4J8XB

X-ray structure of ncp145 with bound chlorido(eta-6-p-cymene)(n-fluorophenyl-2-pyridinecarbothioamide)ruthenium(ii)
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
82
structure length
82
Chain Sequence
VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.2
publication title Novel metal(II) arene 2-pyridinecarbothioamides: a rationale to orally active organometallic anticancer agents
doi rcsb
source organism Xenopus laevis
molecule tags Structural protein/dna
total genus 27
structure length 82
sequence length 82
chains with identical sequence F
ec nomenclature
pdb deposition date 2013-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4j8xB00
3TU4D 5AV9C 5BS7A 3UTBB 4KUDC 2LY8A 2AROD 1P3BB 5DNND 5AVBA 3LZ1A 4LD9C 1KX4B 5F99B 1M18D 1EQZA 1ZLAA 4J8VA 4XZQB 1AOIB 1P3AB 2BYKA 5B0ZC 4XUJA 3X1UB 4AWLB 3AZHA 4KGCB 1B6WA 4NE5A 3AYWB 3AN2D 3REHB 3WTPB 1EQZD 4WU8D 5B32B 2HUEC 3AZEA 3X1TC 1Q9CA 4H9NA 3WAAC 5AV8C 3MGSA 3AZHD 4CAYB 2RVQD 5KDMA 3AZGC 2IO5B 3AZKC 3AZMC 5B32G 3VH5A 4JJNA 3AZNC 1ID3B 3B6GA 3B0DB 3AZMD 5AV6B 2AROC 4KHAA 2FJ7A 1P3FA 2CV5D 5BS7C 1U35B 4YM6B 5GXQA 1M19B 4R8PB 4NE3A 3LZ1C 1S32D 5GSUD 5B33B 1F1EA 5AV5A 3UTBA 1EQZC 2FJ7D 1ZLAC 4J8VC 1P3FD 1P3BA 4XUJC 1KX4A 3AZHC 1AOIA 1P3AA 1M1AB 3X1UA 3UTBD 5B0YA 4KGCA 3AYWA 3AZEC 1P3BD 4H9OB 3REHA 1KX4D 5F99D 3MGSC 5B32A 4H9QA 4XZQD 1TZYD 1AOID 1P3AD 3AZLB 3X1UD 4KGCD 4CAYA 3AYWD 3UTAA 3REHD 3W97B 3WTPD 4JJNC 1P3PB 3B6GC 5B32D 3MGRB 3NQJA 4G92B 1JFIB 1ID3A 5B40B 4NE6A 2FJ7C 1P3MA 1P3FC 3AFAA 4G91B 4YS3A 5GXQC 1ID3D 2NZDA 3UTBC 5AV5C 5AV6D 1F66B 4M6BA 4EO5B 4YM6A 1M19A 1P3BC 4WNNB 4R8PA 3B0CT 4Z2MH 5B33A 1KX4C 2F8NK 4E44A 1AOIC 3MGPA 1P3AC 3MGQB 5DNMB 1U35D 3X1UC 4J8XD 5B0YC 3AZIB 4AWLC 4YM6D 4KGCC 3AYWC 1M1AA 3W96B 4R8PD 3KWQB 3WKJB 3REHC 5B33D 3W98B 5B32C 2PYOB 1TAFA 5BNXB 3O62B 1M1AD 3LJAB 3UTAC 3AV1B 3AZLA 2IO5C 3X1SA 3KUYB 3W97A 1ID3C 3B0DC 2F8NB 1P3IB 3MGRA 1P3MC 3TU4A 3AZLD 1JFIA 3AFAC 4YS3C 5B31G 3W97D 3A6NB 1P3PD 2HIOB 5CPIB 5DNNA 3MGRD 1KX3B 4YM6C 1M18A 2F8NG 1M19C 4R8PC 5E5AB 5B33C 5B40D 1F66A 3MGPC 3AZJB 3AN2A 4H9RB 3B0CW 5JA4B 4WU8A 1M1AC 3RELB 1TZYB 5BT1C 3MGQA 1HQ3B 1F66D 3AZIA 4H9SA 3W96A 4ZUXB 5DNMD 3MGQD 3AZLC 3X1SC 5B2ID 1H3OB 3AZID 5CHLB 3W96D 3KWQD 3WKJD 2BYMB 3VH5T 3W97C 3AV2B 3W98D 3KUYA 3WA9B 2F8NH 2PYOD 3MGRC 4G92C 3TU4C 2CV5A 2F8NA 3O62D 3LJAD 3AV1D 2YFWB 4Z5TB 3KUYD 1BH8A 5DNNC 1S32A 3LELB 5GSUA 1M18C 3A6NA 5CPIA 2F8ND 1P3ID 1F66C 1KX3A 4J8XB 4EO5C 3C1BB 3VH6A 3AN2C 1ULYA 4WU8C 3A6ND 2HIOD 3MNNB 3MGQC 5CPID 3UT9B 3AZIC 1KX3D 4H9PB 5F99A 5JA4A 4H9SC 3W96C 4XZQA 1TZYA 5B24B 2RVQC 5E5AD 3AZJD 4ZUXA 3WTPA 5B1MB 3LJAC 3RELD 5CPJB 4J8UB 1HQ3D 1H3OA 3KUYC 5AV9B 4J8WB 3AV2A 5AVCB 4ZUXD 2CV5C 3WA9A 3VH5W 1KX5B 3REIB 1S32C 5GSUC 5C3IC 3LZ0B 5AV6A 2L5AA 3A6NC 3AV2D 2YFWA 4Z5TA 5CPIC 3WA9D 3V9RB 1KX3C 5BNVB 1P3KB 1U35A 4J8XA 3C1BA 4WZSB 3X1TB 4WU9B 1WWIA 4Z5TD 3R45B 4HGAB 3LELD 4ZBJB 4CSRB 5F99C 3AZGB 4XZQC 1TZYC 3MNNA 4H9PA 3C1BD 5B2IB 2NQBB 1N1JB 5GT3B 5B2JB 3MVDB 4ZUXC 3WTPC 3W99B 3MNND 3UT9D 4H9OA 5CP6B 5B1MA 5B24D 3AZFB 5CPJA 4J8UA 3AV2C 3WA9C 5B1LB 5B31B 4J8WA 5AVBB 3LZ1B 5AVCA 1P3PA 1KX5A 1ZLAB 5B1MD 4J8VB 1A7WA 5CPJD 4J8UD 5AV6C 4XUJB 5CPKB 4Z5TC 3REIA 5AV9D 4J8WD 5B40A 3LZ0A 1BH9B 5AVCD 1KX5D 3WTPE 3V9RA 1U35C 4J8XC 5BNVA 3C1BC 5JRGB 2CWEA 1P3KA 3MGSB 3C1CB 3REID 5KDMB 5FUGB 3LZ0D 4WU9A 3R45A 3MNNC 4WNNA 4CSRA 4X23B 1P3KD 4JJNB 3B6GB 4NFTA 5DNMA 3B6FB 5B2IA 4WU9D 3X1TD 5AV8D 1P34B 2NQBA 1N1JA 3KWQA 5GT3A 3MVDA 3WKJA 4Z66B 3W99A 3W98A 5B1MC 3AZGD 5CPJC 2PYOA 4J8UC 5BNXA 5CP6A 5GXQB 3O62A 3AZFA 2NQBD 4J8WC 3AZND 3LJAA 3AV1A 5GT3D 5B2JD 3MVDD 5AVCC 3KXBB 5AV5B 3W99D 5B1LA 1P3LB 1P3PC 1KX5C 5B31A 3X1VB 4UUZB 5CP6D 3REIC 3AZFD 1P3IA 5B40C 3LZ0C 5CPKA 5B1LD 5B0YB 5B31D 4G91C 5AVBD 3LZ1D 1BH9A 3VH6T 1P3KC 3REKB 2HIOA 4H9QB 4J8VD 1ZLAD 3NQUB 1B67A 4WU9C 5JRGA 3WKJC 4XUJD 5CPKD 1P3OB 5AY8B 4HGAC 3C1CA 5E5AA 4ZBJC 3UTAB 5FUGA 3AZJA 4QLCB 5DNMC 3AZED 3NQJB 5B2IC 4X23A 4H9RA 5JRGD 2NQBC 3MGSD 3KWQC 3REJB 5GT3C 5GT0B 5B2JC 3MVDC 1HQ3A 3C1CD 3RELA 3W99C 3B6FA 1P34A 1P3MB 3W98C 1P3GB 2PYOC 3AFAB 1WWSA 5CP6C 4Z66A 4YS3B 4X23D 3O62C 3AZFC 4JJND 3B6GD 3AV1C 2NZDB 3B6FD 5B1LC 2YFVB 1P34D 5B31C 1BFMA 5AVBC 2BYMA 3KXBA 4Z66D 1P3LA 4KUDB 3MGPB 1P3IC 5BO0B 3X1VA 2JSSA 5CPKC 4LD9B 4UUZA 5GXQD 5B0ZB 3KXBD 5AV5D 1P3LD 2HIOC 3X1VD 1TAFB 4WV4B 5JRGC 3LELA 3REKA 3C1CC 4Z2MG 3VH6W 5E5AC 2HUEB 3NQUA 5G49B 3X1SB 3AZJC 5AV8B 5B0YD 1P3OA 3WAAB 5AY8A 4X23C 4DRBA 3B0BA 3RELC 4QLCA 3REKD 3B6FC 1HQ3C 3UT9A 3AZKB 3AZMB 1P34C 3TU4B 1P3OD 5B24A 5AY8D 5GT0A 3REJA 3AZNB 4Z66C 3UTAD 1P3GA 2AROB 4QLCD 5DNNB 4DRAA 1M18B 3REJD 5GT0D 3KXBC 2YFVA 1P3LC 1P3MD 1P3GD 5AV9A 3X1VC 3AFAD 4YS3D 3AN2B 4KUDA 1EQZB 4WU8B 5BO0A 2NZDD 1HTAA 2BYKB 4LD9A 1M19D 3AZHB 3LELC 5B0ZA 3REKC 3KSYA 4KUDD 3MGPD 1R4VA 3AZEB 4LD9D 4H9NB 1P3OC 5AY8C 4E45A 5G49A 5BT1D 5B0ZD 3X1TA 5AV8A 3WAAA 4QLCC 3UT9C 3AZGA 2CV5B 5B24C 3REJC 5GT0C 3AZKA 3AZMA 3X1SD 1P3GC 3WAAD 1KU5A 3AZNA 1BH8B 1S32B 5B2JA 5GSUB 5C3IB 4KHAB 2FJ7B 1P3FB 2AROA 2NZDC 3AZKD
