3AN2D

The structure of the centromeric nucleosome containing cenp-a
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
90
structure length
90
Chain Sequence
ESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3-like centromeric protein A
publication title Crystal structure of the human centromeric nucleosome containing CENP-A
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 24
structure length 90
sequence length 90
chains with identical sequence H
ec nomenclature
pdb deposition date 2010-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3an2D00
1HQ3A 5GT3A 3WTPB 4H9OB 5B2IC 4QLCC 3AZNC 4WU8B 1P3PB 1F66D 5B40C 5AV6C 1P3BA 3W97B 3MGSC 3AZFB 4H9SA 2AROD 5E5AA 4Z66D 5DNND 3LELC 3NQJA 3REJB 1KX4D 4G92C 3KWQD 2HIOA 3REHD 3AZIB 1M1AD 3X1SC 3MGQB 4Z5TC 4E45A 3X1TC 3AYWB 1N1JB 4CAYA 5F99B 5GT0B 3A6ND 1Q9CA 5B2JD 3UT9C 3LZ0C 2PYOA 5AV5A 3LJAB 5GXQC 3MGRA 3RELC 1TZYC 1F1EA 3C1BA 1P34B 4H9PB 5AVCB 1HTAA 4XUJA 3AZLB 4KUDB 5AV8D 1KX5C 5AVBB 2CV5D 1P3GC 5B2IA 5B24C 5CPKC 3TU4B 1P3LA 4HGAB 1ZLAC 1P3BB 5B40A 5DNMD 5B31A 4YS3A 3MGSA 3AZMB 3B0DC 3AZGD 5BS7A 1P3KB 1WWIA 1EQZC 2BYKA 4XZQD 5BT1D 4J8VC 3UTAD 4YM6B 3X1SA 5JRGC 3X1TA 5B33D 2NZDC 5B1LB 2HUEC 3O62C 3UT9A 3MNNC 3MGRB 3AZHD 5GXQA 5GSUD 1TZYA 5CPJD 3C1CD 1JFIB 3KXBA 2JSSA 2F8ND 4WU9D 5CHLB 1H3OB 4XZQA 3MVDC 3AZNB 4QLCB 3W99D 1P3GA 4J8WC 5BO0B 5B24A 5CPKA 5B40B 5AV6B 3X1VD 4J8UD 3REKC 1P3FD 3W98C 5CPID 1KX3C 3LELB 4G91B 4G92B 3LZ1C 4KGCD 5GT3C 4JJNC 4Z5TB 4ZUXC 3X1TB 3B6FD 3AZJA 3WTPD 1P3IB 2NZDA 2F8NH 1P3AD 3AV1D 3LZ0B 1P3MC 3UTBA 4R8PC 3RELB 5AY8C 5E5AC 3WKJD 2BYMA 3W97D 1KX5B 3MGPB 4WZSB 3REJD 1P3GB 5B32A 5AV9B 3AZKD 1ZLAB 4LD9B 2YFVB 4J8WA 4J8XD 3WAAB 4DRBA 3MGQD 2L5AA 5B0ZD 1F66C 4X23B 1AOIB 2PYOC 3W98A 3WA9D 3B0DB 3X1UB 1EQZB 3B6FB 3LJAD 2AROC 3WKJA 4Z66C 5DNNC 5G49B 4J8VB 1TAFA 1KX4C 1ID3B 1P3OB 4JJNA 4ZUXA 5JRGB 3W96B 4H9QA 4ZBJC 5BNXB 3REHC 1M1AC 4KUDD 1M18D 3AZKA 4UUZA 2HUEB 5B31G 3O62B 1P3LC 4J8XA 4NE3A 1P3MA 3MNNB 3TU4D 4R8PA 3AV2B 5B31C 5B2JC 5AY8A 5KDMA 4YS3C 4NE5A 5CP6D 1S32B 5BS7C 3VH6W 3AZMD 3MVDB 4AWLC 1P3KD 4CSRA 5AV8C 3AZED 2NQBD 2CV5C 3B6GB 1M18A 1F66A 3REKB 5FUGB 1BH9B 1KX3B 4Z2MG 5DNMC 4H9NA 3LZ1B 2IO5C 5CP6A 3KXBC 2AROA 3AZGC 1TAFB 4Z66A 1HQ3B 5DNNA 1M19D 5GT3B 4JJNB 3AN2D 3B0BA 1KX4A 4H9QB 4XZQC 5BT1C 3KWQA 5C3IC 3UTAC 3REHA 4NFTA 1M1AA 1BFMA 3AZND 4DRAA 5AV6D 3A6NA 5E5AB 5B2JA 3NQJB 2FJ7D 5CPJC 5B0YD 3C1CC 3LELD 2HIOB 4WU9C 4KHAA 5AV8A 3W99C 4CAYB 3AZJC 2CV5A 2PYOB 5AV5B 1P3ID 3UTBC 5DNMA 3X1VC 3LZ0D 4J8UC 1P3FC 5CPIC 3C1BB 4EO5B 4Z66B 4XUJB 3RELD 1BH8A 5BNVA 1B6WA 3AZGA 1KX4B 1B67A 3KUYD 5B32G 2FJ7A 4KGCC 4M6BA 4ZBJB 3REHB 1M1AB 5B2IB 5B32C 3REID 3UTAA 1U35D 1P3LB 3B6FC 4E44A 3MGPD 1WWSA 5AV9D 3WTPC 5B33A 4LD9D 5B31B 3WAAD 1P3AC 3AV1C 4YS3B 3MGSB 3NQUA 3V9RA 4X23D 1AOID 3AZHA 3AFAD 2BYKB 5GSUA 5CPJA 3X1UD 3C1CA 4AWLB 3WKJC 3KUYA 2F8NA 4WU9A 3X1SB 2YFWA 5B1MD 2CV5B 3REJC 1ID3D 1P3OD 3W99A 3AZKC 3W96D 5JRGD 4J8XC 3UT9B 3MGQC 5DNMB 5B0ZC 3O62D 5GXQB 4WU8D 1P3PD 3X1VA 1TZYB 4J8UA 3MNND 1P3FA 3WA9C 1BH8B 3B0CW 5BNVB 3KXBB 5CPIA 3AV2D 3AZFD 4XZQB 3VH6T 1S32D 4KGCA 5C3IB 3UTAB 5B24B 3MVDD 5CPKB 3B6FA 3AZID 4KUDC 1M18C 3WTPA 1P3AA 3AYWD 3AV1A 3B6GD 3TU4C 5F99D 3REKD 1R4VA 5GT0D 1KX3D 5CP6C 4WU9B 3LZ1D 2YFWB 3W97A 1P34D 5AVCD 1HQ3D 1P3KC 3KWQC 3AZJB 3AZLD 3REJA 2NZDB 3AZEC 3VH6A 2NQBC 5AVBD 3UTBB 3MGQA 3X1VB 5B0ZA 4J8UB 5CPIB 3A6NC 1P3BD 2BYMB 3WA9A 1N1JA 3KSYA 3LJAA 3R45A 4H9RA 1M19C 5B32B 3AN2C 2RVQD 2HIOD 4H9PA 5AVCA 4J8WB 3AZLA 4YM6D 4KUDA 1P3AB 3AV1B 3W98B 5AVBA 5B1LD 2PYOD 4WNNA 3TU4A 5AV5D 3WKJB 3MGRD 2FJ7C 3C1BD 5B0YC 4XUJD 4ZUXB 3AZMA 4G91C 1P3KA 3AZKB 4UUZB 4J8XB 3AZEA 1P3MB 2NQBA 5B2ID 4QLCD 5B0ZB 5B33C 1P3LD 4YM6A 4R8PB 5KDMB 5AY8B 3WA9B 5B40D 1P3IC 5B1LA 5B31D 3AZHC 4YS3D 2F8NG 1ULYA 3MGSD 3R45B 5GSUC 4H9RB 3KUYC 4CSRB 1M19A 1JFIA 3AN2A 3X1SD 1M18B 3REIC 1U35C 1F66B 4Z5TD 3X1TD 1H3OA 3MGPC 3AZNA 4QLCA 5AV9C 4WNNB 4LD9C 4H9NB 5BO0A 3WAAC 3UT9D 5CP6B 5AV6A 2AROB 5GXQD 4X23C 1AOIC 1TZYD 3B0CT 5DNNB 3KXBD 3AFAC 3X1UC 5B0YA 3LELA 1A7WA 3KWQB 3AZEB 2NQBB 1KX5D 5B1MC 1P3GD 1ID3C 5B24D 1P3OC 5CPKD 3W96C 4Z5TA 1ZLAD 3A6NB 5B2JB 1P3IA 4WU8C 1P3PC 3VH5T 3LZ0A 3AV2C 3RELA 1EQZD 1M19B 3AN2B 3W97C 3AZFC 1S32C 4KHAB 5AV8B 3WTPE 4J8VD 5JA4A 2F8NK 3REIA 1U35A 1KX5A 3AZJD 4Z2MH 3MGPA 3AZIC 2NZDD 5AV9A 1ZLAA 4LD9A 2YFVA 3WAAA 3UTBD 3AYWC 3B6GC 2IO5B 5F99C 4X23A 3AZGB 2FJ7B 1AOIA 5GT0C 5B0YB 3AFAA 3LJAC 3X1UA 1EQZA 3VH5A 1P34C 5AVCC 1HQ3C 5G49A 5B32D 5B1MA 4J8VA 5B33B 3AZLC 1ID3A 4J8WD 1P3OA 3W96A 5JRGA 5AVBC 5BNXA 4H9OA 3NQUB 3V9RB 3AZHB 3VH5W 4WU8A 3O62A 1P3PA 4HGAC 3W98D 1P3BC 5GSUB 5CPJB 3C1CB 3MNNA 2CWEA 3KUYB 4H9SC 3AV2A 2F8NB 3AZFA 3AZMC 1S32A 5JA4B 4NE6A 3W99B 3REIB 5GT3D 4JJND 4ZUXD 2RVQC 1U35B 2HIOC 2LY8A 3MVDA 3AZIA 4YM6C 1KU5A 1P3MD 1P3FB 3AYWA 3B6GA 4R8PD 5B1LC 5AY8D 5F99A 5FUGA 3REKA 3AFAB 5AV5C 5GT0A 1BH9A 5E5AD 4KGCB 1KX3A 3MGRC 3C1BC 4EO5C 3LZ1A 4WV4B 4XUJC 1P34A 5B1MB
