3UTBC 3AZNB 2CV5D 4YM6A 4UUZA 4JJNA 1S32D 1M1AB 4ZUXD 5B32A 4XUJA 2YFVA 5CPJB 3KWQB 2F8ND 5DNNC 3MGSB 1Q9CA 5BNVB 5BS7C 2CV5A 1S32A 1P3FB 4CSRA 4ZUXA 3AYWD 3AV1B 3X1UC 4UPKA 2UWXA 4J8UB 2F8NA 3AZMC 3NQJB 1T3UA 3C1BC 3B0DB 3AYWA 5GXQB 4WNNB 4Z66D 4WU8C 5GT0B 3REHD 1M18B 5CP6D 4NE6A 3B6GD 2XD1A 4DRBA 1TZYC 2NZDD 5FUGB 4Z66A 3REJD 3AZHB 3REHA 1AOID 5CP6A 3A6NB 5AY8D 5B32G 1KX4B 5CPID 3W97D 2DQNC 3B6GA 4H9OB 5KDMA 5JRGB 3AN2D 2NZDA 5B0YD 3REJA 2Y2JA 1EQZD 1AOIA 4J8XB 5AY8A 3KXBB 5CPIA 1P3MC 3A1IA 3W97A 5C3IB 4QLCC 3MGQD 3X1TC 2F8NG 2RVQD 2J8PA 4Z2MG 1Z2CB 3AN2A 3KFUG 5B40B 5AVBB 5B1LD 5B0YA 1EQZA 2BYKA 2HUEB 5B33D 4NFTA 5CPKD 1M19B 3MGQA 3UTBB 5AV9D 4G91C 3O62C 5B1LA 3WAAD 3MVDC 4H9PB 1PZRA 5B33A 4Z5TD 5G49A 5CPKA 3MNND 5DNNB 2NQBC 5AV9A 2Y2QA 3WAAA 5B2ID 3WTPE 3EPLA 4JJNC 4Z5TA 3X1UB 1P3KD 4EO5C 3MNNA 1HTAA 4WU9D 1F66C 3AZKD 3AZMB 1BH8A 3C1BB 2CV5C 3MGPD 3AZGC 5B2IA 2ZY3A 1S32C 2JCHA 4ZUXC 1P3KA 4WU8B 5JA4B 4G92C 4WU9A 3AZKA 1P34D 4KUDC 2RIQA 3MGPA 1N1JA 3LELC 3W99D 5B31G 5BNXA 3AYWC 1H3OA 3RELD 1P34A 5GT3B 1KX5B 3AZLD 3H0LC 3W99A 5B2JC 3AZFD 4Z66C 3REHC 3RELA 1P3LC 1TAFA 3EPHA 1P3MB 4YS3D 4NE3A 1KU5A 4QLCB 3AZLA 3X1TB 1U35D 3B6GC 3WKJD 2PYOD 2NZDC 4J8WC 3AZFA 3W98D 5GSUD 1AOIC 5AY8C 4YS3A 5CPIC 3AV2D 3MGRD 1P3GD 1U35A 3AZID 4H9RA 3V9RA 2Y2MA 3WKJA 4G91B 2PYOA 3O62B 1KX3D 3W98A 4KGCD 2F2AC 4LD9D 5GSUA 3MVDB 3REKD 3B6FD 3AV2A 1P3GA 3MGRA 3UT9D 4X23C 3WTPD 3MGQC 1P3BD 2Y2NA 3AZIA 5AV6D 2NQBB 4H9QA 3B0BA 3X1SD 2Y2IA 1KX3A 4UUZB 4KGCA 4LD9A 5B1LC 3REKA 4JJNB 3B6FA 1W2EA 2YFVB 3W96C 3UT9A 4EO5B 3LZ1B 3WTPA 2Y2HA 1P3BA 1F66B 5AV6A 3X1SA 5F99C 2CV5B 3AZGB 1P3OD 5B24B 3LJAD 1S32B 4KHAA 4ZUXB 3UTAC 2Y2GA 4G92B 3AZND 4KUDB 3KUYD 4NE5A 1M1AD 1P3OA 3LELB 5CPJD 5B2IC 3LJAA 1JFIA 3C1CC 1A7WA 1P3KC 3A1KA 5BO0A 3MGSD 1ZLAD 3AZNA 4WU9C 4WV4B 3AZKC 3KUYA 1P3FD 1M1AA 5AVCC 3AV1D 3H0MC 5CPJA 5B2JB 2BG1A 4Z66B 3REHB 1P3LB 3MGSA 4H9SA 5BNVA 3TU4B 1ZLAA 1P3ID 5AV8D 3X1VC 1P34C 1P3FA 3B6GB 5KDMB 3AV1A 5GXQD 1M18D 5AV5C 4J8WB 2YFWB 3B0CW 1AOIB 3AZJD 3RELC 5AY8B 1P3IA 5AV8A 5CPIB 3EG5B 3REIC 2G5HC 3WA9C 5GXQA 1P3PB 4WNNA 3AZHD 1M18A 3A6ND 3AZFC 5B31D 5B0ZC 1KX4D 2BYKB 3AZJA 1HQ3C 3AZED 4X23B 3MGQB 1ID3C 5FUGA 3AZHA 5B1MC 3WKJC 4CAYB 3A6NA 4J8XD 2PYOC 3W98C 1KX4A 5B31A 3KXBD 2IO5C 5GSUC 2Y2LA 3W96B 1P3GC 3AZEA 3AZIC 5B40D 5F99B 4J8XA 1P3AD 1KX3C 3KXBA 4YM6C 3UTAB 1M19D 3B6FC 1B6WA 3UT9C 1R4VA 5B32C 4XUJC 3WTPC 1P3BC 2W8SA 5B40A 3X1SC 2HIOD 1P3AA 5B2IB 3C1CB 2F8NK 1M19A 2F8NH 3R45B 4Z2MH 5DNND 5BT1D 2BYMA 4WU9B 3AZKB 3EPKA 2JE5A 4H9PA 2HIOA 5AVCB 1WWIA 2LY8A 3LJAC 4AWLC 3B0CT 5DNNA 1TZYB 1H3OB 3AZMD 3X1VB 1P34B 3KUYC 2ZY4A 5AV5B 4H9NB 3AZMA 5E5AD 1TAFB 4H9SC 5DNMD 1ZLAC 3WA9B 3REIB 1BH9B 5CP6C 1P3FC 4J8VD 2DF4C 5B0ZB 5E5AA 1HQ3B 4DRAA 5GT3D 5DNMA 4XZQD 3REJC 1P3IC 5AV8C 4E44A 1KX5D 3AFAD 3W97C 1ID3B 5GXQC 5B1MB 4J8VA 3WKJB 2PYOB 3H0RC 3AN2C 4DQYB 2IO5B 5GT3A 3AZJC 1KX5A 4XZQA 4QLCD 5B0YC 1EQZC 1P3GB 2VQRA 4HGAC 2Y2OA 3AFAA 3AZIB 3NQUA 2RVQC 1KX3B 3LZ0D 5B31C 4YM6B 4QLCA 2FJ7D 4E45A 3B6FB 3VH5W 3AZEC 5B33C 5B32B 4XUJB 1P3BB 5CPKC 3X1SB 3LZ0A 5AV9C 2AROD 2FJ7A 3WAAC 4CSRB 