3UTBB

Crystal structure of nucleosome core particle assembled with the 146b alpha-satellite sequence (ncp146b)
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
83
structure length
83
Chain Sequence
KVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.2
publication title The mechanics behind DNA sequence-dependent properties of the nucleosome
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Structural protein/dna
total genus 28
structure length 83
sequence length 83
chains with identical sequence F
ec nomenclature
pdb deposition date 2011-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3utbB00
5B0YA 4WU9C 3AV1B 1F66A 3O62C 5CP6D 1JFIB 4H9PB 4WU9A 3AZHD 5B40D 3MVDB 3VH6W 3B0CW 5B31B 3O62A 3RELC 5B1LC 5DNNC 5AVBC 4ZUXB 3WAAB 2BYKA 5B24C 4YM6B 4YS3C 3AZMD 5B33C 3LZ0D 5BNVB 3RELA 5B1LA 4M6BA 5DNNA 5AVBA 1ZLAB 4LD9C 5B24A 4J8VD 4YS3A 5BO0B 3REJD 5B33A 1HQ3C 3C1CB 2YFVB 1P34D 3AZKD 4LD9A 2HUEB 3REKB 2L5AA 3AZLD 1HQ3A 4E44A 2CV5C 3AZFB 5CPKC 4X23B 3X1VC 2CV5A 3KUYD 3WTPB 1TAFB 5B31G 5CPKA 5DNMC 3AV2C 5CPJD 1S32B 4AWLC 5F99D 3X1VA 2NZDD 1KX4B 3W96D 2BYMA 1BH8A 4H9QB 3W97B 1KX5D 3LZ1C 4WU8D 5B1MB 5DNMA 3AV2A 4H9SC 4WV4B 3X1SC 1F1EA 4J8UD 3B6FC 3UTBC 5AV9C 2HIOD 5GXQB 4EO5B 3LZ1A 3AV1D 4H9SA 2NQBC 3X1SA 4G92C 3B6FA 3UTBA 5AV9A 5BS7C 3REIB 4QLCB 3C1BB 2NQBA 3MVDD 2PYOC 1M19C 3MNNC 4ZUXD 5BS7A 3WAAD 5G49A 4YM6D 5FUGB 5B0ZB 4H9RB 2PYOA 3VH6A 1M18C 1WWSA 4XUJB 1M19A 3MNNA 3VH5W 1P3BC 1ZLAD 1KX3B 3C1CD 4WNNA 1M18A 3W98C 5CHLB 3R45A 3LELC 5AV8C 1P3BA 3AZJB 3NQJA 2RVQC 3REKD 3WKJD 5BNXA 3KXBB 3AZGC 3W98A 3KWQC 3NQUB 3AZFD 3LELA 1AOIB 4NE6A 4X23D 5AV8A 5CPIB 5GSUB 1WWIA 5CP6C 1P3OD 3AZGA 3AZEC 3KWQA 3WTPD 3AZHC 1BFMA 4CAYA 5B40C 4CSRA 4Z66B 1S32D 5GT0B 1KX4D 2YFWA 5CP6A 3WA9C 3AZEA 3W97D 3AZHA 5B40A 3AZMC 2AROB 3B6GB 3KSYA 1P3IB 3LZ0C 4KUDB 4E45A 3WA9A 5GXQD 4J8VC 1P3MD 3REJC 3AZMA 1H3OB 5C3IC 1P34C 3LZ0A 3A6NC 4J8VA 3REID 3REJA 4QLCD 3C1BD 5B32D 3W99B 1P34A 4HGAB 3A6NA 1BH9B 5B0ZD 3KUYC 3UTAC 4XUJD 5CPJC 1U35C 2NZDC 1B6WA 1P3GB 3W96C 3AZIC 3KUYA 1KX3D 1KX5C 4Z5TB 3UTAA 4WU8C 2BYKB 5CPJA 3AZJD 1U35A 2NZDA 1N1JB 3VH5A 3W96A 4J8UC 3AZIA 3MGPB 3KXBD 1KX5A 1EQZB 4WU8A 1AOID 3AV1C 3UT9B 5E5AB 4J8UA 4J8XC 5CPID 5GSUD 4H9NB 1P3FB 4R8PB 3AV1A 3MVDC 4Z66D 2F8NK 5B31C 5GT0D 3AFAB 5GT3B 4J8XA 3AZNB 1P3KB 1P3AB 3WAAC 4ZUXC 4H9PA 1JFIA 3WKJB 4YM6C 3MVDA 2AROD 3B6GD 1P3ID 5JRGB 4H9OB 5B31A 4KUDD 2F8ND 4ZUXA 3WAAA 1ZLAC 1P3OB 4YM6A 1P3LB 3X1UD 3C1CC 1BH8B 3MGRB 3LJAB 1ZLAA 4NFTA 2HUEC 1TZYB 5BO0A 5DNMB 3REKC 4DRBA 3C1CA 2YFVA 3W99D 3AZFC 4X23C 5AY8C 4WZSB 3REKA 1P3MB 1A7WA 3MGQB 3WTPC 3AZFA 5AV9B 4ZBJC 4X23A 5AY8A 1S32C 1P3GD 1KX4C 5B32B 3WTPA 1M1AB 3W97C 1TAFA 4Z5TD 4XZQB 5B1MC 5G49B 4NE5A 1S32A 1KX4A 3MGPD 4EO5C 4H9QA 3W97A 4UUZB 5GXQC 1EQZD 5B1MA 3UT9D 5E5AD 3TU4B 5BT1D 5B33D 4G91B 5GXQA 1P3FD 4R8PD 3REIC 4KGCB 4QLCC 1P3BB 2LY8A 3AFAD 3AYWB 5GT3D 3AZND 1P3KD 1P3AD 3REIA 4KHAB 4QLCA 5B0ZC 5JRGD 2CV5D 4XUJC 3V9RB 5AV5B 3MGSB 5B2JB 5KDMA 5B32G 4CAYB 5FUGA 1P3LD 1P3PB 5B0ZA 3REHB 2IO5B 1KX3C 1B67A 4XUJA 3AZEB 5B2IB 3MGRD 2CWEA 3LJAD 3AZJC 1TZYD 2JSSA 5DNMD 5AV6B 1ID3B 3KXBC 1KX3A 2FJ7B 1KU5A 3WA9B 1AOIC 3AZJA 2F8NB 5CPIC 5GSUC 3KXBA 3MGQD 4J8WB 3X1UB 3NQUA 1AOIA 3VH6T 5AV9D 3AZKC 5AVCB 3B0CT 5GT0C 4JJNB 5CPIA 5JA4B 5GSUA 3B0DB 3X1TB 3AZLC 1M1AD 4XZQD 2AROC 3A6NB 3AZKA 3AN2B 3B6GC 1P3IC 5GT0A 4KUDC 5B0YB 1F66B 3AZLA 1M19D 2AROA 3B6GA 1P3IA 4KUDA 4WU9B 3TU4D 5F99C 4KGCD 1H3OA 1P3BD 3O62B 1U35B 3W99C 2F8NG 4NE3A 3AYWD 4HGAC 5F99A 2HIOC 3RELB 5B1LB 5DNNB 3W99A 5AVBB 5B24B 4YS3B 3AZGD 5AV5D 3MGSD 2F8NH 5B2JD 5B33B 4DRAA 1P3PD 4Z2MG 1BH9A 2HIOA 1P3GC 3REHD 4J8XB 4LD9B 4Z5TC 3AZED 5B2ID 1HQ3B 5AV6D 1P3GA 4Z2MH 3MGPC 1ID3D 3B0BA 2FJ7D 1EQZC 4Z5TA 3WA9D 3WTPE 3UT9C 2CV5B 5E5AC 1N1JA 1HTAA 5BT1C 3MGPA 4J8WD 5CPKB 1P3FC 4R8PC 1EQZA 3X1VB 3UT9A 5BNVA 2BYMB 5E5AA 5AVCD 3AFAC 4JJND 5GT3C 4H9NA 3AZNC 3AV2B 4R8PA 1P3AC 1P3KC 3X1TD 1P3FA 3WKJC 4AWLB 1R4VA 3AN2D 3A6ND 5JRGC 3AFAA 3LZ1B 5GT3A 5B0YD 3AZNA 3VH5T 1P3AA 1P3KA 3WKJA 1F66D 1Q9CA 1P3OC 1P3LC 3X1SB 5AY8B 3B6FB 3UTBB 5JRGA 4H9OA 4WU9D 3MGRC 2NQBB 3LJAC 1P3OA 3UTAD 1P3LA 1TZYC 4ZBJB 4G92B 3O62D 1U35D 3AZID 3MGRA 3LJAA 1TZYA 2PYOB 1P3MC 3MGQC 3RELD 5B1LD 5DNND 1M19B 3MNNB 5AVBD 5B24D 4YS3D 4WNNB 1M18B 1P3MA 3MGQA 3R45B 3C1BC 5B32C 1M1AC 4J8XD 4LD9D 4XZQC 3NQJB 1HQ3D 5BNXB 3W98B 1ULYA 3LELB 3C1BA 5B32A 5AV8B 5B31D 1M1AA 4XZQA 5KDMB 3AZGB 3KWQB 3TU4C 5CPKD 4G91C 4UUZA 4CSRB 4H9RA 4KGCC 3X1VD 2YFWB 5CP6B 3TU4A 3AZHB 3AYWC 5B40B 3AV2D 4KGCA 3AYWA 3LZ1D 5AV5C 3MGSC 3AZMB 5B2JC 4KHAA 1P3PC 3X1SD 3LZ0B 3REHC 5AY8D 2IO5C 3UTBD 3B6FD 4J8VB 5AV5A 3V9RA 4Z66C 5B2IC 5B2JA 3MGSA 3REJB 2NQBD 1P3PA 5C3IB 5AV6C 1P34B 3AZKB 3REHA 1ID3C 2FJ7C 4Z66A 5B2IA 3AZLB 5AV6A 5B1MD 2PYOD 1ID3A 4J8WC 2FJ7A 3MNND 3X1UC 5AVCC 3KUYB 2F8NA 1M18D 4JJNC 3UTAB 4J8WA 3B0DC 3X1UA 3X1TC 5CPJB 5F99B 2NZDB 3AN2C 3W96B 5AVCA 3AZIB 3W98D 4JJNA 1KX5B 5JA4A 5B0YC 4WU8B 3LELD 1F66C 5AV8D 3X1TA 2RVQD 3AN2A 4J8UB 2HIOB 3KWQD