chains in the Genus database with same CATH superfamily
1HQ3A 5GT3A 3WTPB 4H9OB 5B2IC 4QLCC 3AZNC 4WU8B 1P3PB 1F66D 5B40C 5AV6C 1P3BA 3W97B 3MGSC 3AZFB 4H9SA 2AROD 5E5AA 4Z66D 5DNND 3LELC 3NQJA 3REJB 1KX4D 4G92C 3KWQD 2HIOA 3REHD 3AZIB 1M1AD 3X1SC 3MGQB 4Z5TC 4E45A 3X1TC 3AYWB 1N1JB 1PZRA 4CAYA 5F99B 2Y2HA 3EPHA 5GT0B 3A6ND 1Q9CA 2F2AC 5B2JD 3LZ0C 3UT9C 2PYOA 5AV5A 3LJAB 5GXQC 3EPJA 3MGRA 3RELC 1TZYC 1F1EA 3C1BA 1P34B 4H9PB 5AVCB 1HTAA 4XUJA 3AZLB 3P5JB 4KUDB 5AV8D 1KX5C 5AVBB 2CV5D 1P3GC 5B2IA 5B24C 5CPKC 3TU4B 1P3LA 4HGAB 1ZLAC 1P3BB 5B40A 5DNMD 5B31A 4YS3A 3MGSA 3AZMB 3B0DC 3AZGD 5BS7A 1P3KB 1WWIA 1EQZC 2RIQA 3EPKA 2BYKA 4XZQD 5BT1D 4J8VC 3UTAD 4YM6B 3X1SA 2BG1A 5JRGC 3X1TA 5B33D 2NZDC 5B1LB 2DF4C 2HUEC 3O62C 3UT9A 3MNNC 3MGRB 3AZHD 5GXQA 5GSUD 1TZYA 5CPJD 3C1CD 1JFIB 3KXBA 2JSSA 2F8ND 4WU9D 5CHLB 1H3OB 4XZQA 3MVDC 3AZNB 4QLCB 3W99D 1P3GA 4J8WC 5BO0B 5B24A 5CPKA 5B40B 5AV6B 2Y2LA 3X1VD 4J8UD 3REKC 1P3FD 3W98C 5CPID 1KX3C 3LELB 4G91B 4G92B 3LZ1C 4KGCD 5GT3C 4JJNC 4Z5TB 4ZUXC 3X1TB 3B6FD 3AZJA 3WTPD 1P3IB 2NZDA 2F8NH 1P3AD 3H0RC 3LZ0B 3AV1D 1P3MC 3UTBA 4R8PC 3RELB 5AY8C 5E5AC 3WKJD 2BYMA 3W97D 2Y2OA 1KX5B 3MGPB 4WZSB 3REJD 1P3GB 2DQNC 5B32A 5AV9B 3AZKD 1ZLAB 4LD9B 2YFVB 4J8WA 4J8XD 3WAAB 4DRBA 3MGQD 2L5AA 5B0ZD 1F66C 4X23B 1AOIB 2PYOC 3W98A 3WA9D 3B0DB 3X1UB 1EQZB 3B6FB 3LJAD 2AROC 3WKJA 2G5HC 4Z66C 5DNNC 5G49B 4J8VB 1TAFA 1KX4C 1ID3B 1P3OB 4JJNA 4ZUXA 5JRGB 3W96B 4H9QA 4ZBJC 5BNXB 3REHC 1M1AC 4KUDD 1M18D 3AZKA 4UUZA 2HUEB 5B31G 3O62B 1P3LC 4J8XA 4NE3A 1P3MA 3MNNB 3TU4D 4R8PA 3AV2B 5B31C 5B2JC 5AY8A 5KDMA 4YS3C 3AL0C 4NE5A 5CP6D 1S32B 5BS7C 3VH6W 3AZMD 3MVDB 4AWLC 1P3KD 4CSRA 5AV8C 3AZED 2NQBD 2JE5A 2CV5C 1T3UA 3B6GB 1M18A 1F66A 2J8PA 5FUGB 3REKB 1Z2CB 1BH9B 1KX3B 4Z2MG 5DNMC 4H9NA 3LZ1B 2IO5C 5CP6A 3KXBC 2AROA 3AZGC 1TAFB 4Z66A 1HQ3B 5DNNA 1M19D 5GT3B 4JJNB 3AN2D 3B0BA 1KX4A 4H9QB 4XZQC 5BT1C 3KWQA 5C3IC 3UTAC 3REHA 4NFTA 1M1AA 1BFMA 3AZND 4DRAA 5AV6D 3A6NA 2ZY5A 5E5AB 5B2JA 3H0LC 2Y2KA 3NQJB 2FJ7D 5CPJC 5B0YD 3C1CC 3LELD 2HIOB 4WU9C 2XD1A 4KHAA 5AV8A 3W99C 4CAYB 3AZJC 2CV5A 2PYOB 5AV5B 1P3ID 3UTBC 5DNMA 3X1VC 3LZ0D 4J8UC 1P3FC 5CPIC 3C1BB 4EO5B 4Z66B 4XUJB 3RELD 1BH8A 5BNVA 1B6WA 3AZGA 1KX4B 1B67A 3KUYD 5B32G 2FJ7A 4KGCC 4M6BA 4ZBJB 3REHB 1M1AB 5B2IB 5B32C 3REID 3UTAA 1U35D 1P3LB 3B6FC 4E44A 3MGPD 1WWSA 5AV9D 3WTPC 5B33A 4LD9D 4WJ3C 5B31B 3WAAD 1P3AC 3AV1C 4YS3B 3MGSB 3NQUA 3V9RA 3FDDA 4X23D 1AOID 3AZHA 2ZY3A 3AFAD 2BYKB 5GSUA 5CPJA 2UWXA 3X1UD 3C1CA 4AWLB 3WKJC 3F6TA 3IP4C 3KUYA 3H0MC 4WU9A 3X1SB 2F8NA 2YFWA 5B1MD 2CV5B 3REJC 1ID3D 1P3OD 3W99A 3AZKC 3W96D 5JRGD 4J8XC 3UT9B 3MGQC 5DNMB 5B0ZC 3O62D 5GXQB 4WU8D 1P3PD 3X1VA 1TZYB 4J8UA 3MNND 1P3FA 3WA9C 1BH8B 3B0CW 5BNVB 3KXBB 5CPIA 1W2EA 3A1IA 3AV2D 3AZFD 4XZQB 3VH6T 1S32D 4KGCA 5C3IB 3UTAB 5B24B 3MVDD 5CPKB 3B6FA 3AZID 4KUDC 1M18C 3WTPA 4UPKA 1P3AA 3AYWD 3AV1A 3B6GD 3TU4C 5F99D 3REKD 1R4VA 5GT0D 1KX3D 5CP6C 4WU9B 3LZ1D 2YFWB 2Y2NA 3W97A 1P34D 3KFUG 5AVCD 1HQ3D 1P3KC 3KWQC 3AZJB 3AZLD 3REJA 2NZDB 3AZEC 3VH6A 2NQBC 5AVBD 3UTBB 3MGQA 3X1VB 5B0ZA 4J8UB 5CPIB 3A6NC 1P3BD 2BYMB 3WA9A 1N1JA 2G5IC 2JCHA 3KSYA 2ZY2A 2ZY4A 3LJAA 3R45A 4H9RA 1M19C 5B32B 3AN2C 2RVQD 2HIOD 4H9PA 5AVCA 4J8WB 3AZLA 4YM6D 2ZM5A 4KUDA 1P3AB 3AV1B 3W98B 5AVBA 5B1LD 2PYOD 4WNNA 3TU4A 5AV5D 3WKJB 3MGRD 4DQYB 2FJ7C 3C1BD 5B0YC 4XUJD 4ZUXB 3AZMA 4G91C 1P3KA 3AZKB 4UUZB 4J8XB 3AZEA 1P3MB 2NQBA 5B2ID 4QLCD 5B0ZB 5B33C 1P3LD 4YM6A 4R8PB 5KDMB 5AY8B 3WA9B 5B40D 1P3IC 5B1LA 5B31D 3AZHC 4YS3D 2F8NG 1ULYA 3MGSD 3R45B 5GSUC 4H9RB 3KUYC 4CSRB 2FFFB 1M19A 1JFIA 3AN2A 3X1SD 1M18B 3REIC 1U35C 1F66B 4Z5TD 3X1TD 1H3OA 3MGPC 3AZNA 4QLCA 5AV9C 4WNNB 4LD9C 2Y2QA 4H9NB 5BO0A 3WAAC 3UT9D 5CP6B 5AV6A 2AROB 5GXQD 4X23C 1AOIC 1TZYD 3B0CT 5DNNB 2Y2IA 3KXBD 3AFAC 3X1UC 5B0YA 3LELA 1A7WA 3KWQB 3AZEB 2NQBB 1KX5D 5B1MC 1P3GD 1ID3C 5B24D 1P3OC 5CPKD 3W96C 4Z5TA 