4J8XB

X-ray structure of ncp145 with bound chlorido(eta-6-p-cymene)(n-fluorophenyl-2-pyridinecarbothioamide)ruthenium(ii)
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
82
structure length
82
Chain Sequence
VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.2
publication title Novel metal(II) arene 2-pyridinecarbothioamides: a rationale to orally active organometallic anticancer agents
doi rcsb
source organism Xenopus laevis
molecule tags Structural protein/dna
total genus 27
structure length 82
sequence length 82
chains with identical sequence F
ec nomenclature
pdb deposition date 2013-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4j8xB00
5CPIA 4H9RB 4R8PB 1M19C 3REKC 5GSUA 3LZ1B 1EQZB 3W99A 5B31C 2CV5C 1HQ3D 5AV8B 1KX4A 1KU5A 5B31G 1P3LC 1JFIA 2NZDB 1ID3A 3AZHB 1M1AA 1TAFB 4QLCB 5B2IA 1AOIC 3AZGB 3AZNC 5CPKC 5AV6C 3VH5W 3AZEB 3AZMA 5AVCC 2NQBB 5AV5B 3X1UD 2AROB 3MNNB 3AZID 3O62C 1KX5B 5CPIB 5GSUB 3MGQA 3W99B 2F8NG 1B6WA 5B24C 3B6GD 5B40D 1KX4B 3AN2A 1JFIB 1ID3B 4XUJC 1M1AB 2F8NH 2PYOD 1P3PC 3B0DC 5B2IB 3AZJB 1P3GD 4JJNC 4G92B 3UT9A 3W96C 2HIOD 3AZMB 4WU9D 5E5AC 1S32C 4J8XD 5BNXA 4X23C 3B6FC 3AZKC 5B1LD 3MGQB 2FJ7C 2BYMA 3AN2B 1TZYA 3VH6W 1F1EA 5GT0D 3A6NA 4LD9D 1HQ3B 4J8VA 2HUEB 1BH8A 4J8UA 3AZLC 2PYOA 4ZBJB 3TU4C 1P3KC 5C3IB 3UT9B 3WTPD 5GT3A 1P34D 5BNXB 3MGPC 4G91C 2NQBD 5AVBC 4R8PD 2BYMB 1EQZD 3LZ1D 3X1UB 1TZYB 4J8XA 1U35D 5AV8D 5AV9D 5B1LA 2NZDD 1P3AC 4J8WA 3A6NB 3AZHD 3WA9C 4J8VB 5JRGC 3LELC 1BH8B 5F99C 4QLCD 3LELA 3C1CD 4J8UB 2PYOB 3LZ0C 5B32C 3REIC 1P3IC 2IO5B 4LD9A 5B32A 5B32G 3AZGD 1Q9CA 5B1MD 5GT3B 4H9NA 3X1VC 3RELD 5AV5D 2AROD 3MNND 4YM6D 3MGSA 1KX5D 3B0CT 5CPID 3LJAC 4WU9B 1M19D 3REKD 1P3FC 4J8XB 1P34A 5B31D 1KX4D 4ZUXC 5B1LB 2BYKA 4J8WB 1U35A 5AV9A 1P3BC 1P3MC 4LD9B 3WKJC 1AOID 5AY8C 3UTBA 3AZND 1B67A 4H9NB 4Z5TC 3C1CA 5CPKD 3AZMD 3VH6A 3MGRC 4KHAA 5AVCD 3MGSB 4Z66C 5CPJC 3O62D 5B1MA 2F8ND 5B0YA 1P34B 2CWEA 3RELA 3AN2D 5B24D 4YM6A 2BYKB 3AZFA 4XUJD 5G49A 1BFMA 1M19A 5BT1D 3REKA 4NE3A 1U35B 5B31A 3WAAC 5AV9B 2CV5A 1P3LA 4KUDC 1R4VA 3KWQC 3REHC 3UTBB 3B0BA 3UT9D 3C1CB 1KX3C 3W96D 3UTAC 4KHAB 4CSRA 3X1SC 1AOIA 5E5AD 1F66C 1S32D 5JA4A 4X23D 5B1MB 3AZNA 3B6FD 4XZQC 5B0YB 5CPKA 3RELB 4EO5C 5AV6A 1TZYD 5AVCA 4YM6B 3X1TC 3AYWC 3REJC 4YS3C 3AZFB 3O62A 5G49B 2F8NA 5BS7C 3A6ND 3REKB 1M19B 5B31B 5CP6C 4HGAC 5B24A 4J8VD 3KXBC 2CV5B 3W98C 1P3LB 4J8UD 5BNVA 4UUZA 4XUJA 1P3PA 4WU8C 3TU4D 1P3KD 5GT3D 4CSRB 5B33C 1AOIB 4DRAA 2RVQC 1M18C 5JA4B 4JJNA 3AZNB 3C1BC 5CPKB 3W96A 5AV6B 5AVBD 5AVCB 5E5AA 1S32A 3AV1C 3O62B 4CAYA 4X23A 3B6FA 2F8NB 3AZKA 5DNNC 4J8WD 1P3AD 4KGCC 2FJ7A 5B24B 5CHLB 3W97C 5BNVB 3LELD 4UUZB 4XUJB 1ZLAC 1P3PB 3LZ0D 5B32D 1P3ID 4AWLC 3B0DB 3AZLA 3X1VD 4JJNB 3MGSD 3TU4A 1P3KA 1A7WA 3W96B 5DNMC 5B2JC 5E5AB 4H9OA 1S32B 3X1UC 4CAYB 4WZSB 4X23B 3AZIC 3B6FB 3MGPA 3AZKB 5GXQC 5AVBA 2FJ7B 4H9QA 3B6GC 5B40C 3KUYC 1P3MD 1P3AA 3UTBD 3MVDC 3WA9A 3AV2C 5JRGA 5F99A 1P3GC 3AZLB 3VH5T 3LZ0A 3REIA 1P3IA 3MGRD 3TU4B 1P3KB 4H9PA 5B0ZC 3AFAC 5CPJD 5B0YD 2HIOC 4DRBA 3X1VA 3MGPB 4G91B 3AZFD 1WWIA 5AVBB 4H9QB 3LJAA 1P3OC 1P3FA 2CV5D 1P3LD 4ZUXA 3WAAD 2YFWA 1P3AB 3WA9B 3REHD 5GT0C 5JRGB 3LELB 5F99B 1P3BA 3LZ0B 5B32B 3REIB 1P3IB 1P3MA 5FUGA 3WKJA 4H9PB 5AY8A 3WTPC 4Z5TA 5AV6D 4XZQD 3X1VB 3MGRA 3X1TD 3AYWD 4Z66A 3NQUA 2NQBC 4YS3D 5CPJA 1N1JA 3LJAB 4R8PC 1EQZC 3LZ1C 1P3FB 4WNNA 4ZUXB 5AV8C 3KXBD 3W98D 2YFWB 2NZDC 4NFTA 1P3PD 3AZHC 4WV4B 1P3BB 4H9SC 1H3OA 4QLCC 1P3MB 5BO0A 5KDMA 3WAAA 5FUGB 3KWQA 4KUDA 5B33D 1ULYA 3WKJB 4JJND 3REHA 5AY8B 3AZGC 3KSYA 4Z5TB 1KX3A 3AZEC 3MGRB 3X1SA 3UTAA 5AV5C 2AROC 4Z66B 3MNNC 3NQUB 1F66A 5CPJB 3AZKD 1N1JB 3AV1D 1KX5C 5CPIC 4XZQA 5GSUC 2FJ7D 3W99C 4WNNB 4KGCD 3V9RA 1KX4C 3W97D 3X1TA 3AYWA 3REJA 4YS3A 1ID3C 1ZLAD 1M1AC 5BS7A 5CP6A 3WAAB 1H3OB 4M6BA 3KXBA 5BO0B 5KDMB 5B2IC 3AZJC 3W98A 3KWQB 3AZLD 4KUDB 3REHB 3AZJA 4G92C 4WU8A 1KX3B 5DNMD 5B2JD 3AZMC 3X1SB 3UTAB 5B33A 1F66B 3MGPD 1M18A 3C1BA 4XZQB 5GXQD 3MGQC 3NQJA 4EO5B 3V9RB 3AN2C 3X1TB 3AYWB 3REJB 3B0CW 4YS3B 3AV1A 4NE6A 5DNNA 3KUYD 3WA9D 5BT1C 5CP6B 4HGAB 4KGCA 4Z2MG 1HQ3C 5JRGD 3KXBB 3MVDD 3W97A 3AV2D 3W98B 5F99D 1HQ3A 2HUEC 1ZLAA 3REID 4E44A 1HTAA 4ZBJC 4Z2MH 4WU8B 5C3IC 3UT9C 5B0ZD 