3AV2C

The human nucleosome structure containing the histone variant h3.3
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
105
structure length
105
Chain Sequence
AKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords Histone H3.3
publication title Structures of human nucleosomes containing major histone H3 variants
pubmed doi rcsb
source organism Homo sapiens
total genus 30
structure length 105
sequence length 105
chains with identical sequence G
ec nomenclature
pdb deposition date 2011-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3av2C00
3AFAC 3LJAD 4J8XB 3UTAA 5BS7A 5B0ZB 4H9RA 2HIOD 3C1CB 1KX3C 1P3PD 1ZLAA 3C1BA 1JFIA 3LELA 3AZFB 3X1SB 5GT0A 3REIC 5JRGD 4G92C 3REIB 2YFWB 4YM6D 3MVDB 4EO5B 1TAFA 5AY8C 3NQJA 5AV8B 5B32C 4J8VC 5B40C 3AZJC 3W97C 1AOIB 5BNVB 3B6FB 3MGSB 4J8WA 5F99C 1KX5B 1BFMA 5G49B 3AYWA 3O62A 2BYMB 2NQBA 3REKC 3B0CW 3UT9B 1P3GB 4Z5TB 4WU9D 3LZ0C 5AV6C 3AZKD 3AZND 1KX4C 5AV6B 4JJNC 1F66C 5CP6D 5B33C 5B33B 4XZQC 1S32B 4AWLC 1P3BB 2F8NG 4H9QB 3W98A 3LZ1D 3WAAC 1M19A 4H9OA 4KHAB 4WV4B 5GXQB 5B24B 2F8ND 3B6GC 5AVBB 5B0YA 5B1LD 4LD9D 3W96B 1P3LB 3AZEC 3MGPD 3KWQC 3KUYA 5DNMB 2CV5C 4KGCB 5DNNB 1P3KB 5B32G 1U35C 4WU8B 4J8XA 3B0BA 3AV1C 2NZDD 3REJB 3AZLB 3R45B 3AZFA 4H9NB 3X1SA 3REIA 3AZGC 5CPJC 3MGRB 2BYKB 4X23B 3AZHB 3B0DB 3RELD 1HTAA 5AV8A 5B1MC 3W97A 3AZJA 1WWSA 1P3AC 1AOIA 5BNVA 3KXBB 1P3AB 3MGSA 3B6FA 1KX5A 3NQUA 4ZBJB 5GSUB 5CPIC 5AV5B 5G49A 2FJ7D 2BYMA 3UT9A 1P3GA 4Z66B 5CHLB 3WTPD 3W99D 4Z5TA 5E5AD 5B31C 5CPKB 4R8PB 5AV6A 1ID3C 3LJAC 3WAAD 1TAFB 3NQJB 3REHD 2HIOB 5B33A 1P3PB 3B6GD 4M6BA 1S32A 1P3BA 3AZED 5JRGB 4H9QA 4YM6C 2CV5D 3O62B 4KHAA 5BT1C 5AV9C 5B24A 5GXQA 4NFTA 1P3FC 3WA9B 1U35D 4XUJC 5AVBA 2AROD 3W96A 5JA4A 1P3LA 3AV1D 2PYOD 5DNMA 3AV2B 4KGCA 5DNNA 1P3KA 2F8NH 3AZGD 3MNND 4G91B 3AZID 3AZNC 3AZKB 4WU9B 5C3IC 1B67A 4UUZB 5B1MD 4J8UD 3AZLA 3R45A 5CP6B 4H9NA 1EQZD 2JSSA 5CPID 3MGRA 5CPJA 1BH9B 2BYKA 4X23A 5B31G 1P3OD 5AVCB 3VH5W 3LZ1B 2RVQD 4HGAB 5B2JD 1P3AA 1P3IB 2F8NB 5B31D 4NE6A 3UTBD 5GSUA 5B1LC 4LD9C 5B1LB 5B2IB 5AV5A 3TU4B 3AFAB 3MGPC 1BH8B 4KUDC 1KX3B 4Z66A 2LY8A 5CPKA 4R8PA 4G92B 2HUEC 2HIOA 5BT1D 5GT3C 5AY8B 5AV9D 1P3FD 1P3PA 2NZDC 5B32B 5B40B 4J8VB 3AZJB 3W97B 3C1BD 4XUJD 4Z2MH 2YFVB 1Q9CA 2CWEA 1P3MC 5F99B 3NQUB 5JRGA 4YM6A 3RELC 3REKB 3WA9A 2IO5C 3AZMD 3LZ0B 1KX4B 3AV2A 4JJNB 2FJ7C 1F66B 3VH6A 2NQBD 4XZQB 4YS3C 3WTPC 3A6NC 4CAYB 4AWLB 1M1AC 3W99C 5E5AC 4E45A 3AZKA 4WU9A 4UUZA 3AN2D 3WAAB 3REHC 5CP6A 3REHB 4H9PB 1P34C 3B6GB 1BH9A 5JA4B 1HQ3C 3AZEB 5AVCA 3MGQC 3X1UD 3KWQB 4H9SA 3LZ1A 3W98D 2CV5B 4KUDD 1P3IA 2F8NA 4ZUXC 1U35B 2AROC 5B1LA 4LD9A 5B2IA 3TU4A 3AFAA 2PYOC 3AV1B 3WTPE 1BH8A 5GT3D 1KX3A 1P3MD 3MNNC 3AZGB 5CPJB 3AZIC 1N1JA 5AY8A 5B0ZD 1H3OB 5KDMB 3C1CD 4J8UC 5B32A 5B40A 5B1MB 4J8VA 2YFVA 3AZFD 1EQZC 5F99A 4Z2MG 3X1SD 5CPIB 1M18D 3X1VD 1P3OC 3MVDD 3REKA 3VH5A 2RVQC 5AV8D 5B2JC 5BO0B 4YS3D 3A6ND 1M1AD 4QLCC 3UTBC 5B31B 3LZ0A 3UTBB 3B6FD 1KX4A 1ID3B 4JJNA 3LJAB 1F66A 1P34D 3UT9D 4XZQA 1P3GD 4CAYA 1HQ3D 2L5AA 3X1TD 1TZYD 3MGQD 4YM6B 3UTAC 3WAAA 5BS7C 3REHA 5AV9B 1P3FB 4H9PA 4ZUXD 3B6GA 1ZLAC 3C1BC 1S32D 3LELC 4XUJB 3AZEA 5GT0C 3WKJD 4E44A 3KWQA 2CV5A 1R4VA 1U35A 3AZMC 3W96D 3AZNB 3AV1A 5C3IB 1A7WA 5DNMD 2NQBC 3AZGA 4WU8D 1H3OA 5KDMA 3AN2C 3AN2B 5B1MA 3REJD 4QLCD 4LD9B 1WWIA 5CPIA 3MGRD 1P3OA 3X1UC 4X23D 3MGPB 3AZHD 3X1UB 3W98C 4KUDB 1M19C 5BO0A 3KXBD 5B31A 3UTBA 1ID3A 5GSUD 3LJAA 3KSYA 3UTAD 1N1JB 2HUEB 5AV5D 3KUYC 5GT3B 2NZDB 1ZLAD 4Z66D 3LELD 1P3MB 5GT0D 1B6WA 4J8XC 5B0ZC 3RELB 5AV9A 3C1CC 4CSRB 1P3FA 2IO5B 4XUJA 3AZFC 3X1SC 4J8WD 2F8NK 1M18C 3X1VC 2FJ7B 1M18B 3X1VB 3MVDC 3AYWD 3O62D 4EO5C 3V9RB 5AV8C 3WA9D 3WTPB 3A6NB 4YS3B 1M1AB 1AOIC 3B6FC 3MGSC 5E5AB 3AZMA 1KX5C 3W99B 3AZNA 3AV2D 3UT9C 1P34B 1P3GC 4WNNB 1HQ3B 4Z5TC 1TZYC 3X1TC 3X1TB 1TZYB 3MGQB 3AN2A 1M19D 4ZUXB 1S32C 4DRAA 1P3BC 3VH6T 2AROB 5B0YD 3WKJC 3MGPA 2PYOB 3WKJB 5AVCD 3X1UA 3KUYD 4KUDA 5GXQC 5B24C 1P3ID 3MNNB 5AVBC 3AZIB 3W96C 1P3LC 5B2ID 4J8XD 3TU4D 3AFAD 4DRBA 5GT3A 2NZDA 5DNMC 4J8UB 1KX3D 4KGCC 4WZSB 1EQZB 1P3MA 5DNNC 1P3KC 3REID 4WU8C 1P3OB 3RELA 5B0ZA 4CSRA 3C1CA 5AY8D 5B40D 5B32D 5B2JB 4J8VD 3REJC 3AZLC 3AZJD 1AOID 3W97D 3MGSD 4QLCB 1KX5D 5F99D 3TU4C 3MGRC 2YFWA 1M18A 3X1VA 2FJ7A 5FUGB 4X23C 3AZHC 3MVDA 3B0DC 4NE3A 3V9RA 5BNXB 3REKD 3WTPA 3A6NA 4YS3A 1M1AA 3KXBC 3W99A 5E5AA 4Z5TD 3LZ0D 4ZBJC 5GSUC 5AV6D 1KX4D 4NE5A 5AV5C 4JJND 3UTAB 3VH6W 1F66D 4H9RB 5B33D 1P34A 4Z66C 1ZLAB 3C1BB 4WNNA 4XZQD 1P3BD 3LELB 1JFIB 1HQ3A 3VH5T 5CPKC 4R8PC 1TZYA 5GT0B 3X1TA 3MGQA 2HIOC 5GXQD 4ZUXA 5B24D 1P3PC 2AROA 5AVBD 3AZMB 4J8WC 1P3LD 4J8WB 2PYOA 5JRGC 3WKJA 3KWQD 3AYWC 4KGCD 3O62C 3AYWB 2NQBB 1KU5A 5DNND 3WA9C 1P3KD 3MNNA 3AZIA 3AV2C 4J8UA 3AZLD 1EQZA 4G91C 5CPJD 3B0CT 4WU8A 3AZKC 4WU9C 3W98B 1M19B 5B2JA 4H9OB 5CP6C 3REJA 1P3AD 4QLCA 5B0YC 5B0YB 5FUGA 1ULYA 5AVCC 3AZHA 3KUYB 5BNXA 4H9SC 3LZ1C 4HGAC 1P3IC 3KXBA 1F1EA 5CPKD 4R8PD 1ID3D 5B2IC