chains in the Genus database with same CATH superfamily
5B0YA 4WU9C 3AL0C 3AV1B 1F66A 2ZY5A 3O62C 5CP6D 1JFIB 4H9PB 4WU9A 3AZHD 3P5JB 5B40D 3MVDB 3VH6W 3B0CW 5B31B 3O62A 3RELC 5B1LC 5DNNC 5AVBC 4ZUXB 3WAAB 2BYKA 5B24C 4YM6B 4YS3C 3AZMD 2Y2JA 5B33C 3LZ0D 5BNVB 3RELA 5B1LA 4M6BA 5DNNA 5AVBA 1ZLAB 2ZY3A 5B24A 4J8VD 4YS3A 5BO0B 4LD9C 3REJD 5B33A 1HQ3C 3C1CB 2YFVB 1P34D 3AZKD 4LD9A 2HUEB 2DQNC 3REKB 2L5AA 3AZLD 1HQ3A 4E44A 2CV5C 3AZFB 5CPKC 4X23B 2Y2KA 3X1VC 2CV5A 3KUYD 2Y2MA 3WTPB 1TAFB 5B31G 5CPKA 5DNMC 3AV2C 5CPJD 1S32B 4AWLC 5F99D 3X1VA 2NZDD 1KX4B 3W96D 2BYMA 1BH8A 4H9QB 3W97B 1KX5D 3LZ1C 4WU8D 5B1MB 5DNMA 3AV2A 4H9SC 4WV4B 3X1SC 1F1EA 4J8UD 3B6FC 3UTBC 5AV9C 2HIOD 5GXQB 4EO5B 3LZ1A 3AV1D 4H9SA 2NQBC 2XD5A 3X1SA 4G92C 3B6FA 3UTBA 5AV9A 5BS7C 3REIB 4QLCB 3C1BB 2NQBA 3MVDD 2PYOC 1W2EA 1M19C 3MNNC 4ZUXD 5BS7A 3WAAD 5G49A 4YM6D 5FUGB 5B0ZB 4H9RB 2PYOA 3VH6A 1M18C 1WWSA 4XUJB 1M19A 3MNNA 3VH5W 1P3BC 1ZLAD 4WJ3C 1KX3B 3C1CD 4WNNA 1M18A 3W98C 5CHLB 3R45A 3LELC 5AV8C 1P3BA 3AZJB 3NQJA 2RVQC 3REKD 3WKJD 5BNXA 3KXBB 3AZGC 3W98A 3KWQC 2XD1A 3NQUB 3AZFD 3LELA 1AOIB 4NE6A 4X23D 5AV8A 5CPIB 5GSUB 1WWIA 5CP6C 1P3OD 3AZGA 3AZEC 3KWQA 3WTPD 3AZHC 1BFMA 4CAYA 5B40C 4CSRA 4Z66B 1S32D 5GT0B 1KX4D 2YFWA 5CP6A 3WA9C 3AZEA 3W97D 3AZHA 5B40A 3AZMC 2AROB 3B6GB 3KSYA 1P3IB 3LZ0C 4KUDB 4E45A 3WA9A 2Y2HA 5GXQD 4J8VC 1P3MD 3EPLA 3REJC 3AZMA 1H3OB 5C3IC 1P34C 3LZ0A 3A6NC 4J8VA 3REID 3REJA 4QLCD 3C1BD 5B32D 3W99B 1P34A 4HGAB 3A6NA 1BH9B 5B0ZD 3KUYC 3UTAC 4XUJD 5CPJC 1U35C 2NZDC 1B6WA 1P3GB 3W96C 3AZIC 3KUYA 1KX3D 1KX5C 4Z5TB 3UTAA 1PZRA 4WU8C 2BYKB 5CPJA 3AZJD 1U35A 2NZDA 1N1JB 3VH5A 3W96A 4J8UC 3AZIA 3MGPB 3KXBD 4UPKA 1KX5A 3IP4C 1EQZB 4WU8A 1AOID 3AV1C 3UT9B 5E5AB 4J8UA 4J8XC 5CPID 5GSUD 4H9NB 1P3FB 4R8PB 3AV1A 3MVDC 4Z66D 2F8NK 5B31C 5GT0D 3AFAB 5GT3B 4J8XA 3AZNB 1P3KB 1P3AB 3WAAC 4ZUXC 4H9PA 1JFIA 3WKJB 4YM6C 3MVDA 2AROD 3B6GD 3KFUG 1P3ID 5JRGB 4H9OB 5B31A 4KUDD 2J8PA 1Z2CB 2F8ND 4ZUXA 3WAAA 2W8SA 1ZLAC 1P3OB 4YM6A 1P3LB 3X1UD 3C1CC 1BH8B 3MGRB 3LJAB 1ZLAA 4NFTA 2HUEC 1TZYB 5BO0A 5DNMB 3REKC 4DRBA 2DF4C 3C1CA 2YFVA 3W99D 2Y2GA 2FFFB 3AZFC 4X23C 5AY8C 4WZSB 3REKA 1P3MB 1A7WA 3MGQB 3WTPC 3AZFA 5AV9B 4ZBJC 4X23A 2Y2IA 5AY8A 1S32C 1P3GD 1KX4C 5B32B 3WTPA 1M1AB 3W97C 1TAFA 4Z5TD 4XZQB 2JE5A 5B1MC 3A1IA 5G49B 4NE5A 1S32A 1KX4A 3MGPD 4EO5C 4H9QA 3W97A 4UUZB 5GXQC 1EQZD 5B1MA 3UT9D 5E5AD 3H0LC 3TU4B 5BT1D 5B33D 3H0RC 4G91B 5GXQA 1P3FD 4R8PD 3REIC 4KGCB 4QLCC 1P3BB 2LY8A 3AFAD 3AYWB 5GT3D 3AZND 1P3KD 1P3AD 3REIA 4KHAB 4QLCA 5B0ZC 5JRGD 2CV5D 4XUJC 3V9RB 3F6TA 5AV5B 5B2JB 3MGSB 5KDMA 5B32G 4CAYB 5FUGA 1P3LD 1P3PB 5B0ZA 3REHB 2IO5B 1KX3C 1B67A 4XUJA 3AZEB 5B2IB 3MGRD 2CWEA 3LJAD 3AZJC 1TZYD 2JSSA 5DNMD 5AV6B 1ID3B 3KXBC 1KX3A 2FJ7B 1KU5A 3WA9B 1AOIC 3FDDA 3AZJA 2F8NB 5CPIC 5GSUC 3KXBA 3MGQD 4J8WB 3X1UB 1T3UA 3NQUA 1AOIA 3VH6T 5AV9D 3AZKC 5AVCB 3B0CT 5GT0C 4JJNB 5CPIA 5JA4B 5GSUA 3B0DB 2F2AC 3X1TB 3AZLC 1M1AD 4XZQD 2AROC 3A6NB 3AZKA 3AN2B 3B6GC 1P3IC 5GT0A 4KUDC 5B0YB 2G5IC 1F66B 3AZLA 1M19D 2AROA 3B6GA 2ZM5A 1P3IA 4KUDA 4WU9B 3TU4D 5F99C 4KGCD 2ZY2A 1H3OA 1P3BD 3O62B 1U35B 3W99C 2F8NG 4NE3A 3AYWD 4HGAC 5F99A 2HIOC 3RELB 5B1LB 5DNNB 3W99A 5AVBB 5B24B 4YS3B 3AZGD 5AV5D 3MGSD 2F8NH 5B2JD 5B33B 4DRAA 1P3PD 2ZY4A 4Z2MG 1BH9A 2HIOA 1P3GC 3REHD 4J8XB 4LD9B 4Z5TC 3AZED 5B2ID 1HQ3B 5AV6D 1P3GA 4Z2MH 3MGPC 1ID3D 3B0BA 2FJ7D 1EQZC 4Z5TA 3WA9D 3EPKA 3WTPE 3UT9C 2CV5B 5E5AC 1N1JA 1HTAA 5BT1C 3MGPA 4J8WD 5CPKB 1P3FC 4R8PC 1EQZA 2Y2LA 3X1VB 3UT9A 5BNVA 2BYMB 5E5AA 5AVCD 2RIQA 3AFAC 4JJND 5GT3C 4H9NA 3AZNC 3AV2B 4R8PA 1P3AC 1P3KC 3X1TD 1P3FA 3WKJC 4AWLB 1R4VA 3AN2D 3A6ND 2JCHA 5JRGC 3AFAA 3LZ1B 5GT3A 5B0YD 3AZNA 3VH5T 1P3AA 1P3KA 3WKJA 1F66D 1Q9CA 1P3OC 1P3LC 3X1SB 5AY8B 3B6FB 3UTBB 5JRGA 4H9OA 4WU9D 2BG1A 3MGRC 2NQBB 3LJAC 1P3OA 3UTAD 1P3LA 1TZYC 4ZBJB 4G92B 3O62D 