3AFAD 5B33B 1BH9A 1WWSA 1M18B 3C1BB 3NQJB 3LJAD 2LY8A 5DNMA 5B2JA 1P3OD 1P3FD 1TZYC 4ZUXD 3AV1B 3X1UA 3AZIA 5DNNB 5GXQA 3A6NC 4KGCB 4J8VC 3W97B 3B6GA 5B40A 1P3BD 4J8UC 1ZLAB 2PYOC 3KUYA 2JSSA 2IO5C 3WKJD 4AWLB 5AY8D 3WTPE 3MVDA 3AV2A 4Z5TD 5GT3C 1P3GA 2YFVA 1BH9B 4Z66D 5B0ZA 3AFAA 5DNMB 5B2JB 4H9OB 4WU9C 2HIOA 4WU9A 4J8XC 3AZIB 2L5AA 3R45A 5B1LC 5GXQB 4J8WC 4E45A 1P3OA 3B6GB 5B40B 3VH5A 3KUYB 3KWQD 4KUDD 4LD9C 3MVDB 5GT0A 3AV2B 1KX3D 1P3GB 2YFVB 3X1SD 3UTAD 3AZED 1F66D 3MGSC 5B0ZB 3AFAB 2HIOB 3WTPA 5GSUD 1P34C 3W99D 3R45B 3VH6T 3REJD 1ID3D 2NQBA 1P3OB 1M1AD 4H9RA 4R8PA 1EQZA 5CP6D 3LZ1A 1U35C 5AV9C 5AV8A 5B2ID 3AZJD 2NZDA 2F8NK 3AZHA 5GT0B 4WU8D 3UTBC 3C1CC 1TAFA 4H9SA 4QLCA 2RVQD 1M18D 3C1BD 3AZGA 5B1MC 3WTPB 5B0YC 3MGQD 3RELC 3AZEA 4NE5A 4YM6C 5AV5A 2AROA 3MNNA 3AZFC 1KX5A 5DNND
chains in the Genus database with same CATH superfamily
5CPIA 4H9RB 4R8PB 1M19C 3REKC 5GSUA 3LZ1B 1EQZB 3W99A 5B31C 2CV5C 1HQ3D 5AV8B 1KX4A 1KU5A 5B31G 1P3LC 1JFIA 2NZDB 1ID3A 3AZHB 1M1AA 1TAFB 4QLCB 5B2IA 1AOIC 3AZGB 3AZNC 5CPKC 5AV6C 3VH5W 3AZEB 3AZMA 5AVCC 2NQBB 5AV5B 3X1UD 2AROB 1T3UA 3MNNB 3AZID 3O62C 1KX5B 5CPIB 5GSUB 3MGQA 3W99B 2F8NG 1B6WA 3EG5B 5B24C 3B6GD 5B40D 1KX4B 3AN2A 1JFIB 1ID3B 4XUJC 3EPKA 1M1AB 2F8NH 2PYOD 1P3PC 3B0DC 3AL0C 5B2IB 3AZJB 1P3GD 4JJNC 4G92B 2XD5A 3IP4C 3UT9A 3W96C 2HIOD 3AZMB 4WU9D 5E5AC 1S32C 4J8XD 5BNXA 4X23C 3B6FC 2W8SA 3AZKC 5B1LD 3MGQB 2FJ7C 2BYMA 3F6TA 3AN2B 1TZYA 3VH6W 1F1EA 5GT0D 3A6NA 4LD9D 1HQ3B 4J8VA 2HUEB 1BH8A 4J8UA 3AZLC 2PYOA 4ZBJB 3TU4C 1P3KC 5C3IB 3UT9B 3WTPD 5GT3A 1P34D 5BNXB 3MGPC 4G91C 2NQBD 5AVBC 4R8PD 2BYMB 1EQZD 3LZ1D 3X1UB 1TZYB 4J8XA 1U35D 5AV8D 5AV9D 5B1LA 2NZDD 1P3AC 4J8WA 3A6NB 3AZHD 3WA9C 3A1KA 4J8VB 5JRGC 3LELC 1BH8B 5F99C 4QLCD 3LELA 3EPJA 3C1CD 4J8UB 2PYOB 2Y2MA 3LZ0C 5B32C 3REIC 1P3IC 1W2EA 2IO5B 4LD9A 5B32A 5B32G 3AZGD 1Q9CA 2FFFB 3H0MC 5B1MD 5GT3B 4H9NA 3X1VC 3RELD 5AV5D 2AROD 3MNND 4YM6D 3MGSA 1KX5D 3B0CT 5CPID 3LJAC 4WU9B 1M19D 3REKD 1P3FC 4J8XB 1P34A 5B31D 1KX4D 4ZUXC 5B1LB 2BYKA 4J8WB 3EPLA 1U35A 5AV9A 1P3BC 1P3MC 4LD9B 3WKJC 1AOID 5AY8C 3UTBA 3AZND 1B67A 4H9NB 4Z5TC 3C1CA 3P5JB 3AZMD 5CPKD 3VH6A 3MGRC 4KHAA 5AVCD 3MGSB 4Z66C 5CPJC 3O62D 5B1MA 2F8ND 5B0YA 1P34B 2CWEA 2Y2HA 3RELA 3AN2D 5B24D 4YM6A 2BYKB 3AZFA 4XUJD 5G49A 1BFMA 2ZM5A 5BT1D 3REKA 4NE3A 1U35B 1M19A 5B31A 3WAAC 5AV9B 2CV5A 1P3LA 4KUDC 1R4VA 3KWQC 3REHC 3UTBB 3H0RC 3B0BA 3UT9D 3C1CB 1KX3C 3W96D 2Y2PA 3UTAC 4KHAB 4CSRA 3X1SC 1PZRA 5E5AD 1AOIA 1F66C 1S32D 5JA4A 4X23D 5B1MB 3AZNA 3B6FD 4XZQC 5B0YB 5CPKA 3RELB 4EO5C 5AV6A 1TZYD 5AVCA 4YM6B 3X1TC 3AYWC 2JCHA 3REJC 4YS3C 3AZFB 3O62A 5G49B 2F8NA 5BS7C 3A6ND 3REKB 1M19B 5B31B 5CP6C 4HGAC 5B24A 4J8VD 3EPHA 3KXBC 2CV5B 3W98C 1P3LB 4J8UD 5BNVA 4UUZA 2VQRA 4XUJA 1P3PA 4WU8C 3TU4D 1P3KD 2Y2LA 5GT3D 2Y2KA 4CSRB 5B33C 1AOIB 4DRAA 2RVQC 1M18C 5JA4B 4JJNA 3AZNB 3C1BC 5CPKB 3W96A 5AV6B 5AVBD 5AVCB 5E5AA 2RIQA 1S32A 3AV1C 3O62B 4CAYA 4X23A 3B6FA 2F8NB 3AZKA 5DNNC 4J8WD 1P3AD 4KGCC 2FJ7A 5B24B 5CHLB 3W97C 5BNVB 3LELD 4UUZB 4XUJB 1ZLAC 1P3PB 3LZ0D 5B32D 1P3ID 4AWLC 3B0DB 2Y2IA 3AZLA 3X1VD 4JJNB 3MGSD 3TU4A 1P3KA 1A7WA 3W96B 5DNMC 5B2JC 2ZY3A 5E5AB 4H9OA 1S32B 3X1UC 4CAYB 4WZSB 4X23B 3AZIC 3B6FB 3MGPA 3AZKB 5GXQC 5AVBA 2FJ7B 4H9QA 3H0LC 3B6GC 5B40C 3KUYC 1P3MD 1P3AA 3UTBD 3MVDC 3WA9A 3AV2C 5JRGA 5F99A 1P3GC 3AZLB 3FDDA 3VH5T 3LZ0A 3REIA 1P3IA 3MGRD 3TU4B 1P3KB 4H9PA 5B0ZC 3AFAC 5CPJD 5B0YD 2HIOC 4DRBA 3X1VA 3MGPB 4G91B 2DQNC 3AZFD 1WWIA 5AVBB 4H9QB 4UPKA 3LJAA 1P3OC 1Z2CB 1P3FA 2CV5D 1P3LD 4ZUXA 3WAAD 2YFWA 1P3AB 3WA9B 3REHD 5GT0C 5JRGB 3LELB 5F99B 1P3BA 3LZ0B 5B32B 3REIB 1P3IB 1P3MA 5FUGA 3WKJA 2G5IC 4H9PB 5AY8A 3WTPC 4Z5TA 5AV6D 4XZQD 3X1VB 3MGRA 3X1TD 3AYWD 4Z66A 3NQUA 2NQBC 4YS3D 5CPJA 1N1JA 3LJAB 4R8PC 1EQZC 3LZ1C 1P3FB 4WNNA 4ZUXB 5AV8C 3KXBD 3W98D 2YFWB 2NZDC 4NFTA 1P3PD 3AZHC 4WV4B 2G5HC 1P3BB 4H9SC 1H3OA 4QLCC 1P3MB 5BO0A 5KDMA 3WAAA 5FUGB 3KWQA 4KUDA 5B33D 1ULYA 3WKJB 4JJND 3REHA 5AY8B 3AZGC 2DF4C 3KSYA 4Z5TB 1KX3A 3AZEC 3MGRB 3X1SA 3UTAA 5AV5C 2AROC 4Z66B 3MNNC 3NQUB 1F66A 5CPJB 3AZKD 1N1JB 3AV1D 1KX5C 5CPIC 4XZQA 5GSUC 2FJ7D 3W99C 4WNNB 4KGCD 3V9RA 1KX4C 3W97D 3X1TA 2BG1A 3AYWA 3REJA 4YS3A 1ID3C 1ZLAD 2F2AC 1M1AC 3KFUG 