3UTBB

Crystal structure of nucleosome core particle assembled with the 146b alpha-satellite sequence (ncp146b)
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
83
structure length
83
Chain Sequence
KVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords Histone H3.2
publication title The mechanics behind DNA sequence-dependent properties of the nucleosome
pubmed doi rcsb
source organism Xenopus laevis
total genus 28
structure length 83
sequence length 83
chains with identical sequence F
ec nomenclature
pdb deposition date 2011-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3utbB00
3VH5T 3TU4D 3X1TB 3VH6W 3LZ1C 3KWQA 3AZLB 3REIA 5CPJB 4NE3A 2CV5B 3LZ0C 3B0CW 1KX5D 1BH8B 4H9RB 2NQBC 4KHAA 2F8NK 3MGQD 4HGAB 1P3PD 1P3GD 3AZGC 5B40C 3REJA 3AFAD 1P3OB 4CSRB 5CPIC 5BNVA 1M18D 2YFVB 5KDMB 1TAFA 3AZIB 4R8PC 3VH5W 1P3AD 5B32G 3AN2C 2AROC 4J8XD 5B0YD 1P3LD 3AZEA 5B1MA 3V9RB 4JJNB 5B24A 5AV5A 5B32D 1P3FB 3AZHC 3KUYA 1P3IC 3W99B 1M19C 4H9PA 3TU4C 2FJ7D 4XUJD 5B2ID 1WWIA 4WU8B 3C1BA 3AZND 1AOID 3WA9A 5BS7C 3MGPA 1KX5C 5AV8A 5B0ZA 4J8WA 3R45A 5DNMA 3AZKB 1ID3B 5B33A 5B1LB 1P3PC 1TZYB 5B2JC 1P3GC 3KWQD 4YS3B 3REID 3AFAC 5AV6B 2F8NH 1P3MB 4UUZA 3W96A 3MGSA 3LJAA 3MGRA 1M18C 5AVBD 4KGCA 5CPKD 5B0YC 1P3LC 4ZBJB 3LZ1B 4X23B 1U35A 5AY8A 5B32C 5DNNA 3B6GA 3AV1D 4XZQA 4YM6A 2YFWB 4QLCB 1P3BB 2HUEC 2NQBB 3O62B 2FJ7C 4XUJC 5B2IC 5GXQB 1A7WA 5GT3A 5F99B 5B1MD 3AZED 3AZGB 5B40B 1P3KC 3X1VA 4J8UA 2PYOB 5AV5D 3AZNC 1AOIC 1N1JA 3KUYD 5CPIB 5C3IB 4Z66B 3KXBA 1EQZA 4R8PB 3UT9B 2AROB 3KWQC 5BO0A 3REIC 4E44A 2LY8A 3C1CB 3AZFB 3WAAB 3WA9D 3MGPD 5AV8D 5B0ZD 3AYWA 5DNMD 5CP6A 5B33D 3MVDB 1P34D 3AZMB 3W98B 3REJC 3W96D 3MGSD 3LJAD 3MGRD 3REHC 1P3AA 4KGCD 1KX3B 3W97A 5G49B 1HQ3B 4WU9B 5B2JB 3AZEC 5B1MC 3B6FB 2NZDD 4G91C 1U35D 5B24C 5AV5C 5AY8D 3AFAB 4Z5TA 3KUYC 2RVQD 5GT0A 4YM6D 5GSUB 5AV9A 5B31C 1S32B 1F66D 5GT3D 4H9OA 1B67A 4CAYA 3X1VD 3MNNA 4J8UD 4E45A 3C1BC 1P3LB 3WA9C 3B0BA 3WTPB 3MGPC 5AV8C 5B0ZC 4J8WC 5DNMC 1ULYA 4KUDD 5B33C 5JA4A 3REKA 3KXBD 1EQZD 1M1AA 3UTBA 3AZJB 2BYKA 3X1SA 3W96C 4XUJB 3LJAC 3MGSC 3MGRC 1P3KB 1H3OB 3UTAC 3AYWD 4LD9A 3X1UB 5AVBA 5CP6D 3X1TA 3AZLA 5CHLB 3KSYA 4H9NB 4H9SA 4KGCC 5CPKA 5CPJA 2CV5A 4J8VD 2BYMA 1BH8A 1U35C 4H9RA 5AY8C 3B6GC 5DNNC 4AWLB 3AV1A 4XZQC 2RVQC 2F8NB 4YM6C 3W97D 4KHAB 4CSRA 3B0DC 1KX4C 3X1VC 5KDMA 4J8UC 3REJB 3AZIA 4Z5TD 1B6WA 5GT0D 5BNVB 5AV9D 3AV2C 2HIOB 5E5AB 3KXBC 3RELB 1EQZC 3V9RA 3REHB 4JJNA 1P3FA 3NQUA 3MNND 3W99A 5AVCB 4G91B 5B24B 1ZLAB 3AYWC 3REKD 5FUGB 3MGQC 1P34A 5B31B 1M1AD 4NE6A 3UTBD 3X1SD 3A6NB 3AZKA 1ID3A 3C1BB 1Q9CA 2IO5C 5B1LA 3LELB 4LD9D 3X1TD 5B0ZB 4J8WB 3AZLD 1P3AC 3W97C 5CPJD 1P3MA 4J8XC 2CV5D 5JRGA 2NZDA 5BNXA 4Z5TC 4UUZB 3W96B 3LZ0B 5GT0C 5AV9C 3UTAB 1P3OD 4KGCB 4X23A 1F66A 3MNNC 3AZID 1HTAA 2YFWA 4QLCA 1P3BA 3B6GB 2NQBA 5DNNB 1BFMA 3O62A 3REKC 4KUDA 3NQJB 4XZQB 5GXQA 4YM6B 5F99A 2PYOA 5B40A 4JJND 3AN2B 1M1AC 1P3FD 1BH9B 3W99D 3X1SC 5BT1D 4LD9B 3B0DB 1KX4B 4DRBA 4Z66A 4R8PA 1N1JB 5AVBC 3UT9A 2AROA 3AZHB 3X1TC 1P3IB 4H9SC 4WU8D 5CPKC 5CPJC 1M19B 3AV2B 3C1CA 3AZFA 2CV5C 3WAAA 4ZUXA 4J8VA 3TU4B 3WKJA 5BO0B 3AZKD 1ID3D 3MVDA 1WWSA 4HGAC 5B1LD 3AZMA 1TZYD 3AV1C 3W98A 1KX5B 4YS3D 2L5AA 1P3MD 5JRGD 3MGQB 1P3PB 1P3GB 1KX3A 1HQ3A 1M18B 4WU9A 4Z2MG 5B2JA 3B6FA 3LZ1D 1P3AB 4X23D 4JJNC 1P3FC 4J8XB 5B0YB 3W99C 5GSUA 3VH6A 4QLCD 1P3BD 1JFIB 2NQBD 4H9QB 5B32B 4WZSB 3O62D 1S32A 5GXQD 1P34C 5F99D 3AZGD 2PYOD 5B40D 2HUEB 3WTPA 1KU5A 4NFTA 2FJ7B 5B2IB 3AZKC 1ID3C 3MNNB 4Z66D 5B1LC 4R8PD 3AZNB 1AOIB 3UT9D 2AROD 3AZJA 5JA4B 3C1CD 3REKB 3AZFD 4ZUXD 5JRGC 4WNNB 3WAAD 1P3KA 1H3OA 3WKJD 2NZDC 3KWQB 4DRAA 3X1UA 3REIB 3MVDD 4H9NA 3AZMD 3W98D 4ZBJC 5AVBB 2CWEA 4M6BA 4X23C 1P3OA 5CPKB 1F66C 5GT3C 2YFVA 2F8NA 2BYMB 4QLCC 4WV4B 1P3BC 1KX3D 1HQ3D 3O62C 4WU9D 3AV1B 4KUDC 5GXQC 5B2JD 1TAFB 5F99C 2PYOC 3B6FD 5GSUD 3AZEB 5B1MB 5C3IC 2HIOA 5E5AA 4Z66C 3RELA 5AV5B 3REHA 3UT9C 1S32D 5CP6C 3KUYB 4WU8A 3WAAC 3C1CC 3AZFC 4ZUXC 4EO5C 5AVCA 3WTPD 4J8VC 4H9PB 1ZLAA 3WKJC 3NQUB 3MVDC 5FUGA 3AZMC 1TZYA 3WA9B 5B31A 3W98C 3MGPB 4G92C 5AV8B 4YS3A 3R45B 5DNMB 5AV6A 3AZJD 5B33B 3A6NA 1P34B 1P3KD 3LELA 3X1UD 1KX3C 3MGSB 3LJAB 2F8NG 3MGRB 1HQ3C 4WU9C 3B6FC 3LZ1A 5JRGB 2F8ND 3LZ0A 5GSUC 3UTAA 2NZDB 5BNXB 1U35B 5AY8B 1S32C 3AZGA 3REJD 3WTPC 3UTBC 1F66B 5GT3B 5CPIA 2HIOD 3NQJA 5E5AD 4J8UB 3RELD 3X1VB 4LD9C 3REHD 3AN2A 3AZLC 1BH9A 3AZJC 4KUDB 5B31G 3KXBB 1KX4A 5AVCD 1EQZB 5B24D 1ZLAD 3X1UC 3AZHA 1P3IA 1M19A 5B31D 3AV2A 3AYWB 5AV6D 3TU4A 5CP6B 1P3OC 3A6ND 3C1BD 3LELD 4ZUXB 4AWLC 4EO5B 4J8VB 5BS7A 3AZIC 4J8WD 1KX5A 3WKJB 5G49A 3MGQA 2IO5B 1P3PA 1P3GA 4G92B 3AFAA 3W97B 3WTPE 3LZ0D 4Z2MH 5BT1C 1M18A 3UTAD 2HIOC 4NE5A 5E5AC 3RELC 4Z5TB 5GT0B 5B0YA 4J8XA 4WU8C 5AV9B 1P3LA 2JSSA 5AVCC 1ZLAC 1JFIA 3VH6T 3B6GD 4H9QA 5DNND 5B32A 5CPID 4H9OB 4CAYB 4XZQD 1TZYC 3B0CT 3AN2D 4YS3C 5AV6C 1P3MC 2FJ7A 4XUJA 5B2IA 3A6NC 1KX4D 1R4VA 1F1EA 3VH5A 3LELC 1M1AB 3AZNA 1AOIA 3AZHD 3UTBB 1P3ID 2BYKB 3X1SB 1M19D 3AV2D 4WNNA