chains in the Genus database with same CATH superfamily
3AFAC 3LJAD 4J8XB 3UTAA 5BS7A 5B0ZB 4H9RA 2HIOD 3C1CB 1KX3C 1P3PD 1ZLAA 3C1BA 1JFIA 3LELA 3AZFB 3X1SB 5GT0A 3REIC 5JRGD 4G92C 3REIB 2YFWB 4YM6D 3MVDB 4EO5B 1TAFA 5AY8C 3NQJA 5AV8B 5B32C 4J8VC 5B40C 3AZJC 3W97C 1AOIB 5BNVB 3B6FB 3MGSB 4J8WA 5F99C 1KX5B 1BFMA 2Y2HA 5G49B 3AYWA 3O62A 2BYMB 2NQBA 3REKC 3B0CW 3UT9B 1P3GB 2DQNC 4Z5TB 4WU9D 3LZ0C 5AV6C 3AZKD 3AZND 1KX4C 5AV6B 4JJNC 2UWXA 1F66C 5CP6D 5B33C 5B33B 4XZQC 1S32B 4AWLC 1P3BB 1Z2CB 2F8NG 4H9QB 3W98A 3LZ1D 3WAAC 1M19A 4H9OA 4KHAB 4WV4B 5GXQB 5B24B 2FFFB 2F8ND 3B6GC 5AVBB 5B0YA 5B1LD 4LD9D 3W96B 1P3LB 2G5IC 3AZEC 3EPJA 3MGPD 3KWQC 3KUYA 5DNMB 2CV5C 4KGCB 5DNNB 1P3KB 5B32G 1U35C 4WU8B 4J8XA 3B0BA 3AV1C 2G5HC 2NZDD 3REJB 3AZLB 3R45B 3AZFA 4H9NB 3X1SA 3REIA 3AZGC 2Y2JA 5CPJC 3MGRB 2BYKB 4X23B 3AZHB 3B0DB 3RELD 1HTAA 5AV8A 5B1MC 3W97A 3AZJA 1WWSA 1P3AC 1AOIA 5BNVA 3KXBB 1P3AB 3MGSA 3B6FA 1KX5A 3NQUA 4ZBJB 5GSUB 5CPIC 2ZM5A 5AV5B 5G49A 2FJ7D 2BYMA 3UT9A 1P3GA 4Z66B 2XD5A 5CHLB 3WTPD 3W99D 4Z5TA 5E5AD 5B31C 5CPKB 4R8PB 5AV6A 1ID3C 3LJAC 3WAAD 1TAFB 3NQJB 3REHD 2HIOB 5B33A 1P3PB 3B6GD 4M6BA 1S32A 3EPKA 1P3BA 3AZED 5JRGB 4H9QA 2ZY4A 4YM6C 2CV5D 3O62B 4KHAA 5BT1C 5AV9C 5B24A 5GXQA 4NFTA 1P3FC 3WA9B 1U35D 4XUJC 5AVBA 2AROD 3W96A 5JA4A 1P3LA 3AV1D 2PYOD 5DNMA 3AV2B 4KGCA 3EPHA 5DNNA 1P3KA 2F8NH 3AZGD 2W8SA 3MNND 4G91B 3AZID 3H0LC 3AZNC 3AZKB 4WU9B 5C3IC 1B67A 4UUZB 5B1MD 4J8UD 3AZLA 3R45A 5CP6B 4H9NA 1EQZD 3KFUG 2JSSA 5CPID 3MGRA 5CPJA 1BH9B 2BYKA 4X23A 5B31G 1P3OD 5AVCB 2XD1A 3VH5W 3LZ1B 2RVQD 4HGAB 5B2JD 1P3AA 1P3IB 2F8NB 5B31D 4NE6A 3UTBD 5GSUA 5B1LC 4LD9C 5B1LB 5B2IB 5AV5A 3TU4B 3AFAB 3MGPC 1BH8B 4KUDC 1KX3B 4Z66A 2LY8A 5CPKA 4R8PA 2Y2GA 4G92B 2HUEC 2HIOA 5BT1D 5GT3C 2Y2IA 5AY8B 5AV9D 1P3FD 1P3PA 5B32B 5B40B 4J8VB 3AZJB 3W97B 3C1BD 4XUJD 4Z2MH 2YFVB 1Q9CA 2CWEA 1P3MC 5F99B 3NQUB 5JRGA 4YM6A 3RELC 2Y2MA 3REKB 2DF4C 3WA9A 2IO5C 3AZMD 3LZ0B 2RIQA 1KX4B 3AV2A 4JJNB 2FJ7C 1F66B 3VH6A 2NQBD 4XZQB 4YS3C 3WTPC 3A6NC 4CAYB 4AWLB 1M1AC 3W99C 5E5AC 4E45A 3AZKA 4WU9A 4UUZA 3AN2D 3WAAB 3REHC 5CP6A 2J8PA 3REHB 4H9PB 1P34C 3B6GB 1BH9A 5JA4B 1HQ3C 3AZEB 5AVCA 3MGQC 3X1UD 3KWQB 4H9SA 3LZ1A 3W98D 2CV5B 4KUDD 1W2EA 1P3IA 2F8NA 4ZUXC 1U35B 2AROC 5B1LA 4LD9A 5B2IA 3TU4A 3AFAA 2PYOC 3P5JB 3WTPE 3AV1B 1BH8A 5GT3D 1KX3A 2NZDC 1P3MD 3MNNC 3AZGB 5CPJB 3AZIC 1N1JA 5AY8A 2ZY3A 1H3OB 5KDMB 5B0ZD 3C1CD 4J8UC 5B32A 5B40A 5B1MB 4J8VA 2Y2LA 2YFVA 3AZFD 1EQZC 5F99A 4Z2MG 3X1SD 5CPIB 1M18D 3X1VD 1P3OC 3MVDD 3REKA 3VH5A 2RVQC 5AV8D 5B2JC 5BO0B 3H0MC 4YS3D 2Y2OA 3A6ND 1M1AD 4QLCC 3UTBC 5B31B 3LZ0A 3UTBB 3B6FD 1KX4A 1ID3B 4JJNA 3LJAB 1F66A 1P34D 3UT9D 4XZQA 1P3GD 4CAYA 2L5AA 1HQ3D 3X1TD 1TZYD 2Y2PA 3MGQD 4YM6B 3UTAC 3WAAA 5BS7C 3REHA 5AV9B 1P3FB 4H9PA 4ZUXD 3B6GA 1ZLAC 3C1BC 1S32D 3LELC 4XUJB 3IP4C 5GT0C 3AZEA 3WKJD 1T3UA 4E44A 3KWQA 2CV5A 2Y2KA 3AL0C 1R4VA 1U35A 3AZMC 3W96D 3AZNB 3AV1A 5C3IB 1A7WA 3A1IA 5DNMD 2NQBC 3AZGA 4WU8D 1H3OA 5KDMA 3AN2C 3AN2B 5B1MA 3REJD 4QLCD 4LD9B 1WWIA 5CPIA 3MGRD 4DQYB 1P3OA 3X1UC 4X23D 3MGPB 3AZHD 3X1UB 3W98C 4KUDB 1M19C 5BO0A 3KXBD 5B31A 3UTBA 2BG1A 1ID3A 5GSUD 3LJAA 3KSYA 3UTAD 1N1JB 2HUEB 5AV5D 3KUYC 5GT3B 2NZDB 1ZLAD 4Z66D 3LELD 1P3MB 5GT0D 2VQRA 1B6WA 4J8XC 5B0ZC 3RELB 5AV9A 3C1CC 4CSRB 1P3FA 2F2AC 2IO5B 4XUJA 3AZFC 3X1SC 4J8WD 2Y2QA 2F8NK 4UPKA 1M18C 3X1VC 2FJ7B 1M18B 3X1VB 3MVDC 3AYWD 3O62D 4EO5C 3V9RB 5AV8C 3WA9D 3WTPB 3A6NB 4YS3B 1M1AB 1AOIC 3B6FC 3MGSC 5E5AB 3AZMA 1KX5C 3W99B 3AZNA 3A1KA 3AV2D 3UT9C 1P34B 1P3GC 4WNNB 1HQ3B 4Z5TC 1TZYC 3X1TC 3X1TB 1TZYB 3MGQB 3AN2A 1M19D 4ZUXB 1S32C 4DRAA 1P3BC 3VH6T 2AROB 5B0YD 3WKJC 3MGPA 2PYOB 3WKJB 5AVCD 3X1UA 3KUYD 4KUDA 2ZY5A 5GXQC 5B24C 1P3ID 2JE5A 3MNNB 5AVBC 3AZIB 3W96C 1P3LC 5B2ID 4J8XD 3TU4D 3AFAD 4DRBA 5GT3A 2NZDA 3F6TA 5DNMC 3FDDA 4J8UB 1KX3D 4KGCC 4WZSB 1EQZB 1P3MA 5DNNC 1P3KC 3REID 4WU8C 1P3OB 3RELA 