4ZBJC 4Z5TC 1F1EA 3EPJA 4R8PD 5B40C 3MNNC 2F8NB 1P3AC 2AROA 3LJAB 4AWLB 3LZ1D 1F66D 1B67A 3KWQD 3AYWB 3KSYA 3AZGD 4R8PA 5B24D 3KUYB 3FDDA 2HIOC 3LZ1A 3MGPC 1F66A 3KWQA 2CWEA 4J8UD 4KUDD 1ZLAB 5BT1C 3AZGA 5CP6B 5B24A 3LELD 4M6BA 2ZY2A 3W99C 5GT0D 4J8UA 4KUDA 2NZDB 3REJB 1P3IB 5AV8B 3NQJA 3LELA 3AL0C 5B2JD 3W97B 3AZLC 1P3LD 3TU4D 3AN2B 2Y2PA 5GT0A 3AZJB 5E5AC 5B0YB 5DNMC 3VH5T 1EQZB 4HGAB 5B2JA 4YS3C 5JRGD 4J8WD 1U35C 4J8VC 1P3LA 3TU4A 5B31B 5GT3C 1KX5C 5B1LB 4XZQC 3IP4C 3AZEB 5B33B 3AFAC 1P3PD 5G49B 4WZSB 3AV2C 4H9OA 3MGRC 5JRGA 5CPKB 4J8WA 2YFWA 3F6TA 5AVBD 5AV9B 3VH5A 2FFFB 4X23D 4KGCC 3WAAB 4LD9C 3REKC 4ZBJB 1P3PA 4Z5TB 3UTBD 3MNNB 5AV6C 3VH6W 1P3AB 5AVBA 3LZ0C 1ULYA 2ZY5A 3W96D 1BH8B 4X23A 2FJ7C 5F99D 1P3KB 2BYMB 2JSSA 4CAYA 3UTBA 2XD5A 2HIOB 3UTAD 3W96A 2AROC 3X1UD 1N1JB 3MGPB 1P3OC 2ZM5A 5BNXB 5F99A 5BS7A 4R8PC 3AZNC 3C1BD 3C1CD 3UTAA 1M1AC 3X1UA 3LZ1C 5CPJC 4WU8D 3W99B 1WWSA 3KWQC 2G5IC 5AVCD 3RELB 3MGSC 5B24C 3C1BA 3C1CA 1BFMA 3R45A 3AZLB 1TZYD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AV1 C;  4WU8 A;  3X1V D;  5JA4 A;  5E5A B;  4J8U C;  5DNM B;  3AZF B;  5AVC A;  5CHL B;  4YS3 B;  5AV5 D;  1U35 B;  3B0D C;  1TZY A;  4J8V B;  4H9R B;  3V9R B;  3WA9 D;  3X1V A;  3REI D;  5GT0 C;  1M18 C;  3W98 B;  4XZQ B;  1P3M D;  5GSU B;  3AFA B;  3X1T D;  3AV2 B;  3MGR B;  5AV5 A;  3NQU B;  4H9N A;  3VH6 T;  5B0Z D;  4H9Q B;  1HQ3 D;  3TU4 C;  3AZH C;  3WA9 A;  3REI A;  1BH9 A;  3A6N C;  4KGC B;  1P3M A;  4LD9 B;  1KX4 C;  3REK B;  1ID3 D;  3X1T A;  5B1M D;  3UT9 B;  5JRG C;  3WTP B;  5B0Z A;  5AV6 B;  3O62 D;  1HQ3 A;  3LZ0 B;  3MVD D;  4J8X C;  2FJ7 B;  3KXB C;  5C3I C;  1ID3 A;  4KHA B;  1P3P C;  5B1M A;  3VH6 A;  2NQB D;  2L5A A;  3O62 A;  4YM6 D;  5AVB C;  3MVD A;  2ARO B;  4JJN D;  2HUE C;  5B32 D;  1P3O B;  4XUJ D;  1JFI B;  1M19 C;  2NQB A;  5BO0 B;  4R8P B;  3UTB C;  3AZN B;  2CV5 D;  4YM6 A;  4UUZ A;  4JJN A;  1S32 D;  1M1A B;  4ZUX D;  5B32 A;  4XUJ A;  2YFV A;  5CPJ B;  3KWQ B;  2F8N D;  5DNN C;  3MGS B;  1Q9C A;  5BNV B;  5BS7 C;  2CV5 A;  1S32 A;  1P3F B;  4CSR A;  4ZUX A;  3AYW D;  3AV1 B;  3X1U C;  4J8U B;  2F8N A;  3AZM C;  3NQJ B;  3C1B C;  3B0D B;  3AYW A;  5GXQ B;  4WNN B;  4Z66 D;  4WU8 C;  5GT0 B;  3REH D;  1M18 B;  5CP6 D;  4NE6 A;  3B6G D;  4DRB A;  1TZY C;  2NZD D;  5FUG B;  4Z66 A;  3REJ D;  3AZH B;  3REH A;  1AOI D;  5CP6 A;  3A6N B;  5AY8 D;  5B32 G;  1KX4 B;  5CPI D;  3W97 D;  3B6G A;  4H9O B;  5KDM A;  5JRG B;  3AN2 D;  2NZD A;  5B0Y D;  3REJ A;  1EQZ D;  1AOI A;  4J8X B;  5AY8 A;  3KXB B;  5CPI A;  1P3M C;  3W97 A;  5C3I B;  4QLC C;  3MGQ D;  3X1T C;  2F8N G;  2RVQ D;  4Z2M G;  3AN2 A;  5B40 B;  5AVB B;  5B1L D;  5B0Y A;  1EQZ A;  2BYK A;  2HUE B;  5B33 D;  4NFT A;  5CPK D;  1M19 B;  3MGQ A;  3UTB B;  5AV9 D;  4G91 C;  3O62 C;  5B1L A;  3WAA D;  3MVD C;  4H9P B;  5B33 A;  4Z5T D;  5G49 A;  5CPK A;  3MNN D;  5DNN B;  2NQB C;  5AV9 A;  3WAA A;  5B2I D;  3WTP E;  4JJN C;  4Z5T A;  3X1U B;  1P3K D;  4EO5 C;  3MNN A;  1HTA A;  4WU9 D;  1F66 C;  3AZK D;  3AZM B;  1BH8 A;  3C1B B;  2CV5 C;  3MGP D;  3AZG C;  