1ZLAD 2VQRA 3A6NB 5B2JB 1P3IA 4WU8C 1P3PC 3VH5T 3LZ0A 3AV2C 3RELA 1EQZD 1M19B 3AN2B 3W97C 3AZFC 1S32C 4KHAB 2XD5A 5AV8B 3WTPE 4J8VD 5JA4A 2F8NK 3REIA 1U35A 1KX5A 3AZJD 4Z2MH 3MGPA 3AZIC 2NZDD 5AV9A 1ZLAA 4LD9A 2YFVA 3WAAA 3UTBD 3AYWC 3B6GC 2IO5B 5F99C 4X23A 3AZGB 2FJ7B 1AOIA 5GT0C 5B0YB 3AFAA 3LJAC 3X1UA 1EQZA 3VH5A 2Y2PA 1P34C 5AVCC 1HQ3C 5G49A 5B32D 5B1MA 4J8VA 3A1KA 5B33B 3AZLC 2Y2GA 1ID3A 4J8WD 1P3OA 3W96A 5JRGA 5AVBC 5BNXA 3NQUB 4H9OA 3V9RB 3AZHB 3VH5W 4WU8A 3O62A 1P3PA 4HGAC 3W98D 1P3BC 5GSUB 2Y2MA 5CPJB 3C1CB 3MNNA 2CWEA 3KUYB 4H9SC 3AV2A 2F8NB 3EG5B 3AZFA 3AZMC 1S32A 5JA4B 4NE6A 3W99B 3REIB 5GT3D 4JJND 4ZUXD 2RVQC 2Y2JA 2HIOC 1U35B 2LY8A 3MVDA 3EPLA 3AZIA 4YM6C 1KU5A 1P3MD 1P3FB 3AYWA 3B6GA 4R8PD 5B1LC 5AY8D 5F99A 5FUGA 3REKA 2W8SA 3AFAB 5AV5C 5GT0A 1BH9A 5E5AD 4KGCB 1KX3A 3MGRC 3C1BC 4EO5C 3LZ1A 4WV4B 4XUJC 1P34A 5B1MB
chains in the Genus database with same CATH topology
1HQ3A 5GT3A 3WTPB 4H9OB 5B2IC 4QLCC 3AZNC 4WU8B 1P3PB 1F66D 5B40C 5AV6C 1P3BA 3W97B 3MGSC 3AZFB 4H9SA 2AROD 5E5AA 4Z66D 5DNND 3LELC 3NQJA 3REJB 1KX4D 4G92C 3KWQD 2HIOA 3REHD 3AZIB 1M1AD 3X1SC 3MGQB 4Z5TC 4E45A 3X1TC 3AYWB 1N1JB 1PZRA 4CAYA 5F99B 2Y2HA 3EPHA 5GT0B 3A6ND 1Q9CA 2F2AC 5B2JD 3LZ0C 3UT9C 2PYOA 5AV5A 3LJAB 5GXQC 3EPJA 3MGRA 3RELC 1TZYC 1F1EA 3C1BA 1P34B 4H9PB 5AVCB 1HTAA 4XUJA 3AZLB 3P5JB 4KUDB 5AV8D 1KX5C 5AVBB 2CV5D 1P3GC 5B2IA 5B24C 5CPKC 3TU4B 1P3LA 4HGAB 1ZLAC 1P3BB 5B40A 5DNMD 5B31A 4YS3A 3MGSA 3AZMB 3B0DC 3AZGD 5BS7A 1P3KB 1WWIA 1EQZC 2RIQA 3EPKA 2BYKA 4XZQD 5BT1D 4J8VC 3UTAD 4YM6B 3X1SA 2BG1A 5JRGC 3X1TA 5B33D 2NZDC 5B1LB 2DF4C 2HUEC 3O62C 3UT9A 3MNNC 3MGRB 3AZHD 5GXQA 5GSUD 1TZYA 5CPJD 3C1CD 1JFIB 3KXBA 2JSSA 2F8ND 4WU9D 5CHLB 1H3OB 4XZQA 3MVDC 3AZNB 4QLCB 3W99D 1P3GA 4J8WC 5BO0B 5B24A 5CPKA 5B40B 5AV6B 2Y2LA 3X1VD 4J8UD 3REKC 1P3FD 3W98C 5CPID 1KX3C 3LELB 4G91B 4G92B 3LZ1C 4KGCD 5GT3C 4JJNC 4Z5TB 4ZUXC 3X1TB 3B6FD 3AZJA 3WTPD 1P3IB 2NZDA 2F8NH 1P3AD 3H0RC 3LZ0B 3AV1D 1P3MC 3UTBA 4R8PC 3RELB 5AY8C 5E5AC 3WKJD 2BYMA 3W97D 2Y2OA 1KX5B 3MGPB 4WZSB 3REJD 1P3GB 2DQNC 5B32A 5AV9B 3AZKD 1ZLAB 4LD9B 2YFVB 4J8WA 4J8XD 3WAAB 4DRBA 3MGQD 2L5AA 5B0ZD 1F66C 4X23B 1AOIB 2PYOC 3W98A 3WA9D 3B0DB 3X1UB 1EQZB 3B6FB 3LJAD 2AROC 3WKJA 2G5HC 4Z66C 5DNNC 5G49B 4J8VB 1TAFA 1KX4C 1ID3B 1P3OB 4JJNA 4ZUXA 5JRGB 3W96B 4H9QA 4ZBJC 5BNXB 3REHC 1M1AC 4KUDD 1M18D 3AZKA 4UUZA 2HUEB 5B31G 3O62B 1P3LC 4J8XA 4NE3A 1P3MA 3MNNB 3TU4D 4R8PA 3AV2B 5B31C 5B2JC 5AY8A 5KDMA 4YS3C 3AL0C 4NE5A 5CP6D 1S32B 5BS7C 3VH6W 3AZMD 3MVDB 4AWLC 1P3KD 4CSRA 5AV8C 3AZED 2NQBD 2JE5A 2CV5C 1T3UA 3B6GB 1M18A 1F66A 2J8PA 5FUGB 3REKB 1Z2CB 1BH9B 1KX3B 4Z2MG 5DNMC 4H9NA 3LZ1B 2IO5C 5CP6A 3KXBC 2AROA 3AZGC 1TAFB 4Z66A 1HQ3B 5DNNA 1M19D 5GT3B 4JJNB 3AN2D 3B0BA 1KX4A 4H9QB 4XZQC 5BT1C 3KWQA 5C3IC 3UTAC 3REHA 4NFTA 1M1AA 1BFMA 3AZND 4DRAA 5AV6D 3A6NA 2ZY5A 5E5AB 5B2JA 3H0LC 2Y2KA 3NQJB 2FJ7D 5CPJC 5B0YD 3C1CC 3LELD 2HIOB 4WU9C 2XD1A 4KHAA 5AV8A 3W99C 4CAYB 3AZJC 2CV5A 2PYOB 5AV5B 1P3ID 3UTBC 5DNMA 3X1VC 3LZ0D 4J8UC 1P3FC 5CPIC 3C1BB 4EO5B 4Z66B 4XUJB 3RELD 1BH8A 5BNVA 1B6WA 3AZGA 1KX4B 1B67A 3KUYD 5B32G 2FJ7A 4KGCC 4M6BA 4ZBJB 3REHB 1M1AB 5B2IB 5B32C 3REID 3UTAA 1U35D 1P3LB 3B6FC 4E44A 3MGPD 1WWSA 5AV9D 3WTPC 5B33A 4LD9D 4WJ3C 5B31B 3WAAD 1P3AC 3AV1C 4YS3B 3MGSB 3NQUA 3V9RA 3FDDA 4X23D 1AOID 3AZHA 2ZY3A 3AFAD 2BYKB 5GSUA 5CPJA 2UWXA 3X1UD 3C1CA 4AWLB 3WKJC 3F6TA 3IP4C 3KUYA 3H0MC 4WU9A 3X1SB 2F8NA 2YFWA 5B1MD 2CV5B 3REJC 1ID3D 1P3OD 3W99A 3AZKC 3W96D 5JRGD 4J8XC 3UT9B 3MGQC 5DNMB 5B0ZC 3O62D 5GXQB 4WU8D 1P3PD 3X1VA 1TZYB 4J8UA 3MNND 1P3FA 3WA9C 1BH8B 3B0CW 5BNVB 3KXBB 5CPIA 1W2EA 3A1IA 3AV2D 3AZFD 4XZQB 3VH6T 1S32D 4KGCA 5C3IB 3UTAB 5B24B 3MVDD 5CPKB 3B6FA 3AZID 4KUDC 1M18C 3WTPA 4UPKA 1P3AA 3AYWD 3AV1A 3B6GD 3TU4C 5F99D 3REKD 1R4VA 5GT0D 1KX3D 5CP6C 4WU9B 3LZ1D 2YFWB 2Y2NA 3W97A 1P34D 3KFUG 5AVCD 1HQ3D 1P3KC 3KWQC 3AZJB 3AZLD 3REJA 2NZDB 3AZEC 3VH6A 2NQBC 5AVBD 3UTBB 3MGQA 3X1VB 5B0ZA 4J8UB 5CPIB 3A6NC 1P3BD 2BYMB 3WA9A 1N1JA 2G5IC 2JCHA 3KSYA 2ZY2A 2ZY4A 3LJAA 3R45A 4H9RA 1M19C 5B32B 3AN2C 2RVQD 2HIOD 4H9PA 5AVCA 4J8WB 3AZLA 4YM6D 2ZM5A 4KUDA 1P3AB 3AV1B 3W98B 5AVBA 5B1LD 2PYOD 4WNNA 3TU4A 5AV5D 3WKJB 3MGRD 4DQYB 2FJ7C 3C1BD 5B0YC 4XUJD 4ZUXB 3AZMA 4G91C 1P3KA 3AZKB 4UUZB 4J8XB 3AZEA 1P3MB 2NQBA 5B2ID 4QLCD 5B0ZB 5B33C 1P3LD 4YM6A 4R8PB 5KDMB 5AY8B 3WA9B 5B40D 1P3IC 5B1LA 5B31D 3AZHC 4YS3D 2F8NG 1ULYA 3MGSD 3R45B 5GSUC 