5B0ZA 4CSRA 3C1CA 5AY8D 5B40D 5B32D 5B2JB 4J8VD 3REJC 3AZLC 3AZJD 1AOID 3W97D 3MGSD 4QLCB 1KX5D 5F99D 3TU4C 3MGRC 2YFWA 1M18A 3X1VA 2FJ7A 5FUGB 4X23C 3AZHC 3MVDA 3B0DC 4NE3A 3V9RA 5BNXB 3REKD 2JCHA 3WTPA 3A6NA 4YS3A 1M1AA 3KXBC 3W99A 5E5AA 3H0RC 4Z5TD 3LZ0D 4ZBJC 5GSUC 5AV6D 1KX4D 4NE5A 5AV5C 4JJND 3UTAB 3VH6W 1F66D 4H9RB 5B33D 1P34A 4Z66C 1ZLAB 3C1BB 4WNNA 4XZQD 1P3BD 3LELB 1JFIB 1HQ3A 3VH5T 5CPKC 4R8PC 1TZYA 5GT0B 3X1TA 3MGQA 2HIOC 5GXQD 4ZUXA 5B24D 1P3PC 2AROA 5AVBD 3AZMB 4J8WC 1P3LD 4J8WB 2PYOA 5JRGC 3WKJA 3EPLA 3KWQD 3AYWC 4KGCD 3O62C 3AYWB 2NQBB 1KU5A 5DNND 3WA9C 1P3KD 3MNNA 3AZIA 3AV2C 4J8UA 4WJ3C 3AZLD 1EQZA 4G91C 5CPJD 3B0CT 4WU8A 1PZRA 3AZKC 4WU9C 3W98B 1M19B 5B2JA 4H9OB 5CP6C 3REJA 1P3AD 4QLCA 2Y2NA 5B0YC 5B0YB 2ZY2A 5FUGA 1ULYA 5AVCC 3AZHA 3KUYB 5BNXA 4H9SC 3LZ1C 4HGAC 1P3IC 3KXBA 1F1EA 5CPKD 4R8PD 3EG5B 1ID3D 5B2IC
chains in the Genus database with same CATH topology
3AFAC 3LJAD 4J8XB 3UTAA 5BS7A 5B0ZB 4H9RA 2HIOD 3C1CB 1KX3C 1P3PD 1ZLAA 3C1BA 1JFIA 3LELA 3AZFB 3X1SB 5GT0A 3REIC 5JRGD 4G92C 3REIB 2YFWB 4YM6D 3MVDB 4EO5B 1TAFA 5AY8C 3NQJA 5AV8B 5B32C 4J8VC 5B40C 3AZJC 3W97C 1AOIB 5BNVB 3B6FB 3MGSB 4J8WA 5F99C 1KX5B 1BFMA 2Y2HA 5G49B 3AYWA 3O62A 2BYMB 2NQBA 3REKC 3B0CW 3UT9B 1P3GB 2DQNC 4Z5TB 4WU9D 3LZ0C 5AV6C 3AZKD 3AZND 1KX4C 5AV6B 4JJNC 2UWXA 1F66C 5CP6D 5B33C 5B33B 4XZQC 1S32B 4AWLC 1P3BB 1Z2CB 2F8NG 4H9QB 3W98A 3LZ1D 3WAAC 1M19A 4H9OA 4KHAB 4WV4B 5GXQB 5B24B 2FFFB 2F8ND 3B6GC 5AVBB 5B0YA 5B1LD 4LD9D 3W96B 1P3LB 2G5IC 3AZEC 3EPJA 3MGPD 3KWQC 3KUYA 5DNMB 2CV5C 4KGCB 5DNNB 1P3KB 5B32G 1U35C 4WU8B 4J8XA 3B0BA 3AV1C 2G5HC 2NZDD 3REJB 3AZLB 3R45B 3AZFA 4H9NB 3X1SA 3REIA 3AZGC 2Y2JA 5CPJC 3MGRB 2BYKB 4X23B 3AZHB 3B0DB 3RELD 1HTAA 5AV8A 5B1MC 3W97A 3AZJA 1WWSA 1P3AC 1AOIA 5BNVA 3KXBB 1P3AB 3MGSA 3B6FA 1KX5A 3NQUA 4ZBJB 5GSUB 5CPIC 2ZM5A 5AV5B 5G49A 2FJ7D 2BYMA 3UT9A 1P3GA 4Z66B 2XD5A 5CHLB 3WTPD 3W99D 4Z5TA 5E5AD 5B31C 5CPKB 4R8PB 5AV6A 1ID3C 3LJAC 3WAAD 1TAFB 3NQJB 3REHD 2HIOB 5B33A 1P3PB 3B6GD 4M6BA 1S32A 3EPKA 1P3BA 3AZED 5JRGB 4H9QA 2ZY4A 4YM6C 2CV5D 3O62B 4KHAA 5BT1C 5AV9C 5B24A 5GXQA 4NFTA 1P3FC 3WA9B 1U35D 4XUJC 5AVBA 2AROD 3W96A 5JA4A 1P3LA 3AV1D 2PYOD 5DNMA 3AV2B 4KGCA 3EPHA 5DNNA 1P3KA 2F8NH 3AZGD 2W8SA 3MNND 4G91B 3AZID 3H0LC 3AZNC 3AZKB 4WU9B 5C3IC 1B67A 4UUZB 5B1MD 4J8UD 3AZLA 3R45A 5CP6B 4H9NA 1EQZD 3KFUG 2JSSA 5CPID 3MGRA 5CPJA 1BH9B 2BYKA 4X23A 5B31G 1P3OD 5AVCB 2XD1A 3VH5W 3LZ1B 2RVQD 4HGAB 5B2JD 1P3AA 1P3IB 2F8NB 5B31D 4NE6A 3UTBD 5GSUA 5B1LC 4LD9C 5B1LB 5B2IB 5AV5A 3TU4B 3AFAB 3MGPC 1BH8B 4KUDC 1KX3B 4Z66A 2LY8A 5CPKA 4R8PA 2Y2GA 4G92B 2HUEC 2HIOA 5BT1D 5GT3C 2Y2IA 5AY8B 5AV9D 1P3FD 1P3PA 5B32B 5B40B 4J8VB 3AZJB 3W97B 3C1BD 4XUJD 4Z2MH 2YFVB 1Q9CA 2CWEA 1P3MC 5F99B 3NQUB 5JRGA 4YM6A 3RELC 2Y2MA 3REKB 2DF4C 3WA9A 2IO5C 3AZMD 3LZ0B 2RIQA 1KX4B 3AV2A 4JJNB 2FJ7C 1F66B 3VH6A 2NQBD 4XZQB 4YS3C 3WTPC 3A6NC 4CAYB 4AWLB 1M1AC 3W99C 5E5AC 4E45A 3AZKA 4WU9A 4UUZA 3AN2D 3WAAB 3REHC 5CP6A 2J8PA 3REHB 4H9PB 1P34C 3B6GB 1BH9A 5JA4B 1HQ3C 3AZEB 5AVCA 3MGQC 3X1UD 3KWQB 4H9SA 3LZ1A 3W98D 2CV5B 4KUDD 1W2EA 1P3IA 2F8NA 4ZUXC 1U35B 2AROC 5B1LA 4LD9A 5B2IA 3TU4A 3AFAA 2PYOC 3P5JB 3WTPE 3AV1B 1BH8A 5GT3D 1KX3A 2NZDC 1P3MD 3MNNC 3AZGB 5CPJB 3AZIC 1N1JA 5AY8A 2ZY3A 1H3OB 5KDMB 5B0ZD 3C1CD 4J8UC 5B32A 5B40A 5B1MB 4J8VA 2Y2LA 2YFVA 3AZFD 1EQZC 5F99A 4Z2MG 3X1SD 5CPIB 1M18D 3X1VD 1P3OC 3MVDD 3REKA 3VH5A 2RVQC 5AV8D 5B2JC 5BO0B 3H0MC 4YS3D 2Y2OA 3A6ND 1M1AD 4QLCC 3UTBC 5B31B 3LZ0A 3UTBB 3B6FD 1KX4A 1ID3B 4JJNA 3LJAB 1F66A 1P34D 3UT9D 4XZQA 1P3GD 4CAYA 2L5AA 1HQ3D 3X1TD 1TZYD 2Y2PA 3MGQD 4YM6B 3UTAC 3WAAA 5BS7C 3REHA 5AV9B 1P3FB 4H9PA 4ZUXD 3B6GA 1ZLAC 3C1BC 1S32D 3LELC 4XUJB 3IP4C 5GT0C 3AZEA 3WKJD 1T3UA 4E44A 3KWQA 2CV5A 2Y2KA 3AL0C 1R4VA 1U35A 3AZMC 3W96D 3AZNB 3AV1A 5C3IB 1A7WA 3A1IA 5DNMD 2NQBC 3AZGA 4WU8D 1H3OA 5KDMA 3AN2C 3AN2B 5B1MA 3REJD 4QLCD 4LD9B 1WWIA 5CPIA 3MGRD 4DQYB 1P3OA 3X1UC 4X23D 3MGPB 3AZHD 3X1UB 3W98C 4KUDB 1M19C 5BO0A 3KXBD 5B31A 3UTBA 2BG1A 1ID3A 5GSUD 3LJAA 3KSYA 3UTAD 1N1JB 2HUEB 5AV5D 3KUYC 5GT3B 2NZDB 1ZLAD 4Z66D 3LELD 1P3MB 5GT0D 2VQRA 1B6WA 4J8XC 5B0ZC 3RELB 5AV9A 3C1CC 4CSRB 1P3FA 2F2AC 2IO5B 4XUJA 3AZFC 3X1SC 4J8WD 2Y2QA 2F8NK 4UPKA 1M18C 3X1VC 2FJ7B 1M18B 3X1VB 3MVDC 3AYWD 3O62D 4EO5C 3V9RB 5AV8C 3WA9D 3WTPB 3A6NB 4YS3B 1M1AB 1AOIC 3B6FC 3MGSC 5E5AB 3AZMA 1KX5C 3W99B 3AZNA 3A1KA 3AV2D 3UT9C 1P34B 1P3GC 4WNNB 1HQ3B 4Z5TC 