1U35D 3AZID 3MGRA 3LJAA 1TZYA 2PYOB 2UWXA 1P3MC 3MGQC 3RELD 5B1LD 5DNND 1M19B 3MNNB 5AVBD 5B24D 4YS3D 2G5HC 4WNNB 1M18B 1P3MA 3MGQA 3R45B 3C1BC 2Y2PA 5B32C 4J8XD 3EPJA 1M1AC 4XZQC 4LD9D 3NQJB 1HQ3D 5BNXB 3W98B 1ULYA 3LELB 3C1BA 5B32A 5AV8B 5B31D 1M1AA 4XZQA 5KDMB 3AZGB 3KWQB 3EPHA 3TU4C 2Y2NA 5CPKD 2Y2OA 4G91C 4UUZA 4CSRB 2Y2QA 4H9RA 4KGCC 3X1VD 2YFWB 5CP6B 3A1KA 2VQRA 3TU4A 3AZHB 3AYWC 5B40B 3AV2D 4KGCA 3AYWA 3LZ1D 5AV5C 3MGSC 3AZMB 5B2JC 4KHAA 1P3PC 3X1SD 3LZ0B 3REHC 5AY8D 2IO5C 3UTBD 3B6FD 4DQYB 4J8VB 5AV5A 3V9RA 4Z66C 5B2IC 5B2JA 3H0MC 3MGSA 3REJB 2NQBD 1P3PA 5C3IB 5AV6C 1P34B 3AZKB 3REHA 1ID3C 2FJ7C 4Z66A 5B2IA 3AZLB 5AV6A 5B1MD 2PYOD 3EG5B 1ID3A 4J8WC 2FJ7A 3MNND 3X1UC 5AVCC 3KUYB 2F8NA 1M18D 4JJNC 3UTAB 4J8WA 3B0DC 3X1UA 3X1TC 5CPJB 5F99B 2NZDB 3AN2C 3W96B 5AVCA 3AZIB 3W98D 4JJNA 1KX5B 5JA4A 5B0YC 4WU8B 3LELD 1F66C 5AV8D 3X1TA 2RVQD 3AN2A 4J8UB 2HIOB 3KWQD
chains in the Genus database with same CATH topology
5B0YA 4WU9C 3AL0C 3AV1B 1F66A 2ZY5A 3O62C 5CP6D 1JFIB 4H9PB 4WU9A 3AZHD 3P5JB 5B40D 3MVDB 3VH6W 3B0CW 5B31B 3O62A 3RELC 5B1LC 5DNNC 5AVBC 4ZUXB 3WAAB 2BYKA 5B24C 4YM6B 4YS3C 3AZMD 2Y2JA 5B33C 3LZ0D 5BNVB 3RELA 5B1LA 4M6BA 5DNNA 5AVBA 1ZLAB 2ZY3A 5B24A 4J8VD 4YS3A 5BO0B 4LD9C 3REJD 5B33A 1HQ3C 3C1CB 2YFVB 1P34D 3AZKD 4LD9A 2HUEB 2DQNC 3REKB 2L5AA 3AZLD 1HQ3A 4E44A 2CV5C 3AZFB 5CPKC 4X23B 2Y2KA 3X1VC 2CV5A 3KUYD 2Y2MA 3WTPB 1TAFB 5B31G 5CPKA 5DNMC 3AV2C 5CPJD 1S32B 4AWLC 5F99D 3X1VA 2NZDD 1KX4B 3W96D 2BYMA 1BH8A 4H9QB 3W97B 1KX5D 3LZ1C 4WU8D 5B1MB 5DNMA 3AV2A 4H9SC 4WV4B 3X1SC 1F1EA 4J8UD 3B6FC 3UTBC 5AV9C 2HIOD 5GXQB 4EO5B 3LZ1A 3AV1D 4H9SA 2NQBC 2XD5A 3X1SA 4G92C 3B6FA 3UTBA 5AV9A 5BS7C 3REIB 4QLCB 3C1BB 2NQBA 3MVDD 2PYOC 1W2EA 1M19C 3MNNC 4ZUXD 5BS7A 3WAAD 5G49A 4YM6D 5FUGB 5B0ZB 4H9RB 2PYOA 3VH6A 1M18C 1WWSA 4XUJB 1M19A 3MNNA 3VH5W 1P3BC 1ZLAD 4WJ3C 1KX3B 3C1CD 4WNNA 1M18A 3W98C 5CHLB 3R45A 3LELC 5AV8C 1P3BA 3AZJB 3NQJA 2RVQC 3REKD 3WKJD 5BNXA 3KXBB 3AZGC 3W98A 3KWQC 2XD1A 3NQUB 3AZFD 3LELA 1AOIB 4NE6A 4X23D 5AV8A 5CPIB 5GSUB 1WWIA 5CP6C 1P3OD 3AZGA 3AZEC 3KWQA 3WTPD 3AZHC 1BFMA 4CAYA 5B40C 4CSRA 4Z66B 1S32D 5GT0B 1KX4D 2YFWA 5CP6A 3WA9C 3AZEA 3W97D 3AZHA 5B40A 3AZMC 2AROB 3B6GB 3KSYA 1P3IB 3LZ0C 4KUDB 4E45A 3WA9A 2Y2HA 5GXQD 4J8VC 1P3MD 3EPLA 3REJC 3AZMA 1H3OB 5C3IC 1P34C 3LZ0A 3A6NC 4J8VA 3REID 3REJA 4QLCD 3C1BD 5B32D 3W99B 1P34A 4HGAB 3A6NA 1BH9B 5B0ZD 3KUYC 3UTAC 4XUJD 5CPJC 1U35C 2NZDC 1B6WA 1P3GB 3W96C 3AZIC 3KUYA 1KX3D 1KX5C 4Z5TB 3UTAA 1PZRA 4WU8C 2BYKB 5CPJA 3AZJD 1U35A 2NZDA 1N1JB 3VH5A 3W96A 4J8UC 3AZIA 3MGPB 3KXBD 4UPKA 1KX5A 3IP4C 1EQZB 4WU8A 1AOID 3AV1C 3UT9B 5E5AB 4J8UA 4J8XC 5CPID 5GSUD 4H9NB 1P3FB 4R8PB 3AV1A 3MVDC 4Z66D 2F8NK 5B31C 5GT0D 3AFAB 5GT3B 4J8XA 3AZNB 1P3KB 1P3AB 3WAAC 4ZUXC 4H9PA 1JFIA 3WKJB 4YM6C 3MVDA 2AROD 3B6GD 3KFUG 1P3ID 5JRGB 4H9OB 5B31A 4KUDD 2J8PA 1Z2CB 2F8ND 4ZUXA 3WAAA 2W8SA 1ZLAC 1P3OB 4YM6A 1P3LB 3X1UD 3C1CC 1BH8B 3MGRB 3LJAB 1ZLAA 4NFTA 2HUEC 1TZYB 5BO0A 5DNMB 3REKC 4DRBA 2DF4C 3C1CA 2YFVA 3W99D 2Y2GA 2FFFB 3AZFC 4X23C 5AY8C 4WZSB 3REKA 1P3MB 1A7WA 3MGQB 3WTPC 3AZFA 5AV9B 4ZBJC 4X23A 2Y2IA 5AY8A 1S32C 1P3GD 1KX4C 5B32B 3WTPA 1M1AB 3W97C 1TAFA 4Z5TD 4XZQB 2JE5A 5B1MC 3A1IA 5G49B 4NE5A 1S32A 1KX4A 3MGPD 4EO5C 4H9QA 3W97A 4UUZB 5GXQC 1EQZD 5B1MA 3UT9D 5E5AD 3H0LC 3TU4B 5BT1D 5B33D 3H0RC 4G91B 5GXQA 1P3FD 4R8PD 3REIC 4KGCB 4QLCC 1P3BB 2LY8A 3AFAD 3AYWB 5GT3D 3AZND 1P3KD 1P3AD 3REIA 4KHAB 4QLCA 5B0ZC 5JRGD 2CV5D 4XUJC 3V9RB 3F6TA 5AV5B 5B2JB 3MGSB 5KDMA 5B32G 4CAYB 5FUGA 1P3LD 1P3PB 5B0ZA 3REHB 2IO5B 1KX3C 1B67A 4XUJA 3AZEB 5B2IB 3MGRD 2CWEA 3LJAD 3AZJC 1TZYD 2JSSA 5DNMD 5AV6B 1ID3B 3KXBC 1KX3A 2FJ7B 1KU5A 3WA9B 1AOIC 3FDDA 3AZJA 2F8NB 5CPIC 5GSUC 3KXBA 3MGQD 4J8WB 3X1UB 1T3UA 3NQUA 1AOIA 3VH6T 5AV9D 3AZKC 5AVCB 3B0CT 5GT0C 4JJNB 5CPIA 5JA4B 5GSUA 3B0DB 2F2AC 3X1TB 3AZLC 1M1AD 4XZQD 2AROC 3A6NB 3AZKA 3AN2B 3B6GC 1P3IC 5GT0A 4KUDC 5B0YB 2G5IC 1F66B 3AZLA 1M19D 2AROA 3B6GA 2ZM5A 1P3IA 4KUDA 4WU9B 3TU4D 5F99C 4KGCD 2ZY2A 1H3OA 1P3BD 3O62B 1U35B 3W99C 2F8NG 4NE3A 3AYWD 4HGAC 5F99A 2HIOC 3RELB 5B1LB 5DNNB 3W99A 5AVBB 5B24B 4YS3B 3AZGD 5AV5D 3MGSD 2F8NH 5B2JD 5B33B 4DRAA 1P3PD 2ZY4A 4Z2MG 1BH9A 2HIOA 1P3GC 3REHD 4J8XB 4LD9B 4Z5TC 3AZED 5B2ID 1HQ3B 5AV6D 1P3GA 4Z2MH 3MGPC 1ID3D 3B0BA 2FJ7D 1EQZC 4Z5TA 3WA9D 3EPKA 3WTPE 3UT9C 2CV5B 5E5AC 1N1JA 1HTAA 5BT1C 3MGPA 4J8WD 5CPKB 1P3FC 4R8PC 1EQZA 2Y2LA 3X1VB 3UT9A 5BNVA 