4H9RB 3KUYC 4CSRB 2FFFB 1M19A 1JFIA 3AN2A 3X1SD 1M18B 3REIC 1U35C 1F66B 4Z5TD 3X1TD 1H3OA 3MGPC 3AZNA 4QLCA 5AV9C 4WNNB 4LD9C 2Y2QA 4H9NB 5BO0A 3WAAC 3UT9D 5CP6B 5AV6A 2AROB 5GXQD 4X23C 1AOIC 1TZYD 3B0CT 5DNNB 2Y2IA 3KXBD 3AFAC 3X1UC 5B0YA 3LELA 1A7WA 3KWQB 3AZEB 2NQBB 1KX5D 5B1MC 1P3GD 1ID3C 5B24D 1P3OC 5CPKD 3W96C 4Z5TA 1ZLAD 2VQRA 3A6NB 5B2JB 1P3IA 4WU8C 1P3PC 3VH5T 3LZ0A 3AV2C 3RELA 1EQZD 1M19B 3AN2B 3W97C 3AZFC 1S32C 4KHAB 2XD5A 5AV8B 3WTPE 4J8VD 5JA4A 2F8NK 3REIA 1U35A 1KX5A 3AZJD 4Z2MH 3MGPA 3AZIC 2NZDD 5AV9A 1ZLAA 4LD9A 2YFVA 3WAAA 3UTBD 3AYWC 3B6GC 2IO5B 5F99C 4X23A 3AZGB 2FJ7B 1AOIA 5GT0C 5B0YB 3AFAA 3LJAC 3X1UA 1EQZA 3VH5A 2Y2PA 1P34C 5AVCC 1HQ3C 5G49A 5B32D 5B1MA 4J8VA 3A1KA 5B33B 3AZLC 2Y2GA 1ID3A 4J8WD 1P3OA 3W96A 5JRGA 5AVBC 5BNXA 3NQUB 4H9OA 3V9RB 3AZHB 3VH5W 4WU8A 3O62A 1P3PA 4HGAC 3W98D 1P3BC 5GSUB 2Y2MA 5CPJB 3C1CB 3MNNA 2CWEA 3KUYB 4H9SC 3AV2A 2F8NB 3EG5B 3AZFA 3AZMC 1S32A 5JA4B 4NE6A 3W99B 3REIB 5GT3D 4JJND 4ZUXD 2RVQC 2Y2JA 2HIOC 1U35B 2LY8A 3MVDA 3EPLA 3AZIA 4YM6C 1KU5A 1P3MD 1P3FB 3AYWA 3B6GA 4R8PD 5B1LC 5AY8D 5F99A 5FUGA 3REKA 2W8SA 3AFAB 5AV5C 5GT0A 1BH9A 5E5AD 4KGCB 1KX3A 3MGRC 3C1BC 4EO5C 3LZ1A 4WV4B 4XUJC 1P34A 5B1MB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HQ3 A;  5GT3 A;  3WTP B;  4H9O B;  5B2I C;  4QLC C;  3AZN C;  4WU8 B;  1P3P B;  1F66 D;  5B40 C;  5AV6 C;  1P3B A;  3W97 B;  3MGS C;  3AZF B;  4H9S A;  2ARO D;  5E5A A;  4Z66 D;  5DNN D;  3LEL C;  3NQJ A;  3REJ B;  1KX4 D;  4G92 C;  3KWQ D;  2HIO A;  3REH D;  3AZI B;  1M1A D;  3X1S C;  3MGQ B;  4Z5T C;  4E45 A;  3X1T C;  3AYW B;  1N1J B;  4CAY A;  5F99 B;  5GT0 B;  3A6N D;  1Q9C A;  5B2J D;  3UT9 C;  3LZ0 C;  2PYO A;  5AV5 A;  3LJA B;  5GXQ C;  3MGR A;  3REL C;  1TZY C;  1F1E A;  3C1B A;  1P34 B;  4H9P B;  5AVC B;  1HTA A;  4XUJ A;  3AZL B;  4KUD B;  5AV8 D;  1KX5 C;  5AVB B;  2CV5 D;  1P3G C;  5B2I A;  5B24 C;  5CPK C;  3TU4 B;  1P3L A;  4HGA B;  1ZLA C;  1P3B B;  5B40 A;  5DNM D;  5B31 A;  4YS3 A;  3MGS A;  3AZM B;  3B0D C;  3AZG D;  5BS7 A;  1P3K B;  1WWI A;  1EQZ C;  2BYK A;  4XZQ D;  5BT1 D;  4J8V C;  3UTA D;  4YM6 B;  3X1S A;  5JRG C;  3X1T A;  5B33 D;  2NZD C;  5B1L B;  2HUE C;  3O62 C;  3UT9 A;  3MNN C;  3MGR B;  3AZH D;  5GXQ A;  5GSU D;  1TZY A;  5CPJ D;  3C1C D;  1JFI B;  3KXB A;  2JSS A;  2F8N D;  4WU9 D;  5CHL B;  1H3O B;  4XZQ A;  3MVD C;  3AZN B;  4QLC B;  3W99 D;  1P3G A;  4J8W C;  5BO0 B;  5B24 A;  5CPK A;  5B40 B;  5AV6 B;  3X1V D;  4J8U D;  3REK C;  1P3F D;  3W98 C;  5CPI D;  1KX3 C;  3LEL B;  4G91 B;  4G92 B;  3LZ1 C;  4KGC D;  5GT3 C;  4JJN C;  4Z5T B;  4ZUX C;  3X1T B;  3B6F D;  3AZJ A;  3WTP D;  1P3I B;  2NZD A;  2F8N H;  1P3A D;  3AV1 D;  3LZ0 B;  1P3M C;  3UTB A;  4R8P C;  3REL B;  5AY8 C;  5E5A C;  3WKJ D;  2BYM A;  3W97 D;  1KX5 B;  3MGP B;  4WZS B;  3REJ D;  1P3G B;  5B32 A;  5AV9 B;  3AZK D;  1ZLA B;  4LD9 B;  2YFV B;  4J8W A;  4J8X D;  3WAA B;  4DRB A;  3MGQ D;  2L5A A;  5B0Z D;  1F66 C;  4X23 B;  1AOI B;  2PYO C;  3W98 A;  3WA9 D;  3B0D B;  3X1U B;  1EQZ B;  3B6F B;  3LJA D;  2ARO C;  3WKJ A;  4Z66 C;  5DNN C;  5G49 B;  4J8V B;  1TAF A;  1KX4 C;  1ID3 B;  1P3O B;  4JJN A;  4ZUX A;  5JRG B;  3W96 B;  4H9Q A;  4ZBJ C;  5BNX B;  3REH C;  1M1A C;  4KUD D;  1M18 D;  3AZK A;  4UUZ A;  2HUE B;  5B31 G;  3O62 B;  1P3L C;  4J8X A;  4NE3 A;  1P3M A;  3MNN B;  3TU4 D;  4R8P A;  3AV2 B;  5B31 C;  5B2J C;  5AY8 A;  5KDM A;  4YS3 C;  4NE5 A;  5CP6 D;  1S32 B;  5BS7 C;  3VH6 W;  3AZM D;  3MVD B;  4AWL C;  1P3K D;  4CSR A;  5AV8 C;  3AZE D;  2NQB D;  2CV5 C;  3B6G B;  1M18 A;  1F66 A;  3REK B;  5FUG B;  1BH9 B;  1KX3 B;  4Z2M G;  5DNM C;  4H9N A;  3LZ1 B;  2IO5 C;  5CP6 A;  3KXB C;  2ARO A;  3AZG C;  1TAF B;  4Z66 A;  1HQ3 B;  5DNN A;  1M19 D;  5GT3 B;  4JJN B;  3AN2 D;  3B0B A;  1KX4 A;  4H9Q B;  4XZQ C;  5BT1 C;  3KWQ A;  5C3I C;  3UTA C;  3REH A;  4NFT A;  1M1A A;  1BFM A;  3AZN D;  4DRA A;  5AV6 D;  3A6N A;  5E5A B;  5B2J A;  3NQJ B;  2FJ7 D;  5CPJ C;  5B0Y D;  3C1C C;  3LEL D;  2HIO B;  4WU9 C;  4KHA A;  5AV8 A;  3W99 C;  4CAY B;  3AZJ C;  2CV5 A;  2PYO B;  5AV5 B;  1P3I D;  3UTB C;  5DNM A;  3X1V C;  3LZ0 D;  4J8U C;  1P3F C;  5CPI C;  3C1B B;  4EO5 B;  4Z66 B;  4XUJ B;  3REL D;  1BH8 A;  5BNV A;  1B6W A;  3AZG A;  1KX4 B;  1B67 A;  3KUY D;  5B32 G;  2FJ7 A;  4KGC C;  4M6B A;  4ZBJ B;  3REH B;  1M1A B;  5B2I B;  5B32 C;  3REI D;  3UTA