5BS7A 5CP6A 3WAAB 1H3OB 4M6BA 3A1IA 5B2IC 5BO0B 5KDMB 3KXBA 3AZJC 3KWQB 3AZLD 3W98A 4KUDB 3REHB 3AZJA 4G92C 4WU8A 1KX3B 2J8PA 5DNMD 5B2JD 3AZMC 3X1SB 2Y2GA 5B33A 3UTAB 1F66B 3MGPD 1M18A 3C1BA 4XZQB 5GXQD 3MGQC 3NQJA 4EO5B 3V9RB 3AN2C 3X1TB 3AYWB 3REJB 3B0CW 4YS3B 3AV1A 4NE6A 5DNNA 3KUYD 4WJ3C 3WA9D 2Y2OA 5BT1C 5CP6B 4HGAB 4KGCA 4Z2MG 1HQ3C 5JRGD 3KXBB 3MVDD 3W97A 3AV2D 3W98B 5F99D 1HQ3A 2HUEC 1ZLAA 3REID 4E44A 1HTAA 4ZBJC 4Z2MH 4WU8B 5C3IC 3UT9C 2ZY4A 5B0ZD 3AFAD 5B33B 1BH9A 1WWSA 1M18B 3C1BB 3NQJB 2JE5A 3LJAD 2LY8A 5DNMA 5B2JA 1P3OD 1P3FD 1TZYC 4ZUXD 3AV1B 3X1UA 3AZIA 5DNNB 5GXQA 3A6NC 4KGCB 4J8VC 3W97B 3B6GA 2ZY2A 5B40A 1P3BD 4J8UC 1ZLAB 2PYOC 3KUYA 2JSSA 2IO5C 3WKJD 4AWLB 5AY8D 3WTPE 3MVDA 3AV2A 4Z5TD 5GT3C 1P3GA 2YFVA 1BH9B 4Z66D 5B0ZA 3AFAA 5DNMB 5B2JB 4H9OB 4WU9C 2HIOA 4WU9A 4J8XC 3AZIB 2L5AA 3R45A 5B1LC 5GXQB 4J8WC 2ZY5A 4E45A 1P3OA 3B6GB 5B40B 3VH5A 2XD1A 3KUYB 3KWQD 4KUDD 4LD9C 3MVDB 5GT0A 3AV2B 1KX3D 1P3GB 2YFVB 3X1SD 3UTAD 3AZED 1F66D 3MGSC 5B0ZB 3AFAB 2HIOB 3WTPA 5GSUD 1P34C 3W99D 3R45B 3VH6T 3REJD 4DQYB 1ID3D 2NQBA 1P3OB 1M1AD 4H9RA 4R8PA 2UWXA 5CP6D 3LZ1A 1U35C 1EQZA 5AV9C 5AV8A 2Y2JA 5B2ID 3AZJD 2NZDA 2F8NK 3AZHA 5GT0B 4WU8D 3UTBC 2Y2QA 2Y2NA 3C1CC 1TAFA 4H9SA 4QLCA 2RVQD 1M18D 3C1BD 3AZGA 5B1MC 3WTPB 5B0YC 3MGQD 3RELC 3AZEA 4NE5A 4YM6C 5AV5A 2AROA 3MNNA 3AZFC 1KX5A 5DNND
chains in the Genus database with same CATH topology
5CPIA 4H9RB 4R8PB 1M19C 3REKC 5GSUA 3LZ1B 1EQZB 3W99A 5B31C 2CV5C 1HQ3D 5AV8B 1KX4A 1KU5A 5B31G 1P3LC 1JFIA 2NZDB 1ID3A 3AZHB 1M1AA 1TAFB 4QLCB 5B2IA 1AOIC 3AZGB 3AZNC 5CPKC 5AV6C 3VH5W 3AZEB 3AZMA 5AVCC 2NQBB 5AV5B 3X1UD 2AROB 1T3UA 3MNNB 3AZID 3O62C 1KX5B 5CPIB 5GSUB 3MGQA 3W99B 2F8NG 1B6WA 3EG5B 5B24C 3B6GD 5B40D 1KX4B 3AN2A 1JFIB 1ID3B 4XUJC 3EPKA 1M1AB 2F8NH 2PYOD 1P3PC 3B0DC 3AL0C 5B2IB 3AZJB 1P3GD 4JJNC 4G92B 2XD5A 3IP4C 3UT9A 3W96C 2HIOD 3AZMB 4WU9D 5E5AC 1S32C 4J8XD 5BNXA 4X23C 3B6FC 2W8SA 3AZKC 5B1LD 3MGQB 2FJ7C 2BYMA 3F6TA 3AN2B 1TZYA 3VH6W 1F1EA 5GT0D 3A6NA 4LD9D 1HQ3B 4J8VA 2HUEB 1BH8A 4J8UA 3AZLC 2PYOA 4ZBJB 3TU4C 1P3KC 5C3IB 3UT9B 3WTPD 5GT3A 1P34D 5BNXB 3MGPC 4G91C 2NQBD 5AVBC 4R8PD 2BYMB 1EQZD 3LZ1D 3X1UB 1TZYB 4J8XA 1U35D 5AV8D 5AV9D 5B1LA 2NZDD 1P3AC 4J8WA 3A6NB 3AZHD 3WA9C 3A1KA 4J8VB 5JRGC 3LELC 1BH8B 5F99C 4QLCD 3LELA 3EPJA 3C1CD 4J8UB 2PYOB 2Y2MA 3LZ0C 5B32C 3REIC 1P3IC 1W2EA 2IO5B 4LD9A 5B32A 5B32G 3AZGD 1Q9CA 2FFFB 3H0MC 5B1MD 5GT3B 4H9NA 3X1VC 3RELD 5AV5D 2AROD 3MNND 4YM6D 3MGSA 1KX5D 3B0CT 5CPID 3LJAC 4WU9B 1M19D 3REKD 1P3FC 4J8XB 1P34A 5B31D 1KX4D 4ZUXC 5B1LB 2BYKA 4J8WB 3EPLA 1U35A 5AV9A 1P3BC 1P3MC 4LD9B 3WKJC 1AOID 5AY8C 3UTBA 3AZND 1B67A 4H9NB 4Z5TC 3C1CA 3P5JB 3AZMD 5CPKD 3VH6A 3MGRC 4KHAA 5AVCD 3MGSB 4Z66C 5CPJC 3O62D 5B1MA 2F8ND 5B0YA 1P34B 2CWEA 2Y2HA 3RELA 3AN2D 5B24D 4YM6A 2BYKB 3AZFA 4XUJD 5G49A 1BFMA 2ZM5A 5BT1D 3REKA 4NE3A 1U35B 1M19A 5B31A 3WAAC 5AV9B 2CV5A 1P3LA 4KUDC 1R4VA 3KWQC 3REHC 3UTBB 3H0RC 3B0BA 3UT9D 3C1CB 1KX3C 3W96D 2Y2PA 3UTAC 4KHAB 4CSRA 3X1SC 1PZRA 5E5AD 1AOIA 1F66C 1S32D 5JA4A 4X23D 5B1MB 3AZNA 3B6FD 4XZQC 5B0YB 5CPKA 3RELB 4EO5C 5AV6A 1TZYD 5AVCA 4YM6B 3X1TC 3AYWC 2JCHA 3REJC 4YS3C 3AZFB 3O62A 5G49B 2F8NA 5BS7C 3A6ND 3REKB 1M19B 5B31B 5CP6C 4HGAC 5B24A 4J8VD 3EPHA 3KXBC 2CV5B 3W98C 1P3LB 4J8UD 5BNVA 4UUZA 2VQRA 4XUJA 1P3PA 4WU8C 3TU4D 1P3KD 2Y2LA 5GT3D 2Y2KA 4CSRB 5B33C 1AOIB 4DRAA 2RVQC 1M18C 5JA4B 4JJNA 3AZNB 3C1BC 5CPKB 3W96A 5AV6B 5AVBD 5AVCB 5E5AA 2RIQA 1S32A 3AV1C 3O62B 4CAYA 4X23A 3B6FA 2F8NB 3AZKA 5DNNC 4J8WD 1P3AD 4KGCC 2FJ7A 5B24B 5CHLB 3W97C 5BNVB 3LELD 4UUZB 4XUJB 1ZLAC 1P3PB 3LZ0D 5B32D 1P3ID 4AWLC 3B0DB 2Y2IA 3AZLA 3X1VD 4JJNB 3MGSD 3TU4A 1P3KA 1A7WA 3W96B 5DNMC 5B2JC 2ZY3A 5E5AB 4H9OA 1S32B 3X1UC 4CAYB 4WZSB 4X23B 3AZIC 3B6FB 3MGPA 3AZKB 5GXQC 5AVBA 2FJ7B 4H9QA 3H0LC 3B6GC 5B40C 3KUYC 1P3MD 1P3AA 3UTBD 3MVDC 3WA9A 3AV2C 5JRGA 5F99A 1P3GC 3AZLB 3FDDA 3VH5T 3LZ0A 3REIA 1P3IA 3MGRD 3TU4B 1P3KB 4H9PA 5B0ZC 3AFAC 5CPJD 5B0YD 2HIOC 4DRBA 3X1VA 3MGPB 4G91B 2DQNC 3AZFD 1WWIA 5AVBB 4H9QB 4UPKA 3LJAA 1P3OC 1Z2CB 1P3FA 2CV5D 1P3LD 4ZUXA 3WAAD 2YFWA 1P3AB 3WA9B 3REHD 5GT0C 5JRGB 3LELB 5F99B 1P3BA 3LZ0B 5B32B 3REIB 1P3IB 1P3MA 5FUGA 3WKJA 2G5IC 4H9PB 5AY8A 3WTPC 4Z5TA 5AV6D 