chains in the Genus database with same CATH superfamily
3VH5T 3TU4D 3X1TB 3VH6W 3LZ1C 3KWQA 3AZLB 3REIA 3FDDA 5CPJB 4NE3A 2CV5B 3LZ0C 3B0CW 1KX5D 1BH8B 4H9RB 2J8PA 2NQBC 4KHAA 2F8NK 3MGQD 4HGAB 1P3PD 1P3GD 3AZGC 5B40C 3REJA 3AFAD 1P3OB 4CSRB 5CPIC 5BNVA 1M18D 2YFVB 5KDMB 1TAFA 3AZIB 4R8PC 3VH5W 1P3AD 5B32G 3AN2C 2AROC 4J8XD 5B0YD 1P3LD 3AZEA 5B1MA 3V9RB 4JJNB 5B24A 5AV5A 5B32D 1P3FB 3AZHC 3KUYA 1P3IC 3W99B 1M19C 4H9PA 3TU4C 2FJ7D 4XUJD 5B2ID 2JCHA 1WWIA 4WU8B 3C1BA 3AZND 1AOID 3WA9A 5BS7C 3MGPA 1KX5C 5AV8A 5B0ZA 4J8WA 3R45A 5DNMA 3AZKB 1ID3B 5B33A 5B1LB 1P3PC 1TZYB 5B2JC 1P3GC 3KWQD 4YS3B 3REID 3AFAC 5AV6B 2F8NH 1P3MB 4UUZA 3W96A 3MGSA 3LJAA 3MGRA 1M18C 5AVBD 4KGCA 2Y2KA 5CPKD 5B0YC 1P3LC 3EPKA 4ZBJB 3LZ1B 4X23B 1U35A 5AY8A 5B32C 5DNNA 3B6GA 3AV1D 4XZQA 4YM6A 2ZY5A 2W8SA 2YFWB 4QLCB 1P3BB 2HUEC 2NQBB 3O62B 2FJ7C 4XUJC 5B2IC 5GXQB 1A7WA 5GT3A 5F99B 5B1MD 3AZED 3AZGB 5B40B 1P3KC 3X1VA 4J8UA 2PYOB 5AV5D 3AZNC 1AOIC 1N1JA 3KUYD 2Y2NA 2F2AC 5CPIB 5C3IB 4Z66B 3KXBA 1EQZA 4R8PB 2BG1A 3UT9B 2AROB 3KWQC 3F6TA 5BO0A 3REIC 4E44A 2LY8A 3C1CB 3AZFB 3WAAB 3WA9D 2Y2LA 3MGPD 5AV8D 5B0ZD 2ZM5A 3AYWA 5DNMD 5CP6A 5B33D 3MVDB 1P34D 3AZMB 3W98B 3REJC 3W96D 3MGSD 3LJAD 3MGRD 2JE5A 3REHC 1P3AA 4KGCD 1KX3B 3W97A 5G49B 3EPJA 1HQ3B 4WU9B 5B2JB 3AZEC 5B1MC 3B6FB 2NZDD 4G91C 1U35D 5B24C 5AV5C 5AY8D 3AFAB 4Z5TA 3EPHA 3KUYC 2RVQD 5GT0A 4YM6D 5GSUB 2ZY4A 5AV9A 5B31C 1S32B 1F66D 5GT3D 4H9OA 1B67A 3KFUG 4CAYA 3X1VD 3MNNA 4J8UD 4E45A 3C1BC 1P3LB 3WA9C 3B0BA 3WTPB 3MGPC 5AV8C 5B0ZC 4J8WC 5DNMC 1ULYA 4KUDD 5B33C 5JA4A 3REKA 3KXBD 1EQZD 3IP4C 1M1AA 3UTBA 3AZJB 2BYKA 3X1SA 3W96C 4XUJB 3LJAC 3MGSC 3MGRC 1P3KB 1H3OB 3UTAC 3AYWD 4LD9A 3X1UB 5AVBA 5CP6D 3X1TA 3AZLA 5CHLB 3KSYA 3P5JB 4H9NB 4H9SA 4KGCC 5CPKA 5CPJA 2CV5A 4J8VD 2BYMA 1BH8A 1U35C 4H9RA 5AY8C 3B6GC 5DNNC 4AWLB 3AV1A 4XZQC 2RVQC 2F8NB 4YM6C 3W97D 4KHAB 4CSRA 3B0DC 1KX4C 3X1VC 5KDMA 4J8UC 3REJB 3AZIA 4Z5TD 1B6WA 5GT0D 5BNVB 3H0LC 5AV9D 3AV2C 2HIOB 5E5AB 3KXBC 3RELB 1EQZC 3V9RA 3REHB 4JJNA 1P3FA 3NQUA 3MNND 3W99A 2Y2GA 5AVCB 4G91B 5B24B 1ZLAB 3AYWC 3REKD 5FUGB 3MGQC 1P34A 5B31B 1M1AD 4NE6A 3UTBD 3X1SD 2Y2PA 3A6NB 3AZKA 1ID3A 3C1BB 1Q9CA 2IO5C 2Y2HA 5B1LA 3LELB 4LD9D 3X1TD 5B0ZB 4J8WB 3AZLD 1P3AC 3W97C 5CPJD 1P3MA 2G5HC 4J8XC 2CV5D 5JRGA 2NZDA 5BNXA 4Z5TC 4UUZB 3W96B 3LZ0B 5GT0C 5AV9C 3UTAB 3H0MC 1P3OD 4KGCB 4X23A 1F66A 3MNNC 3AZID 1HTAA 2YFWA 4QLCA 1P3BA 3B6GB 2NQBA 5DNNB 1BFMA 3O62A 3REKC 4KUDA 3NQJB 4XZQB 5GXQA 4YM6B 5F99A 2PYOA 5B40A 4JJND 3AN2B 1M1AC 1P3FD 1BH9B 3W99D 3EG5B 5BT1D 3X1SC 4LD9B 3B0DB 1KX4B 4DRBA 4Z66A 4R8PA 1N1JB 5AVBC 3UT9A 2AROA 2G5IC 3AZHB 2DF4C 2XD5A 4H9SC 3X1TC 1P3IB 4WU8D 5CPKC 5CPJC 1M19B 3AV2B 3C1CA 3AZFA 2CV5C 3WAAA 1Z2CB 4ZUXA 4J8VA 3TU4B 3WKJA 5BO0B 3AZKD 1ID3D 2RIQA 3MVDA 1WWSA 4HGAC 5B1LD 3AZMA 1TZYD 3AV1C 1T3UA 3W98A 1KX5B 4YS3D 2L5AA 1P3MD 5JRGD 3MGQB 1P3PB 2Y2QA 1P3GB 1KX3A 2FFFB 1HQ3A 1M18B 4WU9A 4Z2MG 5B2JA 3B6FA 3LZ1D 1P3AB 4X23D 4JJNC 1P3FC 4J8XB 5B0YB 1PZRA 3W99C 5GSUA 3VH6A 4QLCD 1P3BD 1JFIB 3A1IA 2NQBD 4H9QB 5B32B 4WZSB 3O62D 1S32A 5GXQD 1P34C 5F99D 3AZGD 2PYOD 5B40D 2HUEB 3WTPA 1KU5A 4NFTA 2FJ7B 5B2IB 3AZKC 1ID3C 3MNNB 4Z66D 5B1LC 4R8PD 3AZNB 1AOIB 3UT9D 2AROD 3AZJA 5JA4B 3C1CD 3REKB 3AZFD 4ZUXD 5JRGC 4WNNB 3WAAD 1P3KA 1H3OA 3WKJD 2NZDC 3KWQB 4DRAA 3X1UA 3REIB 3MVDD 4H9NA 3AZMD 3W98D 3H0RC 4ZBJC 5AVBB 2CWEA 4M6BA 4X23C 1P3OA 5CPKB 1F66C 5GT3C 2YFVA 2F8NA 1W2EA 2BYMB 4QLCC 4WV4B 1P3BC 1KX3D 1HQ3D 3O62C 4WU9D 3AV1B 4KUDC 5GXQC 5B2JD 1TAFB 5F99C 2PYOC 3B6FD 4WJ3C 3AL0C 5GSUD 3AZEB 5B1MB 5C3IC 2HIOA 5E5AA 4Z66C 3RELA 5AV5B 3REHA 3UT9C 1S32D 5CP6C 3KUYB 4WU8A 3WAAC 3C1CC 3AZFC 4ZUXC 4EO5C 5AVCA 3WTPD 4J8VC 2DQNC 4H9PB 1ZLAA 3WKJC 2ZY2A 3NQUB 2Y2OA 3MVDC 5FUGA 3AZMC 1TZYA 3WA9B 5B31A 3W98C 3MGPB 4G92C 5AV8B 2Y2MA 4YS3A 3R45B 5DNMB 5AV6A 3AZJD 5B33B 3A6NA 1P34B 1P3KD 