A;  1U35 D;  1P3L B;  3B6F C;  4E44 A;  3MGP D;  1WWS A;  5AV9 D;  3WTP C;  5B33 A;  4LD9 D;  5B31 B;  3WAA D;  1P3A C;  3AV1 C;  4YS3 B;  3MGS B;  3NQU A;  3V9R A;  4X23 D;  1AOI D;  3AZH A;  3AFA D;  2BYK B;  5GSU A;  5CPJ A;  3X1U D;  3C1C A;  4AWL B;  3WKJ C;  3KUY A;  2F8N A;  4WU9 A;  3X1S B;  2YFW A;  5B1M D;  2CV5 B;  3REJ C;  1ID3 D;  1P3O D;  3W99 A;  3AZK C;  3W96 D;  5JRG D;  4J8X C;  3UT9 B;  3MGQ C;  5DNM B;  5B0Z C;  3O62 D;  5GXQ B;  4WU8 D;  1P3P D;  3X1V A;  1TZY B;  4J8U A;  3MNN D;  1P3F A;  3WA9 C;  1BH8 B;  3B0C W;  5BNV B;  3KXB B;  5CPI A;  3AV2 D;  3AZF D;  4XZQ B;  3VH6 T;  1S32 D;  4KGC A;  5C3I B;  3UTA B;  5B24 B;  3MVD D;  5CPK B;  3B6F A;  3AZI D;  4KUD C;  1M18 C;  3WTP A;  1P3A A;  3AYW D;  3AV1 A;  3B6G D;  3TU4 C;  5F99 D;  3REK D;  1R4V A;  5GT0 D;  1KX3 D;  5CP6 C;  4WU9 B;  3LZ1 D;  2YFW B;  3W97 A;  1P34 D;  5AVC D;  1HQ3 D;  1P3K C;  3KWQ C;  3AZJ B;  3AZL D;  3REJ A;  2NZD B;  3AZE C;  3VH6 A;  2NQB C;  5AVB D;  3UTB B;  3MGQ A;  3X1V B;  5B0Z A;  4J8U B;  5CPI B;  3A6N C;  1P3B D;  2BYM B;  3WA9 A;  1N1J A;  3KSY A;  3LJA A;  3R45 A;  4H9R A;  1M19 C;  5B32 B;  3AN2 C;  2RVQ D;  2HIO D;  4H9P A;  5AVC A;  4J8W B;  3AZL A;  4YM6 D;  4KUD A;  1P3A B;  3AV1 B;  3W98 B;  5AVB A;  5B1L D;  2PYO D;  4WNN A;  3TU4 A;  5AV5 D;  3WKJ B;  3MGR D;  2FJ7 C;  3C1B D;  5B0Y C;  4XUJ D;  4ZUX B;  3AZM A;  4G91 C;  1P3K A;  3AZK B;  4UUZ B;  4J8X B;  3AZE A;  1P3M B;  2NQB A;  5B2I D;  4QLC D;  5B0Z B;  5B33 C;  1P3L D;  4YM6 A;  4R8P B;  5KDM B;  5AY8 B;  3WA9 B;  5B40 D;  1P3I C;  5B1L A;  5B31 D;  3AZH C;  4YS3 D;  2F8N G;  1ULY A;  3MGS D;  3R45 B;  5GSU C;  4H9R B;  3KUY C;  4CSR B;  1M19 A;  1JFI A;  3AN2 A;  3X1S D;  1M18 B;  3REI C;  1U35 C;  1F66 B;  4Z5T D;  3X1T D;  1H3O A;  3MGP C;  3AZN A;  4QLC A;  5AV9 C;  4WNN B;  4LD9 C;  4H9N B;  5BO0 A;  3WAA C;  3UT9 D;  5CP6 B;  5AV6 A;  2ARO B;  5GXQ D;  4X23 C;  1AOI C;  1TZY D;  3B0C T;  5DNN B;  3KXB D;  3AFA C;  3X1U C;  5B0Y A;  3LEL A;  1A7W A;  3KWQ B;  3AZE B;  2NQB B;  1KX5 D;  5B1M C;  1P3G D;  1ID3 C;  5B24 D;  1P3O C;  5CPK D;  3W96 C;  4Z5T A;  1ZLA D;  3A6N B;  5B2J B;  1P3I A;  4WU8 C;  1P3P C;  3VH5 T;  3LZ0 A;  3AV2 C;  3REL A;  1EQZ D;  1M19 B;  3AN2 B;  3W97 C;  3AZF C;  1S32 C;  4KHA B;  5AV8 B;  3WTP E;  4J8V D;  5JA4 A;  2F8N K;  3REI A;  1U35 A;  1KX5 A;  3AZJ D;  4Z2M H;  3MGP A;  3AZI C;  2NZD D;  5AV9 A;  1ZLA A;  4LD9 A;  2YFV A;  3WAA A;  3UTB D;  3AYW C;  3B6G C;  2IO5 B;  5F99 C;  4X23 A;  3AZG B;  2FJ7 B;  1AOI A;  5GT0 C;  5B0Y B;  3AFA A;  3LJA C;  3X1U A;  1EQZ A;  3VH5 A;  1P34 C;  5AVC C;  1HQ3 C;  5G49 A;  5B32 D;  5B1M A;  4J8V A;  5B33 B;  3AZL C;  1ID3 A;  4J8W D;  1P3O A;  3W96 A;  5JRG A;  5AVB C;  5BNX A;  4H9O A;  3NQU B;  3V9R B;  3AZH B;  3VH5 W;  4WU8 A;  3O62 A;  1P3P A;  4HGA C;  3W98 D;  1P3B C;  5GSU B;  5CPJ B;  3C1C B;  3MNN A;  2CWE A;  3KUY B;  4H9S C;  3AV2 A;  2F8N B;  3AZF A;  3AZM C;  1S32 A;  5JA4 B;  4NE6 A;  3W99 B;  3REI B;  5GT3 D;  4JJN D;  4ZUX D;  2RVQ C;  1U35 B;  2HIO C;  2LY8 A;  3MVD A;  3AZI A;  4YM6 C;  1KU5 A;  1P3M D;  1P3F B;  3AYW A;  3B6G A;  4R8P D;  5B1L C;  5AY8 D;  5F99 A;  5FUG A;  3REK A;  3AFA B;  5AV5 C;  5GT0 A;  1BH9 A;  5E5A D;  4KGC B;  1KX3 A;  3MGR C;  3C1B C;  4EO5 C;  3LZ1 A;  4WV4 B;  4XUJ C;  1P34 A;  5B1M B; 
#chains in the Genus database with same CATH topology
 1HQ3 A;  5GT3 A;  3WTP B;  4H9O B;  5B2I C;  4QLC C;  3AZN C;  4WU8 B;  1P3P B;  1F66 D;  5B40 C;  5AV6 C;  1P3B A;  3W97 B;  3MGS C;  3AZF B;  4H9S A;  2ARO D;  5E5A A;  4Z66 D;  5DNN D;  3LEL C;  3NQJ A;  3REJ B;  1KX4 D;  4G92 C;  3KWQ D;  2HIO A;  3REH D;  3AZI B;  1M1A D;  3X1S C;  3MGQ B;  4Z5T C;  4E45 A;  3X1T C;  3AYW B;  1N1J B;  1PZR A;  4CAY A;  5F99 B;  2Y2H A;  3EPH A;  5GT0 B;  3A6N D;  1Q9C A;  2F2A C;  5B2J D;  3LZ0 C;  3UT9 C;  2PYO A;  5AV5 A;  3LJA B;  5GXQ C;  3EPJ A;  3MGR A;  3REL C;  1TZY C;  1F1E A;  3C1B A;  1P34 B;  4H9P B;  5AVC B;  1HTA A;  4XUJ A;  3AZL B;  3P5J B;  4KUD B;  5AV8 D;  1KX5 C;  5AVB B;  2CV5 D;  1P3G C;  5B2I A;  5B24 C;  5CPK C;  3TU4 B;  1P3L A;  4HGA B;  1ZLA C;  1P3B B;  5B40 A;  5DNM D;  5B31 A;  4YS3 A;  3MGS A;  3AZM B;  3B0D C;  3AZG D;  5BS7 A;  1P3K B;  1WWI A;  1EQZ C;  2RIQ A;  3EPK A;  2BYK A;  4XZQ D;  5BT1 D;  4J8V C;  3UTA D;  4YM6 B;  3X1S A;  2BG1 A;  