5B2I A;  1S32 C;  4ZUX C;  1P3K A;  4WU8 B;  5JA4 B;  4G92 C;  4WU9 A;  3AZK A;  1P34 D;  4KUD C;  3MGP A;  1N1J A;  3LEL C;  3W99 D;  5B31 G;  5BNX A;  3AYW C;  1H3O A;  3REL D;  1P34 A;  5GT3 B;  1KX5 B;  3AZL D;  3W99 A;  5B2J C;  3AZF D;  4Z66 C;  3REH C;  3REL A;  1P3L C;  1TAF A;  1P3M B;  4YS3 D;  4NE3 A;  1KU5 A;  4QLC B;  3AZL A;  3X1T B;  1U35 D;  3B6G C;  3WKJ D;  2PYO D;  2NZD C;  4J8W C;  3AZF A;  3W98 D;  5GSU D;  1AOI C;  5AY8 C;  4YS3 A;  5CPI C;  3AV2 D;  3MGR D;  1P3G D;  1U35 A;  3AZI D;  4H9R A;  3V9R A;  3WKJ A;  4G91 B;  2PYO A;  3O62 B;  1KX3 D;  3W98 A;  4KGC D;  4LD9 D;  5GSU A;  3MVD B;  3REK D;  3B6F D;  3AV2 A;  1P3G A;  3MGR A;  3UT9 D;  4X23 C;  3WTP D;  3MGQ C;  1P3B D;  3AZI A;  5AV6 D;  2NQB B;  4H9Q A;  3B0B A;  3X1S D;  1KX3 A;  4UUZ B;  4KGC A;  4LD9 A;  5B1L C;  3REK A;  4JJN B;  3B6F A;  2YFV B;  3W96 C;  3UT9 A;  4EO5 B;  3LZ1 B;  3WTP A;  1P3B A;  1F66 B;  5AV6 A;  3X1S A;  5F99 C;  2CV5 B;  3AZG B;  1P3O D;  5B24 B;  3LJA D;  1S32 B;  4KHA A;  4ZUX B;  3UTA C;  4G92 B;  3AZN D;  4KUD B;  3KUY D;  4NE5 A;  1M1A D;  1P3O A;  3LEL B;  5CPJ D;  5B2I C;  3LJA A;  1JFI A;  3C1C C;  1A7W A;  1P3K C;  5BO0 A;  3MGS D;  1ZLA D;  3AZN A;  4WU9 C;  4WV4 B;  3AZK C;  3KUY A;  1P3F D;  1M1A A;  5AVC C;  3AV1 D;  5CPJ A;  5B2J B;  4Z66 B;  3REH B;  1P3L B;  3MGS A;  4H9S A;  5BNV A;  3TU4 B;  1ZLA A;  1P3I D;  5AV8 D;  3X1V C;  1P34 C;  1P3F A;  3B6G B;  5KDM B;  3AV1 A;  5GXQ D;  1M18 D;  5AV5 C;  4J8W B;  2YFW B;  3B0C W;  1AOI B;  3AZJ D;  3REL C;  5AY8 B;  1P3I A;  5AV8 A;  5CPI B;  3REI C;  3WA9 C;  5GXQ A;  1P3P B;  4WNN A;  3AZH D;  1M18 A;  3A6N D;  3AZF C;  5B31 D;  5B0Z C;  1KX4 D;  2BYK B;  3AZJ A;  1HQ3 C;  3AZE D;  4X23 B;  3MGQ B;  1ID3 C;  5FUG A;  3AZH A;  5B1M C;  3WKJ C;  4CAY B;  3A6N A;  4J8X D;  2PYO C;  3W98 C;  1KX4 A;  5B31 A;  3KXB D;  2IO5 C;  5GSU C;  3W96 B;  1P3G C;  3AZE A;  3AZI C;  5B40 D;  5F99 B;  4J8X A;  1P3A D;  1KX3 C;  3KXB A;  4YM6 C;  3UTA B;  1M19 D;  3B6F C;  1B6W A;  3UT9 C;  1R4V A;  5B32 C;  4XUJ C;  3WTP C;  1P3B C;  5B40 A;  3X1S C;  2HIO D;  1P3A A;  5B2I B;  3C1C B;  2F8N K;  1M19 A;  2F8N H;  3R45 B;  4Z2M H;  5DNN D;  5BT1 D;  2BYM A;  4WU9 B;  3AZK B;  4H9P A;  2HIO A;  5AVC B;  1WWI A;  2LY8 A;  3LJA C;  4AWL C;  3B0C T;  5DNN A;  1TZY B;  1H3O B;  3AZM D;  3X1V B;  1P34 B;  3KUY C;  5AV5 B;  4H9N B;  3AZM A;  5E5A D;  1TAF B;  4H9S C;  5DNM D;  1ZLA C;  3WA9 B;  3REI B;  1BH9 B;  5CP6 C;  1P3F C;  4J8V D;  5B0Z B;  5E5A A;  1HQ3 B;  4DRA A;  5GT3 D;  4XZQ D;  5DNM A;  3REJ C;  1P3I C;  5AV8 C;  4E44 A;  1KX5 D;  3AFA D;  3W97 C;  1ID3 B;  5GXQ C;  5B1M B;  4J8V A;  3WKJ B;  2PYO B;  3AN2 C;  2IO5 B;  5GT3 A;  3AZJ C;  1KX5 A;  4XZQ A;  4QLC D;  5B0Y C;  1EQZ C;  1P3G B;  4HGA C;  3AFA A;  3AZI B;  3NQU A;  2RVQ C;  1KX3 B;  3LZ0 D;  5B31 C;  4YM6 B;  4QLC A;  2FJ7 D;  4E45 A;  3B6F B;  3VH5 W;  3AZE C;  5B33 C;  5B32 B;  4XUJ B;  1P3B B;  5CPK C;  3X1S B;  3LZ0 A;  5AV9 C;  2ARO D;  2FJ7 A;  3WAA C;  4CSR B;  4ZBJ C;  4Z5T C;  1F1E A;  4R8P D;  5B40 C;  3MNN