1TZYC 3X1TC 3X1TB 1TZYB 3MGQB 3AN2A 1M19D 4ZUXB 1S32C 4DRAA 1P3BC 3VH6T 2AROB 5B0YD 3WKJC 3MGPA 2PYOB 3WKJB 5AVCD 3X1UA 3KUYD 4KUDA 2ZY5A 5GXQC 5B24C 1P3ID 2JE5A 3MNNB 5AVBC 3AZIB 3W96C 1P3LC 5B2ID 4J8XD 3TU4D 3AFAD 4DRBA 5GT3A 2NZDA 3F6TA 5DNMC 3FDDA 4J8UB 1KX3D 4KGCC 4WZSB 1EQZB 1P3MA 5DNNC 1P3KC 3REID 4WU8C 1P3OB 3RELA 5B0ZA 4CSRA 3C1CA 5AY8D 5B40D 5B32D 5B2JB 4J8VD 3REJC 3AZLC 3AZJD 1AOID 3W97D 3MGSD 4QLCB 1KX5D 5F99D 3TU4C 3MGRC 2YFWA 1M18A 3X1VA 2FJ7A 5FUGB 4X23C 3AZHC 3MVDA 3B0DC 4NE3A 3V9RA 5BNXB 3REKD 2JCHA 3WTPA 3A6NA 4YS3A 1M1AA 3KXBC 3W99A 5E5AA 3H0RC 4Z5TD 3LZ0D 4ZBJC 5GSUC 5AV6D 1KX4D 4NE5A 5AV5C 4JJND 3UTAB 3VH6W 1F66D 4H9RB 5B33D 1P34A 4Z66C 1ZLAB 3C1BB 4WNNA 4XZQD 1P3BD 3LELB 1JFIB 1HQ3A 3VH5T 5CPKC 4R8PC 1TZYA 5GT0B 3X1TA 3MGQA 2HIOC 5GXQD 4ZUXA 5B24D 1P3PC 2AROA 5AVBD 3AZMB 4J8WC 1P3LD 4J8WB 2PYOA 5JRGC 3WKJA 3EPLA 3KWQD 3AYWC 4KGCD 3O62C 3AYWB 2NQBB 1KU5A 5DNND 3WA9C 1P3KD 3MNNA 3AZIA 3AV2C 4J8UA 4WJ3C 3AZLD 1EQZA 4G91C 5CPJD 3B0CT 4WU8A 1PZRA 3AZKC 4WU9C 3W98B 1M19B 5B2JA 4H9OB 5CP6C 3REJA 1P3AD 4QLCA 2Y2NA 5B0YC 5B0YB 2ZY2A 5FUGA 1ULYA 5AVCC 3AZHA 3KUYB 5BNXA 4H9SC 3LZ1C 4HGAC 1P3IC 3KXBA 1F1EA 5CPKD 4R8PD 3EG5B 1ID3D 5B2IC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AFA C;  3LJA D;  4J8X B;  3UTA A;  5BS7 A;  5B0Z B;  4H9R A;  2HIO D;  3C1C B;  1KX3 C;  1P3P D;  1ZLA A;  3C1B A;  1JFI A;  3LEL A;  3AZF B;  3X1S B;  5GT0 A;  3REI C;  5JRG D;  4G92 C;  3REI B;  2YFW B;  4YM6 D;  3MVD B;  4EO5 B;  1TAF A;  5AY8 C;  3NQJ A;  5AV8 B;  5B32 C;  4J8V C;  5B40 C;  3AZJ C;  3W97 C;  1AOI B;  5BNV B;  3B6F B;  3MGS B;  4J8W A;  5F99 C;  1KX5 B;  1BFM A;  5G49 B;  3AYW A;  3O62 A;  2BYM B;  2NQB A;  3REK C;  3B0C W;  3UT9 B;  1P3G B;  4Z5T B;  4WU9 D;  3LZ0 C;  5AV6 C;  3AZK D;  3AZN D;  1KX4 C;  5AV6 B;  4JJN C;  1F66 C;  5CP6 D;  5B33 C;  5B33 B;  4XZQ C;  1S32 B;  4AWL C;  1P3B B;  2F8N G;  4H9Q B;  3W98 A;  3LZ1 D;  3WAA C;  1M19 A;  4H9O A;  4KHA B;  4WV4 B;  5GXQ B;  5B24 B;  2F8N D;  3B6G C;  5AVB B;  5B0Y A;  5B1L D;  4LD9 D;  3W96 B;  1P3L B;  3AZE C;  3MGP D;  3KWQ C;  3KUY A;  5DNM B;  2CV5 C;  4KGC B;  5DNN B;  1P3K B;  5B32 G;  1U35 C;  4WU8 B;  4J8X A;  3B0B A;  3AV1 C;  2NZD D;  3REJ B;  3AZL B;  3R45 B;  3AZF A;  4H9N B;  3X1S A;  3REI A;  3AZG C;  5CPJ C;  3MGR B;  2BYK B;  4X23 B;  3AZH B;  3B0D B;  3REL D;  1HTA A;  5AV8 A;  5B1M C;  3W97 A;  3AZJ A;  1WWS A;  1P3A C;  1AOI A;  5BNV A;  3KXB B;  1P3A B;  3MGS A;  3B6F A;  1KX5 A;  3NQU A;  4ZBJ B;  5GSU B;  5CPI C;  5AV5 B;  5G49 A;  2FJ7 D;  2BYM A;  3UT9 A;  1P3G A;  4Z66 B;  5CHL B;  3WTP D;  3W99 D;  4Z5T A;  5E5A D;  5B31 C;  5CPK B;  4R8P B;  5AV6 A;  1ID3 C;  3LJA C;  3WAA D;  1TAF B;  3NQJ B;  3REH D;  2HIO B;  5B33 A;  1P3P B;  3B6G D;  4M6B A;  1S32 A;  1P3B A;  3AZE D;  5JRG B;  4H9Q A;  4YM6 C;  2CV5 D;  3O62 B;  4KHA A;  5BT1 C;  5AV9 C;  5B24 A;  5GXQ A;  4NFT A;  1P3F C;  3WA9 B;  1U35 D;  4XUJ C;  5AVB A;  2ARO D;  3W96 A;  5JA4 A;  1P3L A;  3AV1 D;  2PYO D;  5DNM A;  3AV2 B;  4KGC A;  5DNN A;  1P3K A;  2F8N H;  3AZG D;  3MNN D;  4G91 B;  3AZI D;  3AZN C;  3AZK B;  4WU9 B;  5C3I C;  1B67 A;  4UUZ B;  5B1M D;  4J8U D;  3AZL A;  3R45 A;  5CP6 B;  4H9N A;  1EQZ D;  2JSS A;  5CPI D;  3MGR A;  5CPJ A;  1BH9 B;  2BYK A;  4X23 A;  5B31 G;  1P3O D;  5AVC B;  3VH5 W;  3LZ1 B;  2RVQ D;  4HGA B;  5B2J D;  1P3A A;  1P3I B;  2F8N B;  5B31 D;  4NE6 A;  3UTB D;  5GSU A;  5B1L C;  4LD9 C;  5B1L B;  5B2I B;  5AV5 A;  3TU4 B;  3AFA B;  3MGP C;  1BH8 B;  4KUD C;  1KX3 B;  4Z66 A;  2LY8 A;  5CPK A;  4R8P A;  4G92 B;  2HUE C;  2HIO A;  5BT1 D;  5GT3 C;  5AY8 B;  5AV9 D;  1P3F D;  1P3P A;  2NZD C;  5B32 B;  5B40 B;  4J8V B;  3AZJ B;  3W97 B;  3C1B D;  4XUJ D;  4Z2M H;  2YFV B;  1Q9C A;  2CWE A;  1P3M C;  5F99 B;  3NQU B;  5JRG A;  4YM6 A;  3REL C;  3REK B;  3WA9 A;  2IO5 C;  3AZM D;  3LZ0 B;  1KX4 B;  3AV2 A;  4JJN B;  2FJ7 C;  1F66 B;  3VH6 A;  2NQB D;  4XZQ B;  4YS3 C;  3WTP C;  3A6N C;  4CAY B;  4AWL B;  1M1A C;  3W99 C;  5E5A C;  4E45 A;  3AZK A;  4WU9 A;  4UUZ A;  3AN2 D;  3WAA B;  3REH C;  5CP6 A;  3REH B;  4H9P B;  1P34 C;  3B6G B;  1BH9 A;  5JA4 B;  1HQ3 C;  3AZE B;  5AVC A;  3MGQ C;  3X1U D;  3KWQ B;  4H9S A;  3LZ1 A;  3W98 D;  2CV5 B;  4KUD D;  1P3I A;  2F8N A;  4ZUX C;  1U35 B;  2ARO C;  5B1L A;  4LD9 A;  5B2I A;  3TU4 A;  3AFA A;  2PYO C;  3AV1 B;  3WTP