3UT9D

Crystal structure of nucleosome core particle assembled with a palindromic widom '601' derivative (ncp-601l)
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
96
structure length
96
Chain Sequence
b'RRKTRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.2
publication title The mechanics behind DNA sequence-dependent properties of the nucleosome
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Structural protein/dna
total genus 34
structure length 96
sequence length 96
chains with identical sequence H
ec nomenclature
pdb deposition date 2011-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3ut9D00
5GT0A 3MGPC 3MGPA 2YFWB 5BNXB 3B6FD 1P3OD 3X1TD 5AV5D 3C1BB 2HIOD 3VH6W 3WTPE 3O62C 3KUYD 4J8XD 5GSUD 5GT3B 4R8PA 4JJNC 4JJNA 3X1SB 3MGSD 2CV5A 2JSSA 3VH5T 3AZLC 3WKJD 4H9OB 3MGRC 5B0ZD 3REJD 3AZLA 4J8WD 1P34C 3AFAB 1P34A 5B32G 4KUDD 3UT9D 5AY8D 5AV6C 1M18C 5AV6A 3W96C 1M18A 5G49B 4DRAA 5CP6D 3W96A 3AZGD 3AZJD 1Q9CA 3WA9B 5B1MC 2NQBD 5B1MA 4EO5C 3LELD 1TZYD 1H3OB 2NZDC 4CSRA 2NZDA 4G91B 4QLCC 3W99B 4QLCA 3A6NA 2F8NK 1KX3D 3B0CW 2YFWA 5BNXA 1B6WA 3UTAB 5B0YB 3MVDD 1P3GB 5E5AA 3C1BC 1KX4D 4E44A 3C1BA 2CWEA 3REIB 5B33D 1P3KB 5B40D 5GT3C 2FJ7D 5AVCB 5GT3A 4Z66B 3TU4D 3X1SC 4LD9D 5F99D 1TAFB 5DNMD 4H9OA 1F66D 3AFAC 3X1VB 5CPIB 3AFAA 3UTBB 5B2ID 3X1UB 1ID3B 2HUEB 3REKB 5AV8D 5JRGB 3AZKB 3NQJB 3AZHD 3X1TA 1P3OA 5B31B 3VH6T 1HTAA 5GSUA 3LZ0D 3WA9C 1S32B 2PYOD 1P3ID 3WA9A 3AZIB 5B0ZC 3AV2D 5B0ZA 4ZBJB 4G91C 2AROB 3W99C 5B24D 3C1CB 4M6BA 5AY8A 3UTAC 4R8PB 2LY8A 5B0YC 5B32B 3UTAA 3KWQB 5BT1C 5AVBD 5B0YA 3AZED 1P3GC 1P3GA 4YM6B 1U35D 2CV5B 5CPJD 4ZUXD 3AZJA 1P3MD 3B6GD 3AZLB 3REIC 1P3KC 1P3KA 4WU8B 2IO5B 5AVCC 4XZQB 1ZLAD 1P3LB 5AVCA 3B0DB 4WZSB 5B1LD 3RELD 1P3BD 1P3AB 3AN2B 4YS3B 2F8ND 3UTBC 1KX3A 3X1UC 1ID3C 3UTBA 4UUZA 3X1UA 1M19D 2HUEC 3REKC 3AZFD 4WU9B 1BFMA 5JRGC 3REKA 5JRGA 5B1MB 3AZKC 3AZKA 3AV1D 3NQUB 1F1EA 4KGCB 2NZDB 2BYKB 1S32C 4XUJD 3A6NB 1S32A 3AZIC 3LJAD 3AZIA 2RVQD 3LZ1D 5DNNB 3KSYA 1F66C 5AV9D 1AOIB 4ZBJC 5E5AB 1F66A 2AROC 2F8NH 2AROA 3C1CC 4H9QB 1M1AD 3C1CA 4J8UB 4R8PC 4Z5TD 1ULYA 5B32C 3KWQC 3MGQD 5B32A 3KWQA 4YM6C 2CV5C 4YM6A 3LZ0C 4J8WB 3AZNB 3LZ0A 2PYOC 4WU8C 3WAAD 2IO5C 1P3PD 4WU8A 2PYOA 4XZQC 2YFVA 1P3LC 3V9RA 4XZQA 1P3LA 3W98D 3AV2C 3B0DC 5FUGA 3AV2A 3B6FB 4WNNA 1P3AC 3AN2C 5AV5B 3X1TB 4YS3C 1P3OB 1P3AA 3AN2A 5B24A 2HIOB 3R45B 4YS3A 3KUYB 3W97D 4J8XB 5GSUB 4WU9C 4WU9A 4J8VD 3AZEA 1U35C 3MGSB 1U35A 2L5AA 3WKJB 5BS7C 1P3FD 5B0ZB 5GXQD 5BS7A 4KGCC 4Z2MG 3NQUA 4KUDB 3MNND 4KGCA 5B2JD 3UT9B 2BYKA 5CHLB 3A6NC 3REHD 5AY8B 5CPKD 5DNNC 1HQ3D 1P3BA 5DNNA 5CP6B 1AOIC 5E5AC 1AOIA 4X23D 3AZGB 3AZJB 2BYMA 4H9QA 4J8UC 4J8UA 1KX5D 2NQBB 1BH8B 4NE5A 3AYWD 2F8NG 3LELB 1TZYB 4J8WC 3AZNC 1EQZD 4XUJC 4J8WA 3AZNA 4XUJA 1KX3B 4UUZB 3WTPD 3AZMD 3B6FC 3MVDB 3B6FA 1P3OC 3X1TC 5AV5C 1KX4B 3KXBD 5AV5A 2HIOC 2HIOA 3R45A 5B33B 3KUYC 4J8XC 4Z5TC 3KUYA 5B40B 5GSUC 4J8XA 4Z5TA 2FJ7B 5GT0D 5KDMB 3TU4B 4LD9B 3MGPD 3MGSC 5F99B 3MGSA 5DNMB 3WKJC 3REJC 3WKJA 1F66B 3REJA 4KUDC 3WAAA 3UT9C 4KUDA 5B2IB 3UT9A 3W98A 1R4VA 5AY8C 5AV8B 3O62D 5CP6C 3AZHB 5CP6A 4JJND 4NFTA 1WWIA 3AZGC 3AZJC 3AZGA 3W97A 3LZ0B 3MGRD 2PYOB 1P34D 1P3IB 2NQBC 2YFVB 3V9RB 2NQBA 1BH8A 3LELC 1TZYC 5FUGB 3AV2B 4WNNB 3LELA 1TZYA 5AV6D 3MNNC 1M18D 3MNNA 5B24B 3W96D 3REHA 1KX3C 5BNVB 4HGAB 1A7WA 3MVDC 3AZEB 5AVBB 3MVDA 1U35B 1KX4C 4X23A 1KX4A 5CPJB 4ZUXB 3B6GB 1P3MB 5B33C 5B33A 1KX5C 5B40C 2FJ7C 1KX5A 5B40A 1ZLAB 4QLCD 3TU4C 2FJ7A 4LD9C 5KDMA 3TU4A 5F99C 3B0BA 5B1LB 4DRBA 3RELB 5DNMC 5F99A 4LD9A 5DNMA 1P3BB 1EQZC 1EQZA 2F8NB 2BYMB 5B2IC 3C1BD 5B2IA 1M19B 3AZFB 5AV8C 3AZMA 4H9NB 5AV8A 5C3IB 3AZHC 5GT3D 3AZHA 5BO0B 3X1SD 3AV1B 4NE6A 4XUJB 1P3IC 3AFAD 4H9PB 1P3IA 5B31G 3LJAB 3LZ1B 1N1JB 5AV9B 4KHAA 1BH9B 5B24C 4WV4B 5JA4B 1M1AB 1WWSA 4E45A 4Z5TB 4HGAC 5BNVA 3O62A 3AZEC 5AVBC 3MGQB 3WA9D 5AVBA 5CPJC 4ZUXC 3B6GC 1P3MC 5CPJA 4ZUXA 3B6GA 1P3MA 3REJB 3MGRA 3WAAB 1P3PB 4H9RB 1ZLAC 3W99D 1ZLAA 3W98B 5B1LC 3RELC 5B1LA 3RELA 1P3BC 3UTAD 5B0YD 1P3GD 5BT1D 2F8NA 3W97B 1M19C 4H9SC 3AZFC 1M19A 4H9SA 3REID 1P3KD 3AZFA 4J8VB 5C3IC 4H9NA 5AVCD 4Z66D 1P3FB 3AV1C 5GXQB 5BO0A 3AV1A 3MNNB 5B2JB 1JFIB 3REHB 3X1VD 5CPID 4G92B 3LJAC 4H9PA 5CPKB 3UTBD 2RVQC 3LZ1C 3X1UD 3LJAA 1ID3D 1HQ3B 3LZ1A 1N1JA 5AV9C 3REKD 5JRGD 5AV9A 4CAYB 4X23B 1BH9A 3AZKD 3VH5A 1M1AC 5B31D 5JA4A 1M1AA 1KX5B 3AYWB 3MGQC 1S32D 3AZND 3MGQA 3AZID 3X1SA 1EQZB 4NE3A 3WAAC 1P3PC 1P3PA 2AROD 4H9RA 3C1CD 3W98C 3WTPB 3AZMB 4R8PD 3KXBB 5G49A 5B32D 3KWQD 4AWLB 4YM6D 2CV5D 3W97C 3AZLD 5GT0B 3VH5W 4J8VC 3MGPB 4WU8D 4J8VA 4XZQD 1P3LD 1P3FC 5GXQC 4KHAB 1P3FA 5GXQA 1B67A 1H3OA 5B2JC 1P3AD 3AN2D 3REHC 5B2JA 4YS3D 1JFIA 3W99A 4G92C 5CPKC 5CPKA 3O62B 1HQ3C 1HQ3A 4WU9D 4JJNB 4X23C 5B1MD 4CAYA 3MGRB 3REIA 1P34B 4KGCD 2NZDD 3AYWC 4Z66C 3A6ND 3AYWA 4Z66A 5AV6B 1M18B 1KU5A 1TAFA 5DNND 3W96B 3VH6A 3X1VC 3B0CT 5CPIC 5E5AD 1AOID 3X1VA 5CPIA 1ID3A 3WTPC 3AZMC 4Z2MH 4J8UD 3WTPA 3KXBC 3KXBA 5B31C 3NQJA 4EO5B 4AWLC 5B31A 4CSRB 5GT0C 4QLCB