C;  2F8N B;  1P3A C;  2ARO A;  3LJA B;  4AWL B;  3LZ1 D;  1F66 D;  1B67 A;  3KWQ D;  3AYW B;  3KSY A;  3AZG D;  4R8P A;  5B24 D;  3KUY B;  2HIO C;  3LZ1 A;  3MGP C;  1F66 A;  3KWQ A;  2CWE A;  4J8U D;  4KUD D;  1ZLA B;  5BT1 C;  3AZG A;  5CP6 B;  5B24 A;  3LEL D;  4M6B A;  3W99 C;  5GT0 D;  4J8U A;  4KUD A;  2NZD B;  3REJ B;  1P3I B;  5AV8 B;  3NQJ A;  3LEL A;  5B2J D;  3W97 B;  3AZL C;  1P3L D;  3TU4 D;  3AN2 B;  5GT0 A;  3AZJ B;  5E5A C;  5B0Y B;  5DNM C;  3VH5 T;  1EQZ B;  4HGA B;  5B2J A;  4YS3 C;  5JRG D;  4J8W D;  1U35 C;  4J8V C;  1P3L A;  3TU4 A;  5B31 B;  5GT3 C;  1KX5 C;  5B1L B;  4XZQ C;  3AZE B;  5B33 B;  3AFA C;  1P3P D;  5G49 B;  4WZS B;  3AV2 C;  4H9O A;  3MGR C;  5JRG A;  5CPK B;  4J8W A;  2YFW A;  5AVB D;  5AV9 B;  3VH5 A;  4X23 D;  4KGC C;  3WAA B;  4LD9 C;  3REK C;  4ZBJ B;  1P3P A;  4Z5T B;  3UTB D;  3MNN B;  3VH6 W;  5AV6 C;  1P3A B;  5AVB A;  3LZ0 C;  1ULY A;  3W96 D;  1BH8 B;  4X23 A;  2FJ7 C;  5F99 D;  1P3K B;  2BYM B;  2JSS A;  4CAY A;  3UTB A;  2HIO B;  3UTA D;  3W96 A;  2ARO C;  3X1U D;  1N1J B;  3MGP B;  1P3O C;  5BNX B;  5F99 A;  5BS7 A;  4R8P C;  3AZN C;  3C1B D;  3C1C D;  3UTA A;  1M1A C;  3X1U A;  3LZ1 C;  5CPJ C;  4WU8 D;  3W99 B;  1WWS A;  3KWQ C;  5AVC D;  3REL B;  3MGS C;  5B24 C;  3C1B A;  3C1C A;  1BFM A;  3R45 A;  3AZL B;  1TZY D; 
#chains in the Genus database with same CATH topology
 3AV1 C;  4WJ3 C;  4WU8 A;  3X1V D;  5JA4 A;  5E5A B;  4J8U C;  5DNM B;  3AZF B;  5AVC A;  5CHL B;  4YS3 B;  5AV5 D;  1U35 B;  3B0D C;  1TZY A;  4J8V B;  4H9R B;  3V9R B;  3WA9 D;  3X1V A;  3REI D;  5GT0 C;  1M18 C;  3W98 B;  4XZQ B;  1P3M D;  5GSU B;  3AFA B;  3X1T D;  3AV2 B;  3MGR B;  5AV5 A;  3NQU B;  4H9N A;  3VH6 T;  5B0Z D;  4H9Q B;  1HQ3 D;  3TU4 C;  3AZH C;  3WA9 A;  3REI A;  1BH9 A;  3A6N C;  4KGC B;  1P3M A;  4LD9 B;  1KX4 C;  3REK B;  1ID3 D;  3X1T A;  5B1M D;  3UT9 B;  5JRG C;  3WTP B;  5B0Z A;  3P5J B;  5AV6 B;  3O62 D;  1HQ3 A;  3LZ0 B;  3MVD D;  4J8X C;  2FJ7 B;  3KXB C;  5C3I C;  1ID3 A;  4KHA B;  1P3P C;  5B1M A;  3VH6 A;  2NQB D;  2L5A A;  3O62 A;  2Y2K A;  4YM6 D;  5AVB C;  3MVD A;  2ARO B;  4JJN D;  2HUE C;  5B32 D;  1P3O B;  4XUJ D;  1JFI B;  1M19 C;  2NQB A;  5BO0 B;  4R8P B;  3UTB C;  3AZN B;  2CV5 D;  4YM6 A;  4UUZ A;  4JJN A;  1S32 D;  1M1A B;  4ZUX D;  5B32 A;  4XUJ A;  2YFV A;  5CPJ B;  3KWQ B;  2F8N D;  5DNN C;  3MGS B;  1Q9C A;  5BNV B;  5BS7 C;  2CV5 A;  1S32 A;  1P3F B;  4CSR A;  4ZUX A;  3AYW D;  3AV1 B;  3X1U C;  4UPK A;  2UWX A;  4J8U B;  2F8N A;  3AZM C;  3NQJ B;  1T3U A;  3C1B C;  3B0D B;  3AYW A;  5GXQ B;  4WNN B;  4Z66 D;  4WU8 C;  5GT0 B;  3REH D;  1M18 B;  5CP6 D;  4NE6 A;  3B6G D;  2XD1 A;  4DRB A;  1TZY C;  2NZD D;  5FUG B;  4Z66 A;  3REJ D;  3AZH B;  3REH A;  1AOI D;  5CP6 A;  3A6N B;  5AY8 D;  5B32 G;  1KX4 B;  5CPI D;  3W97 D;  2DQN C;  3B6G A;  4H9O B;  5KDM A;  5JRG B;  3AN2 D;  2NZD A;  5B0Y D;  3REJ A;  2Y2J A;  1EQZ D;  1AOI A;  4J8X B;  5AY8 A;  3KXB B;  5CPI A;  1P3M C;  3A1I A;  3W97 A;  5C3I B;  4QLC C;  3MGQ D;  3X1T C;  2F8N G;  2RVQ D;  2J8P A;  4Z2M G;  1Z2C