3UT9D

Crystal structure of nucleosome core particle assembled with a palindromic widom '601' derivative (ncp-601l)
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
96
structure length
96
Chain Sequence
RRKTRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords Histone H3.2
publication title The mechanics behind DNA sequence-dependent properties of the nucleosome
pubmed doi rcsb
source organism Xenopus laevis
total genus 34
structure length 96
sequence length 96
chains with identical sequence H
ec nomenclature
pdb deposition date 2011-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3ut9D00
5B32D 3X1TB 3AV1B 5GSUB 5GSUA 5GT0C 5JRGC 1ULYA 4E44A 3REKB 5B0ZB 3AZJD 3WA9A 5B1LA 3MVDB 3MVDA 3X1VC 3KWQA 4KHAB 4KHAA 3O62C 3UT9B 2PYOC 1U35C 3V9RB 2AROB 2AROA 3TU4C 1KX4D 5AV5C 1P3MD 2HIOB 5BNVB 5BNVA 4R8PB 4R8PA 3R45B 5AVBB 5AVBA 4WU9C 4WU8D 4XUJD 3AZID 5AVCD 1M1AB 4M6BA 3W97A 5B24B 5B24A 1EQZB 4WNNA 3AFAB 5B32A 3WTPB 3WTPA 1P3ID 3WKJB 3X1SD 5FUGB 5B33D 5GXQD 3B6GC 5BT1C 3AZJA 1P3BD 3X1UC 2CV5C 1JFIB 3LJAD 3AZMD 3AZND 3B6FC 3NQUB 3NQUA 3AZEB 3KXBD 1KX4A 1KX4B 1KX5D 4J8UD 5E5AC 4YS3C 3KUYD 4H9OB 2BYKB 1P3GB 1P3KC 3MNND 1M18D 4X23D 5AV6B 5AV6A 2HUEC 4WU8B 4WU8A 4XUJA 3MGQC 5DNMC 5AVCA 3RELB 3LELC 1TZYC 3AZHD 5CP6B 1TAFA 5DNNC 5GT3D 3AYWC 4XZQC 1P3IA 1P3IB 3X1SA 1HQ3C 5B33A 5GXQA 3A6NC 1AOIC 2NQBB 2NQBA 1P3BB 1P3BA 5B2JD 1ZLAD 3MGRD 3O62B 3LJAA 3AZMA 3AZNA 3AZKD 3AZLD 2PYOB 3AN2C 5AV9C 2F8ND 3REHD 4ZUXD 5C3IB 3KXBA 4G91C 1KX5B 3B0CT 1KX5A 1N1JB 1N1JA 4QLCD 3REIB 4J8UA 5B0YD 3KUYA 3REIA 1M18B 1M18A 3LZ1B 4X23A 3LZ1A 3X1TD 3AV1D 3REKD 4HGAB 5B0ZD 3MGPC 1F66C 3AV2C 3AZHB 3AZHA 2F8NG 3UT9D 5GT3B 5GT3A 5AV8C 4J8VB 4J8VA 4H9QA 5G49A 2HIOD 3W97C 2RVQC 5B2JA 1ZLAB 1ZLAA 3MGRA 3VH5T 1P3PC 2CV5B 3UTBC 4CAYB 3AZFC 1P3LC 4J8WC 3AZKB 3AZKA 4Z5TD 2F8NB 3REHB 3REHA 2F8NA 3AZJC 4ZUXA 1M1AD 5AY8B 5AY8A 3WAAB 3WAAA 4QLCA 3W96C 1EQZD 5BO0B 5BO0A 3NQJB 4ZBJC 3AFAD 3WTPD 3X1TA 3AV1A 2F8NK 3WKJD 3REKA 2NZDC 1P3MC 5BS7C 5B0ZA 1P3AC 3UTAB 3UTAA 4EO5B 2IO5B 5B2ID 5B40C 1BFMA 5CPJB 5CPJA 3REJD 5DNNB 5CHLB 1P3FB 4LD9C 3UT9A 4XUJC 4JJND 3W99C 3V9RA 3AZIC 3AZED 1AOIB 4NFTA 3W98C 1R4VA 2HIOA 4UUZB 4UUZA 1P3GD 3R45A 1KX3C 5AV6D 1P34D 5F99C 3X1SC 4H9PB 5GXQC 4Z5TB 4Z5TA 1S32D 1M1AA 3RELD 5CPKD 1EQZA 5CP6D 5JRGD 3AFAA 3WKJA 4H9RB 4H9RA 5FUGA 2FJ7C 4Z2MH 1F66B 2NQBD 3X1VD 3KUYC 4Z66B 5B2IB 5B2IA 1M19C 3MNNC 3REJB 4X23C 3REJA 3O62D 1JFIA 2JSSA 4JJNB 4JJNA 2PYOD 5AV8B 3TU4D 3KSYA 5AV5D 3AZEA 4DRAA 3C1BA 3C1BB 5B1MB 4J8XC 4G92B 3REID 4WU9D 4H9OA 2BYKA 1P3GA 5B31C 3LZ1D 4H9SA 1P34B 1P34A 3VH6T 4YM6C 3AZGC 1ID3C 1H3OB 1H3OA 3MGSC 5CPIB 5CPIA 4KGCC 3LZ0C 5B2JC 1S32B 1S32A 3MGRC 3RELA 5CPKB 5CPKA 4KUDB 4DRBA 5CP6A 3C1CC 3AZLC 1F1EA 2L5AA 5GT0B 5JRGB 5JRGA 2NZDB 3B6GD 4J8VD 3X1UD 1P3OC 3B0DC 4QLCC 3X1VA 5B0YC 3X1VB 2CV5D 4LD9B 3O62A 3X1TC 5GSUC 3B6FD 4NE6A 1U35B 2PYOA 3TU4B 3TU4A 5AV5B 5AV5A 1BH9B 4CSRB 4CSRA 5B1LC 3WA9C 3MVDC 3KWQC 5AY8D 3WAAD 5E5AD 4YS3D 1P3KD 4WU9B 4WU9A 2AROC 3B0CW 5DNMD 2HIOC 3UTAD 4R8PC 5AVBC 5CPJD 5DNND 2CWEA 4WZSB 1P3FD 4E45A 3AYWD 1HQ3D 3B6GB 3A6ND 1AOID 3B6GA 3X1UB 5B31G 3X1UA 1M19B 5B24C 2CV5A 4CAYA 5B32C 3AFAC 3WTPC 4WV4B 3B6FB 3B6FA 5KDMB 5KDMA 3WKJC 5AV9D 1WWSA 3VH5W 5E5AB 5E5AA 4YS3A 4YS3B 1P3KB 1P3KA 4Z2MG 3NQJA 2HUEB 4YM6B 3MGSB 3MGQB 3MGQA 3LZ0B 1KX4C 3VH6A 3MGPD 1B67A 5DNMB 5DNMA 1F66D 3LELB 4Z66D 1TZYB 1TZYA 2YFWB 2YFWA 3AV2D 1P3GC 5DNNA 5AV6C 1P3FA 4WU8C 3AYWB 3AYWA 4XZQB 5AV8D 1HQ3B 1HQ3A 3A6NB 3A6NA 1AOIA 3C1BD 5AVCC 5B1MD 3RELC 1P3PD 3UTBD 3AZFD 1P3LD 2BYMB 2BYMA 2YFVA 2YFVB 4J8WD 1P3IC 3AN2B 3AN2A 5AV9B 4H9PA 5AV9A 5B33C 5CPID 3WA9B 2NQBC 5B1LB 4G91B 1P3BC 3KWQB 1B6WA 3W96D 4KUDD 3LJAC 3AZMC 3AZNC 5GT0D 3B0BA 2NZDD 2F8NH 3KXBC 5C3IC 3MGPB 3MGPA 1P3AD 1KX5C 5B32G 1F66A 5B40D 4J8UC 3REIC 4Z66A 1Q9CA 4H9NB 4H9NA 3AV2B 3AV2A 1M18C 3LZ1C 4LD9D 4HGAC 3W99D 1U35D 5AV8A 1BH8B 1BH8A 3W98D 5B1MA 4AWLC 3W97B 1A7WA 1P3PB 1P3PA 4WNNB 3AZHC 3UTBB 3UTBA 1KX3D 3AZFB 3AZFA 5B32B 1P3LB 1P3LA 5GT3C 5F99D 3VH5A 4J8WB 4J8WA 4J8VC 3AZJB 1ZLAC 3W96B 3W96A 4KUDA 3VH6W 4ZBJB 3AZKC 5BNXB 5BNXA 5GT0A 3REHC 2FJ7D 1P3MB 1P3MA 5BT1D 5BS7A 4ZUXC 2NZDA 1P3AB 1P3AA 5AY8C 3WAAC 5B40B 5B40A 1M19D 4LD9A 3AV1C 4XUJB 1WWIA 3REKC 3W99B 3W99A 1U35A 4NE3A 3AZIA 3AZIB 5AVCB 5B0ZC 3UTAC 1BH9A 4EO5C 3W98B 3W98A 2IO5C 4J8XD 4NE5A 5CPJC 1TAFB 1P3FC 1KX3B 1KX3A 5B31D 3UT9C 5F99B 5F99A 4YM6D 3X1SB 3AZGD 5B33B 5GXQB 3MGSD 1ID3D 3MGQD 4KGCD 3LZ0D 5JA4B 5JA4A 1HTAA 3LELD 1TZYD 3LJAB 3C1CD 3AZNB 3AZMB 4XZQD 4Z5TC 3KXBB 2FJ7B 2FJ7A 1P3OD 1M1AC 4J8UB 3KUYB 3MNNB 3MNNA 1M19A 1EQZC 4X23B 5GSUD 3AN2D 1KU5A 3WA9D 5B1LD 3MVDD 4AWLB 3KWQD 5B2IC 4Z66C 4J8XB 4J8XA 3REJC 5B31B 5B31A 3AZGB 4JJNC 4YM6A 3AZGA 1ID3B 1ID3A 2AROD 3MGSA 4H9QB 3AZEC 3C1BC 4KGCB 5G49B 4KGCA 3LZ0A 5B1MC 5B2JB 4R8PD 3MGRB 2LY8A 4G92C 3LELA 5AVBD 4H9SC 3WTPE 3C1CA 3C1CB 3AZLB 3AZLA 1P34C 4XZQA 5CPIC 4ZUXB 1S32C 1P3OB 1P3OA 3B0DB 2RVQD 4QLCB 5B0YB 5B0YA 5CPKC 5B24D 3W97D 4KUDC 5CP6C