3LELA 3X1UD 2UWXA 1KX3C 3MGSB 3LJAB 2F8NG 3MGRB 1HQ3C 4WU9C 3B6FC 3LZ1A 5JRGB 2F8ND 3LZ0A 5GSUC 3UTAA 2NZDB 5BNXB 1U35B 5AY8B 3EPLA 1S32C 3AZGA 3REJD 3WTPC 3UTBC 1F66B 5GT3B 5CPIA 3A1KA 2HIOD 3NQJA 5E5AD 4J8UB 3RELD 3X1VB 4LD9C 3REHD 3AN2A 2XD1A 3AZLC 1BH9A 3AZJC 4KUDB 5B31G 3KXBB 1KX4A 5AVCD 1EQZB 5B24D 1ZLAD 3X1UC 3AZHA 2VQRA 1P3IA 1M19A 2ZY3A 5B31D 3AV2A 3AYWB 5AV6D 3TU4A 5CP6B 1P3OC 3A6ND 3C1BD 3LELD 4ZUXB 4AWLC 4EO5B 4J8VB 5BS7A 3AZIC 4J8WD 1KX5A 3WKJB 5G49A 3MGQA 2IO5B 1P3PA 1P3GA 4G92B 3AFAA 3W97B 3WTPE 3LZ0D 4Z2MH 5BT1C 4DQYB 1M18A 3UTAD 2HIOC 4NE5A 5E5AC 3RELC 4Z5TB 5GT0B 5B0YA 4J8XA 4WU8C 5AV9B 1P3LA 2JSSA 5AVCC 4UPKA 2Y2JA 1ZLAC 1JFIA 3VH6T 3B6GD 4H9QA 5DNND 5B32A 5CPID 4H9OB 4CAYB 4XZQD 1TZYC 3B0CT 3AN2D 4YS3C 5AV6C 1P3MC 2FJ7A 4XUJA 5B2IA 3A6NC 1KX4D 1R4VA 1F1EA 3VH5A 3LELC 1M1AB 3AZNA 1AOIA 3AZHD 3UTBB 1P3ID 2BYKB 3X1SB 2Y2IA 1M19D 3AV2D 4WNNA
chains in the Genus database with same CATH topology
3VH5T 3TU4D 3X1TB 3VH6W 3LZ1C 3KWQA 3AZLB 3REIA 3FDDA 5CPJB 4NE3A 2CV5B 3LZ0C 3B0CW 1KX5D 1BH8B 4H9RB 2J8PA 2NQBC 4KHAA 2F8NK 3MGQD 4HGAB 1P3PD 1P3GD 3AZGC 5B40C 3REJA 3AFAD 1P3OB 4CSRB 5CPIC 5BNVA 1M18D 2YFVB 5KDMB 1TAFA 3AZIB 4R8PC 3VH5W 1P3AD 5B32G 3AN2C 2AROC 4J8XD 5B0YD 1P3LD 3AZEA 5B1MA 3V9RB 4JJNB 5B24A 5AV5A 5B32D 1P3FB 3AZHC 3KUYA 1P3IC 3W99B 1M19C 4H9PA 3TU4C 2FJ7D 4XUJD 5B2ID 2JCHA 1WWIA 4WU8B 3C1BA 3AZND 1AOID 3WA9A 5BS7C 3MGPA 1KX5C 5AV8A 5B0ZA 4J8WA 3R45A 5DNMA 3AZKB 1ID3B 5B33A 5B1LB 1P3PC 1TZYB 5B2JC 1P3GC 3KWQD 4YS3B 3REID 3AFAC 5AV6B 2F8NH 1P3MB 4UUZA 3W96A 3MGSA 3LJAA 3MGRA 1M18C 5AVBD 4KGCA 2Y2KA 5CPKD 5B0YC 1P3LC 3EPKA 4ZBJB 3LZ1B 4X23B 1U35A 5AY8A 5B32C 5DNNA 3B6GA 3AV1D 4XZQA 4YM6A 2ZY5A 2W8SA 2YFWB 4QLCB 1P3BB 2HUEC 2NQBB 3O62B 2FJ7C 4XUJC 5B2IC 5GXQB 1A7WA 5GT3A 5F99B 5B1MD 3AZED 3AZGB 5B40B 1P3KC 3X1VA 4J8UA 2PYOB 5AV5D 3AZNC 1AOIC 1N1JA 3KUYD 2Y2NA 2F2AC 5CPIB 5C3IB 4Z66B 3KXBA 1EQZA 4R8PB 2BG1A 3UT9B 2AROB 3KWQC 3F6TA 5BO0A 3REIC 4E44A 2LY8A 3C1CB 3AZFB 3WAAB 3WA9D 2Y2LA 3MGPD 5AV8D 5B0ZD 2ZM5A 3AYWA 5DNMD 5CP6A 5B33D 3MVDB 1P34D 3AZMB 3W98B 3REJC 3W96D 3MGSD 3LJAD 3MGRD 2JE5A 3REHC 1P3AA 4KGCD 1KX3B 3W97A 5G49B 3EPJA 1HQ3B 4WU9B 5B2JB 3AZEC 5B1MC 3B6FB 2NZDD 4G91C 1U35D 5B24C 5AV5C 5AY8D 3AFAB 4Z5TA 3EPHA 3KUYC 2RVQD 5GT0A 4YM6D 5GSUB 2ZY4A 5AV9A 5B31C 1S32B 1F66D 5GT3D 4H9OA 1B67A 3KFUG 4CAYA 3X1VD 3MNNA 4J8UD 4E45A 3C1BC 1P3LB 3WA9C 3B0BA 3WTPB 3MGPC 5AV8C 5B0ZC 4J8WC 5DNMC 1ULYA 4KUDD 5B33C 5JA4A 3REKA 3KXBD 1EQZD 3IP4C 1M1AA 3UTBA 3AZJB 2BYKA 3X1SA 3W96C 4XUJB 3LJAC 3MGSC 3MGRC 1P3KB 1H3OB 3UTAC 3AYWD 4LD9A 3X1UB 5AVBA 5CP6D 3X1TA 3AZLA 5CHLB 3KSYA 3P5JB 4H9NB 4H9SA 4KGCC 5CPKA 5CPJA 2CV5A 4J8VD 2BYMA 1BH8A 1U35C 4H9RA 5AY8C 3B6GC 5DNNC 4AWLB 3AV1A 4XZQC 2RVQC 2F8NB 4YM6C 3W97D 4KHAB 4CSRA 3B0DC 1KX4C 3X1VC 5KDMA 4J8UC 3REJB 3AZIA 4Z5TD 1B6WA 5GT0D 5BNVB 3H0LC 5AV9D 3AV2C 2HIOB 5E5AB 3KXBC 3RELB 1EQZC 3V9RA 3REHB 4JJNA 1P3FA 3NQUA 3MNND 3W99A 2Y2GA 5AVCB 4G91B 5B24B 1ZLAB 3AYWC 3REKD 5FUGB 3MGQC 1P34A 5B31B 1M1AD 4NE6A 3UTBD 3X1SD 2Y2PA 3A6NB 3AZKA 1ID3A 3C1BB 1Q9CA 2IO5C 2Y2HA 5B1LA 3LELB 4LD9D 3X1TD 5B0ZB 4J8WB 3AZLD 1P3AC 3W97C 5CPJD 1P3MA 2G5HC 4J8XC 2CV5D 5JRGA 2NZDA 5BNXA 4Z5TC 4UUZB 3W96B 3LZ0B 5GT0C 5AV9C 3UTAB 3H0MC 1P3OD 4KGCB 4X23A 1F66A 3MNNC 3AZID 1HTAA 2YFWA 4QLCA 1P3BA 3B6GB 2NQBA 5DNNB 1BFMA 3O62A 3REKC 4KUDA 3NQJB 4XZQB 5GXQA 4YM6B 5F99A 2PYOA 5B40A 4JJND 3AN2B 1M1AC 1P3FD 1BH9B 3W99D 3EG5B 5BT1D 3X1SC 4LD9B 3B0DB 1KX4B 4DRBA 4Z66A 4R8PA 1N1JB 5AVBC 3UT9A 2AROA 2G5IC 3AZHB 2DF4C 2XD5A 4H9SC 3X1TC 1P3IB 4WU8D 5CPKC 5CPJC 1M19B 3AV2B 3C1CA 3AZFA 2CV5C 3WAAA 1Z2CB 4ZUXA 4J8VA 3TU4B 3WKJA 5BO0B 3AZKD 1ID3D 2RIQA 3MVDA 1WWSA 4HGAC 5B1LD 3AZMA 1TZYD 3AV1C 1T3UA 3W98A 1KX5B 4YS3D 2L5AA 1P3MD 5JRGD 3MGQB 1P3PB 2Y2QA 1P3GB 1KX3A 2FFFB 1HQ3A 1M18B 4WU9A 4Z2MG 5B2JA 3B6FA 3LZ1D 1P3AB 4X23D 4JJNC 1P3FC 4J8XB 5B0YB 1PZRA 3W99C 5GSUA 3VH6A 4QLCD 1P3BD 1JFIB 3A1IA 2NQBD 4H9QB 5B32B 4WZSB 3O62D 1S32A 5GXQD 1P34C 5F99D 3AZGD 2PYOD 5B40D 2HUEB 3WTPA 1KU5A 4NFTA 2FJ7B 5B2IB 3AZKC 1ID3C 3MNNB 4Z66D 5B1LC 4R8PD 3AZNB 1AOIB 3UT9D 2AROD 3AZJA 5JA4B 3C1CD 3REKB 3AZFD 4ZUXD 5JRGC 4WNNB 3WAAD 1P3KA 1H3OA 3WKJD 2NZDC 3KWQB 4DRAA 3X1UA 3REIB 3MVDD 4H9NA 3AZMD 3W98D 3H0RC 4ZBJC 5AVBB 2CWEA 4M6BA 4X23C 1P3OA 5CPKB 1F66C 5GT3C 2YFVA 2F8NA 1W2EA 2BYMB 4QLCC 4WV4B 1P3BC 1KX3D 1HQ3D 3O62C 4WU9D 3AV1B 4KUDC 5GXQC 5B2JD 1TAFB 5F99C 2PYOC 