B;  3AN2 A;  3KFU G;  5B40 B;  5AVB B;  5B1L D;  5B0Y A;  1EQZ A;  2BYK A;  2HUE B;  5B33 D;  4NFT A;  5CPK D;  1M19 B;  3MGQ A;  3UTB B;  5AV9 D;  4G91 C;  3O62 C;  5B1L A;  3WAA D;  3MVD C;  4H9P B;  1PZR A;  5B33 A;  4Z5T D;  5G49 A;  5CPK A;  3MNN D;  5DNN B;  2NQB C;  5AV9 A;  2Y2Q A;  3WAA A;  5B2I D;  3WTP E;  3EPL A;  4JJN C;  4Z5T A;  3X1U B;  1P3K D;  4EO5 C;  3MNN A;  1HTA A;  4WU9 D;  1F66 C;  3AZK D;  3AZM B;  1BH8 A;  3C1B B;  2CV5 C;  3MGP D;  3AZG C;  5B2I A;  2ZY3 A;  1S32 C;  2JCH A;  4ZUX C;  1P3K A;  4WU8 B;  5JA4 B;  4G92 C;  4WU9 A;  3AZK A;  1P34 D;  4KUD C;  2RIQ A;  3MGP A;  1N1J A;  3LEL C;  3W99 D;  5B31 G;  5BNX A;  3AYW C;  1H3O A;  3REL D;  1P34 A;  5GT3 B;  1KX5 B;  3AZL D;  3H0L C;  3W99 A;  5B2J C;  3AZF D;  4Z66 C;  3REH C;  3REL A;  1P3L C;  1TAF A;  3EPH A;  1P3M B;  4YS3 D;  4NE3 A;  1KU5 A;  4QLC B;  3AZL A;  3X1T B;  1U35 D;  3B6G C;  3WKJ D;  2PYO D;  2NZD C;  4J8W C;  3AZF A;  3W98 D;  5GSU D;  1AOI C;  5AY8 C;  4YS3 A;  5CPI C;  3AV2 D;  3MGR D;  1P3G D;  1U35 A;  3AZI D;  4H9R A;  3V9R A;  2Y2M A;  3WKJ A;  4G91 B;  2PYO A;  3O62 B;  1KX3 D;  3W98 A;  4KGC D;  2F2A C;  4LD9 D;  5GSU A;  3MVD B;  3REK D;  3B6F D;  3AV2 A;  1P3G A;  3MGR A;  3UT9 D;  4X23 C;  3WTP D;  3MGQ C;  1P3B D;  2Y2N A;  3AZI A;  5AV6 D;  2NQB B;  4H9Q A;  3B0B A;  3X1S D;  2Y2I A;  1KX3 A;  4UUZ B;  4KGC A;  4LD9 A;  5B1L C;  3REK A;  4JJN B;  3B6F A;  1W2E A;  2YFV B;  3W96 C;  3UT9 A;  4EO5 B;  3LZ1 B;  3WTP A;  2Y2H A;  1P3B A;  1F66 B;  5AV6 A;  3X1S A;  5F99 C;  2CV5 B;  3AZG B;  1P3O D;  5B24 B;  3LJA D;  1S32 B;  4KHA A;  4ZUX B;  3UTA C;  2Y2G A;  4G92 B;  3AZN D;  4KUD B;  3KUY D;  4NE5 A;  1M1A D;  1P3O A;  3LEL B;  5CPJ D;  5B2I C;  3LJA A;  1JFI A;  3C1C C;  1A7W A;  1P3K C;  3A1K A;  5BO0 A;  3MGS D;  1ZLA D;  3AZN A;  4WU9 C;  4WV4 B;  3AZK C;  3KUY A;  1P3F D;  1M1A A;  5AVC C;  3AV1 D;  3H0M C;  5CPJ A;  5B2J B;  2BG1 A;  4Z66 B;  3REH B;  1P3L B;  3MGS A;  4H9S A;  5BNV A;  3TU4 B;  1ZLA A;  1P3I D;  5AV8 D;  3X1V C;  1P34 C;  1P3F A;  3B6G B;  5KDM B;  3AV1 A;  5GXQ D;  1M18 D;  5AV5 C;  4J8W B;  2YFW B;  3B0C W;  1AOI B;  3AZJ D;  3REL C;  5AY8 B;  1P3I A;  5AV8 A;  5CPI B;  3EG5 B;  3REI C;  2G5H C;  3WA9 C;  5GXQ A;  1P3P B;  4WNN A;  3AZH D;  1M18 A;  3A6N D;  3AZF C;  5B31 D;  5B0Z C;  1KX4 D;  2BYK B;  3AZJ A;  1HQ3 C;  3AZE D;  4X23 B;  3MGQ B;  1ID3 C;  5FUG A;  3AZH A;  5B1M C;  3WKJ C;  4CAY B;  3A6N A;  4J8X D;  2PYO C;  3W98 C;  1KX4 A;  5B31 A;  3KXB D;  2IO5 C;  5GSU C;  2Y2L A;  3W96 B;  1P3G C;  3AZE A;  3AZI C;  5B40 D;  5F99 B;  4J8X A;  1P3A D;  1KX3 C;  3KXB A;  4YM6 C;  3UTA B;  1M19 D;  3B6F C;  1B6W A;  3UT9 C;  1R4V A;  5B32 C;  4XUJ C;  3WTP C;  1P3B C;  2W8S A;  5B40 A;  3X1S C;  2HIO D;  1P3A A;  5B2I B;  3C1C B;  2F8N K;  1M19 A;  2F8N H;  3R45 B;  4Z2M H;  5DNN D;  5BT1 D;  2BYM A;  4WU9 B;  3AZK B;  3EPK A;  2JE5 A;  4H9P A;  2HIO A;  5AVC B;  1WWI A;  2LY8 A;  3LJA C;  4AWL C;  3B0C T;  5DNN A;  1TZY B;  1H3O B;  3AZM D;  3X1V B;  1P34 B;  3KUY C;  2ZY4 A;  5AV5 B;  4H9N B;  