chains in the Genus database with same CATH superfamily
5GT0A 3MGPC 3MGPA 3H0MC 2YFWB 5BNXB 3H0RC 3B6FD 1P3OD 3X1TD 5AV5D 3C1BB 2HIOD 3P5JB 3VH6W 3WTPE 3O62C 3KUYD 4J8XD 5GSUD 5GT3B 4R8PA 4JJNC 2DQNC 4JJNA 3X1SB 3MGSD 2CV5A 2JSSA 3VH5T 3AZLC 3WKJD 4H9OB 3MGRC 3EPHA 5B0ZD 1Z2CB 3REJD 4J8WD 3AZLA 1P34C 3AFAB 1P34A 5B32G 4KUDD 3UT9D 5AY8D 5AV6C 1M18C 5AV6A 3W96C 1M18A 5G49B 4DRAA 5CP6D 3W96A 3AZGD 3AZJD 1Q9CA 3WA9B 5B1MC 2NQBD 5B1MA 4EO5C 3LELD 1TZYD 1H3OB 2NZDC 4CSRA 2NZDA 3IP4C 4G91B 4QLCC 3W99B 4QLCA 3A6NA 2F8NK 1KX3D 3B0CW 2YFWA 5BNXA 1B6WA 3UTAB 5B0YB 3MVDD 1P3GB 2Y2HA 5E5AA 3C1BC 1KX4D 4E44A 3C1BA 2CWEA 3REIB 5B33D 1P3KB 5B40D 5GT3C 2FJ7D 5AVCB 5GT3A 4Z66B 3TU4D 3X1SC 4LD9D 5F99D 3AL0C 1TAFB 5DNMD 1PZRA 4H9OA 1F66D 3AFAC 3X1VB 5CPIB 3AFAA 3UTBB 5B2ID 3X1UB 1ID3B 2HUEB 3REKB 5AV8D 5JRGB 2G5IC 3AZKB 3NQJB 3AZHD 3X1TA 1P3OA 5B31B 3VH6T 1HTAA 5GSUA 3LZ0D 3WA9C 1S32B 2PYOD 1P3ID 3WA9A 3AZIB 2Y2JA 5B0ZC 2XD5A 3AV2D 5B0ZA 3EPLA 4ZBJB 4G91C 2AROB 3W99C 5B24D 3C1CB 3A1IA 4M6BA 5AY8A 3UTAC 4R8PB 2LY8A 5B0YC 5B32B 3UTAA 3KWQB 5BT1C 5AVBD 5B0YA 3AZED 1P3GC 1P3GA 4YM6B 1U35D 2CV5B 5CPJD 4ZUXD 3AZJA 1P3MD 3B6GD 3AZLB 3REIC 1P3KC 1P3KA 4WU8B 2IO5B 5AVCC 4XZQB 1ZLAD 1P3LB 5AVCA 3B0DB 4WZSB 5B1LD 3RELD 2Y2IA 1P3BD 1P3AB 3AN2B 4YS3B 2F8ND 3UTBC 1KX3A 3X1UC 1ID3C 3UTBA 4UUZA 3X1UA 1M19D 2HUEC 3REKC 3AZFD 4WU9B 1BFMA 4UPKA 5JRGC 3REKA 5JRGA 5B1MB 3AZKC 3AZKA 2W8SA 3AV1D 3NQUB 1F1EA 4KGCB 2NZDB 2UWXA 2BYKB 1S32C 4XUJD 3A6NB 1S32A 3AZIC 3LJAD 3AZIA 2ZY4A 2RVQD 3LZ1D 5DNNB 3KSYA 1F66C 5AV9D 1AOIB 4ZBJC 5E5AB 1F66A 2AROC 2F8NH 2AROA 3C1CC 2ZY2A 4H9QB 1M1AD 3C1CA 4J8UB 4R8PC 4Z5TD 1ULYA 5B32C 3KWQC 3MGQD 5B32A 3KWQA 4YM6C 2CV5C 4YM6A 2Y2MA 3LZ0C 4J8WB 3AZNB 3LZ0A 2PYOC 4WU8C 3WAAD 2IO5C 1P3PD 4WU8A 2PYOA 4XZQC 2YFVA 1P3LC 3V9RA 4XZQA 1P3LA 3W98D 3AV2C 3B0DC 5FUGA 3AV2A 3B6FB 4WNNA 1P3AC 3AN2C 5AV5B 3X1TB 4YS3C 1P3OB 1P3AA 3AN2A 5B24A 2HIOB 3R45B 4YS3A 1W2EA 3KUYB 3W97D 4J8XB 5GSUB 2VQRA 4WU9C 4WU9A 4J8VD 3AZEA 1U35C 3MGSB 1U35A 2L5AA 3WKJB 5BS7C 1P3FD 5B0ZB 4WJ3C 5GXQD 5BS7A 4KGCC 4Z2MG 3NQUA 4KUDB 3MNND 2Y2LA 4KGCA 5B2JD 3UT9B 2BYKA 5CHLB 3A6NC 3REHD 5AY8B 5CPKD 5DNNC 1HQ3D 1P3BA 5DNNA 5CP6B 1AOIC 5E5AC 2Y2KA 1AOIA 4X23D 3AZGB 3AZJB 2BYMA 4H9QA 4J8UC 4J8UA 1KX5D 2NQBB 1BH8B 4NE5A 3AYWD 2F8NG 3LELB 1TZYB 4J8WC 3AZNC 1EQZD 4XUJC 4J8WA 3AZNA 4XUJA 1KX3B 4UUZB 3WTPD 3AZMD 3B6FC 3MVDB 2J8PA 3B6FA 1P3OC 3X1TC 5AV5C 1KX4B 3KXBD 3F6TA 5AV5A 2HIOC 2HIOA 3R45A 5B33B 3KUYC 4J8XC 4Z5TC 3KUYA 5B40B 5GSUC 4J8XA 4Z5TA 2FJ7B 5GT0D 5KDMB 3TU4B 4LD9B 3MGPD 3MGSC 2F2AC 5F99B 3MGSA 5DNMB 3WKJC 2ZY5A 3REJC 3WKJA 1F66B 3REJA 4KUDC 3WAAA 3UT9C 4KUDA 5B2IB 3UT9A 3W98A 1R4VA 5AY8C 5AV8B 3O62D 5CP6C 3AZHB 5CP6A 4JJND 4NFTA 1WWIA 3AZGC 3AZJC 2Y2QA 3AZGA 3W97A 3LZ0B 3MGRD 2PYOB 1P34D 1P3IB 2NQBC 2YFVB 3V9RB 2NQBA 1BH8A 2DF4C 2RIQA 3LELC 1TZYC 5FUGB 3AV2B 4WNNB 3LELA 1TZYA 5AV6D 3MNNC 1M18D 3MNNA 5B24B 3W96D 3REHA 1KX3C 3EPJA 5BNVB 4HGAB 1A7WA 3MVDC 3AZEB 5AVBB 3MVDA 1U35B 1KX4C 4X23A 1KX4A 5CPJB 4ZUXB 3B6GB 1P3MB 5B33C 5B33A 1KX5C 5B40C 2FJ7C 1KX5A 5B40A 1ZLAB 4QLCD 3TU4C 2FJ7A 4LD9C 5KDMA 3TU4A 5F99C 3B0BA 5B1LB 4DRBA 3RELB 5DNMC 2G5HC 5F99A 4LD9A 5DNMA 1P3BB 1EQZC 2Y2PA 1EQZA 2Y2NA 2F8NB 2BYMB 5B2IC 3C1BD 5B2IA 1M19B 3AZFB 5AV8C 3AZMA 4H9NB 5AV8A 5C3IB 3AZHC 5GT3D 3AZHA 5BO0B 3X1SD 3AV1B 3H0LC 4NE6A 4XUJB 1P3IC 3AFAD 4H9PB 1P3IA 5B31G 3LJAB 2ZM5A 3LZ1B 1N1JB 5AV9B 4KHAA 1BH9B 5B24C 4WV4B 5JA4B 1M1AB 1WWSA 4E45A 4Z5TB 4HGAC 5BNVA 3O62A 3AZEC 5AVBC 3MGQB 3WA9D 5AVBA 2Y2OA 4ZUXC 5CPJC 1P3MC 3B6GC 5CPJA 4ZUXA 3B6GA 1P3MA 3REJB 1T3UA 3MGRA 3WAAB 1P3PB 4H9RB 1ZLAC 3W99D 1ZLAA 3W98B 2XD1A 5B1LC 3RELC 5B1LA 3RELA 1P3BC 3UTAD 5B0YD 1P3GD 5BT1D 2F8NA 3W97B 1M19C 4H9SC 3AZFC 1M19A 4H9SA 3REID 1P3KD 3AZFA 4J8VB 5C3IC 4H9NA 4DQYB 5AVCD 4Z66D 1P3FB 3AV1C 5GXQB 5BO0A 