chains in the Genus database with same CATH superfamily
3TU4D 5AV9C 5BS7A 2ZY4A 3UTBB 4KUDC 2LY8A 2AROD 1P3BB 5DNND 5AVBA 3LZ1A 4LD9C 1PZRA 5F99B 1M18D 1KX4B 1EQZA 1ZLAA 4J8VA 4XZQB 1AOIB 1P3AB 2BYKA 5B0ZC 4XUJA 3X1UB 4WJ3C 4AWLB 3AZHA 4KGCB 2BG1A 1B6WA 4NE5A 3AYWB 3AN2D 3REHB 3WTPB 1EQZD 4UPKA 2ZY5A 5B32B 4WU8D 2HUEC 3AZEA 3X1TC 1Q9CA 4H9NA 3WAAC 5AV8C 3MGSA 2Y2MA 3AZHD 4CAYB 2RVQD 5KDMA 3AZGC 2IO5B 2DF4C 3AZKC 3AZMC 5B32G 3VH5A 2W8SA 4JJNA 3AZNC 3F6TA 1ID3B 3B0DB 3B6GA 3AZMD 5AV6B 2AROC 4KHAA 2FJ7A 1P3FA 2CV5D 5BS7C 1U35B 3FDDA 4YM6B 5GXQA 1M19B 1W2EA 4R8PB 4NE3A 3LZ1C 1S32D 5GSUD 5B33B 1F1EA 5AV5A 3UTBA 1EQZC 2FJ7D 1ZLAC 4J8VC 2Y2PA 3IP4C 1P3FD 1P3BA 4XUJC 1KX4A 3AZHC 1AOIA 1P3AA 1M1AB 3X1UA 3UTBD 5B0YA 4KGCA 3AYWA 3AZEC 1P3BD 4H9OB 3REHA 1KX4D 5F99D 3MGSC 5B32A 4H9QA 4XZQD 1TZYD 1AOID 1P3AD 3AZLB 3X1UD 4KGCD 4CAYA 3AYWD 2JCHA 3UTAA 3REHD 3W97B 3WTPD 4JJNC 1P3PB 3B6GC 5B32D 2VQRA 3MGRB 3NQJA 4G92B 1JFIB 1ID3A 5B40B 4NE6A 2FJ7C 1P3MA 1P3FC 2ZY2A 3AFAA 4G91B 4YS3A 5GXQC 3A1IA 1ID3D 2NZDA 3UTBC 5AV5C 5AV6D 1F66B 4M6BA 4EO5B 4YM6A 1M19A 1P3BC 4WNNB 4R8PA 3B0CT 4Z2MH 5B33A 1KX4C 2F8NK 4E44A 2G5HC 1AOIC 3MGPA 1P3AC 2Y2NA 3MGQB 5DNMB 1U35D 3X1UC 4J8XD 5B0YC 3AZIB 4AWLC 3H0RC 4YM6D 4KGCC 3AYWC 1M1AA 3W96B 4R8PD 3KWQB 3WKJB 3REHC 5B33D 3W98B 5B32C 2PYOB 1TAFA 5BNXB 3O62B 3P5JB 3EPHA 1M1AD 3LJAB 3UTAC 3AV1B 3AZLA 2IO5C 3X1SA 3KUYB 2Y2QA 3W97A 1ID3C 3B0DC 2F8NB 1P3IB 3MGRA 1P3MC 3TU4A 3AZLD 1JFIA 3AFAC 4YS3C 5B31G 3W97D 3A6NB 1P3PD 2HIOB 5CPIB 5DNNA 3MGRD 1KX3B 2UWXA 4YM6C 1M18A 2F8NG 1M19C 4R8PC 3A1KA 5E5AB 5B33C 5B40D 1F66A 3AL0C 3MGPC 3AZJB 2Y2KA 3AN2A 4H9RB 3B0CW 5JA4B 4WU8A 1M1AC 3RELB 1TZYB 5BT1C 3MGQA 1HQ3B 2ZY3A 2ZM5A 1F66D 3AZIA 2F2AC 2DQNC 4H9SA 3W96A 4ZUXB 5DNMD 3MGQD 3AZLC 3X1SC 5B2ID 1H3OB 3AZID 5CHLB 3W96D 3KWQD 3WKJD 2BYMB 3VH5T 3W97C 3AV2B 3W98D 3KUYA 3WA9B 2F8NH 2PYOD 3MGRC 4G92C 3TU4C 2CV5A 2F8NA 3O62D 3LJAD 2G5IC 3AV1D 2Y2JA 2YFWB 4Z5TB 3KUYD 1BH8A 5DNNC 1S32A 3LELB 5GSUA 1M18C 3A6NA 5CPIA 2F8ND 1P3ID 1F66C 1KX3A 2J8PA 4J8XB 4EO5C 3C1BB 3VH6A 3AN2C 3KFUG 1ULYA 4WU8C 3A6ND 2HIOD 3MNNB 3MGQC 5CPID 3UT9B 3AZIC 1KX3D 4H9PB 5F99A 5JA4A 4H9SC 3W96C 4XZQA 1TZYA 5B24B 2RVQC 5E5AD 3EPKA 2Y2LA 3AZJD 2Y2IA 4ZUXA 3WTPA 5B1MB 3LJAC 3RELD 5CPJB 4J8UB 1HQ3D 1H3OA 3KUYC 5AV9B 4J8WB 3AV2A 5AVCB 4ZUXD 2CV5C 3WA9A 3VH5W 1KX5B 3REIB 1S32C 5GSUC 5C3IC 3LZ0B 5AV6A 2L5AA 3A6NC 3AV2D 2YFWA 4Z5TA 5CPIC 3WA9D 3V9RB 1KX3C 5BNVB 1P3KB 1U35A 4J8XA 3C1BA 4WZSB 3X1TB 4WU9B 1WWIA 4Z5TD 3R45B 4HGAB 2Y2HA 3LELD 4ZBJB 4CSRB 5F99C 3AZGB 4XZQC 1TZYC 3EPJA 3MNNA 4H9PA 3C1BD 5B2IB 2NQBB 1N1JB 5GT3B 5B2JB 3MVDB 4ZUXC 3WTPC 3W99B 3MNND 3UT9D 4H9OA 5CP6B 5B1MA 2FFFB 5B24D 3AZFB 5CPJA 4J8UA 3AV2C 3WA9C 5B1LB 5B31B 4J8WA 5AVBB 3LZ1B 5AVCA 1Z2CB 1P3PA 1KX5A 1ZLAB 5B1MD 4J8VB 1A7WA 5CPJD 4J8UD 5AV6C 4XUJB 5CPKB 4Z5TC 3REIA 5AV9D 4J8WD 5B40A 3LZ0A 1BH9B 5AVCD 1KX5D 3WTPE 3V9RA 1U35C 4J8XC 5BNVA 3C1BC 5JRGB 2CWEA 1P3KA 3MGSB 3C1CB 3REID 5KDMB 5FUGB 3LZ0D 4WU9A 3R45A 3MNNC 4WNNA 4CSRA 4X23B 1P3KD 4JJNB 3B6GB 4NFTA 5DNMA 3B6FB 5B2IA 4WU9D 3X1TD 5AV8D 1P34B 2NQBA 1N1JA 3KWQA 5GT3A 3MVDA 3WKJA 4Z66B 3W99A 3W98A 5B1MC 3AZGD 5CPJC 2PYOA 4J8UC 5BNXA 5CP6A 5GXQB 3O62A 3AZFA 2NQBD 4J8WC 3AZND 3LJAA 3AV1A 5GT3D 5B2JD 3MVDD 5AVCC 3KXBB 5B1LA 3W99D 5AV5B 1P3LB 1P3PC 1KX5C 5B31A 3X1VB 4UUZB 5CP6D 3REIC 3AZFD 1P3IA 5B40C 3LZ0C 5CPKA 5B1LD 5B0YB 5B31D 4G91C 5AVBD 3LZ1D 1BH9A 3VH6T 1P3KC 3REKB 2HIOA 2Y2OA 4H9QB 4J8VD 1ZLAD 3NQUB 1B67A 4WU9C 5JRGA 3WKJC 4XUJD 5CPKD 1P3OB 5AY8B 4HGAC 3C1CA 5E5AA 4ZBJC 3UTAB 5FUGA 3AZJA 4QLCB 5DNMC 3AZED 3NQJB 5B2IC 4X23A 4H9RA 5JRGD 2NQBC 3MGSD 3KWQC 3REJB 5GT3C 5GT0B 5B2JC 3MVDC 1HQ3A 3C1CD 3RELA 3W99C 3B6FA 1P34A 1P3MB 3W98C 1P3GB 2PYOC 3AFAB 1WWSA 5CP6C 4Z66A 4YS3B 2JE5A 4X23D 3O62C 3AZFC 4JJND 