3AZM A;  5E5A D;  1TAF B;  4H9S C;  5DNM D;  1ZLA C;  3WA9 B;  3REI B;  1BH9 B;  5CP6 C;  1P3F C;  4J8V D;  2DF4 C;  5B0Z B;  5E5A A;  1HQ3 B;  4DRA A;  5GT3 D;  5DNM A;  4XZQ D;  3REJ C;  1P3I C;  5AV8 C;  4E44 A;  1KX5 D;  3AFA D;  3W97 C;  1ID3 B;  5GXQ C;  5B1M B;  4J8V A;  3WKJ B;  2PYO B;  3H0R C;  3AN2 C;  4DQY B;  2IO5 B;  5GT3 A;  3AZJ C;  1KX5 A;  4XZQ A;  4QLC D;  5B0Y C;  1EQZ C;  1P3G B;  2VQR A;  4HGA C;  2Y2O A;  3AFA A;  3AZI B;  3NQU A;  2RVQ C;  1KX3 B;  3LZ0 D;  5B31 C;  4YM6 B;  4QLC A;  2FJ7 D;  4E45 A;  3B6F B;  3VH5 W;  3AZE C;  5B33 C;  5B32 B;  4XUJ B;  1P3B B;  5CPK C;  3X1S B;  3LZ0 A;  5AV9 C;  2ARO D;  2FJ7 A;  3WAA C;  4CSR B;  4ZBJ C;  4Z5T C;  1F1E A;  3EPJ A;  4R8P D;  5B40 C;  3MNN C;  2F8N B;  1P3A C;  2ARO A;  3LJA B;  4AWL B;  3LZ1 D;  1F66 D;  1B67 A;  3KWQ D;  3AYW B;  3KSY A;  3AZG D;  4R8P A;  5B24 D;  3KUY B;  3FDD A;  2HIO C;  3LZ1 A;  3MGP C;  1F66 A;  3KWQ A;  2CWE A;  4J8U D;  4KUD D;  1ZLA B;  5BT1 C;  3AZG A;  5CP6 B;  5B24 A;  3LEL D;  4M6B A;  2ZY2 A;  3W99 C;  5GT0 D;  4J8U A;  4KUD A;  2NZD B;  3REJ B;  1P3I B;  5AV8 B;  3NQJ A;  3LEL A;  3AL0 C;  5B2J D;  3W97 B;  3AZL C;  1P3L D;  3TU4 D;  3AN2 B;  2Y2P A;  5GT0 A;  3AZJ B;  5E5A C;  5B0Y B;  5DNM C;  3VH5 T;  1EQZ B;  4HGA B;  5B2J A;  4YS3 C;  5JRG D;  4J8W D;  1U35 C;  4J8V C;  1P3L A;  3TU4 A;  5B31 B;  5GT3 C;  1KX5 C;  5B1L B;  4XZQ C;  3IP4 C;  3AZE B;  5B33 B;  3AFA C;  1P3P D;  5G49 B;  4WZS B;  3AV2 C;  4H9O A;  3MGR C;  5JRG A;  5CPK B;  4J8W A;  2YFW A;  3F6T A;  5AVB D;  5AV9 B;  3VH5 A;  2FFF B;  4X23 D;  4KGC C;  3WAA B;  4LD9 C;  3REK C;  4ZBJ B;  1P3P A;  4Z5T B;  3UTB D;  3MNN B;  5AV6 C;  3VH6 W;  1P3A B;  5AVB A;  3LZ0 C;  1ULY A;  2ZY5 A;  3W96 D;  1BH8 B;  4X23 A;  2FJ7 C;  5F99 D;  1P3K B;  2BYM B;  2JSS A;  4CAY A;  3UTB A;  2XD5 A;  2HIO B;  3UTA D;  3W96 A;  2ARO C;  3X1U D;  1N1J B;  3MGP B;  1P3O C;  2ZM5 A;  5BNX B;  5F99 A;  5BS7 A;  4R8P C;  3AZN C;  3C1B D;  3C1C D;  3UTA A;  1M1A C;  3X1U A;  3LZ1 C;  5CPJ C;  4WU8 D;  3W99 B;  1WWS A;  3KWQ C;  2G5I C;  5AVC D;  3REL B;  3MGS C;  5B24 C;  3C1B A;  3C1C A;  1BFM A;  3R45 A;  3AZL B;  1TZY D; 
#chains in the Genus database with same CATH homology
 3AV1 C;  4WJ3 C;  4WU8 A;  3X1V D;  5JA4 A;  5E5A B;  4J8U C;  5DNM B;  3AZF B;  5AVC A;  5CHL B;  4YS3 B;  5AV5 D;  1U35 B;  3B0D C;  1TZY A;  4J8V B;  4H9R B;  3V9R B;  3WA9 D;  3X1V A;  3REI D;  5GT0 C;  1M18 C;  3W98 B;  4XZQ B;  1P3M D;  5GSU B;  3AFA B;  3X1T D;  3AV2 B;  3MGR B;  5AV5 A;  3NQU B;  4H9N A;  3VH6 T;  5B0Z D;  4H9Q B;  1HQ3 D;  3TU4 C;  3AZH C;  3WA9 A;  3REI A;  1BH9 A;  3A6N C;  4KGC B;  1P3M A;  4LD9 B;  1KX4 C;  3REK B;  1ID3 D;  3X1T A;  5B1M D;  3UT9 B;  5JRG C;  3WTP B;  5B0Z A;  3P5J B;  5AV6 B;  3O62 D;  1HQ3 A;  3LZ0 B;  3MVD D;  4J8X C;  2FJ7 B;  3KXB C;  5C3I C;  1ID3 A;  4KHA B;  1P3P C;  5B1M A;  3VH6 A;  2NQB D;  2L5A A;  3O62 A;  2Y2K A;  4YM6 D;  5AVB C;  3MVD A;  2ARO B;  4JJN D;  2HUE C;  5B32 D;  1P3O B;  4XUJ D;  1JFI B;  1M19 C;  2NQB A;  5BO0 B;  4R8P B;  3UTB C;  