E;  1BH8 A;  5GT3 D;  1KX3 A;  1P3M D;  3MNN C;  3AZG B;  5CPJ B;  3AZI C;  1N1J A;  5AY8 A;  5B0Z D;  1H3O B;  5KDM B;  3C1C D;  4J8U C;  5B32 A;  5B40 A;  5B1M B;  4J8V A;  2YFV A;  3AZF D;  1EQZ C;  5F99 A;  4Z2M G;  3X1S D;  5CPI B;  1M18 D;  3X1V D;  1P3O C;  3MVD D;  3REK A;  3VH5 A;  2RVQ C;  5AV8 D;  5B2J C;  5BO0 B;  4YS3 D;  3A6N D;  1M1A D;  4QLC C;  3UTB C;  5B31 B;  3LZ0 A;  3UTB B;  3B6F D;  1KX4 A;  1ID3 B;  4JJN A;  3LJA B;  1F66 A;  1P34 D;  3UT9 D;  4XZQ A;  1P3G D;  4CAY A;  1HQ3 D;  2L5A A;  3X1T D;  1TZY D;  3MGQ D;  4YM6 B;  3UTA C;  3WAA A;  5BS7 C;  3REH A;  5AV9 B;  1P3F B;  4H9P A;  4ZUX D;  3B6G A;  1ZLA C;  3C1B C;  1S32 D;  3LEL C;  4XUJ B;  3AZE A;  5GT0 C;  3WKJ D;  4E44 A;  3KWQ A;  2CV5 A;  1R4V A;  1U35 A;  3AZM C;  3W96 D;  3AZN B;  3AV1 A;  5C3I B;  1A7W A;  5DNM D;  2NQB C;  3AZG A;  4WU8 D;  1H3O A;  5KDM A;  3AN2 C;  3AN2 B;  5B1M A;  3REJ D;  4QLC D;  4LD9 B;  1WWI A;  5CPI A;  3MGR D;  1P3O A;  3X1U C;  4X23 D;  3MGP B;  3AZH D;  3X1U B;  3W98 C;  4KUD B;  1M19 C;  5BO0 A;  3KXB D;  5B31 A;  3UTB A;  1ID3 A;  5GSU D;  3LJA A;  3KSY A;  3UTA D;  1N1J B;  2HUE B;  5AV5 D;  3KUY C;  5GT3 B;  2NZD B;  1ZLA D;  4Z66 D;  3LEL D;  1P3M B;  5GT0 D;  1B6W A;  4J8X C;  5B0Z C;  3REL B;  5AV9 A;  3C1C C;  4CSR B;  1P3F A;  2IO5 B;  4XUJ A;  3AZF C;  3X1S C;  4J8W D;  2F8N K;  1M18 C;  3X1V C;  2FJ7 B;  1M18 B;  3X1V B;  3MVD C;  3AYW D;  3O62 D;  4EO5 C;  3V9R B;  5AV8 C;  3WA9 D;  3WTP B;  3A6N B;  4YS3 B;  1M1A B;  1AOI C;  3B6F C;  3MGS C;  5E5A B;  3AZM A;  1KX5 C;  3W99 B;  3AZN A;  3AV2 D;  3UT9 C;  1P34 B;  1P3G C;  4WNN B;  1HQ3 B;  4Z5T C;  1TZY C;  3X1T C;  3X1T B;  1TZY B;  3MGQ B;  3AN2 A;  1M19 D;  4ZUX B;  1S32 C;  4DRA A;  1P3B C;  3VH6 T;  2ARO B;  5B0Y D;  3WKJ C;  3MGP A;  2PYO B;  3WKJ B;  5AVC D;  3X1U A;  3KUY D;  4KUD A;  5GXQ C;  5B24 C;  1P3I D;  3MNN B;  5AVB C;  3AZI B;  3W96 C;  1P3L C;  5B2I D;  4J8X D;  3TU4 D;  3AFA D;  4DRB A;  5GT3 A;  2NZD A;  5DNM C;  4J8U B;  1KX3 D;  4KGC C;  4WZS B;  1EQZ B;  1P3M A;  5DNN C;  1P3K C;  3REI D;  4WU8 C;  1P3O B;  3REL A;  5B0Z A;  4CSR A;  3C1C A;  5AY8 D;  5B40 D;  5B32 D;  5B2J B;  4J8V D;  3REJ C;  3AZL C;  3AZJ D;  1AOI D;  3W97 D;  3MGS D;  4QLC B;  1KX5 D;  5F99 D;  3TU4 C;  3MGR C;  2YFW A;  1M18 A;  3X1V A;  2FJ7 A;  5FUG B;  4X23 C;  3AZH C;  3MVD A;  3B0D C;  4NE3 A;  3V9R A;  5BNX B;  3REK D;  3WTP A;  3A6N A;  4YS3 A;  1M1A A;  3KXB C;  3W99 A;  5E5A A;  4Z5T D;  3LZ0 D;  4ZBJ C;  5GSU C;  5AV6 D;  1KX4 D;  4NE5 A;  5AV5 C;  4JJN D;  3UTA B;  3VH6 W;  1F66 D;  4H9R B;  5B33 D;  1P34 A;  4Z66 C;  1ZLA B;  3C1B B;  4WNN A;  4XZQ D;  1P3B D;  3LEL B;  1JFI B;  1HQ3 A;  3VH5 T;  5CPK C;  4R8P C;  1TZY A;  5GT0 B;  3X1T A;  3MGQ A;  2HIO C;  5GXQ D;  4ZUX A;  5B24 D;  1P3P C;  2ARO A;  5AVB D;  3AZM B;  4J8W C;  1P3L D;  4J8W B;  2PYO A;  5JRG C;  3WKJ A;  3KWQ D;  3AYW C;  4KGC D;  3O62 C;  3AYW B;  2NQB B;  1KU5 A;  5DNN D;  3WA9 C;  1P3K D;  3MNN A;  3AZI A;  3AV2 C;  4J8U A;  3AZL D;  1EQZ A;  4G91 C;  5CPJ D;  3B0C T;  4WU8 A;  3AZK C;  4WU9 C;  3W98 B;  1M19 B;  5B2J A;  4H9O B;  5CP6 C;  3REJ A;  1P3A D;  4QLC A;  5B0Y C;  5B0Y B;  5FUG A;  1ULY A;  5AVC C;  3AZH A;  3KUY B;  5BNX A;  4H9S C;  3LZ1 C;  4HGA C;  1P3I C;  3KXB A;  1F1E A;  5CPK D;  4R8P D;  1ID3 D;  5B2I C; 
#chains in the Genus database with same CATH topology
 3AFA C;  3LJA D;  4J8X B;  3UTA A;  5BS7 A;  5B0Z B;  4H9R A;  2HIO D;  3C1C B;  1KX3 C;  1P3P D;  1ZLA A;  3C1B A;  1JFI A;  3LEL A;  3AZF B;  3X1S B;  5GT0 A;  3REI C;  5JRG D;  4G92 C;  3REI B;  2YFW B;  4YM6 D;  3MVD B;  4EO5 B;  1TAF A;  5AY8 C;  3NQJ A;  5AV8 B;  5B32 C;  4J8V C;  5B40 C;  3AZJ C;  3W97 C;  1AOI B;  5BNV B;  3B6F B;  3MGS B;  4J8W A;  5F99 C;  1KX5 B;  1BFM A;  2Y2H A;  5G49 B;  3AYW A;  3O62 A;  2BYM B;  2NQB A;  3REK C;  3B0C W;  3UT9 B;  1P3G B;  2DQN C;  4Z5T B;  4WU9 D;  3LZ0 C;  5AV6 C;  3AZK D;  3AZN D;  1KX4 C;  5AV6 B;  4JJN C;  2UWX A;  1F66 C;  5CP6 D;  5B33 C;  5B33 B;  4XZQ C;  1S32 B;  4AWL C;  1P3B B;  1Z2C B;  2F8N G;  4H9Q B;  3W98 A;  3LZ1 D;  3WAA C;  1M19 A;  4H9O A;  4KHA B;  4WV4 B;  5GXQ B;  5B24 B;  2FFF B;  2F8N D;  3B6G C;  5AVB B;  5B0Y A;  5B1L D;  4LD9 D;  3W96 B;  1P3L B;  2G5I C;  3AZE C;  3EPJ A;  3MGP D;  3KWQ C;  3KUY A;  5DNM B;  2CV5 C;  4KGC B;  5DNN B;  