chains in the Genus database with same CATH superfamily
5B32D 3X1TB 3AV1B 5GSUB 5GSUA 5GT0C 5JRGC 1ULYA 4E44A 3REKB 5B0ZB 3AZJD 3WA9A 5B1LA 3MVDB 3MVDA 3X1VC 3KWQA 4KHAB 4KHAA 3O62C 3UT9B 2Y2KA 2PYOC 1U35C 3V9RB 2AROB 2AROA 3TU4C 1KX4D 5AV5C 1P3MD 3H0MC 2HIOB 5BNVB 5BNVA 4R8PB 4R8PA 3R45B 5AVBB 5AVBA 4WU9C 2G5HC 4WU8D 2XD1A 2ZY5A 4XUJD 3AZID 5AVCD 2J8PA 1M1AB 4M6BA 3W97A 5B24B 5B24A 1EQZB 4WNNA 3AFAB 5B32A 3WTPB 3F6TA 3WTPA 1P3ID 3WKJB 3X1SD 5FUGB 5B33D 5GXQD 3B6GC 5BT1C 3AZJA 1P3BD 3X1UC 2CV5C 1JFIB 3LJAD 3AZMD 3AZND 3B6FC 3NQUB 3NQUA 3AZEB 3KXBD 1KX4A 1KX4B 2ZY3A 1KX5D 4J8UD 5E5AC 4YS3C 3KUYD 4H9OB 2BYKB 1P3GB 1P3KC 3MNND 1M18D 4X23D 5AV6B 5AV6A 2HUEC 4WU8B 4WU8A 4XUJA 3MGQC 2Y2GA 5DNMC 5AVCA 4DQYB 3RELB 3LELC 1TZYC 3AZHD 5CP6B 1TAFA 5DNNC 5GT3D 3AYWC 4XZQC 1P3IA 1P3IB 2DQNC 3X1SA 1HQ3C 5B33A 5GXQA 2DF4C 3A6NC 1AOIC 2NQBB 2NQBA 1P3BB 1P3BA 5B2JD 1ZLAD 3MGRD 3O62B 3LJAA 3AZMA 3AZNA 3AZKD 3AZLD 2PYOB 3AN2C 5AV9C 2F8ND 3REHD 4ZUXD 5C3IB 3KXBA 4G91C 1KX5B 3B0CT 1KX5A 1N1JB 1N1JA 4QLCD 3REIB 4J8UA 5B0YD 3KUYA 3REIA 1M18B 1M18A 3LZ1B 4X23A 3LZ1A 2ZM5A 3X1TD 3AV1D 2Y2OA 4HGAB 3REKD 5B0ZD 3MGPC 1F66C 2F2AC 3AV2C 1Z2CB 3AZHB 3AZHA 2F8NG 3UT9D 5GT3B 5GT3A 5AV8C 4J8VB 4J8VA 4H9QA 5G49A 2HIOD 3W97C 2RVQC 5B2JA 1ZLAB 1ZLAA 3MGRA 3VH5T 1P3PC 2CV5B 3UTBC 4CAYB 3AZFC 1P3LC 4J8WC 3AZKB 3AZKA 4Z5TD 2F8NB 3REHB 3REHA 2F8NA 3AZJC 4ZUXA 1M1AD 5AY8B 5AY8A 3WAAB 3WAAA 4QLCA 3W96C 1EQZD 5BO0B 5BO0A 3NQJB 4ZBJC 3AFAD 3WTPD 3X1TA 3AV1A 2F8NK 3WKJD 3REKA 2NZDC 1P3MC 5BS7C 5B0ZA 1P3AC 3UTAB 3UTAA 4EO5B 2IO5B 5B2ID 5B40C 3H0LC 1BFMA 5CPJB 5CPJA 1PZRA 5DNNB 3REJD 5CHLB 1P3FB 4LD9C 3UT9A 4XUJC 4JJND 2Y2HA 3W99C 3V9RA 3AZIC 3AZED 1AOIB 4NFTA 3W98C 1R4VA 1W2EA 2HIOA 4UUZB 4UUZA 1P3GD 3R45A 1KX3C 5AV6D 1P34D 5F99C 2G5IC 3X1SC 4H9PB 5GXQC 4Z5TB 2Y2MA 4Z5TA 1S32D 1M1AA 3EPLA 3RELD 5CPKD 3A1KA 1EQZA 4UPKA 5CP6D 5JRGD 3AFAA 3WKJA 4H9RB 4H9RA 5FUGA 2FJ7C 4Z2MH 1F66B 2NQBD 3X1VD 3KUYC 4Z66B 5B2IB 5B2IA 1M19C 3MNNC 3REJB 4X23C 3REJA 3O62D 1JFIA 2JSSA 4JJNB 4JJNA 2PYOD 5AV8B 3TU4D 3KSYA 5AV5D 3AZEA 4DRAA 3FDDA 3C1BA 3C1BB 5B1MB 4J8XC 4G92B 3REID 4WU9D 4H9OA 2BYKA 1P3GA 5B31C 3LZ1D 4H9SA 1P34B 1P34A 3VH6T 4YM6C 3AZGC 1ID3C 1H3OB 1H3OA 3MGSC 5CPIB 5CPIA 4KGCC 3LZ0C 3EG5B 3EPJA 5B2JC 1S32B 1T3UA 2Y2JA 3MGRC 1S32A 3RELA 5CPKB 5CPKA 4KUDB 4DRBA 5CP6A 3C1CC 3AZLC 1F1EA 2L5AA 5GT0B 5JRGB 5JRGA 2NZDB 3B6GD 4J8VD 2Y2LA 3X1UD 1P3OC 3B0DC 4QLCC 3X1VA 5B0YC 3X1VB 2CV5D 2Y2NA 4LD9B 3O62A 3X1TC 5GSUC 3B6FD 4NE6A 1U35B 2PYOA 3TU4B 3TU4A 5AV5B 5AV5A 1BH9B 4CSRB 4CSRA 5B1LC 3WA9C 3MVDC 3KWQC 5AY8D 3WAAD 5E5AD 4YS3D 1P3KD 4WU9B 4WU9A 2AROC 3B0CW 5DNMD 2HIOC 3UTAD 4R8PC 5AVBC 5CPJD 5DNND 2CWEA 4WZSB 1P3FD 4E45A 3AYWD 1HQ3D 3IP4C 3A6ND 1AOID 3B6GA 3B6GB 3X1UB 5B31G 3X1UA 1M19B 5B24C 3EPHA 2CV5A 4CAYA 5B32C 3AFAC 3WTPC 4WV4B 3B6FB 3B6FA 5KDMB 5KDMA 3WKJC 5AV9D 1WWSA 3VH5W 5E5AB 5E5AA 4YS3A 4YS3B 1P3KB 1P3KA 4Z2MG 2Y2QA 3NQJA 2HUEB 4YM6B 2JE5A 2VQRA 3MGSB 2JCHA 3MGQB 3MGQA 3LZ0B 1KX4C 3VH6A 3MGPD 1B67A 5DNMB 5DNMA 1F66D 3LELB 4Z66D 1TZYB 1TZYA 2YFWB 2YFWA 3AV2D 1P3GC 3AL0C 5DNNA 5AV6C 1P3FA 4WU8C 3AYWB 3AYWA 4XZQB 5AV8D 1HQ3B 1HQ3A 3A6NB 3A6NA 1AOIA 3C1BD 5AVCC 5B1MD 3RELC 1P3PD 3UTBD 3AZFD 1P3LD 2BYMB 2BYMA 2YFVA 2YFVB 4J8WD 1P3IC 3AN2B 3AN2A 5AV9B 4H9PA 5AV9A 5B33C 5CPID 3WA9B 2NQBC 5B1LB 4G91B 1P3BC 3KWQB 1B6WA 3W96D 4KUDD 3LJAC 3AZMC 3AZNC 5GT0D 3B0BA 2RIQA 2NZDD 2F8NH 3KXBC 5C3IC 3MGPB 3MGPA 1P3AD 1KX5C 5B32G 1F66A 5B40D 4J8UC 3REIC 4Z66A 1Q9CA 4H9NB 4H9NA 3AV2B 3AV2A 1M18C 3LZ1C 4LD9D 4HGAC 3W99D 1U35D 5AV8A 1BH8B 1BH8A 3W98D 5B1MA 4AWLC 3W97B 1A7WA 2ZY4A 1P3PB 1P3PA 4WNNB 3AZHC 3UTBB 3UTBA 1KX3D 3AZFB 3AZFA 5B32B 1P3LB 1P3LA 5GT3C 2BG1A 5F99D 3VH5A 4J8WB 4J8WA 4J8VC 3H0RC 3AZJB 1ZLAC 3W96B 3W96A 4KUDA 3VH6W 4ZBJB 3AZKC 2FFFB 5BNXB 5BNXA 5GT0A 3REHC 2FJ7D 1P3MB 1P3MA 5BT1D 