3B6GD 3AV1C 2NZDB 3B6FD 5B1LC 2YFVB 1P34D 5B31C 1BFMA 2Y2GA 5AVBC 2BYMA 3KXBA 4Z66D 1P3LA 4KUDB 3MGPB 1P3IC 5BO0B 3X1VA 2JSSA 5CPKC 4LD9B 4UUZA 5GXQD 2RIQA 5B0ZB 3KXBD 5AV5D 1P3LD 2HIOC 3X1VD 1TAFB 4WV4B 5JRGC 3LELA 3REKA 3C1CC 4Z2MG 3VH6W 5E5AC 2HUEB 3NQUA 5G49B 3X1SB 3AZJC 5AV8B 5B0YD 1P3OA 3WAAB 5AY8A 4X23C 4DRBA 3B0BA 3RELC 4QLCA 3REKD 3B6FC 1HQ3C 3UT9A 3AZKB 3AZMB 1P34C 3TU4B 1P3OD 1T3UA 5AY8D 5GT0A 5B24A 3REJA 3AZNB 4Z66C 3UTAD 1P3GA 2AROB 4QLCD 5DNNB 4DRAA 1M18B 3H0MC 4DQYB 3REJD 5GT0D 3KXBC 2YFVA 1P3LC 1P3MD 1P3GD 5AV9A 3EPLA 3X1VC 3AFAD 4YS3D 3AN2B 4KUDA 1EQZB 4WU8B 3EG5B 5BO0A 2NZDD 1HTAA 2BYKB 4LD9A 1M19D 3AZHB 3LELC 5B0ZA 3REKC 3KSYA 4KUDD 3MGPD 1R4VA 3AZEB 4LD9D 4H9NB 1P3OC 5AY8C 4E45A 3H0LC 5G49A 5BT1D 5B0ZD 3X1TA 5AV8A 3WAAA 4QLCC 3UT9C 3AZGA 2CV5B 2XD1A 5B24C 5GT0C 3REJC 3AZKA 3AZMA 3X1SD 1P3GC 3WAAD 1KU5A 3AZNA 1BH8B 1S32B 5B2JA 5GSUB 5C3IB 4KHAB 2FJ7B 1P3FB 2AROA 2NZDC 2XD5A 3AZKD
chains in the Genus database with same CATH topology
3TU4D 5AV9C 5BS7A 2ZY4A 3UTBB 4KUDC 2LY8A 2AROD 1P3BB 5DNND 5AVBA 3LZ1A 4LD9C 1PZRA 5F99B 1M18D 1KX4B 1EQZA 1ZLAA 4J8VA 4XZQB 1AOIB 1P3AB 2BYKA 5B0ZC 4XUJA 3X1UB 4WJ3C 4AWLB 3AZHA 4KGCB 2BG1A 1B6WA 4NE5A 3AYWB 3AN2D 3REHB 3WTPB 1EQZD 4UPKA 2ZY5A 5B32B 4WU8D 2HUEC 3AZEA 3X1TC 1Q9CA 4H9NA 3WAAC 5AV8C 3MGSA 2Y2MA 3AZHD 4CAYB 2RVQD 5KDMA 3AZGC 2IO5B 2DF4C 3AZKC 3AZMC 5B32G 3VH5A 2W8SA 4JJNA 3AZNC 3F6TA 1ID3B 3B0DB 3B6GA 3AZMD 5AV6B 2AROC 4KHAA 2FJ7A 1P3FA 2CV5D 5BS7C 1U35B 3FDDA 4YM6B 5GXQA 1M19B 1W2EA 4R8PB 4NE3A 3LZ1C 1S32D 5GSUD 5B33B 1F1EA 5AV5A 3UTBA 1EQZC 2FJ7D 1ZLAC 4J8VC 2Y2PA 3IP4C 1P3FD 1P3BA 4XUJC 1KX4A 3AZHC 1AOIA 1P3AA 1M1AB 3X1UA 3UTBD 5B0YA 4KGCA 3AYWA 3AZEC 1P3BD 4H9OB 3REHA 1KX4D 5F99D 3MGSC 5B32A 4H9QA 4XZQD 1TZYD 1AOID 1P3AD 3AZLB 3X1UD 4KGCD 4CAYA 3AYWD 2JCHA 3UTAA 3REHD 3W97B 3WTPD 4JJNC 1P3PB 3B6GC 5B32D 2VQRA 3MGRB 3NQJA 4G92B 1JFIB 1ID3A 5B40B 4NE6A 2FJ7C 1P3MA 1P3FC 2ZY2A 3AFAA 4G91B 4YS3A 5GXQC 3A1IA 1ID3D 2NZDA 3UTBC 5AV5C 5AV6D 1F66B 4M6BA 4EO5B 4YM6A 1M19A 1P3BC 4WNNB 4R8PA 3B0CT 4Z2MH 5B33A 1KX4C 2F8NK 4E44A 2G5HC 1AOIC 3MGPA 1P3AC 2Y2NA 3MGQB 5DNMB 1U35D 3X1UC 4J8XD 5B0YC 3AZIB 4AWLC 3H0RC 4YM6D 4KGCC 3AYWC 1M1AA 3W96B 4R8PD 3KWQB 3WKJB 3REHC 5B33D 3W98B 5B32C 2PYOB 1TAFA 5BNXB 3O62B 3P5JB 3EPHA 1M1AD 3LJAB 3UTAC 3AV1B 3AZLA 2IO5C 3X1SA 3KUYB 2Y2QA 3W97A 1ID3C 3B0DC 2F8NB 1P3IB 3MGRA 1P3MC 3TU4A 3AZLD 1JFIA 3AFAC 4YS3C 5B31G 3W97D 3A6NB 1P3PD 2HIOB 5CPIB 5DNNA 3MGRD 1KX3B 2UWXA 4YM6C 1M18A 2F8NG 1M19C 4R8PC 3A1KA 5E5AB 5B33C 5B40D 1F66A 3AL0C 3MGPC 3AZJB 2Y2KA 3AN2A 4H9RB 3B0CW 5JA4B 4WU8A 1M1AC 3RELB 1TZYB 5BT1C 3MGQA 1HQ3B 2ZY3A 2ZM5A 1F66D 3AZIA 2F2AC 2DQNC 4H9SA 3W96A 4ZUXB 5DNMD 3MGQD 3AZLC 3X1SC 5B2ID 1H3OB 3AZID 5CHLB 3W96D 3KWQD 3WKJD 2BYMB 3VH5T 3W97C 3AV2B 3W98D 3KUYA 3WA9B 2F8NH 2PYOD 3MGRC 4G92C 3TU4C 2CV5A 2F8NA 3O62D 3LJAD 2G5IC 3AV1D 2Y2JA 2YFWB 4Z5TB 3KUYD 1BH8A 5DNNC 1S32A 3LELB 5GSUA 1M18C 3A6NA 5CPIA 2F8ND 1P3ID 1F66C 1KX3A 2J8PA 4J8XB 4EO5C 3C1BB 3VH6A 3AN2C 3KFUG 1ULYA 4WU8C 3A6ND 2HIOD 3MNNB 3MGQC 5CPID 3UT9B 3AZIC 1KX3D 4H9PB 5F99A 5JA4A 4H9SC 3W96C 4XZQA 1TZYA 5B24B 2RVQC 5E5AD 3EPKA 2Y2LA 3AZJD 2Y2IA 4ZUXA 3WTPA 5B1MB 3LJAC 3RELD 5CPJB 4J8UB 1HQ3D 1H3OA 3KUYC 5AV9B 4J8WB 3AV2A 5AVCB 4ZUXD 2CV5C 3WA9A 3VH5W 1KX5B 3REIB 1S32C 5GSUC 5C3IC 3LZ0B 5AV6A 2L5AA 3A6NC 3AV2D 2YFWA 4Z5TA 5CPIC 3WA9D 3V9RB 1KX3C 5BNVB 1P3KB 1U35A 4J8XA 3C1BA 4WZSB 3X1TB 4WU9B 1WWIA 4Z5TD 3R45B 4HGAB 2Y2HA 3LELD 4ZBJB 4CSRB 5F99C 3AZGB 4XZQC 1TZYC 3EPJA 3MNNA 4H9PA 3C1BD 5B2IB 2NQBB 1N1JB 5GT3B 5B2JB 3MVDB 4ZUXC 3WTPC 3W99B 3MNND 3UT9D 4H9OA 5CP6B 5B1MA 2FFFB 5B24D 3AZFB 5CPJA 4J8UA 3AV2C 3WA9C 5B1LB 5B31B 4J8WA 5AVBB 3LZ1B 5AVCA 1Z2CB 1P3PA 1KX5A 1ZLAB 5B1MD 4J8VB 1A7WA 5CPJD 4J8UD 5AV6C 4XUJB 5CPKB 4Z5TC 3REIA 5AV9D 4J8WD 5B40A 3LZ0A 1BH9B 5AVCD 1KX5D 3WTPE 3V9RA 1U35C 4J8XC 5BNVA 3C1BC 5JRGB 2CWEA 1P3KA 3MGSB 3C1CB 3REID 5KDMB 5FUGB 3LZ0D 4WU9A 3R45A 3MNNC 4WNNA 4CSRA 4X23B 1P3KD 4JJNB 3B6GB 4NFTA 5DNMA 3B6FB 5B2IA 4WU9D 3X1TD 5AV8D 1P34B 2NQBA 1N1JA 3KWQA 5GT3A 3MVDA 3WKJA 4Z66B 3W99A 3W98A 5B1MC 3AZGD 5CPJC 2PYOA 4J8UC 5BNXA 5CP6A 5GXQB 3O62A 3AZFA 2NQBD 4J8WC 3AZND 3LJAA 3AV1A 5GT3D 5B2JD 3MVDD 5AVCC 3KXBB 5B1LA 3W99D 5AV5B 1P3LB 1P3PC 1KX5C 5B31A 3X1VB 4UUZB 5CP6D 3REIC 3AZFD 1P3IA 5B40C 3LZ0C 5CPKA 5B1LD 5B0YB 5B31D 4G91C 5AVBD 3LZ1D 1BH9A 3VH6T 1P3KC 3REKB 2HIOA 2Y2OA 4H9QB 4J8VD 