5JRG C;  3X1T A;  5B33 D;  2NZD C;  5B1L B;  2DF4 C;  2HUE C;  3O62 C;  3UT9 A;  3MNN C;  3MGR B;  3AZH D;  5GXQ A;  5GSU D;  1TZY A;  5CPJ D;  3C1C D;  1JFI B;  3KXB A;  2JSS A;  2F8N D;  4WU9 D;  5CHL B;  1H3O B;  4XZQ A;  3MVD C;  3AZN B;  4QLC B;  3W99 D;  1P3G A;  4J8W C;  5BO0 B;  5B24 A;  5CPK A;  5B40 B;  5AV6 B;  2Y2L A;  3X1V D;  4J8U D;  3REK C;  1P3F D;  3W98 C;  5CPI D;  1KX3 C;  3LEL B;  4G91 B;  4G92 B;  3LZ1 C;  4KGC D;  5GT3 C;  4JJN C;  4Z5T B;  4ZUX C;  3X1T B;  3B6F D;  3AZJ A;  3WTP D;  1P3I B;  2NZD A;  2F8N H;  1P3A D;  3H0R C;  3LZ0 B;  3AV1 D;  1P3M C;  3UTB A;  4R8P C;  3REL B;  5AY8 C;  5E5A C;  3WKJ D;  2BYM A;  3W97 D;  2Y2O A;  1KX5 B;  3MGP B;  4WZS B;  3REJ D;  1P3G B;  2DQN C;  5B32 A;  5AV9 B;  3AZK D;  1ZLA B;  4LD9 B;  2YFV B;  4J8W A;  4J8X D;  3WAA B;  4DRB A;  3MGQ D;  2L5A A;  5B0Z D;  1F66 C;  4X23 B;  1AOI B;  2PYO C;  3W98 A;  3WA9 D;  3B0D B;  3X1U B;  1EQZ B;  3B6F B;  3LJA D;  2ARO C;  3WKJ A;  2G5H C;  4Z66 C;  5DNN C;  5G49 B;  4J8V B;  1TAF A;  1KX4 C;  1ID3 B;  1P3O B;  4JJN A;  4ZUX A;  5JRG B;  3W96 B;  4H9Q A;  4ZBJ C;  5BNX B;  3REH C;  1M1A C;  4KUD D;  1M18 D;  3AZK A;  4UUZ A;  2HUE B;  5B31 G;  3O62 B;  1P3L C;  4J8X A;  4NE3 A;  1P3M A;  3MNN B;  3TU4 D;  4R8P A;  3AV2 B;  5B31 C;  5B2J C;  5AY8 A;  5KDM A;  4YS3 C;  3AL0 C;  4NE5 A;  5CP6 D;  1S32 B;  5BS7 C;  3VH6 W;  3AZM D;  3MVD B;  4AWL C;  1P3K D;  4CSR A;  5AV8 C;  3AZE D;  2NQB D;  2JE5 A;  2CV5 C;  1T3U A;  3B6G B;  1M18 A;  1F66 A;  2J8P A;  5FUG B;  3REK B;  1Z2C B;  1BH9 B;  1KX3 B;  4Z2M G;  5DNM C;  4H9N A;  3LZ1 B;  2IO5 C;  5CP6 A;  3KXB C;  2ARO A;  3AZG C;  1TAF B;  4Z66 A;  1HQ3 B;  5DNN A;  1M19 D;  5GT3 B;  4JJN B;  3AN2 D;  3B0B A;  1KX4 A;  4H9Q B;  4XZQ C;  5BT1 C;  3KWQ A;  5C3I C;  3UTA C;  3REH A;  4NFT A;  1M1A A;  1BFM A;  3AZN D;  4DRA A;  5AV6 D;  3A6N A;  2ZY5 A;  5E5A B;  5B2J A;  3H0L C;  2Y2K A;  3NQJ B;  2FJ7 D;  5CPJ C;  5B0Y D;  3C1C C;  3LEL D;  2HIO B;  4WU9 C;  2XD1 A;  4KHA A;  5AV8 A;  3W99 C;  4CAY B;  3AZJ C;  2CV5 A;  2PYO B;  5AV5 B;  1P3I D;  3UTB C;  5DNM A;  3X1V C;  3LZ0 D;  4J8U C;  1P3F C;  5CPI C;  3C1B B;  4EO5 B;  4Z66 B;  4XUJ B;  3REL D;  1BH8 A;  5BNV A;  1B6W A;  3AZG A;  1KX4 B;  1B67 A;  3KUY D;  5B32 G;  2FJ7 A;  4KGC C;  4M6B A;  4ZBJ B;  3REH B;  1M1A B;  5B2I B;  5B32 C;  3REI D;  3UTA A;  1U35 D;  1P3L B;  3B6F C;  4E44 A;  3MGP D;  1WWS A;  5AV9 D;  3WTP C;  5B33 A;  4LD9 D;  4WJ3 C;  5B31 B;  3WAA D;  1P3A C;  3AV1 C;  4YS3 B;  3MGS B;  3NQU A;  3V9R A;  3FDD A;  4X23 D;  1AOI D;  3AZH A;  2ZY3 A;  3AFA D;  2BYK B;  5GSU A;  5CPJ A;  2UWX A;  3X1U D;  3C1C A;  4AWL B;  3WKJ C;  3F6T A;  3IP4 C;  3KUY A;  3H0M C;  4WU9 A;  3X1S B;  2F8N A;  2YFW A;  5B1M D;  2CV5 B;  3REJ C;  1ID3 D;  1P3O D;  3W99 A;  3AZK C;  3W96 D;  5JRG D;  4J8X C;  3UT9 B;  3MGQ C;  5DNM B;  5B0Z C;  3O62 D;  5GXQ B;  4WU8 D;  1P3P D;  3X1V A;  1TZY B;  4J8U A;  3MNN D;  1P3F A;  3WA9 C;  1BH8 B;  3B0C W;  5BNV B;  3KXB B;  5CPI A;  1W2E A;  3A1I A;  3AV2 D;  3AZF D;  4XZQ B;  3VH6 T;  1S32 D;  4KGC A;  5C3I B;  3UTA B;  5B24 B;  3MVD D;  5CPK B;  3B6F A;  3AZI D;  4KUD C;  1M18 C;  3WTP A;  4UPK A;  1P3A A;  3AYW D;  3AV1 A;  3B6G D;  3TU4 C;  5F99 D;  3REK D;  1R4V A;  5GT0 D;  1KX3 D;  5CP6 C;  4WU9 B;  3LZ1 D;  2YFW B;  2Y2N A;  3W97 A;  1P34 D;  3KFU G;  5AVC D;  1HQ3 D;  1P3K C;  3KWQ C;  3AZJ B;  3AZL D;  3REJ A;  2NZD B;  3AZE C;  3VH6 A;  2NQB C;  5AVB D;  3UTB B;  3MGQ A;  3X1V B;  5B0Z A;  4J8U B;  5CPI B;  3A6N C;  1P3B D;  2BYM B;  3WA9 A;  1N1J A;  2G5I C;  2JCH A;  3KSY A;  2ZY2 A;  2ZY4 A;  3LJA A;  3R45 A;  4H9R A;  1M19 C;  5B32 B;  3AN2 C;  2RVQ D;  2HIO D;  4H9P A;  5AVC A;  4J8W B;  3AZL A;  4YM6 D;  2ZM5 A;  4KUD A;  1P3A B;  3AV1 B;  3W98 B;  5AVB A;  5B1L D;  2PYO D;  4WNN A;  3TU4 A;  5AV5 D;  3WKJ B;  3MGR D;  4DQY B;  2FJ7 C;  3C1B D;  5B0Y C;  4XUJ D;  4ZUX B;  3AZM A;  4G91 C;  1P3K A;  3AZK B;  4UUZ B;  4J8X B;  3AZE A;  1P3M B;  2NQB A;  5B2I D;  4QLC D;  5B0Z B;  5B33 C;  1P3L D;  4YM6 A;  4R8P B;  5KDM B;  5AY8 B;  3WA9 B;  5B40 D;  1P3I C;  5B1L A;  5B31 D;  3AZH C;  4YS3 D;  2F8N G;  1ULY A;  3MGS D;  3R45 B;  5GSU C;  4H9R B;  3KUY C;  4CSR B;  2FFF B;  1M19 A;  1JFI A;  3AN2 A;  3X1S D;  1M18 B;  3REI C;  1U35 C;  1F66 B;  4Z5T D;  3X1T D;  1H3O A;  3MGP C;  3AZN