5BS7A 4ZUXC 2NZDA 1P3AB 1P3AA 5AY8C 3WAAC 5B40B 5B40A 2Y2IA 1M19D 3KFUG 4LD9A 3AV1C 4XUJB 1WWIA 3REKC 3W99B 3W99A 1U35A 4NE3A 3AZIA 2UWXA 3AZIB 5AVCB 5B0ZC 3UTAC 1BH9A 4EO5C 3W98B 3W98A 2IO5C 4J8XD 4NE5A 5CPJC 1TAFB 1P3FC 1KX3B 1KX3A 5B31D 3UT9C 5F99B 5F99A 4YM6D 3X1SB 3AZGD 5B33B 5GXQB 3MGSD 1ID3D 4WJ3C 3MGQD 4KGCD 3LZ0D 5JA4B 5JA4A 1HTAA 3LELD 1TZYD 3LJAB 3C1CD 3AZNB 3AZMB 4XZQD 4Z5TC 3KXBB 2FJ7B 2FJ7A 1P3OD 3EPKA 3P5JB 1M1AC 4J8UB 3KUYB 3MNNB 3MNNA 1M19A 1EQZC 4X23B 5GSUD 3AN2D 1KU5A 3WA9D 5B1LD 3MVDD 4AWLB 3KWQD 5B2IC 4Z66C 4J8XB 4J8XA 3REJC 3A1IA 5B31B 5B31A 3AZGB 4JJNC 4YM6A 3AZGA 1ID3B 1ID3A 2AROD 3MGSA 4H9QB 3AZEC 3C1BC 4KGCB 5G49B 4KGCA 3LZ0A 5B1MC 5B2JB 4R8PD 3MGRB 2LY8A 4G92C 3LELA 5AVBD 4H9SC 3WTPE 3C1CA 3C1CB 3AZLB 3AZLA 1P34C 2Y2PA 4XZQA 5CPIC 4ZUXB 2W8SA 1S32C 1P3OB 1P3OA 3B0DB 2RVQD 4QLCB 2XD5A 5B0YA 5B0YB 5B24D 5CPKC 3W97D 4KUDC 2ZY2A 5CP6C
chains in the Genus database with same CATH topology
5B32D 3X1TB 3AV1B 5GSUB 5GSUA 5GT0C 5JRGC 1ULYA 4E44A 3REKB 5B0ZB 3AZJD 3WA9A 5B1LA 3MVDB 3MVDA 3X1VC 3KWQA 4KHAB 4KHAA 3O62C 3UT9B 2Y2KA 2PYOC 1U35C 3V9RB 2AROB 2AROA 3TU4C 1KX4D 5AV5C 1P3MD 3H0MC 2HIOB 5BNVB 5BNVA 4R8PB 4R8PA 3R45B 5AVBB 5AVBA 4WU9C 2G5HC 4WU8D 2XD1A 2ZY5A 4XUJD 3AZID 5AVCD 2J8PA 1M1AB 4M6BA 3W97A 5B24B 5B24A 1EQZB 4WNNA 3AFAB 5B32A 3WTPB 3F6TA 3WTPA 1P3ID 3WKJB 3X1SD 5FUGB 5B33D 5GXQD 3B6GC 5BT1C 3AZJA 1P3BD 3X1UC 2CV5C 1JFIB 3LJAD 3AZMD 3AZND 3B6FC 3NQUB 3NQUA 3AZEB 3KXBD 1KX4A 1KX4B 2ZY3A 1KX5D 4J8UD 5E5AC 4YS3C 3KUYD 4H9OB 2BYKB 1P3GB 1P3KC 3MNND 1M18D 4X23D 5AV6B 5AV6A 2HUEC 4WU8B 4WU8A 4XUJA 3MGQC 2Y2GA 5DNMC 5AVCA 4DQYB 3RELB 3LELC 1TZYC 3AZHD 5CP6B 1TAFA 5DNNC 5GT3D 3AYWC 4XZQC 1P3IA 1P3IB 2DQNC 3X1SA 1HQ3C 5B33A 5GXQA 2DF4C 3A6NC 1AOIC 2NQBB 2NQBA 1P3BB 1P3BA 5B2JD 1ZLAD 3MGRD 3O62B 3LJAA 3AZMA 3AZNA 3AZKD 3AZLD 2PYOB 3AN2C 5AV9C 2F8ND 3REHD 4ZUXD 5C3IB 3KXBA 4G91C 1KX5B 3B0CT 1KX5A 1N1JB 1N1JA 4QLCD 3REIB 4J8UA 5B0YD 3KUYA 3REIA 1M18B 1M18A 3LZ1B 4X23A 3LZ1A 2ZM5A 3X1TD 3AV1D 2Y2OA 4HGAB 3REKD 5B0ZD 3MGPC 1F66C 2F2AC 3AV2C 1Z2CB 3AZHB 3AZHA 2F8NG 3UT9D 5GT3B 5GT3A 5AV8C 4J8VB 4J8VA 4H9QA 5G49A 2HIOD 3W97C 2RVQC 5B2JA 1ZLAB 1ZLAA 3MGRA 3VH5T 1P3PC 2CV5B 3UTBC 4CAYB 3AZFC 1P3LC 4J8WC 3AZKB 3AZKA 4Z5TD 2F8NB 3REHB 3REHA 2F8NA 3AZJC 4ZUXA 1M1AD 5AY8B 5AY8A 3WAAB 3WAAA 4QLCA 3W96C 1EQZD 5BO0B 5BO0A 3NQJB 4ZBJC 3AFAD 3WTPD 3X1TA 3AV1A 2F8NK 3WKJD 3REKA 2NZDC 1P3MC 5BS7C 5B0ZA 1P3AC 3UTAB 3UTAA 4EO5B 2IO5B 5B2ID 5B40C 3H0LC 1BFMA 5CPJB 5CPJA 1PZRA 5DNNB 3REJD 5CHLB 1P3FB 4LD9C 3UT9A 4XUJC 4JJND 2Y2HA 3W99C 3V9RA 3AZIC 3AZED 1AOIB 4NFTA 3W98C 1R4VA 1W2EA 2HIOA 4UUZB 4UUZA 1P3GD 3R45A 1KX3C 5AV6D 1P34D 5F99C 2G5IC 3X1SC 4H9PB 5GXQC 4Z5TB 2Y2MA 4Z5TA 1S32D 1M1AA 3EPLA 3RELD 5CPKD 3A1KA 1EQZA 4UPKA 5CP6D 5JRGD 3AFAA 3WKJA 4H9RB 4H9RA 5FUGA 2FJ7C 4Z2MH 1F66B 2NQBD 3X1VD 3KUYC 4Z66B 5B2IB 5B2IA 1M19C 3MNNC 3REJB 4X23C 3REJA 3O62D 1JFIA 2JSSA 4JJNB 4JJNA 2PYOD 5AV8B 3TU4D 3KSYA 5AV5D 3AZEA 4DRAA 3FDDA 3C1BA 3C1BB 5B1MB 4J8XC 4G92B 3REID 4WU9D 4H9OA 2BYKA 1P3GA 5B31C 3LZ1D 4H9SA 1P34B 1P34A 3VH6T 4YM6C 3AZGC 1ID3C 1H3OB 1H3OA 3MGSC 5CPIB 5CPIA 4KGCC 3LZ0C 3EG5B 3EPJA 5B2JC 1S32B 1T3UA 2Y2JA 3MGRC 1S32A 3RELA 5CPKB 5CPKA 4KUDB 4DRBA 5CP6A 3C1CC 3AZLC 1F1EA 2L5AA 5GT0B 5JRGB 5JRGA 2NZDB 3B6GD 4J8VD 2Y2LA 3X1UD 1P3OC 3B0DC 4QLCC 3X1VA 5B0YC 3X1VB 2CV5D 2Y2NA 4LD9B 3O62A 3X1TC 5GSUC 3B6FD 4NE6A 1U35B 2PYOA 3TU4B 3TU4A 5AV5B 5AV5A 1BH9B 4CSRB 4CSRA 5B1LC 3WA9C 3MVDC 3KWQC 5AY8D 3WAAD 5E5AD 4YS3D 1P3KD 4WU9B 4WU9A 2AROC 3B0CW 5DNMD 2HIOC 3UTAD 4R8PC 5AVBC 5CPJD 5DNND 2CWEA 4WZSB 1P3FD 4E45A 3AYWD 1HQ3D 3IP4C 3A6ND 1AOID 3B6GA 3B6GB 3X1UB 5B31G 3X1UA 1M19B 5B24C 3EPHA 2CV5A 4CAYA 5B32C 3AFAC 3WTPC 4WV4B 3B6FB 3B6FA 5KDMB 5KDMA 3WKJC 5AV9D 1WWSA 3VH5W 5E5AB 5E5AA 4YS3A 4YS3B 1P3KB 1P3KA 4Z2MG 2Y2QA 3NQJA 2HUEB 4YM6B 2JE5A 2VQRA 3MGSB 2JCHA 3MGQB 3MGQA 3LZ0B 1KX4C 3VH6A 3MGPD 1B67A 5DNMB 5DNMA 1F66D 3LELB 4Z66D 1TZYB 1TZYA 2YFWB 2YFWA 3AV2D 1P3GC 3AL0C 5DNNA 5AV6C 1P3FA 4WU8C 3AYWB 3AYWA 4XZQB 5AV8D 1HQ3B 1HQ3A 3A6NB 3A6NA 1AOIA 3C1BD 5AVCC 5B1MD 3RELC 1P3PD 3UTBD 3AZFD 1P3LD 2BYMB 2BYMA 2YFVA 2YFVB 4J8WD 1P3IC 3AN2B 3AN2A 5AV9B 4H9PA 5AV9A 5B33C 5CPID 3WA9B 2NQBC 5B1LB 4G91B 1P3BC 3KWQB 1B6WA 3W96D 4KUDD 3LJAC 3AZMC 3AZNC 5GT0D 3B0BA 2RIQA 2NZDD 2F8NH 3KXBC 5C3IC 3MGPB 3MGPA 1P3AD 1KX5C 5B32G 1F66A 5B40D 4J8UC 3REIC 4Z66A 1Q9CA 4H9NB 4H9NA 