1ZLAD 3NQUB 1B67A 4WU9C 5JRGA 3WKJC 4XUJD 5CPKD 1P3OB 5AY8B 4HGAC 3C1CA 5E5AA 4ZBJC 3UTAB 5FUGA 3AZJA 4QLCB 5DNMC 3AZED 3NQJB 5B2IC 4X23A 4H9RA 5JRGD 2NQBC 3MGSD 3KWQC 3REJB 5GT3C 5GT0B 5B2JC 3MVDC 1HQ3A 3C1CD 3RELA 3W99C 3B6FA 1P34A 1P3MB 3W98C 1P3GB 2PYOC 3AFAB 1WWSA 5CP6C 4Z66A 4YS3B 2JE5A 4X23D 3O62C 3AZFC 4JJND 3B6GD 3AV1C 2NZDB 3B6FD 5B1LC 2YFVB 1P34D 5B31C 1BFMA 2Y2GA 5AVBC 2BYMA 3KXBA 4Z66D 1P3LA 4KUDB 3MGPB 1P3IC 5BO0B 3X1VA 2JSSA 5CPKC 4LD9B 4UUZA 5GXQD 2RIQA 5B0ZB 3KXBD 5AV5D 1P3LD 2HIOC 3X1VD 1TAFB 4WV4B 5JRGC 3LELA 3REKA 3C1CC 4Z2MG 3VH6W 5E5AC 2HUEB 3NQUA 5G49B 3X1SB 3AZJC 5AV8B 5B0YD 1P3OA 3WAAB 5AY8A 4X23C 4DRBA 3B0BA 3RELC 4QLCA 3REKD 3B6FC 1HQ3C 3UT9A 3AZKB 3AZMB 1P34C 3TU4B 1P3OD 1T3UA 5AY8D 5GT0A 5B24A 3REJA 3AZNB 4Z66C 3UTAD 1P3GA 2AROB 4QLCD 5DNNB 4DRAA 1M18B 3H0MC 4DQYB 3REJD 5GT0D 3KXBC 2YFVA 1P3LC 1P3MD 1P3GD 5AV9A 3EPLA 3X1VC 3AFAD 4YS3D 3AN2B 4KUDA 1EQZB 4WU8B 3EG5B 5BO0A 2NZDD 1HTAA 2BYKB 4LD9A 1M19D 3AZHB 3LELC 5B0ZA 3REKC 3KSYA 4KUDD 3MGPD 1R4VA 3AZEB 4LD9D 4H9NB 1P3OC 5AY8C 4E45A 3H0LC 5G49A 5BT1D 5B0ZD 3X1TA 5AV8A 3WAAA 4QLCC 3UT9C 3AZGA 2CV5B 2XD1A 5B24C 5GT0C 3REJC 3AZKA 3AZMA 3X1SD 1P3GC 3WAAD 1KU5A 3AZNA 1BH8B 1S32B 5B2JA 5GSUB 5C3IB 4KHAB 2FJ7B 1P3FB 2AROA 2NZDC 2XD5A 3AZKD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TU4 D;  5AV9 C;  5BS7 A;  3UTB B;  4KUD C;  2LY8 A;  2ARO D;  1P3B B;  5DNN D;  5AVB A;  3LZ1 A;  4LD9 C;  1KX4 B;  5F99 B;  1M18 D;  1EQZ A;  1ZLA A;  4J8V A;  4XZQ B;  1AOI B;  1P3A B;  2BYK A;  5B0Z C;  4XUJ A;  3X1U B;  4AWL B;  3AZH A;  4KGC B;  1B6W A;  4NE5 A;  3AYW B;  3AN2 D;  3REH B;  3WTP B;  1EQZ D;  4WU8 D;  5B32 B;  2HUE C;  3AZE A;  3X1T C;  1Q9C A;  4H9N A;  3WAA C;  5AV8 C;  3MGS A;  3AZH D;  4CAY B;  2RVQ D;  5KDM A;  3AZG C;  2IO5 B;  3AZK C;  3AZM C;  5B32 G;  3VH5 A;  4JJN A;  3AZN C;  1ID3 B;  3B6G A;  3B0D B;  3AZM D;  5AV6 B;  2ARO C;  4KHA A;  2FJ7 A;  1P3F A;  2CV5 D;  5BS7 C;  1U35 B;  4YM6 B;  5GXQ A;  1M19 B;  4R8P B;  4NE3 A;  3LZ1 C;  1S32 D;  5GSU D;  5B33 B;  1F1E A;  5AV5 A;  3UTB A;  1EQZ C;  2FJ7 D;  1ZLA C;  4J8V C;  1P3F D;  1P3B A;  4XUJ C;  1KX4 A;  3AZH C;  1AOI A;  1P3A A;  1M1A B;  3X1U A;  3UTB D;  5B0Y A;  4KGC A;  3AYW A;  3AZE C;  1P3B D;  4H9O B;  3REH A;  1KX4 D;  5F99 D;  3MGS C;  5B32 A;  4H9Q A;  4XZQ D;  1TZY D;  1AOI D;  1P3A D;  3AZL B;  3X1U D;  4KGC D;  4CAY A;  3AYW D;  3UTA A;  3REH D;  3W97 B;  3WTP D;  4JJN C;  1P3P B;  3B6G C;  5B32 D;  3MGR B;  3NQJ A;  4G92 B;  1JFI B;  1ID3 A;  5B40 B;  4NE6 A;  2FJ7 C;  1P3M A;  1P3F C;  3AFA A;  4G91 B;  4YS3 A;  5GXQ C;  1ID3 D;  2NZD A;  3UTB C;  5AV5 C;  5AV6 D;  1F66 B;  4M6B A;  4EO5 B;  4YM6 A;  1M19 A;  1P3B C;  4WNN B;  4R8P A;  3B0C T;  4Z2M H;  5B33 A;  1KX4 C;  2F8N K;  4E44 A;  1AOI C;  3MGP A;  1P3A C;  3MGQ B;  5DNM B;  1U35 D;  3X1U C;  4J8X D;  5B0Y C;  3AZI B;  4AWL C;  4YM6 D;  4KGC C;  3AYW C;  1M1A A;  3W96 B;  4R8P D;  3KWQ B;  3WKJ B;  3REH C;  5B33 D;  3W98 B;  5B32 C;  2PYO B;  1TAF A;  5BNX B;  3O62 B;  1M1A D;  3LJA B;  3UTA C;  3AV1 B;  3AZL A;  2IO5 C;  3X1S A;  3KUY B;  3W97 A;  1ID3 C;  3B0D C;  2F8N B;  1P3I B;  3MGR A;  1P3M C;  3TU4 A;  3AZL D;  1JFI A;  3AFA C;  4YS3 C;  5B31 G;  3W97 D;  3A6N B;  1P3P D;  2HIO B;  5CPI B;  5DNN A;  3MGR D;  1KX3 B;  4YM6 C;  1M18 A;  2F8N G;  1M19 C;  4R8P C;  5E5A B;  5B33 C;  5B40 D;  1F66 A;  3MGP C;  3AZJ B;  3AN2 A;  4H9R B;  3B0C W;  5JA4 B;  4WU8 A;  1M1A C;  3REL B;  1TZY B;  5BT1 C;  3MGQ A;  1HQ3 B;  1F66 D;  3AZI A;  4H9S A;  3W96 A;  4ZUX B;  5DNM D;  3MGQ D;  3AZL C;  3X1S C;  5B2I D;  1H3O B;  3AZI D;  5CHL B;  3W96 D;  3KWQ D;  3WKJ D;  2BYM B;  3VH5 T;  3W97 C;  3AV2 B;  3W98 D;  3KUY A;  3WA9 B;  2F8N H;  2PYO D;  3MGR C;  4G92 C;  3TU4 C;  2CV5 A;  2F8N A;  3O62 D;  3LJA D;  3AV1 D;  2YFW B;  4Z5T B;  3KUY D;  1BH8 A;  5DNN C;  1S32 A;  3LEL B;  5GSU A;  1M18 C;  3A6N A;  5CPI A;  2F8N D;  1P3I D;  1F66 C;  1KX3 A;  4J8X B;  4EO5 C;  3C1B B;  3VH6 A;  3AN2 C;  1ULY A;  4WU8 C;  3A6N D;  2HIO D;  3MNN B;  3MGQ C;  5CPI D;  3UT9 B;  3AZI C;  1KX3 D;  4H9P B;  5F99 A;  5JA4 A;  4H9S C;  3W96 C;  4XZQ A;  1TZY A;  5B24 B;  2RVQ C;  5E5A D;  3AZJ D;  4ZUX A;  3WTP A;  5B1M B;  3LJA C;  3REL D;  5CPJ B;  4J8U B;  1HQ3 D;  1H3O A;  3KUY C;  5AV9 B;  4J8W B;  3AV2 A;  5AVC B;  4ZUX D;  2CV5 C;  3WA9 A;  3VH5 W;  1KX5 B;  3REI B;  