3AZN B;  2CV5 D;  4YM6 A;  4UUZ A;  4JJN A;  1S32 D;  1M1A B;  4ZUX D;  5B32 A;  4XUJ A;  2YFV A;  5CPJ B;  3KWQ B;  2F8N D;  5DNN C;  3MGS B;  1Q9C A;  5BNV B;  5BS7 C;  2CV5 A;  1S32 A;  1P3F B;  4CSR A;  4ZUX A;  3AYW D;  3AV1 B;  3X1U C;  4UPK A;  2UWX A;  4J8U B;  2F8N A;  3AZM C;  3NQJ B;  1T3U A;  3C1B C;  3B0D B;  3AYW A;  5GXQ B;  4WNN B;  4Z66 D;  4WU8 C;  5GT0 B;  3REH D;  1M18 B;  5CP6 D;  4NE6 A;  3B6G D;  2XD1 A;  4DRB A;  1TZY C;  2NZD D;  5FUG B;  4Z66 A;  3REJ D;  3AZH B;  3REH A;  1AOI D;  5CP6 A;  3A6N B;  5AY8 D;  5B32 G;  1KX4 B;  5CPI D;  3W97 D;  2DQN C;  3B6G A;  4H9O B;  5KDM A;  5JRG B;  3AN2 D;  2NZD A;  5B0Y D;  3REJ A;  2Y2J A;  1EQZ D;  1AOI A;  4J8X B;  5AY8 A;  3KXB B;  5CPI A;  1P3M C;  3A1I A;  3W97 A;  5C3I B;  4QLC C;  3MGQ D;  3X1T C;  2F8N G;  2RVQ D;  2J8P A;  4Z2M G;  1Z2C B;  3AN2 A;  3KFU G;  5B40 B;  5AVB B;  5B1L D;  5B0Y A;  1EQZ A;  2BYK A;  2HUE B;  5B33 D;  4NFT A;  5CPK D;  1M19 B;  3MGQ A;  3UTB B;  5AV9 D;  4G91 C;  3O62 C;  5B1L A;  3WAA D;  3MVD C;  4H9P B;  1PZR A;  5B33 A;  4Z5T D;  5G49 A;  5CPK A;  3MNN D;  5DNN B;  2NQB C;  5AV9 A;  2Y2Q A;  3WAA A;  5B2I D;  3WTP E;  3EPL A;  4JJN C;  4Z5T A;  3X1U B;  1P3K D;  4EO5 C;  3MNN A;  1HTA A;  4WU9 D;  1F66 C;  3AZK D;  3AZM B;  1BH8 A;  3C1B B;  2CV5 C;  3MGP D;  3AZG C;  5B2I A;  2ZY3 A;  1S32 C;  2JCH A;  4ZUX C;  1P3K A;  4WU8 B;  5JA4 B;  4G92 C;  4WU9 A;  3AZK A;  1P34 D;  4KUD C;  2RIQ A;  3MGP A;  1N1J A;  3LEL C;  3W99 D;  5B31 G;  5BNX A;  3AYW C;  1H3O A;  3REL D;  1P34 A;  5GT3 B;  1KX5 B;  3AZL D;  3H0L C;  3W99 A;  5B2J C;  3AZF D;  4Z66 C;  3REH C;  3REL A;  1P3L C;  1TAF A;  3EPH A;  1P3M B;  4YS3 D;  4NE3 A;  1KU5 A;  4QLC B;  3AZL A;  3X1T B;  1U35 D;  3B6G C;  3WKJ D;  2PYO D;  2NZD C;  4J8W C;  3AZF A;  3W98 D;  5GSU D;  1AOI C;  5AY8 C;  4YS3 A;  5CPI C;  3AV2 D;  3MGR D;  1P3G D;  1U35 A;  3AZI D;  4H9R A;  3V9R A;  2Y2M A;  3WKJ A;  4G91 B;  2PYO A;  3O62 B;  1KX3 D;  3W98 A;  4KGC D;  2F2A C;  4LD9 D;  5GSU A;  3MVD B;  3REK D;  3B6F D;  3AV2 A;  1P3G A;  3MGR A;  3UT9 D;  4X23 C;  3WTP D;  3MGQ C;  1P3B D;  2Y2N A;  3AZI A;  5AV6 D;  2NQB B;  4H9Q A;  3B0B A;  3X1S D;  2Y2I A;  1KX3 A;  4UUZ B;  4KGC A;  4LD9 A;  5B1L C;  3REK A;  4JJN B;  3B6F A;  1W2E A;  2YFV B;  3W96 C;  3UT9 A;  4EO5 B;  3LZ1 B;  3WTP A;  2Y2H A;  1P3B A;  1F66 B;  5AV6 A;  3X1S A;  5F99 C;  2CV5 B;  3AZG B;  1P3O D;  5B24 B;  3LJA D;  1S32 B;  4KHA A;  4ZUX B;  3UTA C;  2Y2G A;  4G92 B;  3AZN D;  4KUD B;  3KUY D;  4NE5 A;  1M1A D;  1P3O A;  3LEL B;  5CPJ D;  5B2I C;  3LJA A;  1JFI A;  3C1C C;  1A7W A;  1P3K C;  3A1K A;  5BO0 A;  3MGS D;  1ZLA D;  3AZN A;  4WU9 C;  4WV4 B;  3AZK C;  3KUY A;  1P3F D;  1M1A A;  5AVC C;  3AV1 D;  3H0M C;  5CPJ A;  5B2J B;  2BG1 A;  4Z66 B;  3REH B;  1P3L B;  3MGS A;  4H9S A;  5BNV A;  3TU4 B;  1ZLA A;  1P3I D;  5AV8 D;  3X1V C;  1P34 C;  1P3F A;  3B6G B;  5KDM B;  3AV1 A;  5GXQ D;  1M18 D;  5AV5 C;  4J8W B;  2YFW B;  3B0C W;  1AOI B;  3AZJ D;  3REL C;  5AY8 B;  1P3I A;  5AV8 A;  5CPI B;  3EG5 B;  3REI C;  2G5H