1P3K B;  5B32 G;  1U35 C;  4WU8 B;  4J8X A;  3B0B A;  3AV1 C;  2G5H C;  2NZD D;  3REJ B;  3AZL B;  3R45 B;  3AZF A;  4H9N B;  3X1S A;  3REI A;  3AZG C;  2Y2J A;  5CPJ C;  3MGR B;  2BYK B;  4X23 B;  3AZH B;  3B0D B;  3REL D;  1HTA A;  5AV8 A;  5B1M C;  3W97 A;  3AZJ A;  1WWS A;  1P3A C;  1AOI A;  5BNV A;  3KXB B;  1P3A B;  3MGS A;  3B6F A;  1KX5 A;  3NQU A;  4ZBJ B;  5GSU B;  5CPI C;  2ZM5 A;  5AV5 B;  5G49 A;  2FJ7 D;  2BYM A;  3UT9 A;  1P3G A;  4Z66 B;  2XD5 A;  5CHL B;  3WTP D;  3W99 D;  4Z5T A;  5E5A D;  5B31 C;  5CPK B;  4R8P B;  5AV6 A;  1ID3 C;  3LJA C;  3WAA D;  1TAF B;  3NQJ B;  3REH D;  2HIO B;  5B33 A;  1P3P B;  3B6G D;  4M6B A;  1S32 A;  3EPK A;  1P3B A;  3AZE D;  5JRG B;  4H9Q A;  2ZY4 A;  4YM6 C;  2CV5 D;  3O62 B;  4KHA A;  5BT1 C;  5AV9 C;  5B24 A;  5GXQ A;  4NFT A;  1P3F C;  3WA9 B;  1U35 D;  4XUJ C;  5AVB A;  2ARO D;  3W96 A;  5JA4 A;  1P3L A;  3AV1 D;  2PYO D;  5DNM A;  3AV2 B;  4KGC A;  3EPH A;  5DNN A;  1P3K A;  2F8N H;  3AZG D;  2W8S A;  3MNN D;  4G91 B;  3AZI D;  3H0L C;  3AZN C;  3AZK B;  4WU9 B;  5C3I C;  1B67 A;  4UUZ B;  5B1M D;  4J8U D;  3AZL A;  3R45 A;  5CP6 B;  4H9N A;  1EQZ D;  3KFU G;  2JSS A;  5CPI D;  3MGR A;  5CPJ A;  1BH9 B;  2BYK A;  4X23 A;  5B31 G;  1P3O D;  5AVC B;  2XD1 A;  3VH5 W;  3LZ1 B;  2RVQ D;  4HGA B;  5B2J D;  1P3A A;  1P3I B;  2F8N B;  5B31 D;  4NE6 A;  3UTB D;  5GSU A;  5B1L C;  4LD9 C;  5B1L B;  5B2I B;  5AV5 A;  3TU4 B;  3AFA B;  3MGP C;  1BH8 B;  4KUD C;  1KX3 B;  4Z66 A;  2LY8 A;  5CPK A;  4R8P A;  2Y2G A;  4G92 B;  2HUE C;  2HIO A;  5BT1 D;  5GT3 C;  2Y2I A;  5AY8 B;  5AV9 D;  1P3F D;  1P3P A;  5B32 B;  5B40 B;  4J8V B;  3AZJ B;  3W97 B;  3C1B D;  4XUJ D;  4Z2M H;  2YFV B;  1Q9C A;  2CWE A;  1P3M C;  5F99 B;  3NQU B;  5JRG A;  4YM6 A;  3REL C;  2Y2M A;  3REK B;  2DF4 C;  3WA9 A;  2IO5 C;  3AZM D;  3LZ0 B;  2RIQ A;  1KX4 B;  3AV2 A;  4JJN B;  2FJ7 C;  1F66 B;  3VH6 A;  2NQB D;  4XZQ B;  4YS3 C;  3WTP C;  3A6N C;  4CAY B;  4AWL B;  1M1A C;  3W99 C;  5E5A C;  4E45 A;  3AZK A;  4WU9 A;  4UUZ A;  3AN2 D;  3WAA B;  3REH C;  5CP6 A;  2J8P A;  3REH B;  4H9P B;  1P34 C;  3B6G B;  1BH9 A;  5JA4 B;  1HQ3 C;  3AZE B;  5AVC A;  3MGQ C;  3X1U D;  3KWQ B;  4H9S A;  3LZ1 A;  3W98 D;  2CV5 B;  4KUD D;  1W2E A;  1P3I A;  2F8N A;  4ZUX C;  1U35 B;  2ARO C;  5B1L A;  4LD9 A;  5B2I A;  3TU4 A;  3AFA A;  2PYO C;  3P5J B;  3WTP E;  3AV1 B;  1BH8 A;  5GT3 D;  1KX3 A;  2NZD C;  1P3M D;  3MNN C;  3AZG B;  5CPJ B;  3AZI C;  1N1J A;  5AY8 A;  2ZY3 A;  1H3O B;  5KDM B;  5B0Z D;  3C1C D;  4J8U C;  5B32 A;  5B40 A;  5B1M B;  4J8V A;  2Y2L A;  2YFV A;  3AZF D;  1EQZ C;  5F99 A;  4Z2M G;  3X1S D;  5CPI B;  1M18 D;  3X1V D;  1P3O C;  3MVD D;  3REK A;  3VH5 A;  2RVQ C;  5AV8 D;  5B2J C;  5BO0 B;  3H0M C;  4YS3 D;  2Y2O A;  3A6N D;  1M1A D;  4QLC C;  3UTB C;  5B31 B;  3LZ0 A;  3UTB B;  3B6F D;  1KX4 A;  1ID3 B;  4JJN A;  3LJA B;  1F66 A;  1P34 D;  3UT9 D;  4XZQ A;  1P3G D;  4CAY A;  2L5A A;  1HQ3 D;  3X1T D;  1TZY D;  2Y2P A;  3MGQ D;  4YM6 B;  3UTA C;  3WAA A;  5BS7 C;  3REH A;  5AV9 B;  1P3F B;  4H9P A;  4ZUX D;  3B6G A;  1ZLA C;  3C1B C;  1S32 D;  3LEL C;  4XUJ B;  3IP4 C;  5GT0 C;  3AZE A;  3WKJ D;  1T3U A;  4E44 A;  3KWQ A;  2CV5 A;  2Y2K A;  3AL0 C;  1R4V A;  1U35 A;  3AZM C;  3W96 D;  3AZN B;  3AV1 A;  5C3I B;  1A7W A;  3A1I A;  5DNM D;  2NQB C;  3AZG A;  4WU8 D;  1H3O A;  5KDM A;  3AN2 C;  3AN2 B;  5B1M A;  3REJ D;  4QLC D;  4LD9 B;  1WWI A;  5CPI A;  3MGR D;  4DQY B;  1P3O A;  3X1U C;  4X23 D;  3MGP B;  3AZH D;  3X1U B;  3W98 C;  4KUD B;  1M19 C;  5BO0 A;  3KXB D;  5B31 A;  3UTB A;  2BG1 A;  1ID3 A;  5GSU D;  3LJA A;  3KSY A;  3UTA D;  1N1J B;  2HUE B;  5AV5 D;  3KUY C;  5GT3 B;  2NZD B;  1ZLA D;  4Z66 D;  3LEL D;  1P3M B;  5GT0 D;  2VQR A;  1B6W A;  4J8X C;  5B0Z C;  3REL B;  5AV9 A;  3C1C C;  4CSR B;  1P3F A;  2F2A C;  2IO5 B;  4XUJ A;  3AZF C;  3X1S C;  4J8W D;  2Y2Q A;  2F8N K;  4UPK A;  1M18 C;  3X1V C;  2FJ7 B;  1M18 B;  3X1V B;  3MVD C;  3AYW D;  3O62 D;  4EO5 C;  3V9R B;  5AV8 C;  3WA9 D;  3WTP B;  3A6N B;  4YS3 B;  1M1A B;  1AOI C;  3B6F C;  3MGS C;  5E5A B;  3AZM A;  1KX5 C;  3W99 B;  3AZN A;  3A1K A;  3AV2 D;  3UT9 C;  1P34 B;  1P3G C;  4WNN B;  1HQ3 B;  4Z5T C;  1TZY C;  3X1T C;  3X1T B;  1TZY B;  3MGQ B;  3AN2 A;  1M19 D;  4ZUX B;  1S32 C;  4DRA A;  1P3B C;  3VH6 T;  2ARO B;  5B0Y D;  3WKJ C;  3MGP A;  2PYO