1S32 C;  5GSU C;  5C3I C;  3LZ0 B;  5AV6 A;  2L5A A;  3A6N C;  3AV2 D;  2YFW A;  4Z5T A;  5CPI C;  3WA9 D;  3V9R B;  1KX3 C;  5BNV B;  1P3K B;  1U35 A;  4J8X A;  3C1B A;  4WZS B;  3X1T B;  4WU9 B;  1WWI A;  4Z5T D;  3R45 B;  4HGA B;  3LEL D;  4ZBJ B;  4CSR B;  5F99 C;  3AZG B;  4XZQ C;  1TZY C;  3MNN A;  4H9P A;  3C1B D;  5B2I B;  2NQB B;  1N1J B;  5GT3 B;  5B2J B;  3MVD B;  4ZUX C;  3WTP C;  3W99 B;  3MNN D;  3UT9 D;  4H9O A;  5CP6 B;  5B1M A;  5B24 D;  3AZF B;  5CPJ A;  4J8U A;  3AV2 C;  3WA9 C;  5B1L B;  5B31 B;  4J8W A;  5AVB B;  3LZ1 B;  5AVC A;  1P3P A;  1KX5 A;  1ZLA B;  5B1M D;  4J8V B;  1A7W A;  5CPJ D;  4J8U D;  5AV6 C;  4XUJ B;  5CPK B;  4Z5T C;  3REI A;  5AV9 D;  4J8W D;  5B40 A;  3LZ0 A;  1BH9 B;  5AVC D;  1KX5 D;  3WTP E;  3V9R A;  1U35 C;  4J8X C;  5BNV A;  3C1B C;  5JRG B;  2CWE A;  1P3K A;  3MGS B;  3C1C B;  3REI D;  5KDM B;  5FUG B;  3LZ0 D;  4WU9 A;  3R45 A;  3MNN C;  4WNN A;  4CSR A;  4X23 B;  1P3K D;  4JJN B;  3B6G B;  4NFT A;  5DNM A;  3B6F B;  5B2I A;  4WU9 D;  3X1T D;  5AV8 D;  1P34 B;  2NQB A;  1N1J A;  3KWQ A;  5GT3 A;  3MVD A;  3WKJ A;  4Z66 B;  3W99 A;  3W98 A;  5B1M C;  3AZG D;  5CPJ C;  2PYO A;  4J8U C;  5BNX A;  5CP6 A;  5GXQ B;  3O62 A;  3AZF A;  2NQB D;  4J8W C;  3AZN D;  3LJA A;  3AV1 A;  5GT3 D;  5B2J D;  3MVD D;  5AVC C;  3KXB B;  5AV5 B;  3W99 D;  5B1L A;  1P3L B;  1P3P C;  1KX5 C;  5B31 A;  3X1V B;  4UUZ B;  5CP6 D;  3REI C;  3AZF D;  1P3I A;  5B40 C;  3LZ0 C;  5CPK A;  5B1L D;  5B0Y B;  5B31 D;  4G91 C;  5AVB D;  3LZ1 D;  1BH9 A;  3VH6 T;  1P3K C;  3REK B;  2HIO A;  4H9Q B;  4J8V D;  1ZLA D;  3NQU B;  1B67 A;  4WU9 C;  5JRG A;  3WKJ C;  4XUJ D;  5CPK D;  1P3O B;  5AY8 B;  4HGA C;  3C1C A;  5E5A A;  4ZBJ C;  3UTA B;  5FUG A;  3AZJ A;  4QLC B;  5DNM C;  3AZE D;  3NQJ B;  5B2I C;  4X23 A;  4H9R A;  5JRG D;  2NQB C;  3MGS D;  3KWQ C;  3REJ B;  5GT3 C;  5GT0 B;  5B2J C;  3MVD C;  1HQ3 A;  3C1C D;  3REL A;  3W99 C;  3B6F A;  1P34 A;  1P3M B;  3W98 C;  1P3G B;  2PYO C;  3AFA B;  1WWS A;  5CP6 C;  4Z66 A;  4YS3 B;  4X23 D;  3O62 C;  3AZF C;  4JJN D;  3B6G D;  3AV1 C;  2NZD B;  3B6F D;  5B1L C;  2YFV B;  1P34 D;  5B31 C;  1BFM A;  5AVB C;  2BYM A;  3KXB A;  4Z66 D;  1P3L A;  4KUD B;  3MGP B;  1P3I C;  5BO0 B;  3X1V A;  2JSS A;  5CPK C;  4LD9 B;  4UUZ A;  5GXQ D;  5B0Z B;  3KXB D;  5AV5 D;  1P3L D;  2HIO C;  3X1V D;  1TAF B;  4WV4 B;  5JRG C;  3LEL A;  3REK A;  3C1C C;  4Z2M G;  3VH6 W;  5E5A C;  2HUE B;  3NQU A;  5G49 B;  3X1S B;  3AZJ C;  5AV8 B;  5B0Y D;  1P3O A;  3WAA B;  5AY8 A;  4X23 C;  4DRB A;  3B0B A;  3REL C;  4QLC A;  3REK D;  3B6F C;  1HQ3 C;  3UT9 A;  3AZK B;  3AZM B;  1P34 C;  3TU4 B;  1P3O D;  5B24 A;  5AY8 D;  5GT0 A;  3REJ A;  3AZN B;  4Z66 C;  3UTA D;  1P3G A;  2ARO B;  4QLC D;  5DNN B;  4DRA A;  1M18 B;  3REJ D;  5GT0 D;  3KXB C;  2YFV A;  1P3L C;  1P3M D;  1P3G D;  5AV9 A;  3X1V C;  3AFA D;  4YS3 D;  3AN2 B;  4KUD A;  1EQZ B;  4WU8 B;  5BO0 A;  2NZD D;  1HTA A;  2BYK B;  4LD9 A;  1M19 D;  3AZH B;  3LEL C;  5B0Z A;  3REK C;  3KSY A;  4KUD D;  3MGP D;  1R4V A;  3AZE B;  4LD9 D;  4H9N B;  1P3O C;  5AY8 C;  4E45 A;  5G49 A;  5BT1 D;  5B0Z D;  3X1T A;  5AV8 A;  3WAA A;  4QLC C;  3UT9 C;  3AZG A;  2CV5 B;  5B24 C;  3REJ C;  5GT0 C;  3AZK A;  3AZM A;  3X1S D;  1P3G C;  3WAA D;  1KU5 A;  3AZN A;  1BH8 B;  1S32 B;  5B2J A;  5GSU B;  5C3I B;  4KHA B;  2FJ7 B;  1P3F B;  2ARO A;  2NZD C;  3AZK D; 
#chains in the Genus database with same CATH topology
 3TU4 D;  5AV9 C;  5BS7 A;  2ZY4 A;  3UTB B;  4KUD C;  2LY8 A;  2ARO D;  1P3B B;  5DNN D;  5AVB A;  3LZ1 A;  4LD9 C;  1PZR A;  5F99 B;  1M18 D;  1KX4 B;  1EQZ A;  1ZLA A;  4J8V A;  4XZQ B;  1AOI B;  1P3A B;  2BYK A;  5B0Z C;  4XUJ A;  3X1U B;  4WJ3 C;  4AWL B;  3AZH A;  4KGC B;  2BG1 A;  1B6W A;  4NE5 A;  3AYW B;  3AN2 D;  3REH B;  3WTP B;  1EQZ D;  4UPK A;  2ZY5 A;  5B32 B;  4WU8 D;  2HUE C;  3AZE A;  3X1T C;  1Q9C A;  4H9N A;  3WAA C;  5AV8 C;  3MGS A;  2Y2M A;  3AZH D;  4CAY B;  2RVQ D;  5KDM A;  3AZG C;  2IO5 B;  2DF4 C;  3AZK C;  3AZM C;  5B32 G;  3VH5 A;  2W8S A;  4JJN A;  3AZN C;  3F6T A;  1ID3 B;  3B0D B;  3B6G A;  3AZM D;  5AV6 B;  2ARO C;  4KHA A;  2FJ7 A;  1P3F A;  2CV5 D;  5BS7 C;  1U35 B;  3FDD A;  4YM6 B;  5GXQ A;  1M19 B;  1W2E A;  4R8P B;  4NE3 A;  3LZ1 C;  1S32 D;  5GSU D;  5B33 B;  1F1E A;  5AV5 A;  3UTB A;  1EQZ C;  2FJ7 D;  1ZLA C;  4J8V C;  2Y2P A;  3IP4 C;  