3B6FD 4WJ3C 3AL0C 5GSUD 3AZEB 5B1MB 5C3IC 2HIOA 5E5AA 4Z66C 3RELA 5AV5B 3REHA 3UT9C 1S32D 5CP6C 3KUYB 4WU8A 3WAAC 3C1CC 3AZFC 4ZUXC 4EO5C 5AVCA 3WTPD 4J8VC 2DQNC 4H9PB 1ZLAA 3WKJC 2ZY2A 3NQUB 2Y2OA 3MVDC 5FUGA 3AZMC 1TZYA 3WA9B 5B31A 3W98C 3MGPB 4G92C 5AV8B 2Y2MA 4YS3A 3R45B 5DNMB 5AV6A 3AZJD 5B33B 3A6NA 1P34B 1P3KD 3LELA 3X1UD 2UWXA 1KX3C 3MGSB 3LJAB 2F8NG 3MGRB 1HQ3C 4WU9C 3B6FC 3LZ1A 5JRGB 2F8ND 3LZ0A 5GSUC 3UTAA 2NZDB 5BNXB 1U35B 5AY8B 3EPLA 1S32C 3AZGA 3REJD 3WTPC 3UTBC 1F66B 5GT3B 5CPIA 3A1KA 2HIOD 3NQJA 5E5AD 4J8UB 3RELD 3X1VB 4LD9C 3REHD 3AN2A 2XD1A 3AZLC 1BH9A 3AZJC 4KUDB 5B31G 3KXBB 1KX4A 5AVCD 1EQZB 5B24D 1ZLAD 3X1UC 3AZHA 2VQRA 1P3IA 1M19A 2ZY3A 5B31D 3AV2A 3AYWB 5AV6D 3TU4A 5CP6B 1P3OC 3A6ND 3C1BD 3LELD 4ZUXB 4AWLC 4EO5B 4J8VB 5BS7A 3AZIC 4J8WD 1KX5A 3WKJB 5G49A 3MGQA 2IO5B 1P3PA 1P3GA 4G92B 3AFAA 3W97B 3WTPE 3LZ0D 4Z2MH 5BT1C 4DQYB 1M18A 3UTAD 2HIOC 4NE5A 5E5AC 3RELC 4Z5TB 5GT0B 5B0YA 4J8XA 4WU8C 5AV9B 1P3LA 2JSSA 5AVCC 4UPKA 2Y2JA 1ZLAC 1JFIA 3VH6T 3B6GD 4H9QA 5DNND 5B32A 5CPID 4H9OB 4CAYB 4XZQD 1TZYC 3B0CT 3AN2D 4YS3C 5AV6C 1P3MC 2FJ7A 4XUJA 5B2IA 3A6NC 1KX4D 1R4VA 1F1EA 3VH5A 3LELC 1M1AB 3AZNA 1AOIA 3AZHD 3UTBB 1P3ID 2BYKB 3X1SB 2Y2IA 1M19D 3AV2D 4WNNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VH5 T;  3TU4 D;  3X1T B;  3VH6 W;  3LZ1 C;  3KWQ A;  3AZL B;  3REI A;  5CPJ B;  4NE3 A;  2CV5 B;  3LZ0 C;  3B0C W;  1KX5 D;  1BH8 B;  4H9R B;  2NQB C;  4KHA A;  2F8N K;  3MGQ D;  4HGA B;  1P3P D;  1P3G D;  3AZG C;  5B40 C;  3REJ A;  3AFA D;  1P3O B;  4CSR B;  5CPI C;  5BNV A;  1M18 D;  2YFV B;  5KDM B;  1TAF A;  3AZI B;  4R8P C;  3VH5 W;  1P3A D;  5B32 G;  3AN2 C;  2ARO C;  4J8X D;  5B0Y D;  1P3L D;  3AZE A;  5B1M A;  3V9R B;  4JJN B;  5B24 A;  5AV5 A;  5B32 D;  1P3F B;  3AZH C;  3KUY A;  1P3I C;  3W99 B;  1M19 C;  4H9P A;  3TU4 C;  2FJ7 D;  4XUJ D;  5B2I D;  1WWI A;  4WU8 B;  3C1B A;  3AZN D;  1AOI D;  3WA9 A;  5BS7 C;  3MGP A;  1KX5 C;  5AV8 A;  5B0Z A;  4J8W A;  3R45 A;  5DNM A;  3AZK B;  1ID3 B;  5B33 A;  5B1L B;  1P3P C;  1TZY B;  5B2J C;  1P3G C;  3KWQ D;  4YS3 B;  3REI D;  3AFA C;  5AV6 B;  2F8N H;  1P3M B;  4UUZ A;  3W96 A;  3MGS A;  3LJA A;  3MGR A;  1M18 C;  5AVB D;  4KGC A;  5CPK D;  5B0Y C;  1P3L C;  4ZBJ B;  3LZ1 B;  4X23 B;  1U35 A;  5AY8 A;  5B32 C;  5DNN A;  3B6G A;  3AV1 D;  4XZQ A;  4YM6 A;  2YFW B;  4QLC B;  1P3B B;  2HUE C;  2NQB B;  3O62 B;  2FJ7 C;  4XUJ C;  5B2I C;  5GXQ B;  1A7W A;  5GT3 A;  5F99 B;  5B1M D;  3AZE D;  3AZG B;  5B40 B;  1P3K C;  3X1V A;  4J8U A;  2PYO B;  5AV5 D;  3AZN C;  1AOI C;  1N1J A;  3KUY D;  5CPI B;  5C3I B;  4Z66 B;  3KXB A;  1EQZ A;  4R8P B;  3UT9 B;  2ARO B;  3KWQ C;  5BO0 A;  3REI C;  4E44 A;  2LY8 A;  3C1C B;  3AZF B;  3WAA B;  3WA9 D;  3MGP D;  5AV8 D;  5B0Z D;  3AYW A;  5DNM D;  5CP6 A;  5B33 D;  3MVD B;  1P34 D;  3AZM B;  3W98 B;  3REJ C;  3W96 D;  3MGS D;  3LJA D;  3MGR D;  3REH C;  1P3A A;  4KGC D;  1KX3 B;  3W97 A;  5G49 B;  1HQ3 B;  4WU9 B;  5B2J B;  3AZE C;  5B1M C;  3B6F B;  2NZD D;  4G91 C;  1U35 D;  5B24 C;  5AV5 C;  5AY8 D;  3AFA B;  4Z5T A;  3KUY C;  2RVQ D;  5GT0 A;  4YM6 D;  5GSU B;  5AV9 A;  5B31 C;  1S32 B;  1F66 D;  5GT3 D;  4H9O A;  1B67 A;  4CAY A;  3X1V D;  3MNN A;  4J8U D;  4E45 A;  3C1B C;  1P3L B;  3WA9 C;  3B0B A;  3WTP B;  3MGP C;  5AV8 C;  5B0Z C;  4J8W C;  5DNM C;  1ULY A;  4KUD D;  5B33 C;  5JA4 A;  3REK A;  3KXB D;  1EQZ D;  1M1A A;  3UTB A;  3AZJ B;  2BYK A;  3X1S A;  3W96 C;  4XUJ B;  3LJA C;  3MGS C;  3MGR C;  1P3K B;  1H3O B;  3UTA C;  3AYW D;  4LD9 A;  3X1U B;  5AVB A;  5CP6 D;  3X1T A;  3AZL A;  5CHL B;  3KSY A;  4H9N B;  4H9S A;  4KGC C;  5CPK A;  5CPJ A;  2CV5 A;  4J8V D;  2BYM A;  1BH8 A;  1U35 C;  4H9R A;  5AY8 C;  3B6G C;  5DNN C;  4AWL B;  3AV1 A;  4XZQ C;  2RVQ C;  2F8N B;  4YM6 C;  3W97 D;  4KHA B;  4CSR A;  3B0D C;  1KX4 C;  3X1V C;  5KDM A;  4J8U C;  3REJ B;  3AZI A;  4Z5T D;  1B6W A;  5GT0 D;  5BNV B;  5AV9 D;  3AV2 C;  2HIO B;  5E5A B;  3KXB C;  3REL B;  1EQZ C;  3V9R A;  3REH B;  4JJN A;  1P3F A;  3NQU A;  3MNN D;  3W99 A;  5AVC B;  4G91 B;  5B24 B;  1ZLA B;  3AYW C;  3REK D;  5FUG B;  3MGQ C;  1P34 A;  5B31 B;  1M1A D;  4NE6 A;  3UTB D;  3X1S D;  3A6N B;  3AZK A;  1ID3 A;  3C1B B;  1Q9C A;  2IO5 C;  5B1L A;  3LEL B;  4LD9 D;  3X1T D;  5B0Z B;  4J8W B;  3AZL D;  1P3A C;  3W97 C;  5CPJ D;  1P3M A;  4J8X C;  2CV5 D;  5JRG A;  2NZD A;  5BNX