3AV1A 3MNNB 5B2JB 1JFIB 3REHB 3X1VD 5CPID 4G92B 3LJAC 4H9PA 5CPKB 3UTBD 2RVQC 3LZ1C 3X1UD 3LJAA 1ID3D 3KFUG 1HQ3B 3LZ1A 1N1JA 5AV9C 3REKD 5JRGD 3FDDA 5AV9A 4CAYB 4X23B 1BH9A 3AZKD 3VH5A 2FFFB 1M1AC 5B31D 5JA4A 1M1AA 1KX5B 3AYWB 3MGQC 1S32D 3AZND 3MGQA 3AZID 3X1SA 3EG5B 1EQZB 4NE3A 2BG1A 3WAAC 1P3PC 1P3PA 2AROD 4H9RA 3C1CD 3W98C 3WTPB 3AZMB 4R8PD 3KXBB 5G49A 5B32D 3KWQD 4AWLB 4YM6D 2CV5D 3W97C 3AZLD 5GT0B 3VH5W 4J8VC 3MGPB 4WU8D 4J8VA 4XZQD 1P3LD 1P3FC 3A1KA 5GXQC 4KHAB 1P3FA 5GXQA 1B67A 1H3OA 5B2JC 1P3AD 3AN2D 3REHC 5B2JA 4YS3D 1JFIA 2JCHA 3W99A 4G92C 5CPKC 5CPKA 3O62B 1HQ3C 1HQ3A 4WU9D 4JJNB 4X23C 5B1MD 4CAYA 3MGRB 3REIA 1P34B 4KGCD 2NZDD 3AYWC 4Z66C 3A6ND 3AYWA 4Z66A 5AV6B 2ZY3A 1M18B 1KU5A 1TAFA 5DNND 3W96B 3VH6A 3X1VC 3B0CT 5CPIC 5E5AD 1AOID 3X1VA 5CPIA 2Y2GA 1ID3A 3WTPC 2JE5A 3AZMC 4Z2MH 4J8UD 3WTPA 3KXBC 3KXBA 5B31C 3NQJA 4EO5B 3EPKA 4AWLC 5B31A 4CSRB 5GT0C 4QLCB
chains in the Genus database with same CATH topology
5GT0A 3MGPC 3MGPA 3H0MC 2YFWB 5BNXB 3H0RC 3B6FD 1P3OD 3X1TD 5AV5D 3C1BB 2HIOD 3P5JB 3VH6W 3WTPE 3O62C 3KUYD 4J8XD 5GSUD 5GT3B 4R8PA 4JJNC 2DQNC 4JJNA 3X1SB 3MGSD 2CV5A 2JSSA 3VH5T 3AZLC 3WKJD 4H9OB 3MGRC 3EPHA 5B0ZD 1Z2CB 3REJD 4J8WD 3AZLA 1P34C 3AFAB 1P34A 5B32G 4KUDD 3UT9D 5AY8D 5AV6C 1M18C 5AV6A 3W96C 1M18A 5G49B 4DRAA 5CP6D 3W96A 3AZGD 3AZJD 1Q9CA 3WA9B 5B1MC 2NQBD 5B1MA 4EO5C 3LELD 1TZYD 1H3OB 2NZDC 4CSRA 2NZDA 3IP4C 4G91B 4QLCC 3W99B 4QLCA 3A6NA 2F8NK 1KX3D 3B0CW 2YFWA 5BNXA 1B6WA 3UTAB 5B0YB 3MVDD 1P3GB 2Y2HA 5E5AA 3C1BC 1KX4D 4E44A 3C1BA 2CWEA 3REIB 5B33D 1P3KB 5B40D 5GT3C 2FJ7D 5AVCB 5GT3A 4Z66B 3TU4D 3X1SC 4LD9D 5F99D 3AL0C 1TAFB 5DNMD 1PZRA 4H9OA 1F66D 3AFAC 3X1VB 5CPIB 3AFAA 3UTBB 5B2ID 3X1UB 1ID3B 2HUEB 3REKB 5AV8D 5JRGB 2G5IC 3AZKB 3NQJB 3AZHD 3X1TA 1P3OA 5B31B 3VH6T 1HTAA 5GSUA 3LZ0D 3WA9C 1S32B 2PYOD 1P3ID 3WA9A 3AZIB 2Y2JA 5B0ZC 2XD5A 3AV2D 5B0ZA 3EPLA 4ZBJB 4G91C 2AROB 3W99C 5B24D 3C1CB 3A1IA 4M6BA 5AY8A 3UTAC 4R8PB 2LY8A 5B0YC 5B32B 3UTAA 3KWQB 5BT1C 5AVBD 5B0YA 3AZED 1P3GC 1P3GA 4YM6B 1U35D 2CV5B 5CPJD 4ZUXD 3AZJA 1P3MD 3B6GD 3AZLB 3REIC 1P3KC 1P3KA 4WU8B 2IO5B 5AVCC 4XZQB 1ZLAD 1P3LB 5AVCA 3B0DB 4WZSB 5B1LD 3RELD 2Y2IA 1P3BD 1P3AB 3AN2B 4YS3B 2F8ND 3UTBC 1KX3A 3X1UC 1ID3C 3UTBA 4UUZA 3X1UA 1M19D 2HUEC 3REKC 3AZFD 4WU9B 1BFMA 4UPKA 5JRGC 3REKA 5JRGA 5B1MB 3AZKC 3AZKA 2W8SA 3AV1D 3NQUB 1F1EA 4KGCB 2NZDB 2UWXA 2BYKB 1S32C 4XUJD 3A6NB 1S32A 3AZIC 3LJAD 3AZIA 2ZY4A 2RVQD 3LZ1D 5DNNB 3KSYA 1F66C 5AV9D 1AOIB 4ZBJC 5E5AB 1F66A 2AROC 2F8NH 2AROA 3C1CC 2ZY2A 4H9QB 1M1AD 3C1CA 4J8UB 4R8PC 4Z5TD 1ULYA 5B32C 3KWQC 3MGQD 5B32A 3KWQA 4YM6C 2CV5C 4YM6A 2Y2MA 3LZ0C 4J8WB 3AZNB 3LZ0A 2PYOC 4WU8C 3WAAD 2IO5C 1P3PD 4WU8A 2PYOA 4XZQC 2YFVA 1P3LC 3V9RA 4XZQA 1P3LA 3W98D 3AV2C 3B0DC 5FUGA 3AV2A 3B6FB 4WNNA 1P3AC 3AN2C 5AV5B 3X1TB 4YS3C 1P3OB 1P3AA 3AN2A 5B24A 2HIOB 3R45B 4YS3A 1W2EA 3KUYB 3W97D 4J8XB 5GSUB 2VQRA 4WU9C 4WU9A 4J8VD 3AZEA 1U35C 3MGSB 1U35A 2L5AA 3WKJB 5BS7C 1P3FD 5B0ZB 4WJ3C 5GXQD 5BS7A 4KGCC 4Z2MG 3NQUA 4KUDB 3MNND 2Y2LA 4KGCA 5B2JD 3UT9B 2BYKA 5CHLB 3A6NC 3REHD 5AY8B 5CPKD 5DNNC 1HQ3D 1P3BA 5DNNA 5CP6B 1AOIC 5E5AC 2Y2KA 1AOIA 4X23D 3AZGB 3AZJB 2BYMA 4H9QA 4J8UC 4J8UA 1KX5D 2NQBB 1BH8B 4NE5A 3AYWD 2F8NG 3LELB 1TZYB 4J8WC 3AZNC 1EQZD 4XUJC 4J8WA 3AZNA 4XUJA 1KX3B 4UUZB 3WTPD 3AZMD 3B6FC 3MVDB 2J8PA 3B6FA 1P3OC 3X1TC 5AV5C 1KX4B 3KXBD 3F6TA 5AV5A 2HIOC 2HIOA 3R45A 5B33B 3KUYC 4J8XC 4Z5TC 3KUYA 5B40B 5GSUC 4J8XA 4Z5TA 2FJ7B 5GT0D 5KDMB 3TU4B 4LD9B 3MGPD 3MGSC 2F2AC 5F99B 3MGSA 5DNMB 3WKJC 2ZY5A 3REJC 3WKJA 1F66B 3REJA 4KUDC 3WAAA 3UT9C 4KUDA 5B2IB 3UT9A 3W98A 1R4VA 5AY8C 5AV8B 3O62D 5CP6C 3AZHB 5CP6A 4JJND 4NFTA 1WWIA 3AZGC 3AZJC 2Y2QA 3AZGA 3W97A 3LZ0B 3MGRD 2PYOB 1P34D 1P3IB 2NQBC 2YFVB 3V9RB 2NQBA 1BH8A 2DF4C 2RIQA 3LELC 1TZYC 5FUGB 3AV2B 4WNNB 3LELA 1TZYA 5AV6D 3MNNC 1M18D 3MNNA 5B24B 3W96D 3REHA 1KX3C 3EPJA 5BNVB 4HGAB 1A7WA 3MVDC 3AZEB 5AVBB 3MVDA 1U35B 1KX4C 4X23A 1KX4A 5CPJB 4ZUXB 3B6GB 1P3MB 5B33C 5B33A 1KX5C 5B40C 2FJ7C 1KX5A 5B40A 1ZLAB 4QLCD 3TU4C 2FJ7A 4LD9C 5KDMA 3TU4A 5F99C 3B0BA 5B1LB 4DRBA 3RELB 5DNMC 2G5HC 5F99A 4LD9A 5DNMA 1P3BB 1EQZC 2Y2PA 1EQZA 2Y2NA 2F8NB 2BYMB 5B2IC 3C1BD 5B2IA 1M19B 3AZFB 5AV8C 3AZMA 4H9NB 5AV8A 5C3IB 3AZHC 5GT3D 3AZHA 5BO0B 3X1SD 3AV1B 3H0LC 4NE6A 4XUJB 1P3IC 3AFAD 4H9PB 1P3IA 5B31G 3LJAB 2ZM5A 3LZ1B 1N1JB 5AV9B 4KHAA 1BH9B 5B24C 4WV4B 5JA4B 1M1AB 1WWSA 4E45A 4Z5TB 4HGAC 5BNVA 3O62A 3AZEC 