3AV2B 3AV2A 1M18C 3LZ1C 4LD9D 4HGAC 3W99D 1U35D 5AV8A 1BH8B 1BH8A 3W98D 5B1MA 4AWLC 3W97B 1A7WA 2ZY4A 1P3PB 1P3PA 4WNNB 3AZHC 3UTBB 3UTBA 1KX3D 3AZFB 3AZFA 5B32B 1P3LB 1P3LA 5GT3C 2BG1A 5F99D 3VH5A 4J8WB 4J8WA 4J8VC 3H0RC 3AZJB 1ZLAC 3W96B 3W96A 4KUDA 3VH6W 4ZBJB 3AZKC 2FFFB 5BNXB 5BNXA 5GT0A 3REHC 2FJ7D 1P3MB 1P3MA 5BT1D 5BS7A 4ZUXC 2NZDA 1P3AB 1P3AA 5AY8C 3WAAC 5B40B 5B40A 2Y2IA 1M19D 3KFUG 4LD9A 3AV1C 4XUJB 1WWIA 3REKC 3W99B 3W99A 1U35A 4NE3A 3AZIA 2UWXA 3AZIB 5AVCB 5B0ZC 3UTAC 1BH9A 4EO5C 3W98B 3W98A 2IO5C 4J8XD 4NE5A 5CPJC 1TAFB 1P3FC 1KX3B 1KX3A 5B31D 3UT9C 5F99B 5F99A 4YM6D 3X1SB 3AZGD 5B33B 5GXQB 3MGSD 1ID3D 4WJ3C 3MGQD 4KGCD 3LZ0D 5JA4B 5JA4A 1HTAA 3LELD 1TZYD 3LJAB 3C1CD 3AZNB 3AZMB 4XZQD 4Z5TC 3KXBB 2FJ7B 2FJ7A 1P3OD 3EPKA 3P5JB 1M1AC 4J8UB 3KUYB 3MNNB 3MNNA 1M19A 1EQZC 4X23B 5GSUD 3AN2D 1KU5A 3WA9D 5B1LD 3MVDD 4AWLB 3KWQD 5B2IC 4Z66C 4J8XB 4J8XA 3REJC 3A1IA 5B31B 5B31A 3AZGB 4JJNC 4YM6A 3AZGA 1ID3B 1ID3A 2AROD 3MGSA 4H9QB 3AZEC 3C1BC 4KGCB 5G49B 4KGCA 3LZ0A 5B1MC 5B2JB 4R8PD 3MGRB 2LY8A 4G92C 3LELA 5AVBD 4H9SC 3WTPE 3C1CA 3C1CB 3AZLB 3AZLA 1P34C 2Y2PA 4XZQA 5CPIC 4ZUXB 2W8SA 1S32C 1P3OB 1P3OA 3B0DB 2RVQD 4QLCB 2XD5A 5B0YA 5B0YB 5B24D 5CPKC 3W97D 4KUDC 2ZY2A 5CP6C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5B32 D;  3X1T B;  3AV1 B;  5GSU B;  5GSU A;  5GT0 C;  5JRG C;  1ULY A;  4E44 A;  3REK B;  5B0Z B;  3AZJ D;  3WA9 A;  5B1L A;  3MVD B;  3MVD A;  3X1V C;  3KWQ A;  4KHA B;  4KHA A;  3O62 C;  3UT9 B;  2PYO C;  1U35 C;  3V9R B;  2ARO B;  2ARO A;  3TU4 C;  1KX4 D;  5AV5 C;  1P3M D;  2HIO B;  5BNV B;  5BNV A;  4R8P B;  4R8P A;  3R45 B;  5AVB B;  5AVB A;  4WU9 C;  4WU8 D;  4XUJ D;  3AZI D;  5AVC D;  1M1A B;  4M6B A;  3W97 A;  5B24 B;  5B24 A;  1EQZ B;  4WNN A;  3AFA B;  5B32 A;  3WTP B;  3WTP A;  1P3I D;  3WKJ B;  3X1S D;  5FUG B;  5B33 D;  5GXQ D;  3B6G C;  5BT1 C;  3AZJ A;  1P3B D;  3X1U C;  2CV5 C;  1JFI B;  3LJA D;  3AZM D;  3AZN D;  3B6F C;  3NQU B;  3NQU A;  3AZE B;  3KXB D;  1KX4 A;  1KX4 B;  1KX5 D;  4J8U D;  5E5A C;  4YS3 C;  3KUY D;  4H9O B;  2BYK B;  1P3G B;  1P3K C;  3MNN D;  1M18 D;  4X23 D;  5AV6 B;  5AV6 A;  2HUE C;  4WU8 B;  4WU8 A;  4XUJ A;  3MGQ C;  5DNM C;  5AVC A;  3REL B;  3LEL C;  1TZY C;  3AZH D;  5CP6 B;  1TAF A;  5DNN C;  5GT3 D;  3AYW C;  4XZQ C;  1P3I A;  1P3I B;  3X1S A;  1HQ3 C;  5B33 A;  5GXQ A;  3A6N C;  1AOI C;  2NQB B;  2NQB A;  1P3B B;  1P3B A;  5B2J D;  1ZLA D;  3MGR D;  3O62 B;  3LJA A;  3AZM A;  3AZN A;  3AZK D;  3AZL D;  2PYO B;  3AN2 C;  5AV9 C;  2F8N D;  3REH D;  4ZUX D;  5C3I B;  3KXB A;  4G91 C;  1KX5 B;  3B0C T;  1KX5 A;  1N1J B;  1N1J A;  4QLC D;  3REI B;  4J8U A;  5B0Y D;  3KUY A;  3REI A;  1M18 B;  1M18 A;  3LZ1 B;  4X23 A;  3LZ1 A;  3X1T D;  3AV1 D;  3REK D;  4HGA B;  5B0Z D;  3MGP C;  1F66 C;  3AV2 C;  3AZH B;  3AZH A;  2F8N G;  3UT9 D;  5GT3 B;  5GT3 A;  5AV8 C;  4J8V B;  4J8V A;  4H9Q A;  5G49 A;  2HIO D;  3W97 C;  2RVQ C;  5B2J A;  1ZLA B;  1ZLA A;  3MGR A;  3VH5 T;  1P3P C;  2CV5 B;  3UTB C;  4CAY B;  3AZF C;  1P3L C;  4J8W C;  3AZK B;  3AZK A;  4Z5T D;  2F8N B;  3REH B;  3REH A;  2F8N A;  3AZJ C;  4ZUX A;  1M1A D;  5AY8 B;  5AY8 A;  3WAA B;  3WAA A;  4QLC A;  3W96 C;  1EQZ D;  5BO0 B;  5BO0 A;  3NQJ B;  4ZBJ C;  3AFA D;  3WTP D;  3X1T A;  3AV1 A;  2F8N K;  3WKJ D;  3REK A;  2NZD C;  1P3M C;  5BS7 C;  5B0Z A;  1P3A C;  3UTA B;  3UTA A;  4EO5 B;  2IO5 B;  5B2I D;  5B40 C;  1BFM A;  5CPJ B;  5CPJ A;  3REJ D;  5DNN B;  5CHL B;  1P3F B;  4LD9 C;  3UT9 A;  4XUJ C;  4JJN D;  3W99 C;  3V9R A;  3AZI C;  3AZE D;  1AOI B;  4NFT A;  3W98 C;  1R4V A;  2HIO A;  4UUZ B;  4UUZ A;  1P3G D;  3R45 A;  1KX3 C;  5AV6 D;  1P34 D;  5F99 C;  3X1S C;  4H9P B;  5GXQ C;  4Z5T B;  4Z5T A;  1S32 D;  1M1A A;  3REL D;  5CPK D;  1EQZ A;  5CP6 D;  5JRG D;  3AFA A;  3WKJ A;  4H9R B;  4H9R A;  5FUG A;  2FJ7 C;  4Z2M H;  1F66 B;  2NQB D;  3X1V D;  3KUY C;  4Z66 B;  5B2I B;  5B2I A;  1M19 C;  3MNN C;  3REJ B;  4X23 C;  3REJ A;  3O62 D;  1JFI A;  2JSS A;  4JJN B;  4JJN A;  2PYO D;  5AV8 B;  3TU4 D;  3KSY A;  5AV5 D;  3AZE A;  4DRA A;  3C1B A;  3C1B B;  5B1M B;  4J8X C;  4G92 B;  3REI D;  4WU9 D;  4H9O A;  2BYK A;  1P3G A;  5B31 C;  3LZ1 D;  4H9S A;  1P34 B;  1P34 A;  3VH6 T;  4YM6 C;  3AZG C;  1ID3 C;  1H3O B;  1H3O A;  3MGS C;  5CPI B;  5CPI A;  4KGC C;  3LZ0 C;  5B2J C;  1S32 B;  1S32 A;  3MGR C;  3REL A;  5CPK B;  5CPK A;  