2BYMB 5E5AA 5AVCD 2RIQA 3AFAC 4JJND 5GT3C 4H9NA 3AZNC 3AV2B 4R8PA 1P3AC 1P3KC 3X1TD 1P3FA 3WKJC 4AWLB 1R4VA 3AN2D 3A6ND 2JCHA 5JRGC 3AFAA 3LZ1B 5GT3A 5B0YD 3AZNA 3VH5T 1P3AA 1P3KA 3WKJA 1F66D 1Q9CA 1P3OC 1P3LC 3X1SB 5AY8B 3B6FB 3UTBB 5JRGA 4H9OA 4WU9D 2BG1A 3MGRC 2NQBB 3LJAC 1P3OA 3UTAD 1P3LA 1TZYC 4ZBJB 4G92B 3O62D 1U35D 3AZID 3MGRA 3LJAA 1TZYA 2PYOB 2UWXA 1P3MC 3MGQC 3RELD 5B1LD 5DNND 1M19B 3MNNB 5AVBD 5B24D 4YS3D 2G5HC 4WNNB 1M18B 1P3MA 3MGQA 3R45B 3C1BC 2Y2PA 5B32C 4J8XD 3EPJA 1M1AC 4XZQC 4LD9D 3NQJB 1HQ3D 5BNXB 3W98B 1ULYA 3LELB 3C1BA 5B32A 5AV8B 5B31D 1M1AA 4XZQA 5KDMB 3AZGB 3KWQB 3EPHA 3TU4C 2Y2NA 5CPKD 2Y2OA 4G91C 4UUZA 4CSRB 2Y2QA 4H9RA 4KGCC 3X1VD 2YFWB 5CP6B 3A1KA 2VQRA 3TU4A 3AZHB 3AYWC 5B40B 3AV2D 4KGCA 3AYWA 3LZ1D 5AV5C 3MGSC 3AZMB 5B2JC 4KHAA 1P3PC 3X1SD 3LZ0B 3REHC 5AY8D 2IO5C 3UTBD 3B6FD 4DQYB 4J8VB 5AV5A 3V9RA 4Z66C 5B2IC 5B2JA 3H0MC 3MGSA 3REJB 2NQBD 1P3PA 5C3IB 5AV6C 1P34B 3AZKB 3REHA 1ID3C 2FJ7C 4Z66A 5B2IA 3AZLB 5AV6A 5B1MD 2PYOD 3EG5B 1ID3A 4J8WC 2FJ7A 3MNND 3X1UC 5AVCC 3KUYB 2F8NA 1M18D 4JJNC 3UTAB 4J8WA 3B0DC 3X1UA 3X1TC 5CPJB 5F99B 2NZDB 3AN2C 3W96B 5AVCA 3AZIB 3W98D 4JJNA 1KX5B 5JA4A 5B0YC 4WU8B 3LELD 1F66C 5AV8D 3X1TA 2RVQD 3AN2A 4J8UB 2HIOB 3KWQD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5B0Y A;  4WU9 C;  3AV1 B;  1F66 A;  3O62 C;  5CP6 D;  1JFI B;  4H9P B;  4WU9 A;  3AZH D;  5B40 D;  3MVD B;  3VH6 W;  3B0C W;  5B31 B;  3O62 A;  3REL C;  5B1L C;  5DNN C;  5AVB C;  4ZUX B;  3WAA B;  2BYK A;  5B24 C;  4YM6 B;  4YS3 C;  3AZM D;  5B33 C;  3LZ0 D;  5BNV B;  3REL A;  5B1L A;  4M6B A;  5DNN A;  5AVB A;  1ZLA B;  4LD9 C;  5B24 A;  4J8V D;  4YS3 A;  5BO0 B;  3REJ D;  5B33 A;  1HQ3 C;  3C1C B;  2YFV B;  1P34 D;  3AZK D;  4LD9 A;  2HUE B;  3REK B;  2L5A A;  3AZL D;  1HQ3 A;  4E44 A;  2CV5 C;  3AZF B;  5CPK C;  4X23 B;  3X1V C;  2CV5 A;  3KUY D;  3WTP B;  1TAF B;  5B31 G;  5CPK A;  5DNM C;  3AV2 C;  5CPJ D;  1S32 B;  4AWL C;  5F99 D;  3X1V A;  2NZD D;  1KX4 B;  3W96 D;  2BYM A;  1BH8 A;  4H9Q B;  3W97 B;  1KX5 D;  3LZ1 C;  4WU8 D;  5B1M B;  5DNM A;  3AV2 A;  4H9S C;  4WV4 B;  3X1S C;  1F1E A;  4J8U D;  3B6F C;  3UTB C;  5AV9 C;  2HIO D;  5GXQ B;  4EO5 B;  3LZ1 A;  3AV1 D;  4H9S A;  2NQB C;  3X1S A;  4G92 C;  3B6F A;  3UTB A;  5AV9 A;  5BS7 C;  3REI B;  4QLC B;  3C1B B;  2NQB A;  3MVD D;  2PYO C;  1M19 C;  3MNN C;  4ZUX D;  5BS7 A;  3WAA D;  5G49 A;  4YM6 D;  5FUG B;  5B0Z B;  4H9R B;  2PYO A;  3VH6 A;  1M18 C;  1WWS A;  4XUJ B;  1M19 A;  3MNN A;  3VH5 W;  1P3B C;  1ZLA D;  1KX3 B;  3C1C D;  4WNN A;  1M18 A;  3W98 C;  5CHL B;  3R45 A;  3LEL C;  5AV8 C;  1P3B A;  3AZJ B;  3NQJ A;  2RVQ C;  3REK D;  3WKJ D;  5BNX A;  3KXB B;  3AZG C;  3W98 A;  3KWQ C;  3NQU B;  3AZF D;  3LEL A;  1AOI B;  4NE6 A;  4X23 D;  5AV8 A;  5CPI B;  5GSU B;  1WWI A;  5CP6 C;  1P3O D;  3AZG A;  3AZE C;  3KWQ A;  3WTP D;  3AZH C;  1BFM A;  4CAY A;  5B40 C;  4CSR A;  4Z66 B;  1S32 D;  5GT0 B;  1KX4 D;  2YFW A;  5CP6 A;  3WA9 C;  3AZE A;  3W97 D;  3AZH A;  5B40 A;  3AZM C;  2ARO B;  3B6G B;  3KSY A;  1P3I B;  3LZ0 C;  4KUD B;  4E45 A;  3WA9 A;  5GXQ D;  4J8V C;  1P3M D;  3REJ C;  3AZM A;  1H3O B;  5C3I C;  1P34 C;  3LZ0 A;  3A6N C;  4J8V A;  3REI D;  3REJ A;  4QLC D;  3C1B D;  5B32 D;  3W99 B;  1P34 A;  4HGA B;  3A6N A;  1BH9 B;  5B0Z D;  3KUY C;  3UTA C;  4XUJ D;  5CPJ C;  1U35 C;  2NZD C;  1B6W A;  1P3G B;  3W96 C;  3AZI C;  3KUY A;  1KX3 D;  1KX5 C;  4Z5T B;  3UTA A;  4WU8 C;  2BYK B;  5CPJ A;  3AZJ D;  1U35 A;  2NZD A;  1N1J B;  3VH5 A;  3W96 A;  4J8U C;  3AZI A;  3MGP B;  3KXB D;  1KX5 A;  1EQZ B;  4WU8 A;  1AOI D;  3AV1 C;  3UT9 B;  5E5A B;  4J8U A;  4J8X C;  5CPI D;  5GSU D;  4H9N B;  1P3F B;  4R8P B;  3AV1 A;  3MVD C;  4Z66 D;  2F8N K;  5B31 C;  5GT0 D;  3AFA B;  5GT3 B;  4J8X A;  3AZN B;  1P3K B;  1P3A B;  3WAA C;  4ZUX C;  4H9P A;  1JFI A;  3WKJ B;  4YM6 C;  3MVD A;  2ARO D;  3B6G D;  1P3I D;  5JRG B;  4H9O B;  5B31 A;  4KUD D;  2F8N D;  4ZUX A;  3WAA A;  1ZLA C;  1P3O B;  4YM6 A;  1P3L B;  3X1U D;  3C1C C;  1BH8 B;  3MGR B;  3LJA B;  1ZLA A;  4NFT A;  2HUE C;  1TZY B;  5BO0 A;  5DNM B;  3REK C;  4DRB A;  3C1C A;  2YFV A;  3W99 D;  3AZF C;  4X23 C;  5AY8 C;  4WZS B;  3REK A;  1P3M B;  1A7W A;  3MGQ B;  3WTP C;  3AZF A;  5AV9 B;  4ZBJ C;  4X23 A;  5AY8 A;  1S32 C;  1P3G D;  1KX4 C;  5B32 B;  3WTP A;  1M1A B;  3W97 C;  1TAF A;  4Z5T D;  4XZQ B;  5B1M