5AVBC 3MGQB 3WA9D 5AVBA 2Y2OA 4ZUXC 5CPJC 1P3MC 3B6GC 5CPJA 4ZUXA 3B6GA 1P3MA 3REJB 1T3UA 3MGRA 3WAAB 1P3PB 4H9RB 1ZLAC 3W99D 1ZLAA 3W98B 2XD1A 5B1LC 3RELC 5B1LA 3RELA 1P3BC 3UTAD 5B0YD 1P3GD 5BT1D 2F8NA 3W97B 1M19C 4H9SC 3AZFC 1M19A 4H9SA 3REID 1P3KD 3AZFA 4J8VB 5C3IC 4H9NA 4DQYB 5AVCD 4Z66D 1P3FB 3AV1C 5GXQB 5BO0A 3AV1A 3MNNB 5B2JB 1JFIB 3REHB 3X1VD 5CPID 4G92B 3LJAC 4H9PA 5CPKB 3UTBD 2RVQC 3LZ1C 3X1UD 3LJAA 1ID3D 3KFUG 1HQ3B 3LZ1A 1N1JA 5AV9C 3REKD 5JRGD 3FDDA 5AV9A 4CAYB 4X23B 1BH9A 3AZKD 3VH5A 2FFFB 1M1AC 5B31D 5JA4A 1M1AA 1KX5B 3AYWB 3MGQC 1S32D 3AZND 3MGQA 3AZID 3X1SA 3EG5B 1EQZB 4NE3A 2BG1A 3WAAC 1P3PC 1P3PA 2AROD 4H9RA 3C1CD 3W98C 3WTPB 3AZMB 4R8PD 3KXBB 5G49A 5B32D 3KWQD 4AWLB 4YM6D 2CV5D 3W97C 3AZLD 5GT0B 3VH5W 4J8VC 3MGPB 4WU8D 4J8VA 4XZQD 1P3LD 1P3FC 3A1KA 5GXQC 4KHAB 1P3FA 5GXQA 1B67A 1H3OA 5B2JC 1P3AD 3AN2D 3REHC 5B2JA 4YS3D 1JFIA 2JCHA 3W99A 4G92C 5CPKC 5CPKA 3O62B 1HQ3C 1HQ3A 4WU9D 4JJNB 4X23C 5B1MD 4CAYA 3MGRB 3REIA 1P34B 4KGCD 2NZDD 3AYWC 4Z66C 3A6ND 3AYWA 4Z66A 5AV6B 2ZY3A 1M18B 1KU5A 1TAFA 5DNND 3W96B 3VH6A 3X1VC 3B0CT 5CPIC 5E5AD 1AOID 3X1VA 5CPIA 2Y2GA 1ID3A 3WTPC 2JE5A 3AZMC 4Z2MH 4J8UD 3WTPA 3KXBC 3KXBA 5B31C 3NQJA 4EO5B 3EPKA 4AWLC 5B31A 4CSRB 5GT0C 4QLCB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GT0 A;  3MGP C;  3MGP A;  2YFW B;  5BNX B;  3B6F D;  1P3O D;  3X1T D;  5AV5 D;  3C1B B;  2HIO D;  3VH6 W;  3WTP E;  3O62 C;  3KUY D;  4J8X D;  5GSU D;  5GT3 B;  4R8P A;  4JJN C;  4JJN A;  3X1S B;  3MGS D;  2CV5 A;  2JSS A;  3VH5 T;  3AZL C;  3WKJ D;  4H9O B;  3MGR C;  5B0Z D;  3REJ D;  3AZL A;  4J8W D;  1P34 C;  3AFA B;  1P34 A;  5B32 G;  4KUD D;  3UT9 D;  5AY8 D;  5AV6 C;  1M18 C;  5AV6 A;  3W96 C;  1M18 A;  5G49 B;  4DRA A;  5CP6 D;  3W96 A;  3AZG D;  3AZJ D;  1Q9C A;  3WA9 B;  5B1M C;  2NQB D;  5B1M A;  4EO5 C;  3LEL D;  1TZY D;  1H3O B;  2NZD C;  4CSR A;  2NZD A;  4G91 B;  4QLC C;  3W99 B;  4QLC A;  3A6N A;  2F8N K;  1KX3 D;  3B0C W;  2YFW A;  5BNX A;  1B6W A;  3UTA B;  5B0Y B;  3MVD D;  1P3G B;  5E5A A;  3C1B C;  1KX4 D;  4E44 A;  3C1B A;  2CWE A;  3REI B;  5B33 D;  1P3K B;  5B40 D;  5GT3 C;  2FJ7 D;  5AVC B;  5GT3 A;  4Z66 B;  3TU4 D;  3X1S C;  4LD9 D;  5F99 D;  1TAF B;  5DNM D;  4H9O A;  1F66 D;  3AFA C;  3X1V B;  5CPI B;  3AFA A;  3UTB B;  5B2I D;  3X1U B;  1ID3 B;  2HUE B;  3REK B;  5AV8 D;  5JRG B;  3AZK B;  3NQJ B;  3AZH D;  3X1T A;  1P3O A;  5B31 B;  3VH6 T;  1HTA A;  5GSU A;  3LZ0 D;  3WA9 C;  1S32 B;  2PYO D;  1P3I D;  3WA9 A;  3AZI B;  5B0Z C;  3AV2 D;  5B0Z A;  4ZBJ B;  4G91 C;  2ARO B;  3W99 C;  5B24 D;  3C1C B;  4M6B A;  5AY8 A;  3UTA C;  4R8P B;  2LY8 A;  5B0Y C;  5B32 B;  3UTA A;  3KWQ B;  5BT1 C;  5AVB D;  5B0Y A;  3AZE D;  1P3G C;  1P3G A;  4YM6 B;  1U35 D;  2CV5 B;  5CPJ D;  4ZUX D;  3AZJ A;  1P3M D;  3B6G D;  3AZL B;  3REI C;  1P3K C;  1P3K A;  4WU8 B;  2IO5 B;  5AVC C;  4XZQ B;  1ZLA D;  1P3L B;  5AVC A;  3B0D B;  4WZS B;  5B1L D;  3REL D;  1P3B D;  1P3A B;  3AN2 B;  4YS3 B;  2F8N D;  3UTB C;  1KX3 A;  3X1U C;  1ID3 C;  3UTB A;  4UUZ A;  3X1U A;  1M19 D;  2HUE C;  3REK C;  3AZF D;  4WU9 B;  1BFM A;  5JRG C;  3REK A;  5JRG A;  5B1M B;  3AZK C;  3AZK A;  3AV1 D;  3NQU B;  1F1E A;  4KGC B;  2NZD B;  2BYK B;  1S32 C;  4XUJ D;  3A6N B;  1S32 A;  3AZI C;  3LJA D;  3AZI A;  2RVQ D;  3LZ1 D;  5DNN B;  3KSY A;  1F66 C;  5AV9 D;  1AOI B;  4ZBJ C;  5E5A B;  1F66 A;  2ARO C;  2F8N H;  2ARO A;  3C1C C;  4H9Q B;  1M1A D;  3C1C A;  4J8U B;  4R8P C;  4Z5T D;  1ULY A;  5B32 C;  3KWQ C;  3MGQ D;  5B32 A;  3KWQ A;  4YM6 C;  2CV5 C;  4YM6 A;  3LZ0 C;  4J8W B;  3AZN B;  3LZ0 A;  2PYO C;  4WU8 C;  3WAA D;  2IO5 C;  1P3P D;  4WU8 A;  2PYO A;  4XZQ C;  2YFV A;  1P3L C;  3V9R A;  4XZQ A;  1P3L A;  3W98 D;  3AV2 C;  3B0D C;  5FUG A;  3AV2 A;  3B6F B;  4WNN A;  1P3A C;  3AN2 C;  5AV5 B;  3X1T B;  4YS3 C;  1P3O B;  1P3A A;  3AN2 A;  5B24 A;  2HIO B;  3R45 B;  4YS3 A;  3KUY B;  3W97 D;  4J8X B;  5GSU B;  4WU9 C;  4WU9 A;  4J8V D;  3AZE A;  1U35 C;  3MGS B;  1U35 A;  2L5A A;  3WKJ B;  5BS7 C;  1P3F D;  5B0Z B;  5GXQ D;  5BS7 A;  4KGC C;  4Z2M G;  3NQU A;  4KUD B;  3MNN D;  4KGC A;  5B2J D;  3UT9 B;  2BYK A;  5CHL B;  3A6N C;  3REH D;  5AY8 B;  5CPK D;  5DNN C;  1HQ3 D;  1P3B A;  5DNN A;  5CP6 B;  1AOI C;  5E5A C;  1AOI A;  4X23 D;  3AZG B;  3AZJ B;  2BYM A;  4H9Q A;  4J8U C;  4J8U A;  1KX5 D;  2NQB B;  1BH8 B;  4NE5 A;  3AYW D;  