1P3F D;  1P3B A;  4XUJ C;  1KX4 A;  3AZH C;  1AOI A;  1P3A A;  1M1A B;  3X1U A;  3UTB D;  5B0Y A;  4KGC A;  3AYW A;  3AZE C;  1P3B D;  4H9O B;  3REH A;  1KX4 D;  5F99 D;  3MGS C;  5B32 A;  4H9Q A;  4XZQ D;  1TZY D;  1AOI D;  1P3A D;  3AZL B;  3X1U D;  4KGC D;  4CAY A;  3AYW D;  2JCH A;  3UTA A;  3REH D;  3W97 B;  3WTP D;  4JJN C;  1P3P B;  3B6G C;  5B32 D;  2VQR A;  3MGR B;  3NQJ A;  4G92 B;  1JFI B;  1ID3 A;  5B40 B;  4NE6 A;  2FJ7 C;  1P3M A;  1P3F C;  2ZY2 A;  3AFA A;  4G91 B;  4YS3 A;  5GXQ C;  3A1I A;  1ID3 D;  2NZD A;  3UTB C;  5AV5 C;  5AV6 D;  1F66 B;  4M6B A;  4EO5 B;  4YM6 A;  1M19 A;  1P3B C;  4WNN B;  4R8P A;  3B0C T;  4Z2M H;  5B33 A;  1KX4 C;  2F8N K;  4E44 A;  2G5H C;  1AOI C;  3MGP A;  1P3A C;  2Y2N A;  3MGQ B;  5DNM B;  1U35 D;  3X1U C;  4J8X D;  5B0Y C;  3AZI B;  4AWL C;  3H0R C;  4YM6 D;  4KGC C;  3AYW C;  1M1A A;  3W96 B;  4R8P D;  3KWQ B;  3WKJ B;  3REH C;  5B33 D;  3W98 B;  5B32 C;  2PYO B;  1TAF A;  5BNX B;  3O62 B;  3P5J B;  3EPH A;  1M1A D;  3LJA B;  3UTA C;  3AV1 B;  3AZL A;  2IO5 C;  3X1S A;  3KUY B;  2Y2Q A;  3W97 A;  1ID3 C;  3B0D C;  2F8N B;  1P3I B;  3MGR A;  1P3M C;  3TU4 A;  3AZL D;  1JFI A;  3AFA C;  4YS3 C;  5B31 G;  3W97 D;  3A6N B;  1P3P D;  2HIO B;  5CPI B;  5DNN A;  3MGR D;  1KX3 B;  2UWX A;  4YM6 C;  1M18 A;  2F8N G;  1M19 C;  4R8P C;  3A1K A;  5E5A B;  5B33 C;  5B40 D;  1F66 A;  3AL0 C;  3MGP C;  3AZJ B;  2Y2K A;  3AN2 A;  4H9R B;  3B0C W;  5JA4 B;  4WU8 A;  1M1A C;  3REL B;  1TZY B;  5BT1 C;  3MGQ A;  1HQ3 B;  2ZY3 A;  2ZM5 A;  1F66 D;  3AZI A;  2F2A C;  2DQN C;  4H9S A;  3W96 A;  4ZUX B;  5DNM D;  3MGQ D;  3AZL C;  3X1S C;  5B2I D;  1H3O B;  3AZI D;  5CHL B;  3W96 D;  3KWQ D;  3WKJ D;  2BYM B;  3VH5 T;  3W97 C;  3AV2 B;  3W98 D;  3KUY A;  3WA9 B;  2F8N H;  2PYO D;  3MGR C;  4G92 C;  3TU4 C;  2CV5 A;  2F8N A;  3O62 D;  3LJA D;  2G5I C;  3AV1 D;  2Y2J A;  2YFW B;  4Z5T B;  3KUY D;  1BH8 A;  5DNN C;  1S32 A;  3LEL B;  5GSU A;  1M18 C;  3A6N A;  5CPI A;  2F8N D;  1P3I D;  1F66 C;  1KX3 A;  2J8P A;  4J8X B;  4EO5 C;  3C1B B;  3VH6 A;  3AN2 C;  3KFU G;  1ULY A;  4WU8 C;  3A6N D;  2HIO D;  3MNN B;  3MGQ C;  5CPI D;  3UT9 B;  3AZI C;  1KX3 D;  4H9P B;  5F99 A;  5JA4 A;  4H9S C;  3W96 C;  4XZQ A;  1TZY A;  5B24 B;  2RVQ C;  5E5A D;  3EPK A;  2Y2L A;  3AZJ D;  2Y2I A;  4ZUX A;  3WTP A;  5B1M B;  3LJA C;  3REL D;  5CPJ B;  4J8U B;  1HQ3 D;  1H3O A;  3KUY C;  5AV9 B;  4J8W B;  3AV2 A;  5AVC B;  4ZUX D;  2CV5 C;  3WA9 A;  3VH5 W;  1KX5 B;  3REI B;  1S32 C;  5GSU C;  5C3I C;  3LZ0 B;  5AV6 A;  2L5A A;  3A6N C;  3AV2 D;  2YFW A;  4Z5T A;  5CPI C;  3WA9 D;  3V9R B;  1KX3 C;  5BNV B;  1P3K B;  1U35 A;  4J8X A;  3C1B A;  4WZS B;  3X1T B;  4WU9 B;  1WWI A;  4Z5T D;  3R45 B;  4HGA B;  2Y2H A;  3LEL D;  4ZBJ B;  4CSR B;  5F99 C;  3AZG B;  4XZQ C;  1TZY C;  3EPJ A;  3MNN A;  4H9P A;  3C1B D;  5B2I B;  2NQB B;  1N1J B;  5GT3 B;  5B2J B;  3MVD B;  4ZUX C;  3WTP C;  3W99 B;  3MNN D;  3UT9 D;  4H9O A;  5CP6 B;  5B1M A;  2FFF B;  5B24 D;  3AZF B;  5CPJ A;  4J8U A;  3AV2 C;  3WA9 C;  5B1L B;  5B31 B;  4J8W A;  5AVB B;  3LZ1 B;  5AVC A;  1Z2C B;  1P3P A;  1KX5 A;  1ZLA B;  5B1M D;  4J8V B;  1A7W A;  5CPJ D;  4J8U D;  5AV6 C;  4XUJ B;  5CPK B;  4Z5T C;  3REI A;  5AV9 D;  4J8W D;  5B40 A;  3LZ0 A;  1BH9 B;  5AVC D;  1KX5 D;  3WTP E;  3V9R A;  1U35 C;  4J8X C;  5BNV A;  3C1B C;  5JRG B;  2CWE A;  1P3K A;  3MGS B;  3C1C B;  3REI D;  5KDM B;  5FUG B;  3LZ0 D;  4WU9 A;  3R45 A;  3MNN C;  4WNN A;  4CSR A;  4X23 B;  1P3K D;  4JJN B;  3B6G B;  4NFT A;  5DNM A;  3B6F B;  5B2I A;  4WU9 D;  3X1T D;  5AV8 D;  1P34 B;  2NQB A;  1N1J A;  3KWQ A;  5GT3 A;  3MVD A;  3WKJ A;  4Z66 B;  3W99 A;  3W98 A;  5B1M C;  3AZG D;  5CPJ C;  2PYO A;  4J8U C;  5BNX A;  5CP6 A;  5GXQ B;  3O62 A;  3AZF A;  2NQB D;  4J8W C;  3AZN D;  3LJA A;  3AV1 A;  5GT3 D;  5B2J D;  3MVD D;  5AVC C;  3KXB B;  5B1L A;  3W99 D;  5AV5 B;  1P3L B;  1P3P C;  1KX5 C;  5B31 A;  3X1V B;  4UUZ B;  5CP6 D;  3REI C;  3AZF D;  1P3I A;  5B40 C;  3LZ0 C;  5CPK A;  5B1L D;  5B0Y B;  5B31 D;  4G91 C;  5AVB D;  3LZ1 D;  1BH9 A;  3VH6 T;  1P3K C;  3REK B;  2HIO A;  2Y2O A;  4H9Q B;  4J8V D;  1ZLA D;  3NQU B;  1B67 A;  4WU9 C;  5JRG A;  3WKJ C;  4XUJ D;  5CPK D;  1P3O B;  5AY8 B;  4HGA C;  3C1C A;  5E5A A;  4ZBJ C;  3UTA B;  5FUG A;  3AZJ A;  4QLC B;  5DNM C;  3AZE D;  3NQJ B;  5B2I C;  4X23 A;  4H9R A;  5JRG D;  