4KUD B;  4DRB A;  5CP6 A;  3C1C C;  3AZL C;  1F1E A;  2L5A A;  5GT0 B;  5JRG B;  5JRG A;  2NZD B;  3B6G D;  4J8V D;  3X1U D;  1P3O C;  3B0D C;  4QLC C;  3X1V A;  5B0Y C;  3X1V B;  2CV5 D;  4LD9 B;  3O62 A;  3X1T C;  5GSU C;  3B6F D;  4NE6 A;  1U35 B;  2PYO A;  3TU4 B;  3TU4 A;  5AV5 B;  5AV5 A;  1BH9 B;  4CSR B;  4CSR A;  5B1L C;  3WA9 C;  3MVD C;  3KWQ C;  5AY8 D;  3WAA D;  5E5A D;  4YS3 D;  1P3K D;  4WU9 B;  4WU9 A;  2ARO C;  3B0C W;  5DNM D;  2HIO C;  3UTA D;  4R8P C;  5AVB C;  5CPJ D;  5DNN D;  2CWE A;  4WZS B;  1P3F D;  4E45 A;  3AYW D;  1HQ3 D;  3B6G B;  3A6N D;  1AOI D;  3B6G A;  3X1U B;  5B31 G;  3X1U A;  1M19 B;  5B24 C;  2CV5 A;  4CAY A;  5B32 C;  3AFA C;  3WTP C;  4WV4 B;  3B6F B;  3B6F A;  5KDM B;  5KDM A;  3WKJ C;  5AV9 D;  1WWS A;  3VH5 W;  5E5A B;  5E5A A;  4YS3 A;  4YS3 B;  1P3K B;  1P3K A;  4Z2M G;  3NQJ A;  2HUE B;  4YM6 B;  3MGS B;  3MGQ B;  3MGQ A;  3LZ0 B;  1KX4 C;  3VH6 A;  3MGP D;  1B67 A;  5DNM B;  5DNM A;  1F66 D;  3LEL B;  4Z66 D;  1TZY B;  1TZY A;  2YFW B;  2YFW A;  3AV2 D;  1P3G C;  5DNN A;  5AV6 C;  1P3F A;  4WU8 C;  3AYW B;  3AYW A;  4XZQ B;  5AV8 D;  1HQ3 B;  1HQ3 A;  3A6N B;  3A6N A;  1AOI A;  3C1B D;  5AVC C;  5B1M D;  3REL C;  1P3P D;  3UTB D;  3AZF D;  1P3L D;  2BYM B;  2BYM A;  2YFV A;  2YFV B;  4J8W D;  1P3I C;  3AN2 B;  3AN2 A;  5AV9 B;  4H9P A;  5AV9 A;  5B33 C;  5CPI D;  3WA9 B;  2NQB C;  5B1L B;  4G91 B;  1P3B C;  3KWQ B;  1B6W A;  3W96 D;  4KUD D;  3LJA C;  3AZM C;  3AZN C;  5GT0 D;  3B0B A;  2NZD D;  2F8N H;  3KXB C;  5C3I C;  3MGP B;  3MGP A;  1P3A D;  1KX5 C;  5B32 G;  1F66 A;  5B40 D;  4J8U C;  3REI C;  4Z66 A;  1Q9C A;  4H9N B;  4H9N A;  3AV2 B;  3AV2 A;  1M18 C;  3LZ1 C;  4LD9 D;  4HGA C;  3W99 D;  1U35 D;  5AV8 A;  1BH8 B;  1BH8 A;  3W98 D;  5B1M A;  4AWL C;  3W97 B;  1A7W A;  1P3P B;  1P3P A;  4WNN B;  3AZH C;  3UTB B;  3UTB A;  1KX3 D;  3AZF B;  3AZF A;  5B32 B;  1P3L B;  1P3L A;  5GT3 C;  5F99 D;  3VH5 A;  4J8W B;  4J8W A;  4J8V C;  3AZJ B;  1ZLA C;  3W96 B;  3W96 A;  4KUD A;  3VH6 W;  4ZBJ B;  3AZK C;  5BNX B;  5BNX A;  5GT0 A;  3REH C;  2FJ7 D;  1P3M B;  1P3M A;  5BT1 D;  5BS7 A;  4ZUX C;  2NZD A;  1P3A B;  1P3A A;  5AY8 C;  3WAA C;  5B40 B;  5B40 A;  1M19 D;  4LD9 A;  3AV1 C;  4XUJ B;  1WWI A;  3REK C;  3W99 B;  3W99 A;  1U35 A;  4NE3 A;  3AZI A;  3AZI B;  5AVC B;  5B0Z C;  3UTA C;  1BH9 A;  4EO5 C;  3W98 B;  3W98 A;  2IO5 C;  4J8X D;  4NE5 A;  5CPJ C;  1TAF B;  1P3F C;  1KX3 B;  1KX3 A;  5B31 D;  3UT9 C;  5F99 B;  5F99 A;  4YM6 D;  3X1S B;  3AZG D;  5B33 B;  5GXQ B;  3MGS D;  1ID3 D;  3MGQ D;  4KGC D;  3LZ0 D;  5JA4 B;  5JA4 A;  1HTA A;  3LEL D;  1TZY D;  3LJA B;  3C1C D;  3AZN B;  3AZM B;  4XZQ D;  4Z5T C;  3KXB B;  2FJ7 B;  2FJ7 A;  1P3O D;  1M1A C;  4J8U B;  3KUY B;  3MNN B;  3MNN A;  1M19 A;  1EQZ C;  4X23 B;  5GSU D;  3AN2 D;  1KU5 A;  3WA9 D;  5B1L D;  3MVD D;  4AWL B;  3KWQ D;  5B2I C;  4Z66 C;  4J8X B;  4J8X A;  3REJ C;  5B31 B;  5B31 A;  3AZG B;  4JJN C;  4YM6 A;  3AZG A;  1ID3 B;  1ID3 A;  2ARO D;  3MGS A;  4H9Q B;  3AZE C;  3C1B C;  4KGC B;  5G49 B;  4KGC A;  3LZ0 A;  5B1M C;  5B2J B;  4R8P D;  3MGR B;  2LY8 A;  4G92 C;  3LEL A;  5AVB D;  4H9S C;  3WTP E;  3C1C A;  3C1C B;  3AZL B;  3AZL A;  1P34 C;  4XZQ A;  5CPI C;  4ZUX B;  1S32 C;  1P3O B;  1P3O A;  3B0D B;  2RVQ D;  4QLC B;  5B0Y B;  5B0Y A;  5CPK C;  5B24 D;  3W97 D;  4KUD C;  5CP6 C; 
#chains in the Genus database with same CATH topology
 5B32 D;  3X1T B;  3AV1 B;  5GSU B;  5GSU A;  5GT0 C;  5JRG C;  1ULY A;  4E44 A;  3REK B;  5B0Z B;  3AZJ D;  3WA9 A;  5B1L A;  3MVD B;  3MVD A;  3X1V C;  3KWQ A;  4KHA B;  4KHA A;  3O62 C;  3UT9 B;  2Y2K A;  2PYO C;  1U35 C;  3V9R B;  2ARO B;  2ARO A;  3TU4 C;  1KX4 D;  5AV5 C;  1P3M D;  3H0M C;  2HIO B;  5BNV B;  5BNV A;  4R8P B;  4R8P A;  3R45 B;  5AVB B;  5AVB A;  4WU9 C;  2G5H C;  4WU8 D;  2XD1 A;  2ZY5 A;  4XUJ D;  3AZI D;  5AVC D;  2J8P A;  1M1A B;  4M6B A;  3W97 A;  5B24 B;  5B24 A;  1EQZ B;  4WNN A;  3AFA B;  5B32 A;  3WTP B;  3F6T A;  3WTP A;  1P3I D;  3WKJ B;  3X1S D;  5FUG B;  5B33 D;  5GXQ D;  3B6G C;  5BT1 C;  3AZJ A;  1P3B D;  3X1U C;  2CV5 C;  1JFI B;  3LJA D;  3AZM D;  3AZN D;  3B6F C;  3NQU B;  3NQU A;  3AZE B;  3KXB D;  1KX4 A;  1KX4 B;  2ZY3 A;  1KX5 D;  4J8U D;  5E5A C;  4YS3 C;  3KUY D;  4H9O B;  2BYK B;  1P3G B;  1P3K C;  3MNN D;  1M18 D;  4X23 D;  5AV6 B;  5AV6 A;  2HUE C;  