2F8N G;  3LEL B;  1TZY B;  4J8W C;  3AZN C;  1EQZ D;  4XUJ C;  4J8W A;  3AZN A;  4XUJ A;  1KX3 B;  4UUZ B;  3WTP D;  3AZM D;  3B6F C;  3MVD B;  3B6F A;  1P3O C;  3X1T C;  5AV5 C;  1KX4 B;  3KXB D;  5AV5 A;  2HIO C;  2HIO A;  3R45 A;  5B33 B;  3KUY C;  4J8X C;  4Z5T C;  3KUY A;  5B40 B;  5GSU C;  4J8X A;  4Z5T A;  2FJ7 B;  5GT0 D;  5KDM B;  3TU4 B;  4LD9 B;  3MGP D;  3MGS C;  5F99 B;  3MGS A;  5DNM B;  3WKJ C;  3REJ C;  3WKJ A;  1F66 B;  3REJ A;  4KUD C;  3WAA A;  3UT9 C;  4KUD A;  5B2I B;  3UT9 A;  3W98 A;  1R4V A;  5AY8 C;  5AV8 B;  3O62 D;  5CP6 C;  3AZH B;  5CP6 A;  4JJN D;  4NFT A;  1WWI A;  3AZG C;  3AZJ C;  3AZG A;  3W97 A;  3LZ0 B;  3MGR D;  2PYO B;  1P34 D;  1P3I B;  2NQB C;  2YFV B;  3V9R B;  2NQB A;  1BH8 A;  3LEL C;  1TZY C;  5FUG B;  3AV2 B;  4WNN B;  3LEL A;  1TZY A;  5AV6 D;  3MNN C;  1M18 D;  3MNN A;  5B24 B;  3W96 D;  3REH A;  1KX3 C;  5BNV B;  4HGA B;  1A7W A;  3MVD C;  3AZE B;  5AVB B;  3MVD A;  1U35 B;  1KX4 C;  4X23 A;  1KX4 A;  5CPJ B;  4ZUX B;  3B6G B;  1P3M B;  5B33 C;  5B33 A;  1KX5 C;  5B40 C;  2FJ7 C;  1KX5 A;  5B40 A;  1ZLA B;  4QLC D;  3TU4 C;  2FJ7 A;  4LD9 C;  5KDM A;  3TU4 A;  5F99 C;  3B0B A;  5B1L B;  4DRB A;  3REL B;  5DNM C;  5F99 A;  4LD9 A;  5DNM A;  1P3B B;  1EQZ C;  1EQZ A;  2F8N B;  2BYM B;  5B2I C;  3C1B D;  5B2I A;  1M19 B;  3AZF B;  5AV8 C;  3AZM A;  4H9N B;  5AV8 A;  5C3I B;  3AZH C;  5GT3 D;  3AZH A;  5BO0 B;  3X1S D;  3AV1 B;  4NE6 A;  4XUJ B;  1P3I C;  3AFA D;  4H9P B;  1P3I A;  5B31 G;  3LJA B;  3LZ1 B;  1N1J B;  5AV9 B;  4KHA A;  1BH9 B;  5B24 C;  4WV4 B;  5JA4 B;  1M1A B;  1WWS A;  4E45 A;  4Z5T B;  4HGA C;  5BNV A;  3O62 A;  3AZE C;  5AVB C;  3MGQ B;  3WA9 D;  5AVB A;  5CPJ C;  4ZUX C;  3B6G C;  1P3M C;  5CPJ A;  4ZUX A;  3B6G A;  1P3M A;  3REJ B;  3MGR A;  3WAA B;  1P3P B;  4H9R B;  1ZLA C;  3W99 D;  1ZLA A;  3W98 B;  5B1L C;  3REL C;  5B1L A;  3REL A;  1P3B C;  3UTA D;  5B0Y D;  1P3G D;  5BT1 D;  2F8N A;  3W97 B;  1M19 C;  4H9S C;  3AZF C;  1M19 A;  4H9S A;  3REI D;  1P3K D;  3AZF A;  4J8V B;  5C3I C;  4H9N A;  5AVC D;  4Z66 D;  1P3F B;  3AV1 C;  5GXQ B;  5BO0 A;  3AV1 A;  3MNN B;  5B2J B;  1JFI B;  3REH B;  3X1V D;  5CPI D;  4G92 B;  3LJA C;  4H9P A;  5CPK B;  3UTB D;  2RVQ C;  3LZ1 C;  3X1U D;  3LJA A;  1ID3 D;  1HQ3 B;  3LZ1 A;  1N1J A;  5AV9 C;  3REK D;  5JRG D;  5AV9 A;  4CAY B;  4X23 B;  1BH9 A;  3AZK D;  3VH5 A;  1M1A C;  5B31 D;  5JA4 A;  1M1A A;  1KX5 B;  3AYW B;  3MGQ C;  1S32 D;  3AZN D;  3MGQ A;  3AZI D;  3X1S A;  1EQZ B;  4NE3 A;  3WAA C;  1P3P C;  1P3P A;  2ARO D;  4H9R A;  3C1C D;  3W98 C;  3WTP B;  3AZM B;  4R8P D;  3KXB B;  5G49 A;  5B32 D;  3KWQ D;  4AWL B;  4YM6 D;  2CV5 D;  3W97 C;  3AZL D;  5GT0 B;  3VH5 W;  4J8V C;  3MGP B;  4WU8 D;  4J8V A;  4XZQ D;  1P3L D;  1P3F C;  5GXQ C;  4KHA B;  1P3F A;  5GXQ A;  1B67 A;  1H3O A;  5B2J C;  1P3A D;  3AN2 D;  3REH C;  5B2J A;  4YS3 D;  1JFI A;  3W99 A;  4G92 C;  5CPK C;  5CPK A;  3O62 B;  1HQ3 C;  1HQ3 A;  4WU9 D;  4JJN B;  4X23 C;  5B1M D;  4CAY A;  3MGR B;  3REI A;  1P34 B;  4KGC D;  2NZD D;  3AYW C;  4Z66 C;  3A6N D;  3AYW A;  4Z66 A;  5AV6 B;  1M18 B;  1KU5 A;  1TAF A;  5DNN D;  3W96 B;  3VH6 A;  3X1V C;  3B0C T;  5CPI C;  5E5A D;  1AOI D;  3X1V A;  5CPI A;  1ID3 A;  3WTP C;  3AZM C;  4Z2M H;  4J8U D;  3WTP A;  3KXB C;  3KXB A;  5B31 C;  3NQJ A;  4EO5 B;  4AWL C;  5B31 A;  4CSR B;  5GT0 C;  4QLC B; 
#chains in the Genus database with same CATH topology
 5GT0 A;  3MGP C;  3MGP A;  3H0M C;  2YFW B;  5BNX B;  3H0R C;  3B6F D;  1P3O D;  3X1T D;  5AV5 D;  3C1B B;  2HIO D;  3P5J B;  3VH6 W;  3WTP E;  3O62 C;  3KUY D;  4J8X D;  5GSU D;  5GT3 B;  4R8P A;  4JJN C;  2DQN C;  4JJN A;  3X1S B;  3MGS D;  2CV5 A;  2JSS A;  3VH5 T;  3AZL C;  3WKJ D;  4H9O B;  3MGR C;  3EPH A;  5B0Z D;  1Z2C B;  3REJ D;  4J8W D;  3AZL A;  1P34 C;  3AFA B;  1P34 A;  5B32 G;  4KUD D;  3UT9 D;  5AY8 D;  5AV6 C;  1M18 C;  5AV6 A;  3W96 C;  1M18 A;  5G49 B;  4DRA A;  5CP6 D;  3W96 A;  3AZG D;  3AZJ D;  1Q9C A;  3WA9 B;  5B1M C;  2NQB D;  5B1M A;  4EO5 C;  3LEL D;  1TZY D;  1H3O B;  2NZD C;  4CSR A;  2NZD A;  3IP4 C;  4G91 B;  4QLC C;  3W99 B;  4QLC A;  3A6N A;  2F8N K;  1KX3 D;  3B0C W;  2YFW A;  5BNX A;  1B6W A;  3UTA B;  5B0Y B;  3MVD D;  1P3G B;  2Y2H A;  5E5A A;  3C1B C;  1KX4 D;  4E44 A;  3C1B A;  2CWE A;  3REI B;  5B33 D;  1P3K B;  5B40 D;  5GT3 C;  2FJ7 D;  5AVC B;  5GT3 