A;  4QLC A;  5AV9 C;  4WNN B;  4LD9 C;  2Y2Q A;  4H9N B;  5BO0 A;  3WAA C;  3UT9 D;  5CP6 B;  5AV6 A;  2ARO B;  5GXQ D;  4X23 C;  1AOI C;  1TZY D;  3B0C T;  5DNN B;  2Y2I A;  3KXB D;  3AFA C;  3X1U C;  5B0Y A;  3LEL A;  1A7W A;  3KWQ B;  3AZE B;  2NQB B;  1KX5 D;  5B1M C;  1P3G D;  1ID3 C;  5B24 D;  1P3O C;  5CPK D;  3W96 C;  4Z5T A;  1ZLA D;  2VQR A;  3A6N B;  5B2J B;  1P3I A;  4WU8 C;  1P3P C;  3VH5 T;  3LZ0 A;  3AV2 C;  3REL A;  1EQZ D;  1M19 B;  3AN2 B;  3W97 C;  3AZF C;  1S32 C;  4KHA B;  2XD5 A;  5AV8 B;  3WTP E;  4J8V D;  5JA4 A;  2F8N K;  3REI A;  1U35 A;  1KX5 A;  3AZJ D;  4Z2M H;  3MGP A;  3AZI C;  2NZD D;  5AV9 A;  1ZLA A;  4LD9 A;  2YFV A;  3WAA A;  3UTB D;  3AYW C;  3B6G C;  2IO5 B;  5F99 C;  4X23 A;  3AZG B;  2FJ7 B;  1AOI A;  5GT0 C;  5B0Y B;  3AFA A;  3LJA C;  3X1U A;  1EQZ A;  3VH5 A;  2Y2P A;  1P34 C;  5AVC C;  1HQ3 C;  5G49 A;  5B32 D;  5B1M A;  4J8V A;  3A1K A;  5B33 B;  3AZL C;  2Y2G A;  1ID3 A;  4J8W D;  1P3O A;  3W96 A;  5JRG A;  5AVB C;  5BNX A;  3NQU B;  4H9O A;  3V9R B;  3AZH B;  3VH5 W;  4WU8 A;  3O62 A;  1P3P A;  4HGA C;  3W98 D;  1P3B C;  5GSU B;  2Y2M A;  5CPJ B;  3C1C B;  3MNN A;  2CWE A;  3KUY B;  4H9S C;  3AV2 A;  2F8N B;  3EG5 B;  3AZF A;  3AZM C;  1S32 A;  5JA4 B;  4NE6 A;  3W99 B;  3REI B;  5GT3 D;  4JJN D;  4ZUX D;  2RVQ C;  2Y2J A;  2HIO C;  1U35 B;  2LY8 A;  3MVD A;  3EPL A;  3AZI A;  4YM6 C;  1KU5 A;  1P3M D;  1P3F B;  3AYW A;  3B6G A;  4R8P D;  5B1L C;  5AY8 D;  5F99 A;  5FUG A;  3REK A;  2W8S A;  3AFA B;  5AV5 C;  5GT0 A;  1BH9 A;  5E5A D;  4KGC B;  1KX3 A;  3MGR C;  3C1B C;  4EO5 C;  3LZ1 A;  4WV4 B;  4XUJ C;  1P34 A;  5B1M B; 
#chains in the Genus database with same CATH homology
 1HQ3 A;  5GT3 A;  3WTP B;  4H9O B;  5B2I C;  4QLC C;  3AZN C;  4WU8 B;  1P3P B;  1F66 D;  5B40 C;  5AV6 C;  1P3B A;  3W97 B;  3MGS C;  3AZF B;  4H9S A;  2ARO D;  5E5A A;  4Z66 D;  5DNN D;  3LEL C;  3NQJ A;  3REJ B;  1KX4 D;  4G92 C;  3KWQ D;  2HIO A;  3REH D;  3AZI B;  1M1A D;  3X1S C;  3MGQ B;  4Z5T C;  4E45 A;  3X1T C;  3AYW B;  1N1J B;  1PZR A;  4CAY A;  5F99 B;  2Y2H A;  3EPH A;  5GT0 B;  3A6N D;  1Q9C A;  2F2A C;  5B2J D;  3LZ0 C;  3UT9 C;  2PYO A;  5AV5 A;  3LJA B;  5GXQ C;  3EPJ A;  3MGR A;  3REL C;  1TZY C;  1F1E A;  3C1B A;  1P34 B;  4H9P B;  5AVC B;  1HTA A;  4XUJ A;  3AZL B;  3P5J B;  4KUD B;  5AV8 D;  1KX5 C;  5AVB B;  2CV5 D;  1P3G C;  5B2I A;  5B24 C;  5CPK C;  3TU4 B;  1P3L A;  4HGA B;  1ZLA C;  1P3B B;  5B40 A;  5DNM D;  5B31 A;  4YS3 A;  3MGS A;  3AZM B;  3B0D C;  3AZG D;  5BS7 A;  1P3K B;  1WWI A;  1EQZ C;  2RIQ A;  3EPK A;  2BYK A;  4XZQ D;  5BT1 D;  4J8V C;  3UTA D;  4YM6 B;  3X1S A;  2BG1 A;  5JRG C;  3X1T A;  5B33 D;  2NZD C;  5B1L B;  2DF4 C;  2HUE C;  3O62 C;  3UT9 A;  3MNN C;  3MGR B;  3AZH D;  5GXQ A;  5GSU D;  1TZY A;  5CPJ D;  3C1C D;  1JFI B;  3KXB A;  2JSS A;  2F8N D;  4WU9 D;  5CHL B;  1H3O B;  4XZQ A;  3MVD C;  3AZN B;  4QLC B;  3W99 D;  1P3G A;  4J8W C;  5BO0 B;  5B24 A;  5CPK A;  5B40 B;  5AV6 B;  2Y2L A;  3X1V D;  4J8U D;  3REK C;  1P3F D;  3W98 C;  5CPI D;  1KX3 C;  3LEL B;  4G91 B;  4G92 B;  3LZ1 C;  4KGC D;  5GT3 C;  4JJN C;  4Z5T B;  4ZUX C;  3X1T B;  3B6F D;  3AZJ A;  3WTP D;  1P3I B;  2NZD A;  2F8N H;  1P3A D;  3H0R C;  3LZ0 B;  3AV1 D;  1P3M C;  3UTB A;  4R8P C;  3REL B;  5AY8 C;  5E5A C;  3WKJ D;  2BYM A;  3W97 D;  2Y2O A;  1KX5 B;  3MGP B;  4WZS B;  3REJ D;  1P3G B;  2DQN C;  5B32 A;  5AV9 B;  3AZK D;  1ZLA B;  4LD9 B;  2YFV B;  4J8W A;  4J8X D;  3WAA B;  4DRB A;  3MGQ D;  2L5A A;  5B0Z D;  1F66 C;  4X23 B;  1AOI B;  2PYO C;  3W98 A;  3WA9 D;  3B0D B;  3X1U B;  1EQZ B;  3B6F B;  3LJA D;  2ARO C;  3WKJ A;  2G5H C;  4Z66 C;  5DNN C;  5G49 B;  4J8V B;  1TAF A;  1KX4 C;  1ID3 B;  1P3O B;  4JJN A;  4ZUX A;  5JRG B;  3W96 B;  4H9Q A;  4ZBJ C;  5BNX B;  3REH C;  1M1A C;  4KUD D;  1M18 D;  3AZK A;  4UUZ A;  2HUE B;  5B31 G;  3O62 B;  1P3L C;  4J8X A;  4NE3 A;  1P3M A;  3MNN B;  3TU4 D;  4R8P A;  3AV2 B;  5B31 C;  5B2J C;  5AY8 A;  5KDM A;  4YS3 C;  3AL0 C;  4NE5 A;  5CP6 D;  1S32 B;  5BS7 C;  3VH6 W;  3AZM D;  3MVD B;  4AWL C;  1P3K D;  4CSR A;  5AV8 C;  3AZE D;  2NQB D;  2JE5 A;  2CV5 C;  1T3U A;  3B6G B;  1M18 A;  1F66 A;  2J8P A;  5FUG B;  3REK B;  1Z2C B;  1BH9 B;  1KX3 B;  4Z2M G;  5DNM C;  4H9N A;  3LZ1 B;  2IO5 C;  5CP6 A;  3KXB C;  2ARO A;  3AZG C;  1TAF B;  4Z66 A;  1HQ3 B;  5DNN A;  