C;  5G49 B;  4NE5 A;  1S32 A;  1KX4 A;  3MGP D;  4EO5 C;  4H9Q A;  3W97 A;  4UUZ B;  5GXQ C;  1EQZ D;  5B1M A;  3UT9 D;  5E5A D;  3TU4 B;  5BT1 D;  5B33 D;  4G91 B;  5GXQ A;  1P3F D;  4R8P D;  3REI C;  4KGC B;  4QLC C;  1P3B B;  2LY8 A;  3AFA D;  3AYW B;  5GT3 D;  3AZN D;  1P3K D;  1P3A D;  3REI A;  4KHA B;  4QLC A;  5B0Z C;  5JRG D;  2CV5 D;  4XUJ C;  3V9R B;  5AV5 B;  3MGS B;  5B2J B;  5KDM A;  5B32 G;  4CAY B;  5FUG A;  1P3L D;  1P3P B;  5B0Z A;  3REH B;  2IO5 B;  1KX3 C;  1B67 A;  4XUJ A;  3AZE B;  5B2I B;  3MGR D;  2CWE A;  3LJA D;  3AZJ C;  1TZY D;  2JSS A;  5DNM D;  5AV6 B;  1ID3 B;  3KXB C;  1KX3 A;  2FJ7 B;  1KU5 A;  3WA9 B;  1AOI C;  3AZJ A;  2F8N B;  5CPI C;  5GSU C;  3KXB A;  3MGQ D;  4J8W B;  3X1U B;  3NQU A;  1AOI A;  3VH6 T;  5AV9 D;  3AZK C;  5AVC B;  3B0C T;  5GT0 C;  4JJN B;  5CPI A;  5JA4 B;  5GSU A;  3B0D B;  3X1T B;  3AZL C;  1M1A D;  4XZQ D;  2ARO C;  3A6N B;  3AZK A;  3AN2 B;  3B6G C;  1P3I C;  5GT0 A;  4KUD C;  5B0Y B;  1F66 B;  3AZL A;  1M19 D;  2ARO A;  3B6G A;  1P3I A;  4KUD A;  4WU9 B;  3TU4 D;  5F99 C;  4KGC D;  1H3O A;  1P3B D;  3O62 B;  1U35 B;  3W99 C;  2F8N G;  4NE3 A;  3AYW D;  4HGA C;  5F99 A;  2HIO C;  3REL B;  5B1L B;  5DNN B;  3W99 A;  5AVB B;  5B24 B;  4YS3 B;  3AZG D;  5AV5 D;  3MGS D;  2F8N H;  5B2J D;  5B33 B;  4DRA A;  1P3P D;  4Z2M G;  1BH9 A;  2HIO A;  1P3G C;  3REH D;  4J8X B;  4LD9 B;  4Z5T C;  3AZE D;  5B2I D;  1HQ3 B;  5AV6 D;  1P3G A;  4Z2M H;  3MGP C;  1ID3 D;  3B0B A;  2FJ7 D;  1EQZ C;  4Z5T A;  3WA9 D;  3WTP E;  3UT9 C;  2CV5 B;  5E5A C;  1N1J A;  1HTA A;  5BT1 C;  3MGP A;  4J8W D;  5CPK B;  1P3F C;  4R8P C;  1EQZ A;  3X1V B;  3UT9 A;  5BNV A;  2BYM B;  5E5A A;  5AVC D;  3AFA C;  4JJN D;  5GT3 C;  4H9N A;  3AZN C;  3AV2 B;  4R8P A;  1P3A C;  1P3K C;  3X1T D;  1P3F A;  3WKJ C;  4AWL B;  1R4V A;  3AN2 D;  3A6N D;  5JRG C;  3AFA A;  3LZ1 B;  5GT3 A;  5B0Y D;  3AZN A;  3VH5 T;  1P3A A;  1P3K A;  3WKJ A;  1F66 D;  1Q9C A;  1P3O C;  1P3L C;  3X1S B;  5AY8 B;  3B6F B;  3UTB B;  5JRG A;  4H9O A;  4WU9 D;  3MGR C;  2NQB B;  3LJA C;  1P3O A;  3UTA D;  1P3L A;  1TZY C;  4ZBJ B;  4G92 B;  3O62 D;  1U35 D;  3AZI D;  3MGR A;  3LJA A;  1TZY A;  2PYO B;  1P3M C;  3MGQ C;  3REL D;  5B1L D;  5DNN D;  1M19 B;  3MNN B;  5AVB D;  5B24 D;  4YS3 D;  4WNN B;  1M18 B;  1P3M A;  3MGQ A;  3R45 B;  3C1B C;  5B32 C;  1M1A C;  4J8X D;  4LD9 D;  4XZQ C;  3NQJ B;  1HQ3 D;  5BNX B;  3W98 B;  1ULY A;  3LEL B;  3C1B A;  5B32 A;  5AV8 B;  5B31 D;  1M1A A;  4XZQ A;  5KDM B;  3AZG B;  3KWQ B;  3TU4 C;  5CPK D;  4G91 C;  4UUZ A;  4CSR B;  4H9R A;  4KGC C;  3X1V D;  2YFW B;  5CP6 B;  3TU4 A;  3AZH B;  3AYW C;  5B40 B;  3AV2 D;  4KGC A;  3AYW A;  3LZ1 D;  5AV5 C;  3MGS C;  3AZM B;  5B2J C;  4KHA A;  1P3P C;  3X1S D;  3LZ0 B;  3REH C;  5AY8 D;  2IO5 C;  3UTB D;  3B6F D;  4J8V B;  5AV5 A;  3V9R A;  4Z66 C;  5B2I C;  5B2J A;  3MGS A;  3REJ B;  2NQB D;  1P3P A;  5C3I B;  5AV6 C;  1P34 B;  3AZK B;  3REH A;  1ID3 C;  2FJ7 C;  4Z66 A;  5B2I A;  3AZL B;  5AV6 A;  5B1M D;  2PYO D;  1ID3 A;  4J8W C;  2FJ7 A;  3MNN D;  3X1U C;  5AVC C;  3KUY B;  2F8N A;  1M18 D;  4JJN C;  3UTA B;  4J8W A;  3B0D C;  3X1U A;  3X1T C;  5CPJ B;  5F99 B;  2NZD B;  3AN2 C;  3W96 B;  5AVC A;  3AZI B;  3W98 D;  4JJN A;  1KX5 B;  5JA4 A;  5B0Y C;  4WU8 B;  3LEL D;  1F66 C;  5AV8 D;  3X1T A;  2RVQ D;  3AN2 A;  4J8U B;  2HIO B;  3KWQ D; 
#chains in the Genus database with same CATH topology
 5B0Y A;  4WU9 C;  3AL0 C;  3AV1 B;  1F66 A;  2ZY5 A;  3O62 C;  5CP6 D;  1JFI B;  4H9P B;  4WU9 A;  3AZH D;  3P5J B;  5B40 D;  3MVD B;  3VH6 W;  3B0C W;  5B31 B;  3O62 A;  3REL C;  5B1L C;  5DNN C;  5AVB C;  4ZUX B;  3WAA B;  2BYK A;  5B24 C;  4YM6 B;  4YS3 C;  3AZM D;  2Y2J A;  5B33 C;  3LZ0 D;  5BNV B;  3REL A;  5B1L A;  4M6B A;  5DNN A;  5AVB A;  1ZLA B;  2ZY3 A;  5B24 A;  4J8V D;  4YS3 A;  5BO0 B;  4LD9 C;  3REJ D;  5B33 A;  1HQ3 C;  3C1C B;  2YFV B;  1P34 D;  3AZK D;  4LD9 A;  2HUE B;  2DQN C;  3REK B;  2L5A A;  3AZL D;  1HQ3 A;  4E44 A;  2CV5 C;  3AZF B;  5CPK C;  4X23 B;  2Y2K A;  3X1V C;  2CV5 A;  3KUY D;  2Y2M A;  3WTP B;  1TAF B;  5B31 G;  5CPK A;  5DNM C;  3AV2 C;  5CPJ D;  1S32 B;  4AWL C;  5F99 D;  3X1V A;  2NZD D;  1KX4 B;  3W96 D;  2BYM A;  1BH8 A;  4H9Q B;  3W97 B;  1KX5 D;  3LZ1 C;  4WU8 D;  5B1M B;  5DNM A;  3AV2 A;  4H9S C;  4WV4 B;  3X1S C;  1F1E A;  4J8U D;  3B6F C;  3UTB C;  