A;  4Z66 B;  3TU4 D;  3X1S C;  4LD9 D;  5F99 D;  3AL0 C;  1TAF B;  5DNM D;  1PZR A;  4H9O A;  1F66 D;  3AFA C;  3X1V B;  5CPI B;  3AFA A;  3UTB B;  5B2I D;  3X1U B;  1ID3 B;  2HUE B;  3REK B;  5AV8 D;  5JRG B;  2G5I C;  3AZK B;  3NQJ B;  3AZH D;  3X1T A;  1P3O A;  5B31 B;  3VH6 T;  1HTA A;  5GSU A;  3LZ0 D;  3WA9 C;  1S32 B;  2PYO D;  1P3I D;  3WA9 A;  3AZI B;  2Y2J A;  5B0Z C;  2XD5 A;  3AV2 D;  5B0Z A;  3EPL A;  4ZBJ B;  4G91 C;  2ARO B;  3W99 C;  5B24 D;  3C1C B;  3A1I A;  4M6B A;  5AY8 A;  3UTA C;  4R8P B;  2LY8 A;  5B0Y C;  5B32 B;  3UTA A;  3KWQ B;  5BT1 C;  5AVB D;  5B0Y A;  3AZE D;  1P3G C;  1P3G A;  4YM6 B;  1U35 D;  2CV5 B;  5CPJ D;  4ZUX D;  3AZJ A;  1P3M D;  3B6G D;  3AZL B;  3REI C;  1P3K C;  1P3K A;  4WU8 B;  2IO5 B;  5AVC C;  4XZQ B;  1ZLA D;  1P3L B;  5AVC A;  3B0D B;  4WZS B;  5B1L D;  3REL D;  2Y2I A;  1P3B D;  1P3A B;  3AN2 B;  4YS3 B;  2F8N D;  3UTB C;  1KX3 A;  3X1U C;  1ID3 C;  3UTB A;  4UUZ A;  3X1U A;  1M19 D;  2HUE C;  3REK C;  3AZF D;  4WU9 B;  1BFM A;  4UPK A;  5JRG C;  3REK A;  5JRG A;  5B1M B;  3AZK C;  3AZK A;  2W8S A;  3AV1 D;  3NQU B;  1F1E A;  4KGC B;  2NZD B;  2UWX A;  2BYK B;  1S32 C;  4XUJ D;  3A6N B;  1S32 A;  3AZI C;  3LJA D;  3AZI A;  2ZY4 A;  2RVQ D;  3LZ1 D;  5DNN B;  3KSY A;  1F66 C;  5AV9 D;  1AOI B;  4ZBJ C;  5E5A B;  1F66 A;  2ARO C;  2F8N H;  2ARO A;  3C1C C;  2ZY2 A;  4H9Q B;  1M1A D;  3C1C A;  4J8U B;  4R8P C;  4Z5T D;  1ULY A;  5B32 C;  3KWQ C;  3MGQ D;  5B32 A;  3KWQ A;  4YM6 C;  2CV5 C;  4YM6 A;  2Y2M A;  3LZ0 C;  4J8W B;  3AZN B;  3LZ0 A;  2PYO C;  4WU8 C;  3WAA D;  2IO5 C;  1P3P D;  4WU8 A;  2PYO A;  4XZQ C;  2YFV A;  1P3L C;  3V9R A;  4XZQ A;  1P3L A;  3W98 D;  3AV2 C;  3B0D C;  5FUG A;  3AV2 A;  3B6F B;  4WNN A;  1P3A C;  3AN2 C;  5AV5 B;  3X1T B;  4YS3 C;  1P3O B;  1P3A A;  3AN2 A;  5B24 A;  2HIO B;  3R45 B;  4YS3 A;  1W2E A;  3KUY B;  3W97 D;  4J8X B;  5GSU B;  2VQR A;  4WU9 C;  4WU9 A;  4J8V D;  3AZE A;  1U35 C;  3MGS B;  1U35 A;  2L5A A;  3WKJ B;  5BS7 C;  1P3F D;  5B0Z B;  4WJ3 C;  5GXQ D;  5BS7 A;  4KGC C;  4Z2M G;  3NQU A;  4KUD B;  3MNN D;  2Y2L A;  4KGC A;  5B2J D;  3UT9 B;  2BYK A;  5CHL B;  3A6N C;  3REH D;  5AY8 B;  5CPK D;  5DNN C;  1HQ3 D;  1P3B A;  5DNN A;  5CP6 B;  1AOI C;  5E5A C;  2Y2K A;  1AOI A;  4X23 D;  3AZG B;  3AZJ B;  2BYM A;  4H9Q A;  4J8U C;  4J8U A;  1KX5 D;  2NQB B;  1BH8 B;  4NE5 A;  3AYW D;  2F8N G;  3LEL B;  1TZY B;  4J8W C;  3AZN C;  1EQZ D;  4XUJ C;  4J8W A;  3AZN A;  4XUJ A;  1KX3 B;  4UUZ B;  3WTP D;  3AZM D;  3B6F C;  3MVD B;  2J8P A;  3B6F A;  1P3O C;  3X1T C;  5AV5 C;  1KX4 B;  3KXB D;  3F6T A;  5AV5 A;  2HIO C;  2HIO A;  3R45 A;  5B33 B;  3KUY C;  4J8X C;  4Z5T C;  3KUY A;  5B40 B;  5GSU C;  4J8X A;  4Z5T A;  2FJ7 B;  5GT0 D;  5KDM B;  3TU4 B;  4LD9 B;  3MGP D;  3MGS C;  2F2A C;  5F99 B;  3MGS A;  5DNM B;  3WKJ C;  2ZY5 A;  3REJ C;  3WKJ A;  1F66 B;  3REJ A;  4KUD C;  3WAA A;  3UT9 C;  4KUD A;  5B2I B;  3UT9 A;  3W98 A;  1R4V A;  5AY8 C;  5AV8 B;  3O62 D;  5CP6 C;  3AZH B;  5CP6 A;  4JJN D;  4NFT A;  1WWI A;  3AZG C;  3AZJ C;  2Y2Q A;  3AZG A;  3W97 A;  3LZ0 B;  3MGR D;  2PYO B;  1P34 D;  1P3I B;  2NQB C;  2YFV B;  3V9R B;  2NQB A;  1BH8 A;  2DF4 C;  2RIQ A;  3LEL C;  1TZY C;  5FUG B;  3AV2 B;  4WNN B;  3LEL A;  1TZY A;  5AV6 D;  3MNN C;  1M18 D;  3MNN A;  5B24 B;  3W96 D;  3REH A;  1KX3 C;  3EPJ A;  5BNV B;  4HGA B;  1A7W A;  3MVD C;  3AZE B;  5AVB B;  3MVD A;  1U35 B;  1KX4 C;  4X23 A;  1KX4 A;  5CPJ B;  4ZUX B;  3B6G B;  1P3M B;  5B33 C;  5B33 A;  1KX5 C;  5B40 C;  2FJ7 C;  1KX5 A;  5B40 A;  1ZLA B;  4QLC D;  3TU4 C;  2FJ7 A;  4LD9 C;  5KDM A;  3TU4 A;  5F99 C;  3B0B A;  5B1L B;  4DRB A;  3REL B;  5DNM C;  2G5H C;  5F99 A;  4LD9 A;  5DNM A;  1P3B B;  1EQZ C;  2Y2P A;  1EQZ A;  2Y2N A;  2F8N B;  2BYM B;  5B2I C;  3C1B D;  5B2I A;  1M19 B;  3AZF B;  5AV8 C;  3AZM A;  4H9N B;  5AV8 A;  5C3I B;  3AZH C;  5GT3 D;  3AZH A;  5BO0 B;  3X1S D;  3AV1 B;  3H0L C;  4NE6 A;  4XUJ B;  1P3I C;  3AFA D;  4H9P B;  1P3I A;  5B31 G;  3LJA B;  2ZM5 A;  3LZ1 B;  1N1J B;  5AV9 B;  4KHA A;  1BH9 B;  5B24 C;  4WV4 B;  5JA4 B;  1M1A B;  1WWS A;  4E45 A;  4Z5T B;  4HGA C;  5BNV A;  3O62 A;  3AZE C;  5AVB C;  3MGQ B;  3WA9 D;  5AVB A;  2Y2O A;  4ZUX C;  5CPJ C;  1P3M C;  3B6G C;  5CPJ A;  4ZUX A;  3B6G A;  1P3M A;  3REJ B;  1T3U A;  3MGR A;  3WAA B;  1P3P B;  4H9R B;  1ZLA C;  3W99 D;  