4WU8 B;  4WU8 A;  4XUJ A;  3MGQ C;  2Y2G A;  5DNM C;  5AVC A;  4DQY B;  3REL B;  3LEL C;  1TZY C;  3AZH D;  5CP6 B;  1TAF A;  5DNN C;  5GT3 D;  3AYW C;  4XZQ C;  1P3I A;  1P3I B;  2DQN C;  3X1S A;  1HQ3 C;  5B33 A;  5GXQ A;  2DF4 C;  3A6N C;  1AOI C;  2NQB B;  2NQB A;  1P3B B;  1P3B A;  5B2J D;  1ZLA D;  3MGR D;  3O62 B;  3LJA A;  3AZM A;  3AZN A;  3AZK D;  3AZL D;  2PYO B;  3AN2 C;  5AV9 C;  2F8N D;  3REH D;  4ZUX D;  5C3I B;  3KXB A;  4G91 C;  1KX5 B;  3B0C T;  1KX5 A;  1N1J B;  1N1J A;  4QLC D;  3REI B;  4J8U A;  5B0Y D;  3KUY A;  3REI A;  1M18 B;  1M18 A;  3LZ1 B;  4X23 A;  3LZ1 A;  2ZM5 A;  3X1T D;  3AV1 D;  2Y2O A;  4HGA B;  3REK D;  5B0Z D;  3MGP C;  1F66 C;  2F2A C;  3AV2 C;  1Z2C B;  3AZH B;  3AZH A;  2F8N G;  3UT9 D;  5GT3 B;  5GT3 A;  5AV8 C;  4J8V B;  4J8V A;  4H9Q A;  5G49 A;  2HIO D;  3W97 C;  2RVQ C;  5B2J A;  1ZLA B;  1ZLA A;  3MGR A;  3VH5 T;  1P3P C;  2CV5 B;  3UTB C;  4CAY B;  3AZF C;  1P3L C;  4J8W C;  3AZK B;  3AZK A;  4Z5T D;  2F8N B;  3REH B;  3REH A;  2F8N A;  3AZJ C;  4ZUX A;  1M1A D;  5AY8 B;  5AY8 A;  3WAA B;  3WAA A;  4QLC A;  3W96 C;  1EQZ D;  5BO0 B;  5BO0 A;  3NQJ B;  4ZBJ C;  3AFA D;  3WTP D;  3X1T A;  3AV1 A;  2F8N K;  3WKJ D;  3REK A;  2NZD C;  1P3M C;  5BS7 C;  5B0Z A;  1P3A C;  3UTA B;  3UTA A;  4EO5 B;  2IO5 B;  5B2I D;  5B40 C;  3H0L C;  1BFM A;  5CPJ B;  5CPJ A;  1PZR A;  5DNN B;  3REJ D;  5CHL B;  1P3F B;  4LD9 C;  3UT9 A;  4XUJ C;  4JJN D;  2Y2H A;  3W99 C;  3V9R A;  3AZI C;  3AZE D;  1AOI B;  4NFT A;  3W98 C;  1R4V A;  1W2E A;  2HIO A;  4UUZ B;  4UUZ A;  1P3G D;  3R45 A;  1KX3 C;  5AV6 D;  1P34 D;  5F99 C;  2G5I C;  3X1S C;  4H9P B;  5GXQ C;  4Z5T B;  2Y2M A;  4Z5T A;  1S32 D;  1M1A A;  3EPL A;  3REL D;  5CPK D;  3A1K A;  1EQZ A;  4UPK A;  5CP6 D;  5JRG D;  3AFA A;  3WKJ A;  4H9R B;  4H9R A;  5FUG A;  2FJ7 C;  4Z2M H;  1F66 B;  2NQB D;  3X1V D;  3KUY C;  4Z66 B;  5B2I B;  5B2I A;  1M19 C;  3MNN C;  3REJ B;  4X23 C;  3REJ A;  3O62 D;  1JFI A;  2JSS A;  4JJN B;  4JJN A;  2PYO D;  5AV8 B;  3TU4 D;  3KSY A;  5AV5 D;  3AZE A;  4DRA A;  3FDD A;  3C1B A;  3C1B B;  5B1M B;  4J8X C;  4G92 B;  3REI D;  4WU9 D;  4H9O A;  2BYK A;  1P3G A;  5B31 C;  3LZ1 D;  4H9S A;  1P34 B;  1P34 A;  3VH6 T;  4YM6 C;  3AZG C;  1ID3 C;  1H3O B;  1H3O A;  3MGS C;  5CPI B;  5CPI A;  4KGC C;  3LZ0 C;  3EG5 B;  3EPJ A;  5B2J C;  1S32 B;  1T3U A;  2Y2J A;  3MGR C;  1S32 A;  3REL A;  5CPK B;  5CPK A;  4KUD B;  4DRB A;  5CP6 A;  3C1C C;  3AZL C;  1F1E A;  2L5A A;  5GT0 B;  5JRG B;  5JRG A;  2NZD B;  3B6G D;  4J8V D;  2Y2L A;  3X1U D;  1P3O C;  3B0D C;  4QLC C;  3X1V A;  5B0Y C;  3X1V B;  2CV5 D;  2Y2N A;  4LD9 B;  3O62 A;  3X1T C;  5GSU C;  3B6F D;  4NE6 A;  1U35 B;  2PYO A;  3TU4 B;  3TU4 A;  5AV5 B;  5AV5 A;  1BH9 B;  4CSR B;  4CSR A;  5B1L C;  3WA9 C;  3MVD C;  3KWQ C;  5AY8 D;  3WAA D;  5E5A D;  4YS3 D;  1P3K D;  4WU9 B;  4WU9 A;  2ARO C;  3B0C W;  5DNM D;  2HIO C;  3UTA D;  4R8P C;  5AVB C;  5CPJ D;  5DNN D;  2CWE A;  4WZS B;  1P3F D;  4E45 A;  3AYW D;  1HQ3 D;  3IP4 C;  3A6N D;  1AOI D;  3B6G A;  3B6G B;  3X1U B;  5B31 G;  3X1U A;  1M19 B;  5B24 C;  3EPH A;  2CV5 A;  4CAY A;  5B32 C;  3AFA C;  3WTP C;  4WV4 B;  3B6F B;  3B6F A;  5KDM B;  5KDM A;  3WKJ C;  5AV9 D;  1WWS A;  3VH5 W;  5E5A B;  5E5A A;  4YS3 A;  4YS3 B;  1P3K B;  1P3K A;  4Z2M G;  2Y2Q A;  3NQJ A;  2HUE B;  4YM6 B;  2JE5 A;  2VQR A;  3MGS B;  2JCH A;  3MGQ B;  3MGQ A;  3LZ0 B;  1KX4 C;  3VH6 A;  3MGP D;  1B67 A;  5DNM B;  5DNM A;  1F66 D;  3LEL B;  4Z66 D;  1TZY B;  1TZY A;  2YFW B;  2YFW A;  3AV2 D;  1P3G C;  3AL0 C;  5DNN A;  5AV6 C;  1P3F A;  4WU8 C;  3AYW B;  3AYW A;  4XZQ B;  5AV8 D;  1HQ3 B;  1HQ3 A;  3A6N B;  3A6N A;  1AOI A;  3C1B D;  5AVC C;  5B1M D;  3REL C;  1P3P D;  3UTB D;  3AZF D;  1P3L D;  2BYM B;  2BYM A;  2YFV A;  2YFV B;  4J8W D;  1P3I C;  3AN2 B;  3AN2 A;  5AV9 B;  4H9P A;  5AV9 A;  5B33 C;  5CPI D;  3WA9 B;  2NQB C;  5B1L B;  4G91 B;  1P3B C;  3KWQ B;  1B6W A;  3W96 D;  4KUD D;  3LJA C;  3AZM C;  3AZN C;  5GT0 D;  3B0B A;  2RIQ A;  2NZD D;  2F8N H;  3KXB C;  5C3I C;  3MGP B;  3MGP A;  1P3A D;  1KX5 C;  5B32 G;  1F66 A;  5B40 D;  4J8U C;  3REI C;  4Z66 A;  1Q9C A;  4H9N B;  4H9N A;  3AV2 B;  3AV2 A;  1M18 C;  3LZ1 C;  4LD9 D;  4HGA C;  3W99 D;  1U35 D;  5AV8 A;  1BH8 B;  1BH8 A;  3W98 D;  5B1M A;  4AWL C;  3W97 B;  1A7W A;  2ZY4 A;  1P3P B;  1P3P A;  4WNN B;  3AZH C;  3UTB B;  3UTB A;  1KX3 D;  3AZF B;  3AZF A;  5B32 B;  1P3L B;  1P3L A;  5GT3 C;  2BG1 A;  5F99 D;  3VH5 A;  4J8W B;  4J8W A;  4J8V C;  3H0R C;  3AZJ B;  1ZLA C;  3W96 B;  3W96 A;  4KUD A;  3VH6 W;  4ZBJ B;  3AZK C;  2FFF B;  5BNX B;  5BNX A;  5GT0 A;  3REH C;  2FJ7 D;  1P3M B;  1P3M A;  5BT1 D;  5BS7 A;  4ZUX C;  2NZD A;  1P3A B;  1P3A A;  5AY8 C;  3WAA C;  5B40 B;  5B40 A;  2Y2I A;  1M19 D;  3KFU G;  4LD9 A;  3AV1 C;  4XUJ B;  1WWI A;  3REK C;  3W99 B;  3W99 A;  1U35 A;  4NE3 A;  3AZI A;  2UWX A;  3AZI B;  5AVC B;  5B0Z C;  3UTA C;  1BH9 A;  4EO5 C;  3W98 B;  3W98 A;  2IO5 C;  4J8X D;  4NE5 A;  5CPJ C;  1TAF B;  1P3F C;  1KX3 B;  1KX3 A;  5B31 D;  3UT9 C;  5F99 B;  5F99 A;  4YM6 D;  3X1S B;  3AZG D;  5B33 B;  5GXQ B;  3MGS D;  1ID3 D;  4WJ3 C;  3MGQ D;  4KGC D;  3LZ0 D;  5JA4 B;  5JA4 A;  1HTA A;  3LEL D;  1TZY D;  3LJA B;  3C1C D;  3AZN B;  3AZM B;  4XZQ D;  4Z5T C;  3KXB B;  2FJ7 B;  2FJ7 A;  1P3O D;  3EPK A;  3P5J B;  1M1A C;  4J8U B;  3KUY B;  3MNN B;  3MNN A;  1M19 A;  1EQZ C;  4X23 B;  5GSU D;  3AN2 D;  1KU5 A;  3WA9 D;  5B1L D;  3MVD D;  4AWL B;  3KWQ D;  5B2I C;  4Z66 C;  4J8X B;  4J8X A;  3REJ C;  3A1I A;  5B31 B;  5B31 A;  3AZG B;  4JJN C;  4YM6 A;  3AZG A;  1ID3 B;  1ID3 A;  2ARO D;  3MGS A;  4H9Q B;  3AZE C;  3C1B C;  4KGC B;  5G49 B;  4KGC A;  3LZ0 A;  5B1M C;  5B2J B;  4R8P D;  3MGR B;  2LY8 A;  4G92 C;  3LEL A;  5AVB D;  4H9S C;  3WTP E;  3C1C A;  3C1C B;  3AZL B;  3AZL A;  1P34 C;  2Y2P A;  4XZQ A;  5CPI C;  4ZUX B;  2W8S A;  1S32 C;  1P3O B;  1P3O A;  3B0D B;  2RVQ D;  4QLC B;  2XD5 A;  5B0Y A;  5B0Y B;  5B24 D;  5CPK C;  3W97 D;  4KUD C;  2ZY2 A;  5CP6 C; 
#chains in the Genus database with same CATH homology
 5B32 D;  3X1T B;  3AV1 B;  5GSU B;  5GSU A;  5GT0 C;  5JRG C;  1ULY A;  4E44 A;  3REK B;  5B0Z B;  3AZJ D;  3WA9 A;  5B1L A;  3MVD B;  3MVD A;  3X1V C;  3KWQ A;  4KHA B;  4KHA A;  3O62 C;  3UT9 B;  2Y2K A;  2PYO C;  1U35 C;  3V9R B;  2ARO B;  2ARO A;  3TU4 C;  1KX4 D;  5AV5 C;  1P3M D;  3H0M C;  2HIO B;  5BNV B;  5BNV A;  4R8P B;  4R8P A;  3R45 B;  5AVB B;  5AVB A;  4WU9 C;  2G5H C;  4WU8 D;  2XD1 A;  2ZY5 A;  4XUJ D;  3AZI D;  5AVC D;  2J8P A;  1M1A B;  4M6B A;  3W97 A;  5B24 B;  5B24 A;  1EQZ B;  4WNN A;  3AFA B;  5B32 A;  3WTP B;  3F6T A;  3WTP A;  1P3I D;  3WKJ B;  3X1S D;  5FUG B;  5B33 D;  5GXQ D;  3B6G C;  5BT1 C;  3AZJ A;  1P3B D;  3X1U C;  2CV5 C;  1JFI B;  3LJA D;  3AZM D;  3AZN D;  3B6F C;  3NQU B;  3NQU A;  3AZE B;  3KXB D;  1KX4 A;  1KX4 B;  2ZY3 A;  1KX5 D;  4J8U D;  5E5A C;  4YS3 C;  3KUY D;  4H9O B;  2BYK B;  1P3G B;  1P3K C;  3MNN D;  1M18 D;  4X23 D;  5AV6 B;  5AV6 A;  2HUE C;  4WU8 B;  4WU8 A;  4XUJ A;  3MGQ C;  2Y2G A;  5DNM C;  5AVC A;  4DQY B;  3REL B;  3LEL C;  1TZY C;  3AZH D;  5CP6 B;  1TAF A;  5DNN C;  5GT3 D;  3AYW C;  4XZQ C;  1P3I A;  1P3I B;  2DQN C;  3X1S A;  1HQ3 C;  5B33 A;  5GXQ A;  2DF4 C;  3A6N C;  1AOI C;  2NQB B;  2NQB A;  1P3B B;  1P3B A;  5B2J D;  1ZLA D;  3MGR D;  3O62 B;  3LJA A;  3AZM A;  3AZN A;  3AZK D;  3AZL D;  2PYO B;  3AN2 C;  5AV9 C;  2F8N D;  3REH D;  4ZUX D;  5C3I B;  3KXB A;  4G91 C;  1KX5 B;  3B0C T;  1KX5 A;  1N1J B;  1N1J A;  4QLC D;  3REI B;  4J8U A;  5B0Y D;  3KUY A;  3REI A;  1M18 B;  1M18 A;  3LZ1 B;  4X23 A;  3LZ1 A;  2ZM5 A;  3X1T D;  3AV1 D;  2Y2O A;  4HGA B;  3REK D;  5B0Z D;  3MGP C;  1F66 C;  2F2A C;  3AV2 C;  1Z2C B;  3AZH B;  3AZH A;  2F8N G;  3UT9 D;  5GT3 B;  5GT3 A;  5AV8 C;  4J8V B;  4J8V A;  4H9Q A;  5G49 A;  2HIO D;  3W97 C;  2RVQ C;  5B2J A;  1ZLA B;  1ZLA A;  3MGR A;  3VH5 T;  1P3P C;  2CV5 B;  3UTB C;  4CAY B;  3AZF C;  1P3L C;  4J8W C;  3AZK B;  3AZK A;  4Z5T D;  2F8N B;  3REH B;  3REH A;  2F8N A;  3AZJ C;  4ZUX A;  1M1A D;  5AY8 B;  5AY8 A;  3WAA B;  3WAA A;  4QLC A;  3W96 C;  1EQZ D;  5BO0 B;  5BO0 A;  3NQJ B;  4ZBJ C;  3AFA D;  3WTP D;  3X1T A;  3AV1 A;  2F8N K;  3WKJ D;  3REK A;  2NZD C;  1P3M C;  5BS7 C;  5B0Z A;  1P3A C;  3UTA B;  3UTA A;  4EO5 B;  2IO5 B;  5B2I D;  5B40 C;  3H0L C;  1BFM A;  5CPJ B;  5CPJ A;  1PZR A;  5DNN B;  3REJ D;  5CHL B;  1P3F B;  4LD9 C;  3UT9 A;  4XUJ C;  4JJN D;  2Y2H A;  3W99 C;  3V9R A;  3AZI C;  3AZE D;  1AOI B;  4NFT A;  3W98 C;  1R4V A;  1W2E A;  2HIO A;  4UUZ B;  4UUZ A;  1P3G D;  3R45 A;  1KX3 C;  5AV6 D;  1P34 D;  5F99 C;  2G5I C;  3X1S C;  4H9P B;  5GXQ C;  4Z5T B;  2Y2M A;  4Z5T A;  1S32 D;  1M1A A;  3EPL