C;  3WA9 C;  5GXQ A;  1P3P B;  4WNN A;  3AZH D;  1M18 A;  3A6N D;  3AZF C;  5B31 D;  5B0Z C;  1KX4 D;  2BYK B;  3AZJ A;  1HQ3 C;  3AZE D;  4X23 B;  3MGQ B;  1ID3 C;  5FUG A;  3AZH A;  5B1M C;  3WKJ C;  4CAY B;  3A6N A;  4J8X D;  2PYO C;  3W98 C;  1KX4 A;  5B31 A;  3KXB D;  2IO5 C;  5GSU C;  2Y2L A;  3W96 B;  1P3G C;  3AZE A;  3AZI C;  5B40 D;  5F99 B;  4J8X A;  1P3A D;  1KX3 C;  3KXB A;  4YM6 C;  3UTA B;  1M19 D;  3B6F C;  1B6W A;  3UT9 C;  1R4V A;  5B32 C;  4XUJ C;  3WTP C;  1P3B C;  2W8S A;  5B40 A;  3X1S C;  2HIO D;  1P3A A;  5B2I B;  3C1C B;  2F8N K;  1M19 A;  2F8N H;  3R45 B;  4Z2M H;  5DNN D;  5BT1 D;  2BYM A;  4WU9 B;  3AZK B;  3EPK A;  2JE5 A;  4H9P A;  2HIO A;  5AVC B;  1WWI A;  2LY8 A;  3LJA C;  4AWL C;  3B0C T;  5DNN A;  1TZY B;  1H3O B;  3AZM D;  3X1V B;  1P34 B;  3KUY C;  2ZY4 A;  5AV5 B;  4H9N B;  3AZM A;  5E5A D;  1TAF B;  4H9S C;  5DNM D;  1ZLA C;  3WA9 B;  3REI B;  1BH9 B;  5CP6 C;  1P3F C;  4J8V D;  2DF4 C;  5B0Z B;  5E5A A;  1HQ3 B;  4DRA A;  5GT3 D;  5DNM A;  4XZQ D;  3REJ C;  1P3I C;  5AV8 C;  4E44 A;  1KX5 D;  3AFA D;  3W97 C;  1ID3 B;  5GXQ C;  5B1M B;  4J8V A;  3WKJ B;  2PYO B;  3H0R C;  3AN2 C;  4DQY B;  2IO5 B;  5GT3 A;  3AZJ C;  1KX5 A;  4XZQ A;  4QLC D;  5B0Y C;  1EQZ C;  1P3G B;  2VQR A;  4HGA C;  2Y2O A;  3AFA A;  3AZI B;  3NQU A;  2RVQ C;  1KX3 B;  3LZ0 D;  5B31 C;  4YM6 B;  4QLC A;  2FJ7 D;  4E45 A;  3B6F B;  3VH5 W;  3AZE C;  5B33 C;  5B32 B;  4XUJ B;  1P3B B;  5CPK C;  3X1S B;  3LZ0 A;  5AV9 C;  2ARO D;  2FJ7 A;  3WAA C;  4CSR B;  4ZBJ C;  4Z5T C;  1F1E A;  3EPJ A;  4R8P D;  5B40 C;  3MNN C;  2F8N B;  1P3A C;  2ARO A;  3LJA B;  4AWL B;  3LZ1 D;  1F66 D;  1B67 A;  3KWQ D;  3AYW B;  3KSY A;  3AZG D;  4R8P A;  5B24 D;  3KUY B;  3FDD A;  2HIO C;  3LZ1 A;  3MGP C;  1F66 A;  3KWQ A;  2CWE A;  4J8U D;  4KUD D;  1ZLA B;  5BT1 C;  3AZG A;  5CP6 B;  5B24 A;  3LEL D;  4M6B A;  2ZY2 A;  3W99 C;  5GT0 D;  4J8U A;  4KUD A;  2NZD B;  3REJ B;  1P3I B;  5AV8 B;  3NQJ A;  3LEL A;  3AL0 C;  5B2J D;  3W97 B;  3AZL C;  1P3L D;  3TU4 D;  3AN2 B;  2Y2P A;  5GT0 A;  3AZJ B;  5E5A C;  5B0Y B;  5DNM C;  3VH5 T;  1EQZ B;  4HGA B;  5B2J A;  4YS3 C;  5JRG D;  4J8W D;  1U35 C;  4J8V C;  1P3L A;  3TU4 A;  5B31 B;  5GT3 C;  1KX5 C;  5B1L B;  4XZQ C;  3IP4 C;  3AZE B;  5B33 B;  3AFA C;  1P3P D;  5G49 B;  4WZS B;  3AV2 C;  4H9O A;  3MGR C;  5JRG A;  5CPK B;  4J8W A;  2YFW A;  3F6T A;  5AVB D;  5AV9 B;  3VH5 A;  2FFF B;  4X23 D;  4KGC C;  3WAA B;  4LD9 C;  3REK C;  4ZBJ B;  1P3P A;  4Z5T B;  3UTB D;  3MNN B;  5AV6 C;  3VH6 W;  1P3A B;  5AVB A;  3LZ0 C;  1ULY A;  2ZY5 A;  3W96 D;  1BH8 B;  4X23 A;  2FJ7 C;  5F99 D;  1P3K B;  2BYM B;  2JSS A;  4CAY A;  3UTB A;  2XD5 A;  2HIO B;  3UTA D;  3W96 A;  2ARO C;  3X1U D;  1N1J B;  3MGP B;  1P3O C;  2ZM5 A;  5BNX B;  5F99 A;  5BS7 A;  4R8P C;  3AZN C;  3C1B D;  3C1C D;  3UTA A;  1M1A C;  3X1U A;  3LZ1 C;  5CPJ C;  4WU8 D;  3W99 B;  1WWS A;  3KWQ C;  2G5I C;  5AVC D;  3REL B;  3MGS C;  5B24 C;  3C1B A;  3C1C A;  1BFM A;  3R45 A;  3AZL B;  1TZY D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...