2NQB C;  3MGS D;  3KWQ C;  3REJ B;  5GT3 C;  5GT0 B;  5B2J C;  3MVD C;  1HQ3 A;  3C1C D;  3REL A;  3W99 C;  3B6F A;  1P34 A;  1P3M B;  3W98 C;  1P3G B;  2PYO C;  3AFA B;  1WWS A;  5CP6 C;  4Z66 A;  4YS3 B;  2JE5 A;  4X23 D;  3O62 C;  3AZF C;  4JJN D;  3B6G D;  3AV1 C;  2NZD B;  3B6F D;  5B1L C;  2YFV B;  1P34 D;  5B31 C;  1BFM A;  2Y2G A;  5AVB C;  2BYM A;  3KXB A;  4Z66 D;  1P3L A;  4KUD B;  3MGP B;  1P3I C;  5BO0 B;  3X1V A;  2JSS A;  5CPK C;  4LD9 B;  4UUZ A;  5GXQ D;  2RIQ A;  5B0Z B;  3KXB D;  5AV5 D;  1P3L D;  2HIO C;  3X1V D;  1TAF B;  4WV4 B;  5JRG C;  3LEL A;  3REK A;  3C1C C;  4Z2M G;  3VH6 W;  5E5A C;  2HUE B;  3NQU A;  5G49 B;  3X1S B;  3AZJ C;  5AV8 B;  5B0Y D;  1P3O A;  3WAA B;  5AY8 A;  4X23 C;  4DRB A;  3B0B A;  3REL C;  4QLC A;  3REK D;  3B6F C;  1HQ3 C;  3UT9 A;  3AZK B;  3AZM B;  1P34 C;  3TU4 B;  1P3O D;  1T3U A;  5AY8 D;  5GT0 A;  5B24 A;  3REJ A;  3AZN B;  4Z66 C;  3UTA D;  1P3G A;  2ARO B;  4QLC D;  5DNN B;  4DRA A;  1M18 B;  3H0M C;  4DQY B;  3REJ D;  5GT0 D;  3KXB C;  2YFV A;  1P3L C;  1P3M D;  1P3G D;  5AV9 A;  3EPL A;  3X1V C;  3AFA D;  4YS3 D;  3AN2 B;  4KUD A;  1EQZ B;  4WU8 B;  3EG5 B;  5BO0 A;  2NZD D;  1HTA A;  2BYK B;  4LD9 A;  1M19 D;  3AZH B;  3LEL C;  5B0Z A;  3REK C;  3KSY A;  4KUD D;  3MGP D;  1R4V A;  3AZE B;  4LD9 D;  4H9N B;  1P3O C;  5AY8 C;  4E45 A;  3H0L C;  5G49 A;  5BT1 D;  5B0Z D;  3X1T A;  5AV8 A;  3WAA A;  4QLC C;  3UT9 C;  3AZG A;  2CV5 B;  2XD1 A;  5B24 C;  5GT0 C;  3REJ C;  3AZK A;  3AZM A;  3X1S D;  1P3G C;  3WAA D;  1KU5 A;  3AZN A;  1BH8 B;  1S32 B;  5B2J A;  5GSU B;  5C3I B;  4KHA B;  2FJ7 B;  1P3F B;  2ARO A;  2NZD C;  2XD5 A;  3AZK D; 
#chains in the Genus database with same CATH homology
 3TU4 D;  5AV9 C;  5BS7 A;  2ZY4 A;  3UTB B;  4KUD C;  2LY8 A;  2ARO D;  1P3B B;  5DNN D;  5AVB A;  3LZ1 A;  4LD9 C;  1PZR A;  5F99 B;  1M18 D;  1KX4 B;  1EQZ A;  1ZLA A;  4J8V A;  4XZQ B;  1AOI B;  1P3A B;  2BYK A;  5B0Z C;  4XUJ A;  3X1U B;  4WJ3 C;  4AWL B;  3AZH A;  4KGC B;  2BG1 A;  1B6W A;  4NE5 A;  3AYW B;  3AN2 D;  3REH B;  3WTP B;  1EQZ D;  4UPK A;  2ZY5 A;  5B32 B;  4WU8 D;  2HUE C;  3AZE A;  3X1T C;  1Q9C A;  4H9N A;  3WAA C;  5AV8 C;  3MGS A;  2Y2M A;  3AZH D;  4CAY B;  2RVQ D;  5KDM A;  3AZG C;  2IO5 B;  2DF4 C;  3AZK C;  3AZM C;  5B32 G;  3VH5 A;  2W8S A;  4JJN A;  3AZN C;  3F6T A;  1ID3 B;  3B0D B;  3B6G A;  3AZM D;  5AV6 B;  2ARO C;  4KHA A;  2FJ7 A;  1P3F A;  2CV5 D;  5BS7 C;  1U35 B;  3FDD A;  4YM6 B;  5GXQ A;  1M19 B;  1W2E A;  4R8P B;  4NE3 A;  3LZ1 C;  1S32 D;  5GSU D;  5B33 B;  1F1E A;  5AV5 A;  3UTB A;  1EQZ C;  2FJ7 D;  1ZLA C;  4J8V C;  2Y2P A;  3IP4 C;  1P3F D;  1P3B A;  4XUJ C;  1KX4 A;  3AZH C;  1AOI A;  1P3A A;  1M1A B;  3X1U A;  3UTB D;  5B0Y A;  4KGC A;  3AYW A;  3AZE C;  1P3B D;  4H9O B;  3REH A;  1KX4 D;  5F99 D;  3MGS C;  5B32 A;  4H9Q A;  4XZQ D;  1TZY D;  1AOI D;  1P3A D;  3AZL B;  3X1U D;  4KGC D;  4CAY A;  3AYW D;  2JCH A;  3UTA A;  3REH D;  3W97 B;  3WTP D;  4JJN C;  1P3P B;  3B6G C;  5B32 D;  2VQR A;  3MGR B;  3NQJ A;  4G92 B;  1JFI B;  1ID3 A;  5B40 B;  4NE6 A;  2FJ7 C;  1P3M A;  1P3F C;  2ZY2 A;  3AFA A;  4G91 B;  4YS3 A;  5GXQ C;  3A1I A;  1ID3 D;  2NZD A;  3UTB C;  5AV5 C;  5AV6 D;  1F66 B;  4M6B A;  4EO5 B;  4YM6 A;  1M19 A;  1P3B C;  4WNN B;  4R8P A;  3B0C T;  4Z2M H;  5B33 A;  1KX4 C;  2F8N K;  4E44 A;  2G5H C;  1AOI C;  3MGP A;  1P3A C;  2Y2N A;  3MGQ B;  5DNM B;  1U35 D;  3X1U C;  4J8X D;  5B0Y C;  3AZI B;  4AWL C;  3H0R C;  4YM6 D;  4KGC C;  3AYW C;  1M1A A;  3W96 B;  4R8P D;  3KWQ B;  3WKJ B;  3REH C;  5B33 D;  3W98 B;  5B32 C;  2PYO B;  1TAF A;  5BNX B;  3O62 B;  3P5J B;  3EPH A;  1M1A D;  3LJA B;  3UTA C;  3AV1 B;  3AZL A;  2IO5 C;  3X1S A;  3KUY B;  2Y2Q A;  3W97 A;  1ID3 C;  3B0D C;  2F8N B;  1P3I B;  3MGR A;  1P3M C;  3TU4 A;  3AZL D;  1JFI A;  3AFA C;  4YS3 C;  5B31 G;  3W97 D;  3A6N B;  1P3P D;  2HIO B;  5CPI B;  5DNN A;  3MGR D;  1KX3 B;  2UWX A;  4YM6 C;  1M18 A;  2F8N G;  1M19 C;  4R8P C;  3A1K A;  5E5A B;  5B33 C;  5B40 D;  1F66 A;  3AL0 C;  3MGP C;  3AZJ B;  2Y2K A;  3AN2 A;  4H9R B;  3B0C W;  5JA4 B;  4WU8 A;  1M1A C;  3REL B;  1TZY B;  5BT1 C;  3MGQ A;  1HQ3 B;  2ZY3 A;  2ZM5 A;  1F66 D;  3AZI A;  2F2A C;  2DQN C;  4H9S A;  3W96 A;  4ZUX B;  5DNM D;  3MGQ D;  3AZL C;  3X1S C;  5B2I D;  1H3O B;  3AZI D;  5CHL B;  3W96 D;  3KWQ D;  3WKJ D;  2BYM B;  3VH5 T;  