A;  3REL D;  5CPK D;  3A1K A;  1EQZ A;  4UPK A;  5CP6 D;  5JRG D;  3AFA A;  3WKJ A;  4H9R B;  4H9R A;  5FUG A;  2FJ7 C;  4Z2M H;  1F66 B;  2NQB D;  3X1V D;  3KUY C;  4Z66 B;  5B2I B;  5B2I A;  1M19 C;  3MNN C;  3REJ B;  4X23 C;  3REJ A;  3O62 D;  1JFI A;  2JSS A;  4JJN B;  4JJN A;  2PYO D;  5AV8 B;  3TU4 D;  3KSY A;  5AV5 D;  3AZE A;  4DRA A;  3FDD A;  3C1B A;  3C1B B;  5B1M B;  4J8X C;  4G92 B;  3REI D;  4WU9 D;  4H9O A;  2BYK A;  1P3G A;  5B31 C;  3LZ1 D;  4H9S A;  1P34 B;  1P34 A;  3VH6 T;  4YM6 C;  3AZG C;  1ID3 C;  1H3O B;  1H3O A;  3MGS C;  5CPI B;  5CPI A;  4KGC C;  3LZ0 C;  3EG5 B;  3EPJ A;  5B2J C;  1S32 B;  1T3U A;  2Y2J A;  3MGR C;  1S32 A;  3REL A;  5CPK B;  5CPK A;  4KUD B;  4DRB A;  5CP6 A;  3C1C C;  3AZL C;  1F1E A;  2L5A A;  5GT0 B;  5JRG B;  5JRG A;  2NZD B;  3B6G D;  4J8V D;  2Y2L A;  3X1U D;  1P3O C;  3B0D C;  4QLC C;  3X1V A;  5B0Y C;  3X1V B;  2CV5 D;  2Y2N A;  4LD9 B;  3O62 A;  3X1T C;  5GSU C;  3B6F D;  4NE6 A;  1U35 B;  2PYO A;  3TU4 B;  3TU4 A;  5AV5 B;  5AV5 A;  1BH9 B;  4CSR B;  4CSR A;  5B1L C;  3WA9 C;  3MVD C;  3KWQ C;  5AY8 D;  3WAA D;  5E5A D;  4YS3 D;  1P3K D;  4WU9 B;  4WU9 A;  2ARO C;  3B0C W;  5DNM D;  2HIO C;  3UTA D;  4R8P C;  5AVB C;  5CPJ D;  5DNN D;  2CWE A;  4WZS B;  1P3F D;  4E45 A;  3AYW D;  1HQ3 D;  3IP4 C;  3A6N D;  1AOI D;  3B6G A;  3B6G B;  3X1U B;  5B31 G;  3X1U A;  1M19 B;  5B24 C;  3EPH A;  2CV5 A;  4CAY A;  5B32 C;  3AFA C;  3WTP C;  4WV4 B;  3B6F B;  3B6F A;  5KDM B;  5KDM A;  3WKJ C;  5AV9 D;  1WWS A;  3VH5 W;  5E5A B;  5E5A A;  4YS3 A;  4YS3 B;  1P3K B;  1P3K A;  4Z2M G;  2Y2Q A;  3NQJ A;  2HUE B;  4YM6 B;  2JE5 A;  2VQR A;  3MGS B;  2JCH A;  3MGQ B;  3MGQ A;  3LZ0 B;  1KX4 C;  3VH6 A;  3MGP D;  1B67 A;  5DNM B;  5DNM A;  1F66 D;  3LEL B;  4Z66 D;  1TZY B;  1TZY A;  2YFW B;  2YFW A;  3AV2 D;  1P3G C;  3AL0 C;  5DNN A;  5AV6 C;  1P3F A;  4WU8 C;  3AYW B;  3AYW A;  4XZQ B;  5AV8 D;  1HQ3 B;  1HQ3 A;  3A6N B;  3A6N A;  1AOI A;  3C1B D;  5AVC C;  5B1M D;  3REL C;  1P3P D;  3UTB D;  3AZF D;  1P3L D;  2BYM B;  2BYM A;  2YFV A;  2YFV B;  4J8W D;  1P3I C;  3AN2 B;  3AN2 A;  5AV9 B;  4H9P A;  5AV9 A;  5B33 C;  5CPI D;  3WA9 B;  2NQB C;  5B1L B;  4G91 B;  1P3B C;  3KWQ B;  1B6W A;  3W96 D;  4KUD D;  3LJA C;  3AZM C;  3AZN C;  5GT0 D;  3B0B A;  2RIQ A;  2NZD D;  2F8N H;  3KXB C;  5C3I C;  3MGP B;  3MGP A;  1P3A D;  1KX5 C;  5B32 G;  1F66 A;  5B40 D;  4J8U C;  3REI C;  4Z66 A;  1Q9C A;  4H9N B;  4H9N A;  3AV2 B;  3AV2 A;  1M18 C;  3LZ1 C;  4LD9 D;  4HGA C;  3W99 D;  1U35 D;  5AV8 A;  1BH8 B;  1BH8 A;  3W98 D;  5B1M A;  4AWL C;  3W97 B;  1A7W A;  2ZY4 A;  1P3P B;  1P3P A;  4WNN B;  3AZH C;  3UTB B;  3UTB A;  1KX3 D;  3AZF B;  3AZF A;  5B32 B;  1P3L B;  1P3L A;  5GT3 C;  2BG1 A;  5F99 D;  3VH5 A;  4J8W B;  4J8W A;  4J8V C;  3H0R C;  3AZJ B;  1ZLA C;  3W96 B;  3W96 A;  4KUD A;  3VH6 W;  4ZBJ B;  3AZK C;  2FFF B;  5BNX B;  5BNX A;  5GT0 A;  3REH C;  2FJ7 D;  1P3M B;  1P3M A;  5BT1 D;  5BS7 A;  4ZUX C;  2NZD A;  1P3A B;  1P3A A;  5AY8 C;  3WAA C;  5B40 B;  5B40 A;  2Y2I A;  1M19 D;  3KFU G;  4LD9 A;  3AV1 C;  4XUJ B;  1WWI A;  3REK C;  3W99 B;  3W99 A;  1U35 A;  4NE3 A;  3AZI A;  2UWX A;  3AZI B;  5AVC B;  5B0Z C;  3UTA C;  1BH9 A;  4EO5 C;  3W98 B;  3W98 A;  2IO5 C;  4J8X D;  4NE5 A;  5CPJ C;  1TAF B;  1P3F C;  1KX3 B;  1KX3 A;  5B31 D;  3UT9 C;  5F99 B;  5F99 A;  4YM6 D;  3X1S B;  3AZG D;  5B33 B;  5GXQ B;  3MGS D;  1ID3 D;  4WJ3 C;  3MGQ D;  4KGC D;  3LZ0 D;  5JA4 B;  5JA4 A;  1HTA A;  3LEL D;  1TZY D;  3LJA B;  3C1C D;  3AZN B;  3AZM B;  4XZQ D;  4Z5T C;  3KXB B;  2FJ7 B;  2FJ7 A;  1P3O D;  3EPK A;  3P5J B;  1M1A C;  4J8U B;  3KUY B;  3MNN B;  3MNN A;  1M19 A;  1EQZ C;  4X23 B;  5GSU D;  3AN2 D;  1KU5 A;  3WA9 D;  5B1L D;  3MVD D;  4AWL B;  3KWQ D;  5B2I C;  4Z66 C;  4J8X B;  4J8X A;  3REJ C;  3A1I A;  5B31 B;  5B31 A;  3AZG B;  4JJN C;  4YM6 A;  3AZG A;  1ID3 B;  1ID3 A;  2ARO D;  3MGS A;  4H9Q B;  3AZE C;  3C1B C;  4KGC B;  5G49 B;  4KGC A;  3LZ0 A;  5B1M C;  5B2J B;  4R8P D;  3MGR B;  2LY8 A;  4G92 C;  3LEL A;  5AVB D;  4H9S C;  3WTP E;  3C1C A;  3C1C B;  3AZL B;  3AZL A;  1P34 C;  2Y2P A;  4XZQ A;  5CPI C;  4ZUX B;  2W8S A;  1S32 C;  1P3O B;  1P3O A;  3B0D B;  2RVQ D;  4QLC B;  2XD5 A;  5B0Y A;  5B0Y B;  5B24 D;  5CPK C;  3W97 D;  4KUD C;  2ZY2 A;  5CP6 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...