5AV9 C;  2HIO D;  5GXQ B;  4EO5 B;  3LZ1 A;  3AV1 D;  4H9S A;  2NQB C;  2XD5 A;  3X1S A;  4G92 C;  3B6F A;  3UTB A;  5AV9 A;  5BS7 C;  3REI B;  4QLC B;  3C1B B;  2NQB A;  3MVD D;  2PYO C;  1W2E A;  1M19 C;  3MNN C;  4ZUX D;  5BS7 A;  3WAA D;  5G49 A;  4YM6 D;  5FUG B;  5B0Z B;  4H9R B;  2PYO A;  3VH6 A;  1M18 C;  1WWS A;  4XUJ B;  1M19 A;  3MNN A;  3VH5 W;  1P3B C;  1ZLA D;  4WJ3 C;  1KX3 B;  3C1C D;  4WNN A;  1M18 A;  3W98 C;  5CHL B;  3R45 A;  3LEL C;  5AV8 C;  1P3B A;  3AZJ B;  3NQJ A;  2RVQ C;  3REK D;  3WKJ D;  5BNX A;  3KXB B;  3AZG C;  3W98 A;  3KWQ C;  2XD1 A;  3NQU B;  3AZF D;  3LEL A;  1AOI B;  4NE6 A;  4X23 D;  5AV8 A;  5CPI B;  5GSU B;  1WWI A;  5CP6 C;  1P3O D;  3AZG A;  3AZE C;  3KWQ A;  3WTP D;  3AZH C;  1BFM A;  4CAY A;  5B40 C;  4CSR A;  4Z66 B;  1S32 D;  5GT0 B;  1KX4 D;  2YFW A;  5CP6 A;  3WA9 C;  3AZE A;  3W97 D;  3AZH A;  5B40 A;  3AZM C;  2ARO B;  3B6G B;  3KSY A;  1P3I B;  3LZ0 C;  4KUD B;  4E45 A;  3WA9 A;  2Y2H A;  5GXQ D;  4J8V C;  1P3M D;  3EPL A;  3REJ C;  3AZM A;  1H3O B;  5C3I C;  1P34 C;  3LZ0 A;  3A6N C;  4J8V A;  3REI D;  3REJ A;  4QLC D;  3C1B D;  5B32 D;  3W99 B;  1P34 A;  4HGA B;  3A6N A;  1BH9 B;  5B0Z D;  3KUY C;  3UTA C;  4XUJ D;  5CPJ C;  1U35 C;  2NZD C;  1B6W A;  1P3G B;  3W96 C;  3AZI C;  3KUY A;  1KX3 D;  1KX5 C;  4Z5T B;  3UTA A;  1PZR A;  4WU8 C;  2BYK B;  5CPJ A;  3AZJ D;  1U35 A;  2NZD A;  1N1J B;  3VH5 A;  3W96 A;  4J8U C;  3AZI A;  3MGP B;  3KXB D;  4UPK A;  1KX5 A;  3IP4 C;  1EQZ B;  4WU8 A;  1AOI D;  3AV1 C;  3UT9 B;  5E5A B;  4J8U A;  4J8X C;  5CPI D;  5GSU D;  4H9N B;  1P3F B;  4R8P B;  3AV1 A;  3MVD C;  4Z66 D;  2F8N K;  5B31 C;  5GT0 D;  3AFA B;  5GT3 B;  4J8X A;  3AZN B;  1P3K B;  1P3A B;  3WAA C;  4ZUX C;  4H9P A;  1JFI A;  3WKJ B;  4YM6 C;  3MVD A;  2ARO D;  3B6G D;  3KFU G;  1P3I D;  5JRG B;  4H9O B;  5B31 A;  4KUD D;  2J8P A;  1Z2C B;  2F8N D;  4ZUX A;  3WAA A;  2W8S A;  1ZLA C;  1P3O B;  4YM6 A;  1P3L B;  3X1U D;  3C1C C;  1BH8 B;  3MGR B;  3LJA B;  1ZLA A;  4NFT A;  2HUE C;  1TZY B;  5BO0 A;  5DNM B;  3REK C;  4DRB A;  2DF4 C;  3C1C A;  2YFV A;  3W99 D;  2Y2G A;  2FFF B;  3AZF C;  4X23 C;  5AY8 C;  4WZS B;  3REK A;  1P3M B;  1A7W A;  3MGQ B;  3WTP C;  3AZF A;  5AV9 B;  4ZBJ C;  4X23 A;  2Y2I A;  5AY8 A;  1S32 C;  1P3G D;  1KX4 C;  5B32 B;  3WTP A;  1M1A B;  3W97 C;  1TAF A;  4Z5T D;  4XZQ B;  2JE5 A;  5B1M C;  3A1I A;  5G49 B;  4NE5 A;  1S32 A;  1KX4 A;  3MGP D;  4EO5 C;  4H9Q A;  3W97 A;  4UUZ B;  5GXQ C;  1EQZ D;  5B1M A;  3UT9 D;  5E5A D;  3H0L C;  3TU4 B;  5BT1 D;  5B33 D;  3H0R C;  4G91 B;  5GXQ A;  1P3F D;  4R8P D;  3REI C;  4KGC B;  4QLC C;  1P3B B;  2LY8 A;  3AFA D;  3AYW B;  5GT3 D;  3AZN D;  1P3K D;  1P3A D;  3REI A;  4KHA B;  4QLC A;  5B0Z C;  5JRG D;  2CV5 D;  4XUJ C;  3V9R B;  3F6T A;  5AV5 B;  5B2J B;  3MGS B;  5KDM A;  5B32 G;  4CAY B;  5FUG A;  1P3L D;  1P3P B;  5B0Z A;  3REH B;  2IO5 B;  1KX3 C;  1B67 A;  4XUJ A;  3AZE B;  5B2I B;  3MGR D;  2CWE A;  3LJA D;  3AZJ C;  1TZY D;  2JSS A;  5DNM D;  5AV6 B;  1ID3 B;  3KXB C;  1KX3 A;  2FJ7 B;  1KU5 A;  3WA9 B;  1AOI C;  3FDD A;  3AZJ A;  2F8N B;  5CPI C;  5GSU C;  3KXB A;  3MGQ D;  4J8W B;  3X1U B;  1T3U A;  3NQU A;  1AOI A;  3VH6 T;  5AV9 D;  3AZK C;  5AVC B;  3B0C T;  5GT0 C;  4JJN B;  5CPI A;  5JA4 B;  5GSU A;  3B0D B;  2F2A C;  3X1T B;  3AZL C;  1M1A D;  4XZQ D;  2ARO C;  3A6N B;  3AZK A;  3AN2 B;  3B6G C;  1P3I C;  5GT0 A;  4KUD C;  5B0Y B;  2G5I C;  1F66 B;  3AZL A;  1M19 D;  2ARO A;  3B6G A;  2ZM5 A;  1P3I A;  4KUD A;  4WU9 B;  3TU4 D;  5F99 C;  4KGC D;  2ZY2 A;  1H3O A;  1P3B D;  3O62 B;  1U35 B;  3W99 C;  2F8N G;  4NE3 A;  3AYW D;  4HGA C;  5F99 A;  2HIO C;  3REL B;  5B1L B;  5DNN B;  3W99 A;  5AVB B;  5B24 B;  4YS3 B;  3AZG D;  5AV5 D;  3MGS D;  2F8N H;  5B2J D;  5B33 B;  4DRA A;  1P3P D;  2ZY4 A;  4Z2M G;  1BH9 A;  2HIO A;  1P3G C;  3REH D;  4J8X B;  4LD9 B;  4Z5T C;  3AZE D;  5B2I D;  1HQ3 B;  5AV6 D;  1P3G A;  4Z2M H;  3MGP C;  1ID3 D;  3B0B A;  2FJ7 D;  1EQZ C;  4Z5T A;  3WA9 D;  3EPK A;  3WTP E;  3UT9 C;  2CV5 B;  5E5A C;  1N1J A;  1HTA A;  5BT1 C;  3MGP A;  4J8W D;  5CPK B;  1P3F C;  4R8P C;  1EQZ A;  2Y2L A;  3X1V B;  3UT9 A;  5BNV A;  2BYM B;  5E5A A;  5AVC D;  2RIQ A;  3AFA C;  4JJN D;  5GT3 C;  4H9N A;  3AZN C;  3AV2 B;  4R8P A;  1P3A C;  1P3K C;  3X1T D;  1P3F A;  3WKJ C;  4AWL B;  1R4V A;  3AN2 D;  3A6N D;  