4XZQD 3X1VB 3MGRA 3X1TD 3AYWD 4Z66A 3NQUA 2NQBC 4YS3D 5CPJA 1N1JA 3LJAB 4R8PC 1EQZC 3LZ1C 1P3FB 4WNNA 4ZUXB 5AV8C 3KXBD 3W98D 2YFWB 2NZDC 4NFTA 1P3PD 3AZHC 4WV4B 2G5HC 1P3BB 4H9SC 1H3OA 4QLCC 1P3MB 5BO0A 5KDMA 3WAAA 5FUGB 3KWQA 4KUDA 5B33D 1ULYA 3WKJB 4JJND 3REHA 5AY8B 3AZGC 2DF4C 3KSYA 4Z5TB 1KX3A 3AZEC 3MGRB 3X1SA 3UTAA 5AV5C 2AROC 4Z66B 3MNNC 3NQUB 1F66A 5CPJB 3AZKD 1N1JB 3AV1D 1KX5C 5CPIC 4XZQA 5GSUC 2FJ7D 3W99C 4WNNB 4KGCD 3V9RA 1KX4C 3W97D 3X1TA 2BG1A 3AYWA 3REJA 4YS3A 1ID3C 1ZLAD 2F2AC 1M1AC 3KFUG 5BS7A 5CP6A 3WAAB 1H3OB 4M6BA 3A1IA 5B2IC 5BO0B 5KDMB 3KXBA 3AZJC 3KWQB 3AZLD 3W98A 4KUDB 3REHB 3AZJA 4G92C 4WU8A 1KX3B 2J8PA 5DNMD 5B2JD 3AZMC 3X1SB 2Y2GA 5B33A 3UTAB 1F66B 3MGPD 1M18A 3C1BA 4XZQB 5GXQD 3MGQC 3NQJA 4EO5B 3V9RB 3AN2C 3X1TB 3AYWB 3REJB 3B0CW 4YS3B 3AV1A 4NE6A 5DNNA 3KUYD 4WJ3C 3WA9D 2Y2OA 5BT1C 5CP6B 4HGAB 4KGCA 4Z2MG 1HQ3C 5JRGD 3KXBB 3MVDD 3W97A 3AV2D 3W98B 5F99D 1HQ3A 2HUEC 1ZLAA 3REID 4E44A 1HTAA 4ZBJC 4Z2MH 4WU8B 5C3IC 3UT9C 2ZY4A 5B0ZD 3AFAD 5B33B 1BH9A 1WWSA 1M18B 3C1BB 3NQJB 2JE5A 3LJAD 2LY8A 5DNMA 5B2JA 1P3OD 1P3FD 1TZYC 4ZUXD 3AV1B 3X1UA 3AZIA 5DNNB 5GXQA 3A6NC 4KGCB 4J8VC 3W97B 3B6GA 2ZY2A 5B40A 1P3BD 4J8UC 1ZLAB 2PYOC 3KUYA 2JSSA 2IO5C 3WKJD 4AWLB 5AY8D 3WTPE 3MVDA 3AV2A 4Z5TD 5GT3C 1P3GA 2YFVA 1BH9B 4Z66D 5B0ZA 3AFAA 5DNMB 5B2JB 4H9OB 4WU9C 2HIOA 4WU9A 4J8XC 3AZIB 2L5AA 3R45A 5B1LC 5GXQB 4J8WC 2ZY5A 4E45A 1P3OA 3B6GB 5B40B 3VH5A 2XD1A 3KUYB 3KWQD 4KUDD 4LD9C 3MVDB 5GT0A 3AV2B 1KX3D 1P3GB 2YFVB 3X1SD 3UTAD 3AZED 1F66D 3MGSC 5B0ZB 3AFAB 2HIOB 3WTPA 5GSUD 1P34C 3W99D 3R45B 3VH6T 3REJD 4DQYB 1ID3D 2NQBA 1P3OB 1M1AD 4H9RA 4R8PA 2UWXA 5CP6D 3LZ1A 1U35C 1EQZA 5AV9C 5AV8A 2Y2JA 5B2ID 3AZJD 2NZDA 2F8NK 3AZHA 5GT0B 4WU8D 3UTBC 2Y2QA 2Y2NA 3C1CC 1TAFA 4H9SA 4QLCA 2RVQD 1M18D 3C1BD 3AZGA 5B1MC 3WTPB 5B0YC 3MGQD 3RELC 3AZEA 4NE5A 4YM6C 5AV5A 2AROA 3MNNA 3AZFC 1KX5A 5DNND
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CPI A;  4H9R B;  4R8P B;  1M19 C;  3REK C;  5GSU A;  3LZ1 B;  1EQZ B;  3W99 A;  5B31 C;  2CV5 C;  1HQ3 D;  5AV8 B;  1KX4 A;  1KU5 A;  5B31 G;  1P3L C;  1JFI A;  2NZD B;  1ID3 A;  3AZH B;  1M1A A;  1TAF B;  4QLC B;  5B2I A;  1AOI C;  3AZG B;  3AZN C;  5CPK C;  5AV6 C;  3VH5 W;  3AZE B;  3AZM A;  5AVC C;  2NQB B;  5AV5 B;  3X1U D;  2ARO B;  3MNN B;  3AZI D;  3O62 C;  1KX5 B;  5CPI B;  5GSU B;  3MGQ A;  3W99 B;  2F8N G;  1B6W A;  5B24 C;  3B6G D;  5B40 D;  1KX4 B;  3AN2 A;  1JFI B;  1ID3 B;  4XUJ C;  1M1A B;  2F8N H;  2PYO D;  1P3P C;  3B0D C;  5B2I B;  3AZJ B;  1P3G D;  4JJN C;  4G92 B;  3UT9 A;  3W96 C;  2HIO D;  3AZM B;  4WU9 D;  5E5A C;  1S32 C;  4J8X D;  5BNX A;  4X23 C;  3B6F C;  3AZK C;  5B1L D;  3MGQ B;  2FJ7 C;  2BYM A;  3AN2 B;  1TZY A;  3VH6 W;  1F1E A;  5GT0 D;  3A6N A;  4LD9 D;  1HQ3 B;  4J8V A;  2HUE B;  1BH8 A;  4J8U A;  3AZL C;  2PYO A;  4ZBJ B;  3TU4 C;  1P3K C;  5C3I B;  3UT9 B;  3WTP D;  5GT3 A;  1P34 D;  5BNX B;  3MGP C;  4G91 C;  2NQB D;  5AVB C;  4R8P D;  2BYM B;  1EQZ D;  3LZ1 D;  3X1U B;  1TZY B;  4J8X A;  1U35 D;  5AV8 D;  5AV9 D;  5B1L A;  2NZD D;  1P3A C;  4J8W A;  3A6N B;  3AZH D;  3WA9 C;  4J8V B;  5JRG C;  3LEL C;  1BH8 B;  5F99 C;  4QLC D;  3LEL A;  3C1C D;  4J8U B;  2PYO B;  3LZ0 C;  5B32 C;  3REI C;  1P3I C;  2IO5 B;  4LD9 A;  5B32 A;  5B32 G;  3AZG D;  1Q9C A;  5B1M D;  5GT3 B;  4H9N A;  3X1V C;  3REL D;  5AV5 D;  2ARO D;  3MNN D;  4YM6 D;  3MGS A;  1KX5 D;  3B0C T;  5CPI D;  3LJA C;  4WU9 B;  1M19 D;  3REK D;  1P3F C;  4J8X B;  1P34 A;  5B31 D;  1KX4 D;  4ZUX C;  5B1L B;  2BYK A;  4J8W B;  1U35 A;  5AV9 A;  1P3B C;  1P3M C;  4LD9 B;  3WKJ C;  1AOI D;  5AY8 C;  3UTB A;  3AZN D;  1B67 A;  4H9N B;  4Z5T C;  3C1C A;  5CPK D;  3AZM D;  3VH6 A;  3MGR C;  4KHA A;  5AVC D;  3MGS B;  4Z66 C;  5CPJ C;  3O62 D;  5B1M A;  2F8N D;  5B0Y A;  1P34 B;  2CWE A;  3REL A;  3AN2 D;  5B24 D;  4YM6 A;  2BYK B;  3AZF A;  4XUJ D;  5G49 A;  1BFM A;  1M19 A;  5BT1 D;  3REK A;  4NE3 A;  1U35 B;  5B31 A;  3WAA C;  5AV9 B;  2CV5 A;  1P3L A;  4KUD C;  1R4V A;  3KWQ C;  3REH C;  3UTB B;  3B0B A;  3UT9 D;  3C1C B;  1KX3 C;  3W96 D;  3UTA C;  4KHA B;  4CSR A;  3X1S C;  1AOI A;  5E5A D;  1F66 C;  1S32 D;  5JA4 A;  4X23 D;  5B1M B;  3AZN