A;  4Z5T C;  4UUZ B;  3W96 B;  3LZ0 B;  5GT0 C;  5AV9 C;  3UTA B;  1P3O D;  4KGC B;  4X23 A;  1F66 A;  3MNN C;  3AZI D;  1HTA A;  2YFW A;  4QLC A;  1P3B A;  3B6G B;  2NQB A;  5DNN B;  1BFM A;  3O62 A;  3REK C;  4KUD A;  3NQJ B;  4XZQ B;  5GXQ A;  4YM6 B;  5F99 A;  2PYO A;  5B40 A;  4JJN D;  3AN2 B;  1M1A C;  1P3F D;  1BH9 B;  3W99 D;  3X1S C;  5BT1 D;  4LD9 B;  3B0D B;  1KX4 B;  4DRB A;  4Z66 A;  4R8P A;  1N1J B;  5AVB C;  3UT9 A;  2ARO A;  3AZH B;  3X1T C;  1P3I B;  4H9S C;  4WU8 D;  5CPK C;  5CPJ C;  1M19 B;  3AV2 B;  3C1C A;  3AZF A;  2CV5 C;  3WAA A;  4ZUX A;  4J8V A;  3TU4 B;  3WKJ A;  5BO0 B;  3AZK D;  1ID3 D;  3MVD A;  1WWS A;  4HGA C;  5B1L D;  3AZM A;  1TZY D;  3AV1 C;  3W98 A;  1KX5 B;  4YS3 D;  2L5A A;  1P3M D;  5JRG D;  3MGQ B;  1P3P B;  1P3G B;  1KX3 A;  1HQ3 A;  1M18 B;  4WU9 A;  4Z2M G;  5B2J A;  3B6F A;  3LZ1 D;  1P3A B;  4X23 D;  4JJN C;  1P3F C;  4J8X B;  5B0Y B;  3W99 C;  5GSU A;  3VH6 A;  4QLC D;  1P3B D;  1JFI B;  2NQB D;  4H9Q B;  5B32 B;  4WZS B;  3O62 D;  1S32 A;  5GXQ D;  1P34 C;  5F99 D;  3AZG D;  2PYO D;  5B40 D;  2HUE B;  3WTP A;  1KU5 A;  4NFT A;  2FJ7 B;  5B2I B;  3AZK C;  1ID3 C;  3MNN B;  4Z66 D;  5B1L C;  4R8P D;  3AZN B;  1AOI B;  3UT9 D;  2ARO D;  3AZJ A;  5JA4 B;  3C1C D;  3REK B;  3AZF D;  4ZUX D;  5JRG C;  4WNN B;  3WAA D;  1P3K A;  1H3O A;  3WKJ D;  2NZD C;  3KWQ B;  4DRA A;  3X1U A;  3REI B;  3MVD D;  4H9N A;  3AZM D;  3W98 D;  4ZBJ C;  5AVB B;  2CWE A;  4M6B A;  4X23 C;  1P3O A;  5CPK B;  1F66 C;  5GT3 C;  2YFV A;  2F8N A;  2BYM B;  4QLC C;  4WV4 B;  1P3B C;  1KX3 D;  1HQ3 D;  3O62 C;  4WU9 D;  3AV1 B;  4KUD C;  5GXQ C;  5B2J D;  1TAF B;  5F99 C;  2PYO C;  3B6F D;  5GSU D;  3AZE B;  5B1M B;  5C3I C;  2HIO A;  5E5A A;  4Z66 C;  3REL A;  5AV5 B;  3REH A;  3UT9 C;  1S32 D;  5CP6 C;  3KUY B;  4WU8 A;  3WAA C;  3C1C C;  3AZF C;  4ZUX C;  4EO5 C;  5AVC A;  3WTP D;  4J8V C;  4H9P B;  1ZLA A;  3WKJ C;  3NQU B;  3MVD C;  5FUG A;  3AZM C;  1TZY A;  3WA9 B;  5B31 A;  3W98 C;  3MGP B;  4G92 C;  5AV8 B;  4YS3 A;  3R45 B;  5DNM B;  5AV6 A;  3AZJ D;  5B33 B;  3A6N A;  1P34 B;  1P3K D;  3LEL A;  3X1U D;  1KX3 C;  3MGS B;  3LJA B;  2F8N G;  3MGR B;  1HQ3 C;  4WU9 C;  3B6F C;  3LZ1 A;  5JRG B;  2F8N D;  3LZ0 A;  5GSU C;  3UTA A;  2NZD B;  5BNX B;  1U35 B;  5AY8 B;  1S32 C;  3AZG A;  3REJ D;  3WTP C;  3UTB C;  1F66 B;  5GT3 B;  5CPI A;  2HIO D;  3NQJ A;  5E5A D;  4J8U B;  3REL D;  3X1V B;  4LD9 C;  3REH D;  3AN2 A;  3AZL C;  1BH9 A;  3AZJ C;  4KUD B;  5B31 G;  3KXB B;  1KX4 A;  5AVC D;  1EQZ B;  5B24 D;  1ZLA D;  3X1U C;  3AZH A;  1P3I A;  1M19 A;  5B31 D;  3AV2 A;  3AYW B;  5AV6 D;  3TU4 A;  5CP6 B;  1P3O C;  3A6N D;  3C1B D;  3LEL D;  4ZUX B;  4AWL C;  4EO5 B;  4J8V B;  5BS7 A;  3AZI C;  4J8W D;  1KX5 A;  3WKJ B;  5G49 A;  3MGQ A;  2IO5 B;  1P3P A;  1P3G A;  4G92 B;  3AFA A;  3W97 B;  3WTP E;  3LZ0 D;  4Z2M H;  5BT1 C;  1M18 A;  3UTA D;  2HIO C;  4NE5 A;  5E5A C;  3REL C;  4Z5T B;  5GT0 B;  5B0Y A;  4J8X A;  4WU8 C;  5AV9 B;  1P3L A;  2JSS A;  5AVC C;  1ZLA C;  1JFI A;  3VH6 T;  3B6G D;  4H9Q A;  5DNN D;  5B32 A;  5CPI D;  4H9O B;  4CAY B;  4XZQ D;  1TZY C;  3B0C T;  3AN2 D;  4YS3 C;  5AV6 C;  1P3M C;  2FJ7 A;  4XUJ A;  5B2I A;  3A6N C;  1KX4 D;  1R4V A;  1F1E A;  3VH5 A;  3LEL C;  1M1A B;  3AZN A;  1AOI A;  3AZH D;  3UTB B;  1P3I D;  2BYK B;  3X1S B;  1M19 D;  3AV2 D;  4WNN A; 
#chains in the Genus database with same CATH topology
 3VH5 T;  3TU4 D;  3X1T B;  3VH6 W;  3LZ1 C;  3KWQ A;  3AZL B;  3REI A;  3FDD A;  5CPJ B;  4NE3 A;  2CV5 B;  3LZ0 C;  3B0C W;  1KX5 D;  1BH8 B;  4H9R B;  2J8P A;  2NQB C;  4KHA A;  2F8N K;  3MGQ D;  4HGA B;  1P3P D;  1P3G D;  3AZG C;  5B40 C;  3REJ A;  3AFA D;  1P3O B;  4CSR B;  5CPI C;  5BNV A;  1M18 D;  2YFV B;  5KDM B;  1TAF A;  3AZI B;  4R8P C;  3VH5 W;  1P3A D;  5B32 G;  3AN2 C;  2ARO C;  4J8X D;  5B0Y D;  1P3L D;  3AZE A;  5B1M A;  3V9R B;  4JJN B;  5B24 A;  5AV5 A;  5B32 D;  1P3F B;  3AZH C;  3KUY A;  1P3I C;  3W99 B;  1M19 C;  4H9P A;  3TU4 C;  2FJ7 D;  4XUJ D;  5B2I D;  2JCH A;  1WWI A;  4WU8 B;  3C1B A;  3AZN D;  1AOI D;  3WA9 A;  5BS7 C;  3MGP A;  1KX5 C;  5AV8 A;  5B0Z A;  4J8W A;  3R45 A;  5DNM A;  3AZK B;  1ID3 B;  5B33 A;  5B1L B;  1P3P C;  1TZY B;  5B2J C;  1P3G C;  3KWQ D;  4YS3 B;  3REI D;  3AFA C;  5AV6 B;  2F8N H;  1P3M B;  4UUZ A;  3W96 A;  3MGS A;  3LJA A;  3MGR A;  1M18 C;  5AVB