1ZLA A;  3W98 B;  2XD1 A;  5B1L C;  3REL C;  5B1L A;  3REL A;  1P3B C;  3UTA D;  5B0Y D;  1P3G D;  5BT1 D;  2F8N A;  3W97 B;  1M19 C;  4H9S C;  3AZF C;  1M19 A;  4H9S A;  3REI D;  1P3K D;  3AZF A;  4J8V B;  5C3I C;  4H9N A;  4DQY B;  5AVC D;  4Z66 D;  1P3F B;  3AV1 C;  5GXQ B;  5BO0 A;  3AV1 A;  3MNN B;  5B2J B;  1JFI B;  3REH B;  3X1V D;  5CPI D;  4G92 B;  3LJA C;  4H9P A;  5CPK B;  3UTB D;  2RVQ C;  3LZ1 C;  3X1U D;  3LJA A;  1ID3 D;  3KFU G;  1HQ3 B;  3LZ1 A;  1N1J A;  5AV9 C;  3REK D;  5JRG D;  3FDD A;  5AV9 A;  4CAY B;  4X23 B;  1BH9 A;  3AZK D;  3VH5 A;  2FFF B;  1M1A C;  5B31 D;  5JA4 A;  1M1A A;  1KX5 B;  3AYW B;  3MGQ C;  1S32 D;  3AZN D;  3MGQ A;  3AZI D;  3X1S A;  3EG5 B;  1EQZ B;  4NE3 A;  2BG1 A;  3WAA C;  1P3P C;  1P3P A;  2ARO D;  4H9R A;  3C1C D;  3W98 C;  3WTP B;  3AZM B;  4R8P D;  3KXB B;  5G49 A;  5B32 D;  3KWQ D;  4AWL B;  4YM6 D;  2CV5 D;  3W97 C;  3AZL D;  5GT0 B;  3VH5 W;  4J8V C;  3MGP B;  4WU8 D;  4J8V A;  4XZQ D;  1P3L D;  1P3F C;  3A1K A;  5GXQ C;  4KHA B;  1P3F A;  5GXQ A;  1B67 A;  1H3O A;  5B2J C;  1P3A D;  3AN2 D;  3REH C;  5B2J A;  4YS3 D;  1JFI A;  2JCH A;  3W99 A;  4G92 C;  5CPK C;  5CPK A;  3O62 B;  1HQ3 C;  1HQ3 A;  4WU9 D;  4JJN B;  4X23 C;  5B1M D;  4CAY A;  3MGR B;  3REI A;  1P34 B;  4KGC D;  2NZD D;  3AYW C;  4Z66 C;  3A6N D;  3AYW A;  4Z66 A;  5AV6 B;  2ZY3 A;  1M18 B;  1KU5 A;  1TAF A;  5DNN D;  3W96 B;  3VH6 A;  3X1V C;  3B0C T;  5CPI C;  5E5A D;  1AOI D;  3X1V A;  5CPI A;  2Y2G A;  1ID3 A;  3WTP C;  2JE5 A;  3AZM C;  4Z2M H;  4J8U D;  3WTP A;  3KXB C;  3KXB A;  5B31 C;  3NQJ A;  4EO5 B;  3EPK A;  4AWL C;  5B31 A;  4CSR B;  5GT0 C;  4QLC B; 
#chains in the Genus database with same CATH homology
 5GT0 A;  3MGP C;  3MGP A;  3H0M C;  2YFW B;  5BNX B;  3H0R C;  3B6F D;  1P3O D;  3X1T D;  5AV5 D;  3C1B B;  2HIO D;  3P5J B;  3VH6 W;  3WTP E;  3O62 C;  3KUY D;  4J8X D;  5GSU D;  5GT3 B;  4R8P A;  4JJN C;  2DQN C;  4JJN A;  3X1S B;  3MGS D;  2CV5 A;  2JSS A;  3VH5 T;  3AZL C;  3WKJ D;  4H9O B;  3MGR C;  3EPH A;  5B0Z D;  1Z2C B;  3REJ D;  4J8W D;  3AZL A;  1P34 C;  3AFA B;  1P34 A;  5B32 G;  4KUD D;  3UT9 D;  5AY8 D;  5AV6 C;  1M18 C;  5AV6 A;  3W96 C;  1M18 A;  5G49 B;  4DRA A;  5CP6 D;  3W96 A;  3AZG D;  3AZJ D;  1Q9C A;  3WA9 B;  5B1M C;  2NQB D;  5B1M A;  4EO5 C;  3LEL D;  1TZY D;  1H3O B;  2NZD C;  4CSR A;  2NZD A;  3IP4 C;  4G91 B;  4QLC C;  3W99 B;  4QLC A;  3A6N A;  2F8N K;  1KX3 D;  3B0C W;  2YFW A;  5BNX A;  1B6W A;  3UTA B;  5B0Y B;  3MVD D;  1P3G B;  2Y2H A;  5E5A A;  3C1B C;  1KX4 D;  4E44 A;  3C1B A;  2CWE A;  3REI B;  5B33 D;  1P3K B;  5B40 D;  5GT3 C;  2FJ7 D;  5AVC B;  5GT3 A;  4Z66 B;  3TU4 D;  3X1S C;  4LD9 D;  5F99 D;  3AL0 C;  1TAF B;  5DNM D;  1PZR A;  4H9O A;  1F66 D;  3AFA C;  3X1V B;  5CPI B;  3AFA A;  3UTB B;  5B2I D;  3X1U B;  1ID3 B;  2HUE B;  3REK B;  5AV8 D;  5JRG B;  2G5I C;  3AZK B;  3NQJ B;  3AZH D;  3X1T A;  1P3O A;  5B31 B;  3VH6 T;  1HTA A;  5GSU A;  3LZ0 D;  3WA9 C;  1S32 B;  2PYO D;  1P3I D;  3WA9 A;  3AZI B;  2Y2J A;  5B0Z C;  2XD5 A;  3AV2 D;  5B0Z A;  3EPL A;  4ZBJ B;  4G91 C;  2ARO B;  3W99 C;  5B24 D;  3C1C B;  3A1I A;  4M6B A;  5AY8 A;  3UTA C;  4R8P B;  2LY8 A;  5B0Y C;  5B32 B;  3UTA A;  3KWQ B;  5BT1 C;  5AVB D;  5B0Y A;  3AZE D;  1P3G C;  1P3G A;  4YM6 B;  1U35 D;  2CV5 B;  5CPJ D;  4ZUX D;  3AZJ A;  1P3M D;  3B6G D;  3AZL B;  3REI C;  1P3K C;  1P3K A;  4WU8 B;  2IO5 B;  5AVC C;  4XZQ B;  1ZLA D;  1P3L B;  5AVC A;  3B0D B;  4WZS B;  5B1L D;  3REL D;  2Y2I A;  1P3B D;  1P3A B;  3AN2 B;  4YS3 B;  2F8N D;  3UTB C;  1KX3 A;  3X1U C;  1ID3 C;  3UTB A;  4UUZ A;  3X1U A;  1M19 D;  2HUE C;  3REK C;  3AZF D;  4WU9 B;  1BFM A;  4UPK A;  5JRG C;  3REK A;  5JRG A;  5B1M B;  3AZK C;  3AZK A;  2W8S A;  3AV1 D;  3NQU B;  1F1E A;  4KGC B;  2NZD B;  2UWX A;  2BYK B;  1S32 C;  4XUJ D;  3A6N B;  1S32 A;  3AZI C;  3LJA D;  3AZI A;  2ZY4 A;  2RVQ D;  3LZ1 D;  5DNN B;  3KSY A;  1F66 C;  5AV9 D;  1AOI B;  4ZBJ C;  5E5A B;  1F66 A;  2ARO C;  2F8N H;  2ARO A;  3C1C C;  2ZY2 A;  4H9Q B;  1M1A D;  3C1C A;  4J8U B;  4R8P C;  4Z5T D;  1ULY A;  5B32 C;  3KWQ C;  3MGQ D;  5B32 A;  3KWQ A;  4YM6 C;  2CV5 C;  4YM6 A;  2Y2M A;  3LZ0 C;  4J8W B;  3AZN B;  3LZ0 A;  2PYO C;  4WU8 C;  3WAA D;  2IO5 C;  1P3P D;  4WU8 A;  2PYO A;  4XZQ C;  2YFV A;  1P3L C;  3V9R A;  4XZQ A;  1P3L A;  3W98 D;  3AV2 C;  3B0D C;  5FUG