B;  3WKJ B;  5AVC D;  3X1U A;  3KUY D;  4KUD A;  2ZY5 A;  5GXQ C;  5B24 C;  1P3I D;  2JE5 A;  3MNN B;  5AVB C;  3AZI B;  3W96 C;  1P3L C;  5B2I D;  4J8X D;  3TU4 D;  3AFA D;  4DRB A;  5GT3 A;  2NZD A;  3F6T A;  5DNM C;  3FDD A;  4J8U B;  1KX3 D;  4KGC C;  4WZS B;  1EQZ B;  1P3M A;  5DNN C;  1P3K C;  3REI D;  4WU8 C;  1P3O B;  3REL A;  5B0Z A;  4CSR A;  3C1C A;  5AY8 D;  5B40 D;  5B32 D;  5B2J B;  4J8V D;  3REJ C;  3AZL C;  3AZJ D;  1AOI D;  3W97 D;  3MGS D;  4QLC B;  1KX5 D;  5F99 D;  3TU4 C;  3MGR C;  2YFW A;  1M18 A;  3X1V A;  2FJ7 A;  5FUG B;  4X23 C;  3AZH C;  3MVD A;  3B0D C;  4NE3 A;  3V9R A;  5BNX B;  3REK D;  2JCH A;  3WTP A;  3A6N A;  4YS3 A;  1M1A A;  3KXB C;  3W99 A;  5E5A A;  3H0R C;  4Z5T D;  3LZ0 D;  4ZBJ C;  5GSU C;  5AV6 D;  1KX4 D;  4NE5 A;  5AV5 C;  4JJN D;  3UTA B;  3VH6 W;  1F66 D;  4H9R B;  5B33 D;  1P34 A;  4Z66 C;  1ZLA B;  3C1B B;  4WNN A;  4XZQ D;  1P3B D;  3LEL B;  1JFI B;  1HQ3 A;  3VH5 T;  5CPK C;  4R8P C;  1TZY A;  5GT0 B;  3X1T A;  3MGQ A;  2HIO C;  5GXQ D;  4ZUX A;  5B24 D;  1P3P C;  2ARO A;  5AVB D;  3AZM B;  4J8W C;  1P3L D;  4J8W B;  2PYO A;  5JRG C;  3WKJ A;  3EPL A;  3KWQ D;  3AYW C;  4KGC D;  3O62 C;  3AYW B;  2NQB B;  1KU5 A;  5DNN D;  3WA9 C;  1P3K D;  3MNN A;  3AZI A;  3AV2 C;  4J8U A;  4WJ3 C;  3AZL D;  1EQZ A;  4G91 C;  5CPJ D;  3B0C T;  4WU8 A;  1PZR A;  3AZK C;  4WU9 C;  3W98 B;  1M19 B;  5B2J A;  4H9O B;  5CP6 C;  3REJ A;  1P3A D;  4QLC A;  2Y2N A;  5B0Y C;  5B0Y B;  2ZY2 A;  5FUG A;  1ULY A;  5AVC C;  3AZH A;  3KUY B;  5BNX A;  4H9S C;  3LZ1 C;  4HGA C;  1P3I C;  3KXB A;  1F1E A;  5CPK D;  4R8P D;  3EG5 B;  1ID3 D;  5B2I C; 
#chains in the Genus database with same CATH homology
 3AFA C;  3LJA D;  4J8X B;  3UTA A;  5BS7 A;  5B0Z B;  4H9R A;  2HIO D;  3C1C B;  1KX3 C;  1P3P D;  1ZLA A;  3C1B A;  1JFI A;  3LEL A;  3AZF B;  3X1S B;  5GT0 A;  3REI C;  5JRG D;  4G92 C;  3REI B;  2YFW B;  4YM6 D;  3MVD B;  4EO5 B;  1TAF A;  5AY8 C;  3NQJ A;  5AV8 B;  5B32 C;  4J8V C;  5B40 C;  3AZJ C;  3W97 C;  1AOI B;  5BNV B;  3B6F B;  3MGS B;  4J8W A;  5F99 C;  1KX5 B;  1BFM A;  2Y2H A;  5G49 B;  3AYW A;  3O62 A;  2BYM B;  2NQB A;  3REK C;  3B0C W;  3UT9 B;  1P3G B;  2DQN C;  4Z5T B;  4WU9 D;  3LZ0 C;  5AV6 C;  3AZK D;  3AZN D;  1KX4 C;  5AV6 B;  4JJN C;  2UWX A;  1F66 C;  5CP6 D;  5B33 C;  5B33 B;  4XZQ C;  1S32 B;  4AWL C;  1P3B B;  1Z2C B;  2F8N G;  4H9Q B;  3W98 A;  3LZ1 D;  3WAA C;  1M19 A;  4H9O A;  4KHA B;  4WV4 B;  5GXQ B;  5B24 B;  2FFF B;  2F8N D;  3B6G C;  5AVB B;  5B0Y A;  5B1L D;  4LD9 D;  3W96 B;  1P3L B;  2G5I C;  3AZE C;  3EPJ A;  3MGP D;  3KWQ C;  3KUY A;  5DNM B;  2CV5 C;  4KGC B;  5DNN B;  1P3K B;  5B32 G;  1U35 C;  4WU8 B;  4J8X A;  3B0B A;  3AV1 C;  2G5H C;  2NZD D;  3REJ B;  3AZL B;  3R45 B;  3AZF A;  4H9N B;  3X1S A;  3REI A;  3AZG C;  2Y2J A;  5CPJ C;  3MGR B;  2BYK B;  4X23 B;  3AZH B;  3B0D B;  3REL D;  1HTA A;  5AV8 A;  5B1M C;  3W97 A;  3AZJ A;  1WWS A;  1P3A C;  1AOI A;  5BNV A;  3KXB B;  1P3A B;  3MGS A;  3B6F A;  1KX5 A;  3NQU A;  4ZBJ B;  5GSU B;  5CPI C;  2ZM5 A;  5AV5 B;  5G49 A;  2FJ7 D;  2BYM A;  3UT9 A;  1P3G A;  4Z66 B;  2XD5 A;  5CHL B;  3WTP D;  3W99 D;  4Z5T A;  5E5A D;  5B31 C;  5CPK B;  4R8P B;  5AV6 A;  1ID3 C;  3LJA C;  3WAA D;  1TAF B;  3NQJ B;  3REH D;  2HIO B;  5B33 A;  1P3P B;  3B6G D;  4M6B A;  1S32 A;  3EPK A;  1P3B A;  3AZE D;  5JRG B;  4H9Q A;  2ZY4 A;  4YM6 C;  2CV5 D;  3O62 B;  4KHA A;  5BT1 C;  5AV9 C;  5B24 A;  5GXQ A;  4NFT A;  1P3F C;  3WA9 B;  1U35 D;  4XUJ C;  5AVB A;  2ARO D;  3W96 A;  5JA4 A;  1P3L A;  3AV1 D;  2PYO D;  5DNM A;  3AV2 B;  4KGC A;  3EPH A;  5DNN A;  1P3K A;  2F8N H;  3AZG D;  2W8S A;  3MNN D;  4G91 B;  3AZI D;  3H0L C;  3AZN C;  3AZK B;  4WU9 B;  5C3I C;  1B67 A;  4UUZ B;  5B1M D;  4J8U D;  3AZL A;  3R45 A;  5CP6 B;  4H9N A;  1EQZ D;  3KFU G;  2JSS A;  5CPI D;  3MGR A;  5CPJ A;  1BH9 B;  2BYK A;  4X23 A;  5B31 G;  1P3O D;  5AVC B;  2XD1 A;  3VH5 W;  3LZ1 B;  2RVQ D;  4HGA B;  5B2J D;  1P3A A;  1P3I B;  2F8N B;  5B31 D;  4NE6 A;  3UTB D;  5GSU A;  5B1L C;  4LD9 C;  5B1L B;  5B2I B;  5AV5 A;  3TU4 B;  3AFA B;  3MGP C;  1BH8 B;  4KUD C;  1KX3 B;  4Z66 A;  2LY8 A;  5CPK A;  4R8P A;  2Y2G A;  4G92 B;  2HUE C;  2HIO A;  5BT1 D;  5GT3 C;  2Y2I A;  5AY8 B;  5AV9 D;  1P3F D;  1P3P A;  5B32 B;  5B40 B;  4J8V B;  3AZJ B;  3W97 B;  3C1B D;  4XUJ D;  4Z2M H;  