D;  4KGC A;  2Y2K A;  5CPK D;  5B0Y C;  1P3L C;  3EPK A;  4ZBJ B;  3LZ1 B;  4X23 B;  1U35 A;  5AY8 A;  5B32 C;  5DNN A;  3B6G A;  3AV1 D;  4XZQ A;  4YM6 A;  2ZY5 A;  2W8S A;  2YFW B;  4QLC B;  1P3B B;  2HUE C;  2NQB B;  3O62 B;  2FJ7 C;  4XUJ C;  5B2I C;  5GXQ B;  1A7W A;  5GT3 A;  5F99 B;  5B1M D;  3AZE D;  3AZG B;  5B40 B;  1P3K C;  3X1V A;  4J8U A;  2PYO B;  5AV5 D;  3AZN C;  1AOI C;  1N1J A;  3KUY D;  2Y2N A;  2F2A C;  5CPI B;  5C3I B;  4Z66 B;  3KXB A;  1EQZ A;  4R8P B;  2BG1 A;  3UT9 B;  2ARO B;  3KWQ C;  3F6T A;  5BO0 A;  3REI C;  4E44 A;  2LY8 A;  3C1C B;  3AZF B;  3WAA B;  3WA9 D;  2Y2L A;  3MGP D;  5AV8 D;  5B0Z D;  2ZM5 A;  3AYW A;  5DNM D;  5CP6 A;  5B33 D;  3MVD B;  1P34 D;  3AZM B;  3W98 B;  3REJ C;  3W96 D;  3MGS D;  3LJA D;  3MGR D;  2JE5 A;  3REH C;  1P3A A;  4KGC D;  1KX3 B;  3W97 A;  5G49 B;  3EPJ A;  1HQ3 B;  4WU9 B;  5B2J B;  3AZE C;  5B1M C;  3B6F B;  2NZD D;  4G91 C;  1U35 D;  5B24 C;  5AV5 C;  5AY8 D;  3AFA B;  4Z5T A;  3EPH A;  3KUY C;  2RVQ D;  5GT0 A;  4YM6 D;  5GSU B;  2ZY4 A;  5AV9 A;  5B31 C;  1S32 B;  1F66 D;  5GT3 D;  4H9O A;  1B67 A;  3KFU G;  4CAY A;  3X1V D;  3MNN A;  4J8U D;  4E45 A;  3C1B C;  1P3L B;  3WA9 C;  3B0B A;  3WTP B;  3MGP C;  5AV8 C;  5B0Z C;  4J8W C;  5DNM C;  1ULY A;  4KUD D;  5B33 C;  5JA4 A;  3REK A;  3KXB D;  1EQZ D;  3IP4 C;  1M1A A;  3UTB A;  3AZJ B;  2BYK A;  3X1S A;  3W96 C;  4XUJ B;  3LJA C;  3MGS C;  3MGR C;  1P3K B;  1H3O B;  3UTA C;  3AYW D;  4LD9 A;  3X1U B;  5AVB A;  5CP6 D;  3X1T A;  3AZL A;  5CHL B;  3KSY A;  3P5J B;  4H9N B;  4H9S A;  4KGC C;  5CPK A;  5CPJ A;  2CV5 A;  4J8V D;  2BYM A;  1BH8 A;  1U35 C;  4H9R A;  5AY8 C;  3B6G C;  5DNN C;  4AWL B;  3AV1 A;  4XZQ C;  2RVQ C;  2F8N B;  4YM6 C;  3W97 D;  4KHA B;  4CSR A;  3B0D C;  1KX4 C;  3X1V C;  5KDM A;  4J8U C;  3REJ B;  3AZI A;  4Z5T D;  1B6W A;  5GT0 D;  5BNV B;  3H0L C;  5AV9 D;  3AV2 C;  2HIO B;  5E5A B;  3KXB C;  3REL B;  1EQZ C;  3V9R A;  3REH B;  4JJN A;  1P3F A;  3NQU A;  3MNN D;  3W99 A;  2Y2G A;  5AVC B;  4G91 B;  5B24 B;  1ZLA B;  3AYW C;  3REK D;  5FUG B;  3MGQ C;  1P34 A;  5B31 B;  1M1A D;  4NE6 A;  3UTB D;  3X1S D;  2Y2P A;  3A6N B;  3AZK A;  1ID3 A;  3C1B B;  1Q9C A;  2IO5 C;  2Y2H A;  5B1L A;  3LEL B;  4LD9 D;  3X1T D;  5B0Z B;  4J8W B;  3AZL D;  1P3A C;  3W97 C;  5CPJ D;  1P3M A;  2G5H C;  4J8X C;  2CV5 D;  5JRG A;  2NZD A;  5BNX A;  4Z5T C;  4UUZ B;  3W96 B;  3LZ0 B;  5GT0 C;  5AV9 C;  3UTA B;  3H0M C;  1P3O D;  4KGC B;  4X23 A;  1F66 A;  3MNN C;  3AZI D;  1HTA A;  2YFW A;  4QLC A;  1P3B A;  3B6G B;  2NQB A;  5DNN B;  1BFM A;  3O62 A;  3REK C;  4KUD A;  3NQJ B;  4XZQ B;  5GXQ A;  4YM6 B;  5F99 A;  2PYO A;  5B40 A;  4JJN D;  3AN2 B;  1M1A C;  1P3F D;  1BH9 B;  3W99 D;  3EG5 B;  5BT1 D;  3X1S C;  4LD9 B;  3B0D B;  1KX4 B;  4DRB A;  4Z66 A;  4R8P A;  1N1J B;  5AVB C;  3UT9 A;  2ARO A;  2G5I C;  3AZH B;  2DF4 C;  2XD5 A;  4H9S C;  3X1T C;  1P3I B;  4WU8 D;  5CPK C;  5CPJ C;  1M19 B;  3AV2 B;  3C1C A;  3AZF A;  2CV5 C;  3WAA A;  1Z2C B;  4ZUX A;  4J8V A;  3TU4 B;  3WKJ A;  5BO0 B;  3AZK D;  1ID3 D;  2RIQ A;  3MVD A;  1WWS A;  4HGA C;  5B1L D;  3AZM A;  1TZY D;  3AV1 C;  1T3U A;  3W98 A;  1KX5 B;  4YS3 D;  2L5A A;  1P3M D;  5JRG D;  3MGQ B;  1P3P B;  2Y2Q A;  1P3G B;  1KX3 A;  2FFF B;  1HQ3 A;  1M18 B;  4WU9 A;  4Z2M G;  5B2J A;  3B6F A;  3LZ1 D;  1P3A B;  4X23 D;  4JJN C;  1P3F C;  4J8X B;  5B0Y B;  1PZR A;  3W99 C;  5GSU A;  3VH6 A;  4QLC D;  1P3B D;  1JFI B;  3A1I A;  2NQB D;  4H9Q B;  5B32 B;  4WZS B;  3O62 D;  1S32 A;  5GXQ D;  1P34 C;  5F99 D;  3AZG D;  2PYO D;  5B40 D;  2HUE B;  3WTP A;  1KU5 A;  4NFT A;  2FJ7 B;  5B2I B;  3AZK C;  1ID3 C;  3MNN B;  4Z66 D;  5B1L C;  4R8P D;  3AZN B;  1AOI B;  3UT9 D;  2ARO D;  3AZJ A;  5JA4 B;  3C1C D;  3REK B;  3AZF D;  4ZUX D;  5JRG C;  4WNN B;  3WAA D;  1P3K A;  1H3O A;  3WKJ D;  2NZD C;  3KWQ B;  4DRA A;  3X1U A;  3REI B;  3MVD D;  4H9N A;  3AZM D;  3W98 D;  3H0R C;  4ZBJ C;  5AVB B;  2CWE A;  4M6B A;  4X23 C;  1P3O A;  5CPK B;  1F66 C;  5GT3 C;  2YFV A;  2F8N A;  1W2E A;  2BYM B;  4QLC C;  4WV4 B;  1P3B C;  1KX3 D;  1HQ3 D;  3O62 C;  4WU9 D;  3AV1 B;  4KUD C;  5GXQ C;  5B2J D;  1TAF B;  5F99 C;  2PYO C;  3B6F D;  4WJ3 C;  3AL0 C;  5GSU D;  3AZE B;  5B1M B;  5C3I C;  2HIO A;  5E5A A;  4Z66 C;  3REL A;  5AV5 B;  3REH A;  3UT9 C;  1S32 D;  5CP6 C;  3KUY B;  4WU8 A;  3WAA C;  3C1C