A;  3AV2 A;  3B6F B;  4WNN A;  1P3A C;  3AN2 C;  5AV5 B;  3X1T B;  4YS3 C;  1P3O B;  1P3A A;  3AN2 A;  5B24 A;  2HIO B;  3R45 B;  4YS3 A;  1W2E A;  3KUY B;  3W97 D;  4J8X B;  5GSU B;  2VQR A;  4WU9 C;  4WU9 A;  4J8V D;  3AZE A;  1U35 C;  3MGS B;  1U35 A;  2L5A A;  3WKJ B;  5BS7 C;  1P3F D;  5B0Z B;  4WJ3 C;  5GXQ D;  5BS7 A;  4KGC C;  4Z2M G;  3NQU A;  4KUD B;  3MNN D;  2Y2L A;  4KGC A;  5B2J D;  3UT9 B;  2BYK A;  5CHL B;  3A6N C;  3REH D;  5AY8 B;  5CPK D;  5DNN C;  1HQ3 D;  1P3B A;  5DNN A;  5CP6 B;  1AOI C;  5E5A C;  2Y2K A;  1AOI A;  4X23 D;  3AZG B;  3AZJ B;  2BYM A;  4H9Q A;  4J8U C;  4J8U A;  1KX5 D;  2NQB B;  1BH8 B;  4NE5 A;  3AYW D;  2F8N G;  3LEL B;  1TZY B;  4J8W C;  3AZN C;  1EQZ D;  4XUJ C;  4J8W A;  3AZN A;  4XUJ A;  1KX3 B;  4UUZ B;  3WTP D;  3AZM D;  3B6F C;  3MVD B;  2J8P A;  3B6F A;  1P3O C;  3X1T C;  5AV5 C;  1KX4 B;  3KXB D;  3F6T A;  5AV5 A;  2HIO C;  2HIO A;  3R45 A;  5B33 B;  3KUY C;  4J8X C;  4Z5T C;  3KUY A;  5B40 B;  5GSU C;  4J8X A;  4Z5T A;  2FJ7 B;  5GT0 D;  5KDM B;  3TU4 B;  4LD9 B;  3MGP D;  3MGS C;  2F2A C;  5F99 B;  3MGS A;  5DNM B;  3WKJ C;  2ZY5 A;  3REJ C;  3WKJ A;  1F66 B;  3REJ A;  4KUD C;  3WAA A;  3UT9 C;  4KUD A;  5B2I B;  3UT9 A;  3W98 A;  1R4V A;  5AY8 C;  5AV8 B;  3O62 D;  5CP6 C;  3AZH B;  5CP6 A;  4JJN D;  4NFT A;  1WWI A;  3AZG C;  3AZJ C;  2Y2Q A;  3AZG A;  3W97 A;  3LZ0 B;  3MGR D;  2PYO B;  1P34 D;  1P3I B;  2NQB C;  2YFV B;  3V9R B;  2NQB A;  1BH8 A;  2DF4 C;  2RIQ A;  3LEL C;  1TZY C;  5FUG B;  3AV2 B;  4WNN B;  3LEL A;  1TZY A;  5AV6 D;  3MNN C;  1M18 D;  3MNN A;  5B24 B;  3W96 D;  3REH A;  1KX3 C;  3EPJ A;  5BNV B;  4HGA B;  1A7W A;  3MVD C;  3AZE B;  5AVB B;  3MVD A;  1U35 B;  1KX4 C;  4X23 A;  1KX4 A;  5CPJ B;  4ZUX B;  3B6G B;  1P3M B;  5B33 C;  5B33 A;  1KX5 C;  5B40 C;  2FJ7 C;  1KX5 A;  5B40 A;  1ZLA B;  4QLC D;  3TU4 C;  2FJ7 A;  4LD9 C;  5KDM A;  3TU4 A;  5F99 C;  3B0B A;  5B1L B;  4DRB A;  3REL B;  5DNM C;  2G5H C;  5F99 A;  4LD9 A;  5DNM A;  1P3B B;  1EQZ C;  2Y2P A;  1EQZ A;  2Y2N A;  2F8N B;  2BYM B;  5B2I C;  3C1B D;  5B2I A;  1M19 B;  3AZF B;  5AV8 C;  3AZM A;  4H9N B;  5AV8 A;  5C3I B;  3AZH C;  5GT3 D;  3AZH A;  5BO0 B;  3X1S D;  3AV1 B;  3H0L C;  4NE6 A;  4XUJ B;  1P3I C;  3AFA D;  4H9P B;  1P3I A;  5B31 G;  3LJA B;  2ZM5 A;  3LZ1 B;  1N1J B;  5AV9 B;  4KHA A;  1BH9 B;  5B24 C;  4WV4 B;  5JA4 B;  1M1A B;  1WWS A;  4E45 A;  4Z5T B;  4HGA C;  5BNV A;  3O62 A;  3AZE C;  5AVB C;  3MGQ B;  3WA9 D;  5AVB A;  2Y2O A;  4ZUX C;  5CPJ C;  1P3M C;  3B6G C;  5CPJ A;  4ZUX A;  3B6G A;  1P3M A;  3REJ B;  1T3U A;  3MGR A;  3WAA B;  1P3P B;  4H9R B;  1ZLA C;  3W99 D;  1ZLA A;  3W98 B;  2XD1 A;  5B1L C;  3REL C;  5B1L A;  3REL A;  1P3B C;  3UTA D;  5B0Y D;  1P3G D;  5BT1 D;  2F8N A;  3W97 B;  1M19 C;  4H9S C;  3AZF C;  1M19 A;  4H9S A;  3REI D;  1P3K D;  3AZF A;  4J8V B;  5C3I C;  4H9N A;  4DQY B;  5AVC D;  4Z66 D;  1P3F B;  3AV1 C;  5GXQ B;  5BO0 A;  3AV1 A;  3MNN B;  5B2J B;  1JFI B;  3REH B;  3X1V D;  5CPI D;  4G92 B;  3LJA C;  4H9P A;  5CPK B;  3UTB D;  2RVQ C;  3LZ1 C;  3X1U D;  3LJA A;  1ID3 D;  3KFU G;  1HQ3 B;  3LZ1 A;  1N1J A;  5AV9 C;  3REK D;  5JRG D;  3FDD A;  5AV9 A;  4CAY B;  4X23 B;  1BH9 A;  3AZK D;  3VH5 A;  2FFF B;  1M1A C;  5B31 D;  5JA4 A;  1M1A A;  1KX5 B;  3AYW B;  3MGQ C;  1S32 D;  3AZN D;  3MGQ A;  3AZI D;  3X1S A;  3EG5 B;  1EQZ B;  4NE3 A;  2BG1 A;  3WAA C;  1P3P C;  1P3P A;  2ARO D;  4H9R A;  3C1C D;  3W98 C;  3WTP B;  3AZM B;  4R8P D;  3KXB B;  5G49 A;  5B32 D;  3KWQ D;  4AWL B;  4YM6 D;  2CV5 D;  3W97 C;  3AZL D;  5GT0 B;  3VH5 W;  4J8V C;  3MGP B;  4WU8 D;  4J8V A;  4XZQ D;  1P3L D;  1P3F C;  3A1K A;  5GXQ C;  4KHA B;  1P3F A;  5GXQ A;  1B67 A;  1H3O A;  5B2J C;  1P3A D;  3AN2 D;  3REH C;  5B2J A;  4YS3 D;  1JFI A;  2JCH A;  3W99 A;  4G92 C;  5CPK C;  5CPK A;  3O62 B;  1HQ3 C;  1HQ3 A;  4WU9 D;  4JJN B;  4X23 C;  5B1M D;  4CAY A;  3MGR B;  3REI A;  1P34 B;  4KGC D;  2NZD D;  3AYW C;  4Z66 C;  3A6N D;  3AYW A;  4Z66 A;  5AV6 B;  2ZY3 A;  1M18 B;  1KU5 A;  1TAF A;  5DNN D;  3W96 B;  3VH6 A;  3X1V C;  3B0C T;  5CPI C;  5E5A D;  1AOI D;  3X1V A;  5CPI A;  2Y2G A;  1ID3 A;  3WTP C;  2JE5 A;  3AZM C;  4Z2M H;  4J8U D;  3WTP A;  3KXB C;  3KXB A;  5B31 C;  3NQJ A;  4EO5 B;  3EPK A;  4AWL C;  5B31 A;  4CSR B;  5GT0 C;  4QLC B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...