3W97 C;  3AV2 B;  3W98 D;  3KUY A;  3WA9 B;  2F8N H;  2PYO D;  3MGR C;  4G92 C;  3TU4 C;  2CV5 A;  2F8N A;  3O62 D;  3LJA D;  2G5I C;  3AV1 D;  2Y2J A;  2YFW B;  4Z5T B;  3KUY D;  1BH8 A;  5DNN C;  1S32 A;  3LEL B;  5GSU A;  1M18 C;  3A6N A;  5CPI A;  2F8N D;  1P3I D;  1F66 C;  1KX3 A;  2J8P A;  4J8X B;  4EO5 C;  3C1B B;  3VH6 A;  3AN2 C;  3KFU G;  1ULY A;  4WU8 C;  3A6N D;  2HIO D;  3MNN B;  3MGQ C;  5CPI D;  3UT9 B;  3AZI C;  1KX3 D;  4H9P B;  5F99 A;  5JA4 A;  4H9S C;  3W96 C;  4XZQ A;  1TZY A;  5B24 B;  2RVQ C;  5E5A D;  3EPK A;  2Y2L A;  3AZJ D;  2Y2I A;  4ZUX A;  3WTP A;  5B1M B;  3LJA C;  3REL D;  5CPJ B;  4J8U B;  1HQ3 D;  1H3O A;  3KUY C;  5AV9 B;  4J8W B;  3AV2 A;  5AVC B;  4ZUX D;  2CV5 C;  3WA9 A;  3VH5 W;  1KX5 B;  3REI B;  1S32 C;  5GSU C;  5C3I C;  3LZ0 B;  5AV6 A;  2L5A A;  3A6N C;  3AV2 D;  2YFW A;  4Z5T A;  5CPI C;  3WA9 D;  3V9R B;  1KX3 C;  5BNV B;  1P3K B;  1U35 A;  4J8X A;  3C1B A;  4WZS B;  3X1T B;  4WU9 B;  1WWI A;  4Z5T D;  3R45 B;  4HGA B;  2Y2H A;  3LEL D;  4ZBJ B;  4CSR B;  5F99 C;  3AZG B;  4XZQ C;  1TZY C;  3EPJ A;  3MNN A;  4H9P A;  3C1B D;  5B2I B;  2NQB B;  1N1J B;  5GT3 B;  5B2J B;  3MVD B;  4ZUX C;  3WTP C;  3W99 B;  3MNN D;  3UT9 D;  4H9O A;  5CP6 B;  5B1M A;  2FFF B;  5B24 D;  3AZF B;  5CPJ A;  4J8U A;  3AV2 C;  3WA9 C;  5B1L B;  5B31 B;  4J8W A;  5AVB B;  3LZ1 B;  5AVC A;  1Z2C B;  1P3P A;  1KX5 A;  1ZLA B;  5B1M D;  4J8V B;  1A7W A;  5CPJ D;  4J8U D;  5AV6 C;  4XUJ B;  5CPK B;  4Z5T C;  3REI A;  5AV9 D;  4J8W D;  5B40 A;  3LZ0 A;  1BH9 B;  5AVC D;  1KX5 D;  3WTP E;  3V9R A;  1U35 C;  4J8X C;  5BNV A;  3C1B C;  5JRG B;  2CWE A;  1P3K A;  3MGS B;  3C1C B;  3REI D;  5KDM B;  5FUG B;  3LZ0 D;  4WU9 A;  3R45 A;  3MNN C;  4WNN A;  4CSR A;  4X23 B;  1P3K D;  4JJN B;  3B6G B;  4NFT A;  5DNM A;  3B6F B;  5B2I A;  4WU9 D;  3X1T D;  5AV8 D;  1P34 B;  2NQB A;  1N1J A;  3KWQ A;  5GT3 A;  3MVD A;  3WKJ A;  4Z66 B;  3W99 A;  3W98 A;  5B1M C;  3AZG D;  5CPJ C;  2PYO A;  4J8U C;  5BNX A;  5CP6 A;  5GXQ B;  3O62 A;  3AZF A;  2NQB D;  4J8W C;  3AZN D;  3LJA A;  3AV1 A;  5GT3 D;  5B2J D;  3MVD D;  5AVC C;  3KXB B;  5B1L A;  3W99 D;  5AV5 B;  1P3L B;  1P3P C;  1KX5 C;  5B31 A;  3X1V B;  4UUZ B;  5CP6 D;  3REI C;  3AZF D;  1P3I A;  5B40 C;  3LZ0 C;  5CPK A;  5B1L D;  5B0Y B;  5B31 D;  4G91 C;  5AVB D;  3LZ1 D;  1BH9 A;  3VH6 T;  1P3K C;  3REK B;  2HIO A;  2Y2O A;  4H9Q B;  4J8V D;  1ZLA D;  3NQU B;  1B67 A;  4WU9 C;  5JRG A;  3WKJ C;  4XUJ D;  5CPK D;  1P3O B;  5AY8 B;  4HGA C;  3C1C A;  5E5A A;  4ZBJ C;  3UTA B;  5FUG A;  3AZJ A;  4QLC B;  5DNM C;  3AZE D;  3NQJ B;  5B2I C;  4X23 A;  4H9R A;  5JRG D;  2NQB C;  3MGS D;  3KWQ C;  3REJ B;  5GT3 C;  5GT0 B;  5B2J C;  3MVD C;  1HQ3 A;  3C1C D;  3REL A;  3W99 C;  3B6F A;  1P34 A;  1P3M B;  3W98 C;  1P3G B;  2PYO C;  3AFA B;  1WWS A;  5CP6 C;  4Z66 A;  4YS3 B;  2JE5 A;  4X23 D;  3O62 C;  3AZF C;  4JJN D;  3B6G D;  3AV1 C;  2NZD B;  3B6F D;  5B1L C;  2YFV B;  1P34 D;  5B31 C;  1BFM A;  2Y2G A;  5AVB C;  2BYM A;  3KXB A;  4Z66 D;  1P3L A;  4KUD B;  3MGP B;  1P3I C;  5BO0 B;  3X1V A;  2JSS A;  5CPK C;  4LD9 B;  4UUZ A;  5GXQ D;  2RIQ A;  5B0Z B;  3KXB D;  5AV5 D;  1P3L D;  2HIO C;  3X1V D;  1TAF B;  4WV4 B;  5JRG C;  3LEL A;  3REK A;  3C1C C;  4Z2M G;  3VH6 W;  5E5A C;  2HUE B;  3NQU A;  5G49 B;  3X1S B;  3AZJ C;  5AV8 B;  5B0Y D;  1P3O A;  3WAA B;  5AY8 A;  4X23 C;  4DRB A;  3B0B A;  3REL C;  4QLC A;  3REK D;  3B6F C;  1HQ3 C;  3UT9 A;  3AZK B;  3AZM B;  1P34 C;  3TU4 B;  1P3O D;  1T3U A;  5AY8 D;  5GT0 A;  5B24 A;  3REJ A;  3AZN B;  4Z66 C;  3UTA D;  1P3G A;  2ARO B;  4QLC D;  5DNN B;  4DRA A;  1M18 B;  3H0M C;  4DQY B;  3REJ D;  5GT0 D;  3KXB C;  2YFV A;  1P3L C;  1P3M D;  1P3G D;  5AV9 A;  3EPL A;  3X1V C;  3AFA D;  4YS3 D;  3AN2 B;  4KUD A;  1EQZ B;  4WU8 B;  3EG5 B;  5BO0 A;  2NZD D;  1HTA A;  2BYK B;  4LD9 A;  1M19 D;  3AZH B;  3LEL C;  5B0Z A;  3REK C;  3KSY A;  4KUD D;  3MGP D;  1R4V A;  3AZE B;  4LD9 D;  4H9N B;  1P3O C;  5AY8 C;  4E45 A;  3H0L C;  5G49 A;  5BT1 D;  5B0Z D;  3X1T A;  5AV8 A;  3WAA A;  4QLC C;  3UT9 C;  3AZG A;  2CV5 B;  2XD1 A;  5B24 C;  5GT0 C;  3REJ C;  3AZK A;  3AZM A;  3X1S D;  1P3G C;  3WAA D;  1KU5 A;  3AZN A;  1BH8 B;  1S32 B;  5B2J A;  5GSU B;  5C3I B;  4KHA B;  2FJ7 B;  1P3F B;  2ARO A;  2NZD C;  2XD5 A;  3AZK D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...