C;  3AZF C;  4ZUX C;  4EO5 C;  5AVC A;  3WTP D;  4J8V C;  2DQN C;  4H9P B;  1ZLA A;  3WKJ C;  2ZY2 A;  3NQU B;  2Y2O A;  3MVD C;  5FUG A;  3AZM C;  1TZY A;  3WA9 B;  5B31 A;  3W98 C;  3MGP B;  4G92 C;  5AV8 B;  2Y2M A;  4YS3 A;  3R45 B;  5DNM B;  5AV6 A;  3AZJ D;  5B33 B;  3A6N A;  1P34 B;  1P3K D;  3LEL A;  3X1U D;  2UWX A;  1KX3 C;  3MGS B;  3LJA B;  2F8N G;  3MGR B;  1HQ3 C;  4WU9 C;  3B6F C;  3LZ1 A;  5JRG B;  2F8N D;  3LZ0 A;  5GSU C;  3UTA A;  2NZD B;  5BNX B;  1U35 B;  5AY8 B;  3EPL A;  1S32 C;  3AZG A;  3REJ D;  3WTP C;  3UTB C;  1F66 B;  5GT3 B;  5CPI A;  3A1K A;  2HIO D;  3NQJ A;  5E5A D;  4J8U B;  3REL D;  3X1V B;  4LD9 C;  3REH D;  3AN2 A;  2XD1 A;  3AZL C;  1BH9 A;  3AZJ C;  4KUD B;  5B31 G;  3KXB B;  1KX4 A;  5AVC D;  1EQZ B;  5B24 D;  1ZLA D;  3X1U C;  3AZH A;  2VQR A;  1P3I A;  1M19 A;  2ZY3 A;  5B31 D;  3AV2 A;  3AYW B;  5AV6 D;  3TU4 A;  5CP6 B;  1P3O C;  3A6N D;  3C1B D;  3LEL D;  4ZUX B;  4AWL C;  4EO5 B;  4J8V B;  5BS7 A;  3AZI C;  4J8W D;  1KX5 A;  3WKJ B;  5G49 A;  3MGQ A;  2IO5 B;  1P3P A;  1P3G A;  4G92 B;  3AFA A;  3W97 B;  3WTP E;  3LZ0 D;  4Z2M H;  5BT1 C;  4DQY B;  1M18 A;  3UTA D;  2HIO C;  4NE5 A;  5E5A C;  3REL C;  4Z5T B;  5GT0 B;  5B0Y A;  4J8X A;  4WU8 C;  5AV9 B;  1P3L A;  2JSS A;  5AVC C;  4UPK A;  2Y2J A;  1ZLA C;  1JFI A;  3VH6 T;  3B6G D;  4H9Q A;  5DNN D;  5B32 A;  5CPI D;  4H9O B;  4CAY B;  4XZQ D;  1TZY C;  3B0C T;  3AN2 D;  4YS3 C;  5AV6 C;  1P3M C;  2FJ7 A;  4XUJ A;  5B2I A;  3A6N C;  1KX4 D;  1R4V A;  1F1E A;  3VH5 A;  3LEL C;  1M1A B;  3AZN A;  1AOI A;  3AZH D;  3UTB B;  1P3I D;  2BYK B;  3X1S B;  2Y2I A;  1M19 D;  3AV2 D;  4WNN A; 
#chains in the Genus database with same CATH homology
 3VH5 T;  3TU4 D;  3X1T B;  3VH6 W;  3LZ1 C;  3KWQ A;  3AZL B;  3REI A;  3FDD A;  5CPJ B;  4NE3 A;  2CV5 B;  3LZ0 C;  3B0C W;  1KX5 D;  1BH8 B;  4H9R B;  2J8P A;  2NQB C;  4KHA A;  2F8N K;  3MGQ D;  4HGA B;  1P3P D;  1P3G D;  3AZG C;  5B40 C;  3REJ A;  3AFA D;  1P3O B;  4CSR B;  5CPI C;  5BNV A;  1M18 D;  2YFV B;  5KDM B;  1TAF A;  3AZI B;  4R8P C;  3VH5 W;  1P3A D;  5B32 G;  3AN2 C;  2ARO C;  4J8X D;  5B0Y D;  1P3L D;  3AZE A;  5B1M A;  3V9R B;  4JJN B;  5B24 A;  5AV5 A;  5B32 D;  1P3F B;  3AZH C;  3KUY A;  1P3I C;  3W99 B;  1M19 C;  4H9P A;  3TU4 C;  2FJ7 D;  4XUJ D;  5B2I D;  2JCH A;  1WWI A;  4WU8 B;  3C1B A;  3AZN D;  1AOI D;  3WA9 A;  5BS7 C;  3MGP A;  1KX5 C;  5AV8 A;  5B0Z A;  4J8W A;  3R45 A;  5DNM A;  3AZK B;  1ID3 B;  5B33 A;  5B1L B;  1P3P C;  1TZY B;  5B2J C;  1P3G C;  3KWQ D;  4YS3 B;  3REI D;  3AFA C;  5AV6 B;  2F8N H;  1P3M B;  4UUZ A;  3W96 A;  3MGS A;  3LJA A;  3MGR A;  1M18 C;  5AVB D;  4KGC A;  2Y2K A;  5CPK D;  5B0Y C;  1P3L C;  3EPK A;  4ZBJ B;  3LZ1 B;  4X23 B;  1U35 A;  5AY8 A;  5B32 C;  5DNN A;  3B6G A;  3AV1 D;  4XZQ A;  4YM6 A;  2ZY5 A;  2W8S A;  2YFW B;  4QLC B;  1P3B B;  2HUE C;  2NQB B;  3O62 B;  2FJ7 C;  4XUJ C;  5B2I C;  5GXQ B;  1A7W A;  5GT3 A;  5F99 B;  5B1M D;  3AZE D;  3AZG B;  5B40 B;  1P3K C;  3X1V A;  4J8U A;  2PYO B;  5AV5 D;  3AZN C;  1AOI C;  1N1J A;  3KUY D;  2Y2N A;  2F2A C;  5CPI B;  5C3I B;  4Z66 B;  3KXB A;  1EQZ A;  4R8P B;  2BG1 A;  3UT9 B;  2ARO B;  3KWQ C;  3F6T A;  5BO0 A;  3REI C;  4E44 A;  2LY8 A;  3C1C B;  3AZF B;  3WAA B;  3WA9 D;  2Y2L A;  3MGP D;  5AV8 D;  5B0Z D;  2ZM5 A;  3AYW A;  5DNM D;  5CP6 A;  5B33 D;  3MVD B;  1P34 D;  3AZM B;  3W98 B;  3REJ C;  3W96 D;  3MGS D;  3LJA D;  3MGR D;  2JE5 A;  3REH C;  1P3A A;  4KGC D;  1KX3 B;  3W97 A;  5G49 B;  3EPJ A;  1HQ3 B;  4WU9 B;  5B2J B;  3AZE C;  5B1M C;  3B6F B;  2NZD D;  4G91 C;  1U35 D;  5B24 C;  5AV5 C;  5AY8 D;  3AFA B;  4Z5T A;  3EPH A;  3KUY C;  2RVQ D;  5GT0 A;  4YM6 D;  5GSU B;  2ZY4 A;  5AV9 A;  5B31 C;  1S32 B;  1F66 D;  5GT3 D;  4H9O A;  1B67 A;  3KFU G;  4CAY A;  3X1V D;  3MNN A;  4J8U D;  4E45 A;  3C1B C;  1P3L B;  3WA9 C;  3B0B A;  3WTP B;  3MGP C;  5AV8 C;  5B0Z C;  4J8W C;  5DNM C;  1ULY A;  4KUD D;  5B33 C;  5JA4 A;  3REK A;  3KXB D;  1EQZ D;  3IP4 C;  1M1A A;  3UTB A;  3AZJ B;  2BYK A;  3X1S A;  3W96 C;  4XUJ B;  3LJA C;  3MGS C;  3MGR C;  1P3K B;  1H3O B;  3UTA C;  3AYW D;  4LD9 A;  3X1U B;  5AVB A;  5CP6 D;  3X1T A;  3AZL A;  5CHL B;  3KSY A;  3P5J B;  4H9N B;  4H9S A;  4KGC C;  5CPK A;  5CPJ A;  2CV5 A;  4J8V D;  2BYM A;  1BH8 A;  1U35 C;  4H9R A;  5AY8 C;  3B6G C;  5DNN C;  4AWL B;  3AV1 A;  4XZQ C;  2RVQ C;  2F8N B;  4YM6 C;  3W97 D;  4KHA B;  4CSR A;  3B0D C;  1KX4 C;  3X1V C;  5KDM A;  4J8U C;  3REJ B;  3AZI A;  4Z5T D;  1B6W A;  5GT0 D;  5BNV B;  3H0L C;  5AV9 D;  3AV2 C;  2HIO B;  5E5A B;  3KXB C;  3REL B;  1EQZ C;  3V9R A;  3REH B;  4JJN A;  1P3F A;  3NQU A;  3MNN D;  3W99 A;  2Y2G A;  5AVC B;  4G91 B;  5B24 B;  1ZLA B;  3AYW C;  3REK D;  5FUG B;  3MGQ C;  1P34 A;  5B31 B;  1M1A D;  4NE6 A;  3UTB D;  3X1S D;  2Y2P A;  3A6N B;  3AZK A;  1ID3 A;  3C1B B;  1Q9C A;  2IO5 C;  2Y2H A;  5B1L A;  3LEL B;  4LD9 D;  3X1T D;  5B0Z B;  4J8W B;  3AZL D;  1P3A C;  3W97 C;  5CPJ D;  1P3M A;  2G5H C;  4J8X C;  2CV5 D;  5JRG A;  2NZD A;  5BNX A;  4Z5T C;  4UUZ B;  3W96 B;  3LZ0 B;  5GT0 C;  5AV9 C;  3UTA B;  3H0M C;  1P3O D;  4KGC B;  4X23 A;  1F66 A;  3MNN C;  3AZI D;  1HTA A;  2YFW A;  4QLC A;  1P3B A;  3B6G B;  2NQB A;  5DNN B;  1BFM A;  3O62 A;  3REK C;  4KUD A;  3NQJ B;  4XZQ B;  5GXQ A;  4YM6 B;  5F99 A;  2PYO A;  5B40 A;  4JJN D;  3AN2 B;  1M1A C;  1P3F D;  1BH9 B;  3W99 D;  3EG5 B;  5BT1 D;  3X1S C;  4LD9 B;  3B0D B;  1KX4 B;  4DRB A;  4Z66 A;  4R8P A;  1N1J B;  5AVB C;  3UT9 A;  2ARO A;  2G5I C;  3AZH B;  2DF4 C;  2XD5 A;  4H9S C;  3X1T C;  1P3I B;  4WU8 D;  5CPK C;  5CPJ C;  1M19 B;  3AV2 B;  3C1C A;  3AZF A;  2CV5 C;  3WAA A;  1Z2C B;  4ZUX A;  4J8V A;  3TU4 B;  3WKJ A;  5BO0 B;  3AZK D;  1ID3 D;  2RIQ A;  3MVD A;  1WWS A;  4HGA C;  5B1L D;  3AZM A;  1TZY D;  3AV1 C;  1T3U A;  3W98 A;  1KX5 B;  4YS3 D;  2L5A A;  1P3M D;  5JRG D;  3MGQ B;  1P3P B;  2Y2Q A;  1P3G B;  1KX3 A;  2FFF B;  1HQ3 A;  1M18 B;  4WU9 A;  4Z2M G;  5B2J A;  3B6F A;  3LZ1 D;  1P3A B;  4X23 D;  4JJN C;  1P3F C;  4J8X B;  5B0Y B;  1PZR A;  3W99 C;  5GSU A;  3VH6 A;  4QLC D;  1P3B D;  1JFI B;  3A1I A;  2NQB D;  4H9Q B;  5B32 B;  4WZS B;  3O62 D;  1S32 A;  5GXQ D;  1P34 C;  5F99 D;  3AZG D;  2PYO D;  5B40 D;  2HUE B;  3WTP A;  1KU5 A;  4NFT A;  2FJ7 B;  5B2I B;  3AZK C;  1ID3 C;  3MNN B;  4Z66 D;  5B1L C;  4R8P D;  3AZN B;  1AOI B;  3UT9 D;  2ARO D;  3AZJ A;  5JA4 B;  3C1C D;  3REK B;  3AZF D;  4ZUX D;  5JRG C;  4WNN B;  3WAA D;  1P3K A;  1H3O A;  3WKJ D;  2NZD C;  3KWQ B;  4DRA A;  3X1U A;  3REI B;  3MVD D;  4H9N A;  3AZM D;  3W98 D;  3H0R C;  4ZBJ C;  5AVB B;  2CWE A;  4M6B A;  4X23 C;  1P3O A;  5CPK B;  1F66 C;  5GT3 C;  2YFV A;  2F8N A;  1W2E A;  2BYM B;  4QLC C;  4WV4 B;  1P3B C;  1KX3 D;  1HQ3 D;  3O62 C;  4WU9 D;  3AV1 B;  4KUD C;  5GXQ C;  5B2J D;  1TAF B;  5F99 C;  2PYO C;  3B6F D;  4WJ3 C;  3AL0 C;  5GSU D;  3AZE B;  5B1M B;  5C3I C;  2HIO A;  5E5A A;  4Z66 C;  3REL A;  5AV5 B;  3REH A;  3UT9 C;  1S32 D;  5CP6 C;  3KUY B;  4WU8 A;  3WAA C;  3C1C C;  3AZF C;  4ZUX C;  4EO5 C;  5AVC A;  3WTP D;  4J8V C;  2DQN C;  4H9P B;  1ZLA A;  3WKJ C;  2ZY2 A;  3NQU B;  2Y2O A;  3MVD C;  5FUG A;  3AZM C;  1TZY A;  3WA9 B;  5B31 A;  3W98 C;  3MGP B;  4G92 C;  5AV8 B;  2Y2M A;  4YS3 A;  3R45 B;  5DNM B;  5AV6 A;  3AZJ D;  5B33 B;  3A6N A;  1P34 B;  1P3K D;  3LEL A;  3X1U D;  2UWX A;  1KX3 C;  3MGS B;  3LJA B;  2F8N G;  3MGR B;  1HQ3 C;  4WU9 C;  3B6F C;  3LZ1 A;  5JRG B;  2F8N D;  3LZ0 A;  5GSU C;  3UTA A;  2NZD B;  5BNX B;  1U35 B;  5AY8 B;  3EPL A;  1S32 C;  3AZG A;  3REJ D;  3WTP C;  3UTB C;  1F66 B;  5GT3 B;  5CPI A;  3A1K A;  2HIO D;  3NQJ A;  5E5A D;  4J8U B;  3REL D;  3X1V B;  4LD9 C;  3REH D;  3AN2 A;  2XD1 A;  3AZL C;  1BH9 A;  3AZJ C;  4KUD B;  5B31 G;  3KXB B;  1KX4 A;  5AVC D;  1EQZ B;  5B24 D;  1ZLA D;  3X1U C;  3AZH A;  2VQR A;  1P3I A;  1M19 A;  2ZY3 A;  5B31 D;  3AV2 A;  3AYW B;  5AV6 D;  3TU4 A;  5CP6 B;  1P3O C;  3A6N D;  3C1B D;  3LEL D;  4ZUX B;  4AWL C;  4EO5 B;  4J8V B;  5BS7 A;  3AZI C;  4J8W D;  1KX5 A;  3WKJ B;  5G49 A;  3MGQ A;  2IO5 B;  1P3P A;  1P3G A;  4G92 B;  3AFA A;  3W97 B;  3WTP E;  3LZ0 D;  4Z2M H;  5BT1 C;  4DQY B;  1M18 A;  3UTA D;  2HIO C;  4NE5 A;  5E5A C;  3REL C;  4Z5T B;  5GT0 B;  5B0Y A;  4J8X A;  4WU8 C;  5AV9 B;  1P3L A;  2JSS A;  5AVC C;  4UPK A;  2Y2J A;  1ZLA C;  1JFI A;  3VH6 T;  3B6G D;  4H9Q A;  5DNN D;  5B32 A;  5CPI D;  4H9O B;  4CAY B;  4XZQ D;  1TZY C;  3B0C T;  3AN2 D;  4YS3 C;  5AV6 C;  1P3M C;  2FJ7 A;  4XUJ A;  5B2I A;  3A6N C;  1KX4 D;  1R4V A;  1F1E A;  3VH5 A;  3LEL C;  1M1A B;  3AZN A;  1AOI A;  3AZH D;  3UTB B;  1P3I D;  2BYK B;  3X1S B;  2Y2I A;  1M19 D;  3AV2 D;  4WNN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...