A;  3B6F D;  4XZQ C;  5B0Y B;  5CPK A;  3REL B;  4EO5 C;  5AV6 A;  1TZY D;  5AVC A;  4YM6 B;  3X1T C;  3AYW C;  3REJ C;  4YS3 C;  3AZF B;  3O62 A;  5G49 B;  2F8N A;  5BS7 C;  3A6N D;  3REK B;  1M19 B;  5B31 B;  5CP6 C;  4HGA C;  5B24 A;  4J8V D;  3KXB C;  2CV5 B;  3W98 C;  1P3L B;  4J8U D;  5BNV A;  4UUZ A;  4XUJ A;  1P3P A;  4WU8 C;  3TU4 D;  1P3K D;  5GT3 D;  4CSR B;  5B33 C;  1AOI B;  4DRA A;  2RVQ C;  1M18 C;  5JA4 B;  4JJN A;  3AZN B;  3C1B C;  5CPK B;  3W96 A;  5AV6 B;  5AVB D;  5AVC B;  5E5A A;  1S32 A;  3AV1 C;  3O62 B;  4CAY A;  4X23 A;  3B6F A;  2F8N B;  3AZK A;  5DNN C;  4J8W D;  1P3A D;  4KGC C;  2FJ7 A;  5B24 B;  5CHL B;  3W97 C;  5BNV B;  3LEL D;  4UUZ B;  4XUJ B;  1ZLA C;  1P3P B;  3LZ0 D;  5B32 D;  1P3I D;  4AWL C;  3B0D B;  3AZL A;  3X1V D;  4JJN B;  3MGS D;  3TU4 A;  1P3K A;  1A7W A;  3W96 B;  5DNM C;  5B2J C;  5E5A B;  4H9O A;  1S32 B;  3X1U C;  4CAY B;  4WZS B;  4X23 B;  3AZI C;  3B6F B;  3MGP A;  3AZK B;  5GXQ C;  5AVB A;  2FJ7 B;  4H9Q A;  3B6G C;  5B40 C;  3KUY C;  1P3M D;  1P3A A;  3UTB D;  3MVD C;  3WA9 A;  3AV2 C;  5JRG A;  5F99 A;  1P3G C;  3AZL B;  3VH5 T;  3LZ0 A;  3REI A;  1P3I A;  3MGR D;  3TU4 B;  1P3K B;  4H9P A;  5B0Z C;  3AFA C;  5CPJ D;  5B0Y D;  2HIO C;  4DRB A;  3X1V A;  3MGP B;  4G91 B;  3AZF D;  1WWI A;  5AVB B;  4H9Q B;  3LJA A;  1P3O C;  1P3F A;  2CV5 D;  1P3L D;  4ZUX A;  3WAA D;  2YFW A;  1P3A B;  3WA9 B;  3REH D;  5GT0 C;  5JRG B;  3LEL B;  5F99 B;  1P3B A;  3LZ0 B;  5B32 B;  3REI B;  1P3I B;  1P3M A;  5FUG A;  3WKJ A;  4H9P B;  5AY8 A;  3WTP C;  4Z5T A;  5AV6 D;  4XZQ D;  3X1V B;  3MGR A;  3X1T D;  3AYW D;  4Z66 A;  3NQU A;  2NQB C;  4YS3 D;  5CPJ A;  1N1J A;  3LJA B;  4R8P C;  1EQZ C;  3LZ1 C;  1P3F B;  4WNN A;  4ZUX B;  5AV8 C;  3KXB D;  3W98 D;  2YFW B;  2NZD C;  4NFT A;  1P3P D;  3AZH C;  4WV4 B;  1P3B B;  4H9S C;  1H3O A;  4QLC C;  1P3M B;  5BO0 A;  5KDM A;  3WAA A;  5FUG B;  3KWQ A;  4KUD A;  5B33 D;  1ULY A;  3WKJ B;  4JJN D;  3REH A;  5AY8 B;  3AZG C;  3KSY A;  4Z5T B;  1KX3 A;  3AZE C;  3MGR B;  3X1S A;  3UTA A;  5AV5 C;  2ARO C;  4Z66 B;  3MNN C;  3NQU B;  1F66 A;  5CPJ B;  3AZK D;  1N1J B;  3AV1 D;  1KX5 C;  5CPI C;  4XZQ A;  5GSU C;  2FJ7 D;  3W99 C;  4WNN B;  4KGC D;  3V9R A;  1KX4 C;  3W97 D;  3X1T A;  3AYW A;  3REJ A;  4YS3 A;  1ID3 C;  1ZLA D;  1M1A C;  5BS7 A;  5CP6 A;  3WAA B;  1H3O B;  4M6B A;  3KXB A;  5BO0 B;  5KDM B;  5B2I C;  3AZJ C;  3W98 A;  3KWQ B;  3AZL D;  4KUD B;  3REH B;  3AZJ A;  4G92 C;  4WU8 A;  1KX3 B;  5DNM D;  5B2J D;  3AZM C;  3X1S B;  3UTA B;  5B33 A;  1F66 B;  3MGP D;  1M18 A;  3C1B A;  4XZQ B;  5GXQ D;  3MGQ C;  3NQJ A;  4EO5 B;  3V9R B;  3AN2 C;  3X1T B;  3AYW B;  3REJ B;  3B0C W;  4YS3 B;  3AV1 A;  4NE6 A;  5DNN A;  3KUY D;  3WA9 D;  5BT1 C;  5CP6 B;  4HGA B;  4KGC A;  4Z2M G;  1HQ3 C;  5JRG D;  3KXB B;  3MVD D;  3W97 A;  3AV2 D;  3W98 B;  5F99 D;  1HQ3 A;  2HUE C;  1ZLA A;  3REI D;  4E44 A;  1HTA A;  4ZBJ C;  4Z2M H;  4WU8 B;  5C3I C;  3UT9 C;  5B0Z D;  3AFA D;  5B33 B;  1BH9 A;  1WWS A;  1M18 B;  3C1B B;  3NQJ B;  3LJA D;  2LY8 A;  5DNM A;  5B2J A;  1P3O D;  1P3F D;  1TZY C;  4ZUX D;  3AV1 B;  3X1U A;  3AZI A;  5DNN B;  5GXQ A;  3A6N C;  4KGC B;  4J8V C;  3W97 B;  3B6G A;  5B40 A;  1P3B D;  4J8U C;  1ZLA B;  2PYO C;  3KUY A;  2JSS A;  2IO5 C;  3WKJ D;  4AWL B;  5AY8 D;  3WTP E;  3MVD A;  3AV2 A;  4Z5T D;  5GT3 C;  1P3G A;  2YFV A;  1BH9 B;  4Z66 D;  5B0Z A;  3AFA A;  5DNM B;  5B2J B;  4H9O B;  4WU9 C;  2HIO A;  4WU9 A;  4J8X C;  3AZI B;  2L5A A;  3R45 A;  5B1L C;  5GXQ B;  4J8W C;  4E45 A;  1P3O A;  3B6G B;  5B40 B;  3VH5 A;  3KUY B;  3KWQ D;  4KUD D;  4LD9 C;  3MVD B;  5GT0 A;  3AV2 B;  1KX3 D;  1P3G B;  2YFV B;  3X1S D;  3UTA D;  3AZE D;  1F66 D;  3MGS C;  5B0Z B;  3AFA B;  2HIO B;  3WTP A;  5GSU D;  1P34 C;  3W99 D;  3R45 B;  3VH6 T;  3REJ D;  1ID3 D;  2NQB A;  1P3O B;  1M1A D;  4H9R A;  4R8P A;  1EQZ A;  5CP6 D;  3LZ1 A;  1U35 C;  5AV9 C;  5AV8 A;  5B2I D;  3AZJ D;  2NZD A;  2F8N K;  3AZH A;  5GT0 B;  4WU8 D;  3UTB C;  3C1C C;  1TAF A;  4H9S A;  4QLC A;  2RVQ D;  1M18 D;  3C1B D;  3AZG A;  5B1M C;  3WTP B;  5B0Y C;  3MGQ D;  3REL C;  3AZE A;  4NE5 A;  4YM6 C;  5AV5 A;  2ARO A;  3MNN A;  3AZF C;  1KX5 A;  5DNN D; 