2JCH A;  5JRG C;  3AFA A;  3LZ1 B;  5GT3 A;  5B0Y D;  3AZN A;  3VH5 T;  1P3A A;  1P3K A;  3WKJ A;  1F66 D;  1Q9C A;  1P3O C;  1P3L C;  3X1S B;  5AY8 B;  3B6F B;  3UTB B;  5JRG A;  4H9O A;  4WU9 D;  2BG1 A;  3MGR C;  2NQB B;  3LJA C;  1P3O A;  3UTA D;  1P3L A;  1TZY C;  4ZBJ B;  4G92 B;  3O62 D;  1U35 D;  3AZI D;  3MGR A;  3LJA A;  1TZY A;  2PYO B;  2UWX A;  1P3M C;  3MGQ C;  3REL D;  5B1L D;  5DNN D;  1M19 B;  3MNN B;  5AVB D;  5B24 D;  4YS3 D;  2G5H C;  4WNN B;  1M18 B;  1P3M A;  3MGQ A;  3R45 B;  3C1B C;  2Y2P A;  5B32 C;  4J8X D;  3EPJ A;  1M1A C;  4XZQ C;  4LD9 D;  3NQJ B;  1HQ3 D;  5BNX B;  3W98 B;  1ULY A;  3LEL B;  3C1B A;  5B32 A;  5AV8 B;  5B31 D;  1M1A A;  4XZQ A;  5KDM B;  3AZG B;  3KWQ B;  3EPH A;  3TU4 C;  2Y2N A;  5CPK D;  2Y2O A;  4G91 C;  4UUZ A;  4CSR B;  2Y2Q A;  4H9R A;  4KGC C;  3X1V D;  2YFW B;  5CP6 B;  3A1K A;  2VQR A;  3TU4 A;  3AZH B;  3AYW C;  5B40 B;  3AV2 D;  4KGC A;  3AYW A;  3LZ1 D;  5AV5 C;  3MGS C;  3AZM B;  5B2J C;  4KHA A;  1P3P C;  3X1S D;  3LZ0 B;  3REH C;  5AY8 D;  2IO5 C;  3UTB D;  3B6F D;  4DQY B;  4J8V B;  5AV5 A;  3V9R A;  4Z66 C;  5B2I C;  5B2J A;  3H0M C;  3MGS A;  3REJ B;  2NQB D;  1P3P A;  5C3I B;  5AV6 C;  1P34 B;  3AZK B;  3REH A;  1ID3 C;  2FJ7 C;  4Z66 A;  5B2I A;  3AZL B;  5AV6 A;  5B1M D;  2PYO D;  3EG5 B;  1ID3 A;  4J8W C;  2FJ7 A;  3MNN D;  3X1U C;  5AVC C;  3KUY B;  2F8N A;  1M18 D;  4JJN C;  3UTA B;  4J8W A;  3B0D C;  3X1U A;  3X1T C;  5CPJ B;  5F99 B;  2NZD B;  3AN2 C;  3W96 B;  5AVC A;  3AZI B;  3W98 D;  4JJN A;  1KX5 B;  5JA4 A;  5B0Y C;  4WU8 B;  3LEL D;  1F66 C;  5AV8 D;  3X1T A;  2RVQ D;  3AN2 A;  4J8U B;  2HIO B;  3KWQ D; 
#chains in the Genus database with same CATH homology
 5B0Y A;  4WU9 C;  3AL0 C;  3AV1 B;  1F66 A;  2ZY5 A;  3O62 C;  5CP6 D;  1JFI B;  4H9P B;  4WU9 A;  3AZH D;  3P5J B;  5B40 D;  3MVD B;  3VH6 W;  3B0C W;  5B31 B;  3O62 A;  3REL C;  5B1L C;  5DNN C;  5AVB C;  4ZUX B;  3WAA B;  2BYK A;  5B24 C;  4YM6 B;  4YS3 C;  3AZM D;  2Y2J A;  5B33 C;  3LZ0 D;  5BNV B;  3REL A;  5B1L A;  4M6B A;  5DNN A;  5AVB A;  1ZLA B;  2ZY3 A;  5B24 A;  4J8V D;  4YS3 A;  5BO0 B;  4LD9 C;  3REJ D;  5B33 A;  1HQ3 C;  3C1C B;  2YFV B;  1P34 D;  3AZK D;  4LD9 A;  2HUE B;  2DQN C;  3REK B;  2L5A A;  3AZL D;  1HQ3 A;  4E44 A;  2CV5 C;  3AZF B;  5CPK C;  4X23 B;  2Y2K A;  3X1V C;  2CV5 A;  3KUY D;  2Y2M A;  3WTP B;  1TAF B;  5B31 G;  5CPK A;  5DNM C;  3AV2 C;  5CPJ D;  1S32 B;  4AWL C;  5F99 D;  3X1V A;  2NZD D;  1KX4 B;  3W96 D;  2BYM A;  1BH8 A;  4H9Q B;  3W97 B;  1KX5 D;  3LZ1 C;  4WU8 D;  5B1M B;  5DNM A;  3AV2 A;  4H9S C;  4WV4 B;  3X1S C;  1F1E A;  4J8U D;  3B6F C;  3UTB C;  5AV9 C;  2HIO D;  5GXQ B;  4EO5 B;  3LZ1 A;  3AV1 D;  4H9S A;  2NQB C;  2XD5 A;  3X1S A;  4G92 C;  3B6F A;  3UTB A;  5AV9 A;  5BS7 C;  3REI B;  4QLC B;  3C1B B;  2NQB A;  3MVD D;  2PYO C;  1W2E A;  1M19 C;  3MNN C;  4ZUX D;  5BS7 A;  3WAA D;  5G49 A;  4YM6 D;  5FUG B;  5B0Z B;  4H9R B;  2PYO A;  3VH6 A;  1M18 C;  1WWS A;  4XUJ B;  1M19 A;  3MNN A;  3VH5 W;  1P3B C;  1ZLA D;  4WJ3 C;  1KX3 B;  3C1C D;  4WNN A;  1M18 A;  3W98 C;  5CHL B;  3R45 A;  3LEL C;  5AV8 C;  1P3B A;  3AZJ B;  3NQJ A;  2RVQ C;  3REK D;  3WKJ D;  5BNX A;  3KXB B;  3AZG C;  3W98 A;  3KWQ C;  2XD1 A;  3NQU B;  3AZF D;  3LEL A;  1AOI B;  4NE6 A;  4X23 D;  5AV8 A;  5CPI B;  5GSU B;  1WWI A;  5CP6 C;  1P3O D;  3AZG A;  3AZE C;  3KWQ A;  3WTP D;  3AZH C;  1BFM A;  4CAY A;  5B40 C;  4CSR A;  4Z66 B;  1S32 D;  5GT0 B;  1KX4 D;  2YFW A;  5CP6 A;  3WA9 C;  3AZE A;  3W97 D;  3AZH A;  5B40 A;  3AZM C;  2ARO B;  3B6G B;  3KSY A;  1P3I B;  3LZ0 C;  4KUD B;  4E45 A;  3WA9 A;  2Y2H A;  5GXQ D;  4J8V C;  1P3M D;  3EPL A;  3REJ C;  3AZM A;  1H3O B;  5C3I C;  1P34 C;  3LZ0 A;  3A6N C;  4J8V A;  3REI D;  3REJ A;  4QLC D;  3C1B D;  5B32 D;  3W99 B;  1P34 A;  4HGA B;  3A6N A;  1BH9 B;  5B0Z D;  3KUY C;  3UTA C;  4XUJ D;  5CPJ C;  1U35 C;  2NZD C;  1B6W A;  1P3G B;  3W96 C;  3AZI C;  3KUY A;  1KX3 D;  1KX5 C;  4Z5T B;  3UTA A;  1PZR A;  4WU8 C;  2BYK B;  5CPJ A;  3AZJ D;  1U35 A;  2NZD A;  1N1J B;  3VH5 A;  3W96 A;  4J8U C;  3AZI A;  3MGP B;  3KXB D;  4UPK A;  1KX5 A;  3IP4 C;  1EQZ B;  4WU8 A;  1AOI D;  3AV1 C;  3UT9 B;  5E5A B;  4J8U A;  4J8X C;  5CPI D;  5GSU D;  4H9N B;  1P3F B;  4R8P B;  3AV1 A;  3MVD C;  4Z66 D;  2F8N K;  5B31 C;  5GT0 D;  3AFA B;  5GT3 B;  4J8X A;  3AZN B;  1P3K