1M19 D;  5GT3 B;  4JJN B;  3AN2 D;  3B0B A;  1KX4 A;  4H9Q B;  4XZQ C;  5BT1 C;  3KWQ A;  5C3I C;  3UTA C;  3REH A;  4NFT A;  1M1A A;  1BFM A;  3AZN D;  4DRA A;  5AV6 D;  3A6N A;  2ZY5 A;  5E5A B;  5B2J A;  3H0L C;  2Y2K A;  3NQJ B;  2FJ7 D;  5CPJ C;  5B0Y D;  3C1C C;  3LEL D;  2HIO B;  4WU9 C;  2XD1 A;  4KHA A;  5AV8 A;  3W99 C;  4CAY B;  3AZJ C;  2CV5 A;  2PYO B;  5AV5 B;  1P3I D;  3UTB C;  5DNM A;  3X1V C;  3LZ0 D;  4J8U C;  1P3F C;  5CPI C;  3C1B B;  4EO5 B;  4Z66 B;  4XUJ B;  3REL D;  1BH8 A;  5BNV A;  1B6W A;  3AZG A;  1KX4 B;  1B67 A;  3KUY D;  5B32 G;  2FJ7 A;  4KGC C;  4M6B A;  4ZBJ B;  3REH B;  1M1A B;  5B2I B;  5B32 C;  3REI D;  3UTA A;  1U35 D;  1P3L B;  3B6F C;  4E44 A;  3MGP D;  1WWS A;  5AV9 D;  3WTP C;  5B33 A;  4LD9 D;  4WJ3 C;  5B31 B;  3WAA D;  1P3A C;  3AV1 C;  4YS3 B;  3MGS B;  3NQU A;  3V9R A;  3FDD A;  4X23 D;  1AOI D;  3AZH A;  2ZY3 A;  3AFA D;  2BYK B;  5GSU A;  5CPJ A;  2UWX A;  3X1U D;  3C1C A;  4AWL B;  3WKJ C;  3F6T A;  3IP4 C;  3KUY A;  3H0M C;  4WU9 A;  3X1S B;  2F8N A;  2YFW A;  5B1M D;  2CV5 B;  3REJ C;  1ID3 D;  1P3O D;  3W99 A;  3AZK C;  3W96 D;  5JRG D;  4J8X C;  3UT9 B;  3MGQ C;  5DNM B;  5B0Z C;  3O62 D;  5GXQ B;  4WU8 D;  1P3P D;  3X1V A;  1TZY B;  4J8U A;  3MNN D;  1P3F A;  3WA9 C;  1BH8 B;  3B0C W;  5BNV B;  3KXB B;  5CPI A;  1W2E A;  3A1I A;  3AV2 D;  3AZF D;  4XZQ B;  3VH6 T;  1S32 D;  4KGC A;  5C3I B;  3UTA B;  5B24 B;  3MVD D;  5CPK B;  3B6F A;  3AZI D;  4KUD C;  1M18 C;  3WTP A;  4UPK A;  1P3A A;  3AYW D;  3AV1 A;  3B6G D;  3TU4 C;  5F99 D;  3REK D;  1R4V A;  5GT0 D;  1KX3 D;  5CP6 C;  4WU9 B;  3LZ1 D;  2YFW B;  2Y2N A;  3W97 A;  1P34 D;  3KFU G;  5AVC D;  1HQ3 D;  1P3K C;  3KWQ C;  3AZJ B;  3AZL D;  3REJ A;  2NZD B;  3AZE C;  3VH6 A;  2NQB C;  5AVB D;  3UTB B;  3MGQ A;  3X1V B;  5B0Z A;  4J8U B;  5CPI B;  3A6N C;  1P3B D;  2BYM B;  3WA9 A;  1N1J A;  2G5I C;  2JCH A;  3KSY A;  2ZY2 A;  2ZY4 A;  3LJA A;  3R45 A;  4H9R A;  1M19 C;  5B32 B;  3AN2 C;  2RVQ D;  2HIO D;  4H9P A;  5AVC A;  4J8W B;  3AZL A;  4YM6 D;  2ZM5 A;  4KUD A;  1P3A B;  3AV1 B;  3W98 B;  5AVB A;  5B1L D;  2PYO D;  4WNN A;  3TU4 A;  5AV5 D;  3WKJ B;  3MGR D;  4DQY B;  2FJ7 C;  3C1B D;  5B0Y C;  4XUJ D;  4ZUX B;  3AZM A;  4G91 C;  1P3K A;  3AZK B;  4UUZ B;  4J8X B;  3AZE A;  1P3M B;  2NQB A;  5B2I D;  4QLC D;  5B0Z B;  5B33 C;  1P3L D;  4YM6 A;  4R8P B;  5KDM B;  5AY8 B;  3WA9 B;  5B40 D;  1P3I C;  5B1L A;  5B31 D;  3AZH C;  4YS3 D;  2F8N G;  1ULY A;  3MGS D;  3R45 B;  5GSU C;  4H9R B;  3KUY C;  4CSR B;  2FFF B;  1M19 A;  1JFI A;  3AN2 A;  3X1S D;  1M18 B;  3REI C;  1U35 C;  1F66 B;  4Z5T D;  3X1T D;  1H3O A;  3MGP C;  3AZN A;  4QLC A;  5AV9 C;  4WNN B;  4LD9 C;  2Y2Q A;  4H9N B;  5BO0 A;  3WAA C;  3UT9 D;  5CP6 B;  5AV6 A;  2ARO B;  5GXQ D;  4X23 C;  1AOI C;  1TZY D;  3B0C T;  5DNN B;  2Y2I A;  3KXB D;  3AFA C;  3X1U C;  5B0Y A;  3LEL A;  1A7W A;  3KWQ B;  3AZE B;  2NQB B;  1KX5 D;  5B1M C;  1P3G D;  1ID3 C;  5B24 D;  1P3O C;  5CPK D;  3W96 C;  4Z5T A;  1ZLA D;  2VQR A;  3A6N B;  5B2J B;  1P3I A;  4WU8 C;  1P3P C;  3VH5 T;  3LZ0 A;  3AV2 C;  3REL A;  1EQZ D;  1M19 B;  3AN2 B;  3W97 C;  3AZF C;  1S32 C;  4KHA B;  2XD5 A;  5AV8 B;  3WTP E;  4J8V D;  5JA4 A;  2F8N K;  3REI A;  1U35 A;  1KX5 A;  3AZJ D;  4Z2M H;  3MGP A;  3AZI C;  2NZD D;  5AV9 A;  1ZLA A;  4LD9 A;  2YFV A;  3WAA A;  3UTB D;  3AYW C;  3B6G C;  2IO5 B;  5F99 C;  4X23 A;  3AZG B;  2FJ7 B;  1AOI A;  5GT0 C;  5B0Y B;  3AFA A;  3LJA C;  3X1U A;  1EQZ A;  3VH5 A;  2Y2P A;  1P34 C;  5AVC C;  1HQ3 C;  5G49 A;  5B32 D;  5B1M A;  4J8V A;  3A1K A;  5B33 B;  3AZL C;  2Y2G A;  1ID3 A;  4J8W D;  1P3O A;  3W96 A;  5JRG A;  5AVB C;  5BNX A;  3NQU B;  4H9O A;  3V9R B;  3AZH B;  3VH5 W;  4WU8 A;  3O62 A;  1P3P A;  4HGA C;  3W98 D;  1P3B C;  5GSU B;  2Y2M A;  5CPJ B;  3C1C B;  3MNN A;  2CWE A;  3KUY B;  4H9S C;  3AV2 A;  2F8N B;  3EG5 B;  3AZF A;  3AZM C;  1S32 A;  5JA4 B;  4NE6 A;  3W99 B;  3REI B;  5GT3 D;  4JJN D;  4ZUX D;  2RVQ C;  2Y2J A;  2HIO C;  1U35 B;  2LY8 A;  3MVD A;  3EPL A;  3AZI A;  4YM6 C;  1KU5 A;  1P3M D;  1P3F B;  3AYW A;  3B6G A;  4R8P D;  5B1L C;  5AY8 D;  5F99 A;  5FUG A;  3REK A;  2W8S A;  3AFA B;  5AV5 C;  5GT0 A;  1BH9 A;  5E5A D;  4KGC B;  1KX3 A;  3MGR C;  3C1B C;  4EO5 C;  3LZ1 A;  4WV4 B;  4XUJ C;  1P34 A;  5B1M B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...