#chains in the Genus database with same CATH topology
 5CPI A;  4H9R B;  4R8P B;  1M19 C;  3REK C;  5GSU A;  3LZ1 B;  1EQZ B;  3W99 A;  5B31 C;  2CV5 C;  1HQ3 D;  5AV8 B;  1KX4 A;  1KU5 A;  5B31 G;  1P3L C;  1JFI A;  2NZD B;  1ID3 A;  3AZH B;  1M1A A;  1TAF B;  4QLC B;  5B2I A;  1AOI C;  3AZG B;  3AZN C;  5CPK C;  5AV6 C;  3VH5 W;  3AZE B;  3AZM A;  5AVC C;  2NQB B;  5AV5 B;  3X1U D;  2ARO B;  1T3U A;  3MNN B;  3AZI D;  3O62 C;  1KX5 B;  5CPI B;  5GSU B;  3MGQ A;  3W99 B;  2F8N G;  1B6W A;  3EG5 B;  5B24 C;  3B6G D;  5B40 D;  1KX4 B;  3AN2 A;  1JFI B;  1ID3 B;  4XUJ C;  3EPK A;  1M1A B;  2F8N H;  2PYO D;  1P3P C;  3B0D C;  3AL0 C;  5B2I B;  3AZJ B;  1P3G D;  4JJN C;  4G92 B;  2XD5 A;  3IP4 C;  3UT9 A;  3W96 C;  2HIO D;  3AZM B;  4WU9 D;  5E5A C;  1S32 C;  4J8X D;  5BNX A;  4X23 C;  3B6F C;  2W8S A;  3AZK C;  5B1L D;  3MGQ B;  2FJ7 C;  2BYM A;  3F6T A;  3AN2 B;  1TZY A;  3VH6 W;  1F1E A;  5GT0 D;  3A6N A;  4LD9 D;  1HQ3 B;  4J8V A;  2HUE B;  1BH8 A;  4J8U A;  3AZL C;  2PYO A;  4ZBJ B;  3TU4 C;  1P3K C;  5C3I B;  3UT9 B;  3WTP D;  5GT3 A;  1P34 D;  5BNX B;  3MGP C;  4G91 C;  2NQB D;  5AVB C;  4R8P D;  2BYM B;  1EQZ D;  3LZ1 D;  3X1U B;  1TZY B;  4J8X A;  1U35 D;  5AV8 D;  5AV9 D;  5B1L A;  2NZD D;  1P3A C;  4J8W A;  3A6N B;  3AZH D;  3WA9 C;  3A1K A;  4J8V B;  5JRG C;  3LEL C;  1BH8 B;  5F99 C;  4QLC D;  3LEL A;  3EPJ A;  3C1C D;  4J8U B;  2PYO B;  2Y2M A;  3LZ0 C;  5B32 C;  3REI C;  1P3I C;  1W2E A;  2IO5 B;  4LD9 A;  5B32 A;  5B32 G;  3AZG D;  1Q9C A;  2FFF B;  3H0M C;  5B1M D;  5GT3 B;  4H9N A;  3X1V C;  3REL D;  5AV5 D;  2ARO D;  3MNN D;  4YM6 D;  3MGS A;  1KX5 D;  3B0C T;  5CPI D;  3LJA C;  4WU9 B;  1M19 D;  3REK D;  1P3F C;  4J8X B;  1P34 A;  5B31 D;  1KX4 D;  4ZUX C;  5B1L B;  2BYK A;  4J8W B;  3EPL A;  1U35 A;  5AV9 A;  1P3B C;  1P3M C;  4LD9 B;  3WKJ C;  1AOI D;  5AY8 C;  3UTB A;  3AZN D;  1B67 A;  4H9N B;  4Z5T C;  3C1C A;  3P5J B;  3AZM D;  5CPK D;  3VH6 A;  3MGR C;  4KHA A;  5AVC D;  3MGS B;  4Z66 C;  5CPJ C;  3O62 D;  5B1M A;  2F8N D;  5B0Y A;  1P34 B;  2CWE A;  2Y2H A;  3REL A;  3AN2 D;  5B24 D;  4YM6 A;  2BYK B;  3AZF A;  4XUJ D;  5G49 A;  1BFM A;  2ZM5 A;  5BT1 D;  3REK A;  4NE3 A;  1U35 B;  1M19 A;  5B31 A;  3WAA C;  5AV9 B;  2CV5 A;  1P3L A;  4KUD C;  1R4V A;  3KWQ C;  3REH C;  3UTB B;  3H0R C;  3B0B A;  3UT9 D;  3C1C B;  1KX3 C;  3W96 D;  2Y2P A;  3UTA C;  4KHA B;  4CSR A;  3X1S C;  1PZR A;  5E5A D;  1AOI A;  1F66 C;  1S32 D;  5JA4 A;  4X23 D;  5B1M B;  3AZN A;  3B6F D;  4XZQ C;  5B0Y B;  5CPK A;  3REL B;  4EO5 C;  5AV6 A;  1TZY D;  5AVC A;  4YM6 B;  3X1T C;  3AYW C;  2JCH A;  3REJ C;  4YS3 C;  3AZF B;  3O62 A;  5G49 B;  2F8N A;  5BS7 C;  3A6N D;  3REK B;  1M19 B;  5B31 B;  5CP6 C;  4HGA C;  5B24 A;  4J8V D;  3EPH A;  3KXB C;  2CV5 B;  3W98 C;  1P3L B;  4J8U D;  5BNV A;  4UUZ A;  2VQR A;  4XUJ A;  1P3P A;  4WU8 C;  3TU4 D;  1P3K D;  2Y2L A;  5GT3 D;  2Y2K A;  4CSR B;  5B33 C;  1AOI B;  4DRA A;  2RVQ C;  1M18 C;  5JA4 B;  4JJN A;  3AZN B;  3C1B C;  5CPK B;  3W96 A;  5AV6 B;  5AVB D;  5AVC B;  5E5A A;  2RIQ A;  1S32 A;  3AV1 C;  3O62 B;  4CAY A;  4X23 A;  3B6F A;  2F8N B;  3AZK A;  5DNN C;  4J8W D;  1P3A D;  4KGC C;  2FJ7 A;  5B24 B;  5CHL B;  3W97 C;  5BNV B;  3LEL D;  4UUZ B;  4XUJ B;  1ZLA C;  1P3P B;  3LZ0 D;  5B32 D;  1P3I D;  4AWL C;  3B0D B;  2Y2I A;  3AZL A;  3X1V D;  4JJN B;  3MGS D;  3TU4 A;  1P3K A;  1A7W A;  3W96 B;  5DNM C;  5B2J C;  2ZY3 A;  5E5A B;  4H9O A;  1S32 B;  3X1U C;  4CAY B;  4WZS B;  4X23 B;  3AZI C;  3B6F B;  3MGP A;  3AZK B;  5GXQ C;  5AVB A;  2FJ7 B;  4H9Q A;  3H0L C;  3B6G C;  5B40 C;  3KUY C;  1P3M D;  1P3A A;  3UTB D;  3MVD C;  3WA9 A;  3AV2 C;  5JRG A;  5F99 A;  1P3G C;  3AZL B;  3FDD A;  3VH5 T;  3LZ0 A;  3REI A;  1P3I A;  3MGR D;  3TU4 B;  1P3K B;  4H9P A;  5B0Z C;  3AFA C;  5CPJ D;  5B0Y D;  2HIO C;  4DRB A;  3X1V A;  3MGP B;  4G91 B;  2DQN C;  3AZF D;  1WWI A;  5AVB B;  4H9Q B;  4UPK A;  3LJA A;  1P3O C;  1Z2C B;  1P3F A;  2CV5 D;  1P3L D;  4ZUX A;  3WAA D;  2YFW A;  1P3A B;  3WA9 B;  3REH D;  5GT0 C;  5JRG B;  3LEL B;  5F99 B;  1P3B A;  3LZ0 B;  5B32 B;  3REI B;  1P3I B;  1P3M