B;  1P3A B;  3WAA C;  4ZUX C;  4H9P A;  1JFI A;  3WKJ B;  4YM6 C;  3MVD A;  2ARO D;  3B6G D;  3KFU G;  1P3I D;  5JRG B;  4H9O B;  5B31 A;  4KUD D;  2J8P A;  1Z2C B;  2F8N D;  4ZUX A;  3WAA A;  2W8S A;  1ZLA C;  1P3O B;  4YM6 A;  1P3L B;  3X1U D;  3C1C C;  1BH8 B;  3MGR B;  3LJA B;  1ZLA A;  4NFT A;  2HUE C;  1TZY B;  5BO0 A;  5DNM B;  3REK C;  4DRB A;  2DF4 C;  3C1C A;  2YFV A;  3W99 D;  2Y2G A;  2FFF B;  3AZF C;  4X23 C;  5AY8 C;  4WZS B;  3REK A;  1P3M B;  1A7W A;  3MGQ B;  3WTP C;  3AZF A;  5AV9 B;  4ZBJ C;  4X23 A;  2Y2I A;  5AY8 A;  1S32 C;  1P3G D;  1KX4 C;  5B32 B;  3WTP A;  1M1A B;  3W97 C;  1TAF A;  4Z5T D;  4XZQ B;  2JE5 A;  5B1M C;  3A1I A;  5G49 B;  4NE5 A;  1S32 A;  1KX4 A;  3MGP D;  4EO5 C;  4H9Q A;  3W97 A;  4UUZ B;  5GXQ C;  1EQZ D;  5B1M A;  3UT9 D;  5E5A D;  3H0L C;  3TU4 B;  5BT1 D;  5B33 D;  3H0R C;  4G91 B;  5GXQ A;  1P3F D;  4R8P D;  3REI C;  4KGC B;  4QLC C;  1P3B B;  2LY8 A;  3AFA D;  3AYW B;  5GT3 D;  3AZN D;  1P3K D;  1P3A D;  3REI A;  4KHA B;  4QLC A;  5B0Z C;  5JRG D;  2CV5 D;  4XUJ C;  3V9R B;  3F6T A;  5AV5 B;  5B2J B;  3MGS B;  5KDM A;  5B32 G;  4CAY B;  5FUG A;  1P3L D;  1P3P B;  5B0Z A;  3REH B;  2IO5 B;  1KX3 C;  1B67 A;  4XUJ A;  3AZE B;  5B2I B;  3MGR D;  2CWE A;  3LJA D;  3AZJ C;  1TZY D;  2JSS A;  5DNM D;  5AV6 B;  1ID3 B;  3KXB C;  1KX3 A;  2FJ7 B;  1KU5 A;  3WA9 B;  1AOI C;  3FDD A;  3AZJ A;  2F8N B;  5CPI C;  5GSU C;  3KXB A;  3MGQ D;  4J8W B;  3X1U B;  1T3U A;  3NQU A;  1AOI A;  3VH6 T;  5AV9 D;  3AZK C;  5AVC B;  3B0C T;  5GT0 C;  4JJN B;  5CPI A;  5JA4 B;  5GSU A;  3B0D B;  2F2A C;  3X1T B;  3AZL C;  1M1A D;  4XZQ D;  2ARO C;  3A6N B;  3AZK A;  3AN2 B;  3B6G C;  1P3I C;  5GT0 A;  4KUD C;  5B0Y B;  2G5I C;  1F66 B;  3AZL A;  1M19 D;  2ARO A;  3B6G A;  2ZM5 A;  1P3I A;  4KUD A;  4WU9 B;  3TU4 D;  5F99 C;  4KGC D;  2ZY2 A;  1H3O A;  1P3B D;  3O62 B;  1U35 B;  3W99 C;  2F8N G;  4NE3 A;  3AYW D;  4HGA C;  5F99 A;  2HIO C;  3REL B;  5B1L B;  5DNN B;  3W99 A;  5AVB B;  5B24 B;  4YS3 B;  3AZG D;  5AV5 D;  3MGS D;  2F8N H;  5B2J D;  5B33 B;  4DRA A;  1P3P D;  2ZY4 A;  4Z2M G;  1BH9 A;  2HIO A;  1P3G C;  3REH D;  4J8X B;  4LD9 B;  4Z5T C;  3AZE D;  5B2I D;  1HQ3 B;  5AV6 D;  1P3G A;  4Z2M H;  3MGP C;  1ID3 D;  3B0B A;  2FJ7 D;  1EQZ C;  4Z5T A;  3WA9 D;  3EPK A;  3WTP E;  3UT9 C;  2CV5 B;  5E5A C;  1N1J A;  1HTA A;  5BT1 C;  3MGP A;  4J8W D;  5CPK B;  1P3F C;  4R8P C;  1EQZ A;  2Y2L A;  3X1V B;  3UT9 A;  5BNV A;  2BYM B;  5E5A A;  5AVC D;  2RIQ A;  3AFA C;  4JJN D;  5GT3 C;  4H9N A;  3AZN C;  3AV2 B;  4R8P A;  1P3A C;  1P3K C;  3X1T D;  1P3F A;  3WKJ C;  4AWL B;  1R4V A;  3AN2 D;  3A6N D;  2JCH A;  5JRG C;  3AFA A;  3LZ1 B;  5GT3 A;  5B0Y D;  3AZN A;  3VH5 T;  1P3A A;  1P3K A;  3WKJ A;  1F66 D;  1Q9C A;  1P3O C;  1P3L C;  3X1S B;  5AY8 B;  3B6F B;  3UTB B;  5JRG A;  4H9O A;  4WU9 D;  2BG1 A;  3MGR C;  2NQB B;  3LJA C;  1P3O A;  3UTA D;  1P3L A;  1TZY C;  4ZBJ B;  4G92 B;  3O62 D;  1U35 D;  3AZI D;  3MGR A;  3LJA A;  1TZY A;  2PYO B;  2UWX A;  1P3M C;  3MGQ C;  3REL D;  5B1L D;  5DNN D;  1M19 B;  3MNN B;  5AVB D;  5B24 D;  4YS3 D;  2G5H C;  4WNN B;  1M18 B;  1P3M A;  3MGQ A;  3R45 B;  3C1B C;  2Y2P A;  5B32 C;  4J8X D;  3EPJ A;  1M1A C;  4XZQ C;  4LD9 D;  3NQJ B;  1HQ3 D;  5BNX B;  3W98 B;  1ULY A;  3LEL B;  3C1B A;  5B32 A;  5AV8 B;  5B31 D;  1M1A A;  4XZQ A;  5KDM B;  3AZG B;  3KWQ B;  3EPH A;  3TU4 C;  2Y2N A;  5CPK D;  2Y2O A;  4G91 C;  4UUZ A;  4CSR B;  2Y2Q A;  4H9R A;  4KGC C;  3X1V D;  2YFW B;  5CP6 B;  3A1K A;  2VQR A;  3TU4 A;  3AZH B;  3AYW C;  5B40 B;  3AV2 D;  4KGC A;  3AYW A;  3LZ1 D;  5AV5 C;  3MGS C;  3AZM B;  5B2J C;  4KHA A;  1P3P C;  3X1S D;  3LZ0 B;  3REH C;  5AY8 D;  2IO5 C;  3UTB D;  3B6F D;  4DQY B;  4J8V B;  5AV5 A;  3V9R A;  4Z66 C;  5B2I C;  5B2J A;  3H0M C;  3MGS A;  3REJ B;  2NQB D;  1P3P A;  5C3I B;  5AV6 C;  1P34 B;  3AZK B;  3REH A;  1ID3 C;  2FJ7 C;  4Z66 A;  5B2I A;  3AZL B;  5AV6 A;  5B1M D;  2PYO D;  3EG5 B;  1ID3 A;  4J8W C;  2FJ7 A;  3MNN D;  3X1U C;  5AVC C;  3KUY B;  2F8N A;  1M18 D;  4JJN C;  3UTA B;  4J8W A;  3B0D C;  3X1U A;  3X1T C;  5CPJ B;  5F99 B;  2NZD B;  3AN2 C;  3W96 B;  5AVC A;  3AZI B;  3W98 D;  4JJN A;  1KX5 B;  5JA4 A;  5B0Y C;  4WU8 B;  3LEL D;  1F66 C;  5AV8 D;  3X1T A;  2RVQ D;  3AN2 A;  4J8U B;  2HIO B;  3KWQ D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...