2YFV B;  1Q9C A;  2CWE A;  1P3M C;  5F99 B;  3NQU B;  5JRG A;  4YM6 A;  3REL C;  2Y2M A;  3REK B;  2DF4 C;  3WA9 A;  2IO5 C;  3AZM D;  3LZ0 B;  2RIQ A;  1KX4 B;  3AV2 A;  4JJN B;  2FJ7 C;  1F66 B;  3VH6 A;  2NQB D;  4XZQ B;  4YS3 C;  3WTP C;  3A6N C;  4CAY B;  4AWL B;  1M1A C;  3W99 C;  5E5A C;  4E45 A;  3AZK A;  4WU9 A;  4UUZ A;  3AN2 D;  3WAA B;  3REH C;  5CP6 A;  2J8P A;  3REH B;  4H9P B;  1P34 C;  3B6G B;  1BH9 A;  5JA4 B;  1HQ3 C;  3AZE B;  5AVC A;  3MGQ C;  3X1U D;  3KWQ B;  4H9S A;  3LZ1 A;  3W98 D;  2CV5 B;  4KUD D;  1W2E A;  1P3I A;  2F8N A;  4ZUX C;  1U35 B;  2ARO C;  5B1L A;  4LD9 A;  5B2I A;  3TU4 A;  3AFA A;  2PYO C;  3P5J B;  3WTP E;  3AV1 B;  1BH8 A;  5GT3 D;  1KX3 A;  2NZD C;  1P3M D;  3MNN C;  3AZG B;  5CPJ B;  3AZI C;  1N1J A;  5AY8 A;  2ZY3 A;  1H3O B;  5KDM B;  5B0Z D;  3C1C D;  4J8U C;  5B32 A;  5B40 A;  5B1M B;  4J8V A;  2Y2L A;  2YFV A;  3AZF D;  1EQZ C;  5F99 A;  4Z2M G;  3X1S D;  5CPI B;  1M18 D;  3X1V D;  1P3O C;  3MVD D;  3REK A;  3VH5 A;  2RVQ C;  5AV8 D;  5B2J C;  5BO0 B;  3H0M C;  4YS3 D;  2Y2O A;  3A6N D;  1M1A D;  4QLC C;  3UTB C;  5B31 B;  3LZ0 A;  3UTB B;  3B6F D;  1KX4 A;  1ID3 B;  4JJN A;  3LJA B;  1F66 A;  1P34 D;  3UT9 D;  4XZQ A;  1P3G D;  4CAY A;  2L5A A;  1HQ3 D;  3X1T D;  1TZY D;  2Y2P A;  3MGQ D;  4YM6 B;  3UTA C;  3WAA A;  5BS7 C;  3REH A;  5AV9 B;  1P3F B;  4H9P A;  4ZUX D;  3B6G A;  1ZLA C;  3C1B C;  1S32 D;  3LEL C;  4XUJ B;  3IP4 C;  5GT0 C;  3AZE A;  3WKJ D;  1T3U A;  4E44 A;  3KWQ A;  2CV5 A;  2Y2K A;  3AL0 C;  1R4V A;  1U35 A;  3AZM C;  3W96 D;  3AZN B;  3AV1 A;  5C3I B;  1A7W A;  3A1I A;  5DNM D;  2NQB C;  3AZG A;  4WU8 D;  1H3O A;  5KDM A;  3AN2 C;  3AN2 B;  5B1M A;  3REJ D;  4QLC D;  4LD9 B;  1WWI A;  5CPI A;  3MGR D;  4DQY B;  1P3O A;  3X1U C;  4X23 D;  3MGP B;  3AZH D;  3X1U B;  3W98 C;  4KUD B;  1M19 C;  5BO0 A;  3KXB D;  5B31 A;  3UTB A;  2BG1 A;  1ID3 A;  5GSU D;  3LJA A;  3KSY A;  3UTA D;  1N1J B;  2HUE B;  5AV5 D;  3KUY C;  5GT3 B;  2NZD B;  1ZLA D;  4Z66 D;  3LEL D;  1P3M B;  5GT0 D;  2VQR A;  1B6W A;  4J8X C;  5B0Z C;  3REL B;  5AV9 A;  3C1C C;  4CSR B;  1P3F A;  2F2A C;  2IO5 B;  4XUJ A;  3AZF C;  3X1S C;  4J8W D;  2Y2Q A;  2F8N K;  4UPK A;  1M18 C;  3X1V C;  2FJ7 B;  1M18 B;  3X1V B;  3MVD C;  3AYW D;  3O62 D;  4EO5 C;  3V9R B;  5AV8 C;  3WA9 D;  3WTP B;  3A6N B;  4YS3 B;  1M1A B;  1AOI C;  3B6F C;  3MGS C;  5E5A B;  3AZM A;  1KX5 C;  3W99 B;  3AZN A;  3A1K A;  3AV2 D;  3UT9 C;  1P34 B;  1P3G C;  4WNN B;  1HQ3 B;  4Z5T C;  1TZY C;  3X1T C;  3X1T B;  1TZY B;  3MGQ B;  3AN2 A;  1M19 D;  4ZUX B;  1S32 C;  4DRA A;  1P3B C;  3VH6 T;  2ARO B;  5B0Y D;  3WKJ C;  3MGP A;  2PYO B;  3WKJ B;  5AVC D;  3X1U A;  3KUY D;  4KUD A;  2ZY5 A;  5GXQ C;  5B24 C;  1P3I D;  2JE5 A;  3MNN B;  5AVB C;  3AZI B;  3W96 C;  1P3L C;  5B2I D;  4J8X D;  3TU4 D;  3AFA D;  4DRB A;  5GT3 A;  2NZD A;  3F6T A;  5DNM C;  3FDD A;  4J8U B;  1KX3 D;  4KGC C;  4WZS B;  1EQZ B;  1P3M A;  5DNN C;  1P3K C;  3REI D;  4WU8 C;  1P3O B;  3REL A;  5B0Z A;  4CSR A;  3C1C A;  5AY8 D;  5B40 D;  5B32 D;  5B2J B;  4J8V D;  3REJ C;  3AZL C;  3AZJ D;  1AOI D;  3W97 D;  3MGS D;  4QLC B;  1KX5 D;  5F99 D;  3TU4 C;  3MGR C;  2YFW A;  1M18 A;  3X1V A;  2FJ7 A;  5FUG B;  4X23 C;  3AZH C;  3MVD A;  3B0D C;  4NE3 A;  3V9R A;  5BNX B;  3REK D;  2JCH A;  3WTP A;  3A6N A;  4YS3 A;  1M1A A;  3KXB C;  3W99 A;  5E5A A;  3H0R C;  4Z5T D;  3LZ0 D;  4ZBJ C;  5GSU C;  5AV6 D;  1KX4 D;  4NE5 A;  5AV5 C;  4JJN D;  3UTA B;  3VH6 W;  1F66 D;  4H9R B;  5B33 D;  1P34 A;  4Z66 C;  1ZLA B;  3C1B B;  4WNN A;  4XZQ D;  1P3B D;  3LEL B;  1JFI B;  1HQ3 A;  3VH5 T;  5CPK C;  4R8P C;  1TZY A;  5GT0 B;  3X1T A;  3MGQ A;  2HIO C;  5GXQ D;  4ZUX A;  5B24 D;  1P3P C;  2ARO A;  5AVB D;  3AZM B;  4J8W C;  1P3L D;  4J8W B;  2PYO A;  5JRG C;  3WKJ A;  3EPL A;  3KWQ D;  3AYW C;  4KGC D;  3O62 C;  3AYW B;  2NQB B;  1KU5 A;  5DNN D;  3WA9 C;  1P3K D;  3MNN A;  3AZI A;  3AV2 C;  4J8U A;  4WJ3 C;  3AZL D;  1EQZ A;  4G91 C;  5CPJ D;  3B0C T;  4WU8 A;  1PZR A;  3AZK C;  4WU9 C;  3W98 B;  1M19 B;  5B2J A;  4H9O B;  5CP6 C;  3REJ A;  1P3A D;  4QLC A;  2Y2N A;  5B0Y C;  5B0Y B;  2ZY2 A;  5FUG A;  1ULY A;  5AVC C;  3AZH A;  3KUY B;  5BNX A;  4H9S C;  3LZ1 C;  4HGA C;  1P3I C;  3KXB A;  1F1E A;  5CPK D;  4R8P D;  3EG5 B;  1ID3 D;  5B2I C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...