A;  5FUG A;  3WKJ A;  2G5I C;  4H9P B;  5AY8 A;  3WTP C;  4Z5T A;  5AV6 D;  4XZQ D;  3X1V B;  3MGR A;  3X1T D;  3AYW D;  4Z66 A;  3NQU A;  2NQB C;  4YS3 D;  5CPJ A;  1N1J A;  3LJA B;  4R8P C;  1EQZ C;  3LZ1 C;  1P3F B;  4WNN A;  4ZUX B;  5AV8 C;  3KXB D;  3W98 D;  2YFW B;  2NZD C;  4NFT A;  1P3P D;  3AZH C;  4WV4 B;  2G5H C;  1P3B B;  4H9S C;  1H3O A;  4QLC C;  1P3M B;  5BO0 A;  5KDM A;  3WAA A;  5FUG B;  3KWQ A;  4KUD A;  5B33 D;  1ULY A;  3WKJ B;  4JJN D;  3REH A;  5AY8 B;  3AZG C;  2DF4 C;  3KSY A;  4Z5T B;  1KX3 A;  3AZE C;  3MGR B;  3X1S A;  3UTA A;  5AV5 C;  2ARO C;  4Z66 B;  3MNN C;  3NQU B;  1F66 A;  5CPJ B;  3AZK D;  1N1J B;  3AV1 D;  1KX5 C;  5CPI C;  4XZQ A;  5GSU C;  2FJ7 D;  3W99 C;  4WNN B;  4KGC D;  3V9R A;  1KX4 C;  3W97 D;  3X1T A;  2BG1 A;  3AYW A;  3REJ A;  4YS3 A;  1ID3 C;  1ZLA D;  2F2A C;  1M1A C;  3KFU G;  5BS7 A;  5CP6 A;  3WAA B;  1H3O B;  4M6B A;  3A1I A;  5B2I C;  5BO0 B;  5KDM B;  3KXB A;  3AZJ C;  3KWQ B;  3AZL D;  3W98 A;  4KUD B;  3REH B;  3AZJ A;  4G92 C;  4WU8 A;  1KX3 B;  2J8P A;  5DNM D;  5B2J D;  3AZM C;  3X1S B;  2Y2G A;  5B33 A;  3UTA B;  1F66 B;  3MGP D;  1M18 A;  3C1B A;  4XZQ B;  5GXQ D;  3MGQ C;  3NQJ A;  4EO5 B;  3V9R B;  3AN2 C;  3X1T B;  3AYW B;  3REJ B;  3B0C W;  4YS3 B;  3AV1 A;  4NE6 A;  5DNN A;  3KUY D;  4WJ3 C;  3WA9 D;  2Y2O A;  5BT1 C;  5CP6 B;  4HGA B;  4KGC A;  4Z2M G;  1HQ3 C;  5JRG D;  3KXB B;  3MVD D;  3W97 A;  3AV2 D;  3W98 B;  5F99 D;  1HQ3 A;  2HUE C;  1ZLA A;  3REI D;  4E44 A;  1HTA A;  4ZBJ C;  4Z2M H;  4WU8 B;  5C3I C;  3UT9 C;  2ZY4 A;  5B0Z D;  3AFA D;  5B33 B;  1BH9 A;  1WWS A;  1M18 B;  3C1B B;  3NQJ B;  2JE5 A;  3LJA D;  2LY8 A;  5DNM A;  5B2J A;  1P3O D;  1P3F D;  1TZY C;  4ZUX D;  3AV1 B;  3X1U A;  3AZI A;  5DNN B;  5GXQ A;  3A6N C;  4KGC B;  4J8V C;  3W97 B;  3B6G A;  2ZY2 A;  5B40 A;  1P3B D;  4J8U C;  1ZLA B;  2PYO C;  3KUY A;  2JSS A;  2IO5 C;  3WKJ D;  4AWL B;  5AY8 D;  3WTP E;  3MVD A;  3AV2 A;  4Z5T D;  5GT3 C;  1P3G A;  2YFV A;  1BH9 B;  4Z66 D;  5B0Z A;  3AFA A;  5DNM B;  5B2J B;  4H9O B;  4WU9 C;  2HIO A;  4WU9 A;  4J8X C;  3AZI B;  2L5A A;  3R45 A;  5B1L C;  5GXQ B;  4J8W C;  2ZY5 A;  4E45 A;  1P3O A;  3B6G B;  5B40 B;  3VH5 A;  2XD1 A;  3KUY B;  3KWQ D;  4KUD D;  4LD9 C;  3MVD B;  5GT0 A;  3AV2 B;  1KX3 D;  1P3G B;  2YFV B;  3X1S D;  3UTA D;  3AZE D;  1F66 D;  3MGS C;  5B0Z B;  3AFA B;  2HIO B;  3WTP A;  5GSU D;  1P34 C;  3W99 D;  3R45 B;  3VH6 T;  3REJ D;  4DQY B;  1ID3 D;  2NQB A;  1P3O B;  1M1A D;  4H9R A;  4R8P A;  2UWX A;  5CP6 D;  3LZ1 A;  1U35 C;  1EQZ A;  5AV9 C;  5AV8 A;  2Y2J A;  5B2I D;  3AZJ D;  2NZD A;  2F8N K;  3AZH A;  5GT0 B;  4WU8 D;  3UTB C;  2Y2Q A;  2Y2N A;  3C1C C;  1TAF A;  4H9S A;  4QLC A;  2RVQ D;  1M18 D;  3C1B D;  3AZG A;  5B1M C;  3WTP B;  5B0Y C;  3MGQ D;  3REL C;  3AZE A;  4NE5 A;  4YM6 C;  5AV5 A;  2ARO A;  3MNN A;  3AZF C;  1KX5 A;  5DNN D; 
#chains in the Genus database with same CATH homology
 5CPI A;  4H9R B;  4R8P B;  1M19 C;  3REK C;  5GSU A;  3LZ1 B;  1EQZ B;  3W99 A;  5B31 C;  2CV5 C;  1HQ3 D;  5AV8 B;  1KX4 A;  1KU5 A;  5B31 G;  1P3L C;  1JFI A;  2NZD B;  1ID3 A;  3AZH B;  1M1A A;  1TAF B;  4QLC B;  5B2I A;  1AOI C;  3AZG B;  3AZN C;  5CPK C;  5AV6 C;  3VH5 W;  3AZE B;  3AZM A;  5AVC C;  2NQB B;  5AV5 B;  3X1U D;  2ARO B;  1T3U A;  3MNN B;  3AZI D;  3O62 C;  1KX5 B;  5CPI B;  5GSU B;  3MGQ A;  3W99 B;  2F8N G;  1B6W A;  3EG5 B;  5B24 C;  3B6G D;  5B40 D;  1KX4 B;  3AN2 A;  1JFI B;  1ID3 B;  4XUJ C;  3EPK A;  1M1A B;  2F8N H;  2PYO D;  1P3P C;  3B0D C;  3AL0 C;  5B2I B;  3AZJ B;  1P3G D;  4JJN C;  4G92 B;  2XD5 A;  3IP4 C;  3UT9 A;  3W96 C;  2HIO D;  3AZM B;  4WU9 D;  5E5A C;  1S32 C;  4J8X D;  5BNX A;  4X23 C;  3B6F C;  2W8S A;  3AZK C;  5B1L D;  3MGQ B;  2FJ7 C;  2BYM A;  3F6T A;  3AN2 B;  1TZY A;  3VH6 W;  1F1E A;  5GT0 D;  3A6N A;  4LD9 D;  1HQ3 B;  4J8V A;  2HUE B;  1BH8 A;  4J8U A;  3AZL C;  2PYO A;  4ZBJ B;  3TU4 C;  1P3K C;  5C3I B;  3UT9 B;  3WTP D;  5GT3 A;  1P34 D;  5BNX B;  3MGP C;  4G91 C;  2NQB D;  5AVB C;  4R8P D;  2BYM B;  1EQZ D;  3LZ1 D;  3X1U B;  1TZY B;  4J8X A;  1U35 D;  5AV8 D;  5AV9 D;  5B1L A;  2NZD D;  1P3A C;  4J8W A;  3A6N B;  3AZH D;  3WA9 C;  3A1K A;  4J8V B;  5JRG C;  3LEL C;  1BH8 B;  5F99 C;  4QLC D;  3LEL A;  3EPJ A;  3C1C D;  4J8U B;  2PYO B;  2Y2M A;  3LZ0 C;  5B32 C;  3REI C;  1P3I C;  1W2E A;  2IO5 B;  4LD9 A;  5B32 A;  5B32 G;  3AZG D;  1Q9C A;  2FFF B;  3H0M C;  5B1M D;  5GT3 B;  4H9N A;  3X1V C;  3REL D;  5AV5 D;  2ARO D;  3MNN D;  4YM6 D;  3MGS A;  1KX5 D;  3B0C T;  5CPI D;  3LJA C;  4WU9 B;  1M19 D;  3REK D;  1P3F C;  4J8X B;  1P34 A;  5B31 D;  1KX4 D;  4ZUX C;  5B1L B;  2BYK A;  4J8W B;  3EPL A;  1U35 A;  5AV9 A;  1P3B C;  1P3M C;  4LD9 B;  3WKJ C;  1AOI D;  5AY8 C;  3UTB A;  3AZN D;  1B67 A;  4H9N B;  4Z5T C;  3C1C A;  3P5J B;  3AZM D;  5CPK D;  3VH6 A;  3MGR C;  4KHA A;  5AVC D;  3MGS B;  4Z66 C;  5CPJ C;  3O62 D;  5B1M A;  2F8N D;  5B0Y A;  1P34 B;  2CWE A;  2Y2H A;  3REL A;  3AN2 D;  5B24 D;  4YM6 A;  2BYK B;  3AZF A;  4XUJ D;  5G49 A;  1BFM A;  2ZM5 A;  5BT1 D;  3REK A;  4NE3 A;  1U35 B;  1M19 A;  5B31 A;  3WAA C;  5AV9 B;  2CV5 A;  1P3L A;  4KUD C;  1R4V A;  3KWQ C;  3REH C;  3UTB B;  3H0R C;  3B0B A;  3UT9 D;  3C1C B;  1KX3 C;  3W96 D;  2Y2P A;  3UTA C;  4KHA B;  4CSR A;  3X1S C;  1PZR A;  5E5A D;  1AOI A;  1F66 C;  1S32 D;  5JA4 A;  4X23 D;  5B1M B;  3AZN A;  3B6F D;  4XZQ C;  5B0Y B;  5CPK A;  3REL B;  4EO5 C;  5AV6 A;  1TZY D;  5AVC A;  4YM6 B;  3X1T C;  3AYW C;  2JCH A;  3REJ C;  4YS3 C;  3AZF B;  3O62 A;  5G49 B;  2F8N A;  5BS7 C;  3A6N D;  3REK B;  1M19 B;  5B31 B;  5CP6 C;  4HGA C;  5B24 A;  4J8V D;  3EPH A;  3KXB C;  2CV5 B;  3W98 C;  1P3L B;  4J8U D;  5BNV A;  4UUZ A;  2VQR A;  4XUJ A;  1P3P A;  4WU8 C;  3TU4 D;  1P3K D;  2Y2L A;  5GT3 D;  2Y2K A;  4CSR B;  5B33 C;  1AOI B;  4DRA A;  2RVQ C;  1M18 C;  5JA4 B;  4JJN A;  3AZN B;  3C1B C;  5CPK B;  3W96 A;  5AV6 B;  5AVB D;  5AVC B;  5E5A A;  2RIQ A;  1S32 A;  3AV1 C;  3O62 B;  4CAY A;  4X23 A;  3B6F A;  2F8N B;  3AZK A;  5DNN C;  4J8W D;  1P3A D;  4KGC C;  2FJ7 A;  5B24 B;  5CHL B;  3W97 C;  5BNV B;  3LEL D;  4UUZ B;  4XUJ B;  1ZLA C;  1P3P B;  3LZ0 D;  5B32 D;  1P3I D;  4AWL C;  3B0D B;  2Y2I A;  3AZL A;  3X1V D;  4JJN B;  3MGS D;  3TU4 A;  1P3K A;  1A7W A;  3W96 B;  5DNM C;  5B2J C;  2ZY3 A;  5E5A B;  4H9O A;  1S32 B;  3X1U C;  4CAY B;  4WZS B;  4X23 B;  3AZI C;  3B6F B;  3MGP A;  3AZK B;  5GXQ C;  5AVB A;  2FJ7 B;  4H9Q A;  3H0L C;  3B6G C;  5B40 C;  3KUY C;  1P3M D;  1P3A A;  3UTB D;  3MVD C;  3WA9 A;  3AV2 C;  5JRG A;  5F99 A;  1P3G C;  3AZL B;  3FDD A;  3VH5 T;  3LZ0 A;  3REI A;  1P3I A;  3MGR D;  3TU4 B;  1P3K B;  4H9P A;  5B0Z C;  3AFA C;  5CPJ D;  5B0Y D;  2HIO C;  4DRB A;  3X1V A;  3MGP B;  4G91 B;  2DQN C;  3AZF D;  1WWI A;  5AVB B;  4H9Q B;  4UPK A;  3LJA A;  1P3O C;  1Z2C B;  1P3F A;  2CV5 D;  1P3L D;  4ZUX A;  3WAA D;  2YFW A;  1P3A B;  3WA9 B;  3REH D;  5GT0 C;  5JRG B;  3LEL B;  5F99 B;  1P3B A;  3LZ0 B;  5B32 B;  3REI B;  1P3I B;  1P3M A;  5FUG A;  3WKJ A;  2G5I C;  4H9P B;  5AY8 A;  3WTP C;  4Z5T A;  5AV6 D;  4XZQ D;  3X1V B;  3MGR A;  3X1T D;  3AYW D;  4Z66 A;  3NQU A;  2NQB C;  4YS3 D;  5CPJ A;  1N1J A;  3LJA B;  4R8P C;  1EQZ C;  3LZ1 C;  1P3F B;  4WNN A;  4ZUX B;  5AV8 C;  3KXB D;  3W98 D;  2YFW B;  2NZD C;  4NFT A;  1P3P D;  3AZH C;  4WV4 B;  2G5H C;  1P3B B;  4H9S C;  1H3O A;  4QLC C;  1P3M B;  5BO0 A;  5KDM A;  3WAA A;  5FUG B;  3KWQ A;  4KUD A;  5B33 D;  1ULY A;  3WKJ B;  4JJN D;  3REH A;  5AY8 B;  3AZG C;  2DF4 C;  3KSY A;  4Z5T B;  1KX3 A;  3AZE C;  3MGR B;  3X1S A;  3UTA A;  5AV5 C;  2ARO C;  4Z66 B;  3MNN C;  3NQU B;  1F66 A;  5CPJ B;  3AZK D;  1N1J B;  3AV1 D;  1KX5 C;  5CPI C;  4XZQ A;  5GSU C;  2FJ7 D;  3W99 C;  4WNN B;  4KGC D;  3V9R A;  1KX4 C;  3W97 D;  3X1T A;  2BG1 A;  3AYW A;  3REJ A;  4YS3 A;  1ID3 C;  1ZLA D;  2F2A C;  1M1A C;  3KFU G;  5BS7 A;  5CP6 A;  3WAA B;  1H3O B;  4M6B A;  3A1I A;  5B2I C;  5BO0 B;  5KDM B;  3KXB A;  3AZJ C;  3KWQ B;  3AZL D;  3W98 A;  4KUD B;  3REH B;  3AZJ A;  4G92 C;  4WU8 A;  1KX3 B;  2J8P A;  5DNM D;  5B2J D;  3AZM C;  3X1S B;  2Y2G A;  5B33 A;  3UTA B;  1F66 B;  3MGP D;  1M18 A;  3C1B A;  4XZQ B;  5GXQ D;  3MGQ C;  3NQJ A;  4EO5 B;  3V9R B;  3AN2 C;  3X1T B;  3AYW B;  3REJ B;  3B0C W;  4YS3 B;  3AV1 A;  4NE6 A;  5DNN A;  3KUY D;  4WJ3 C;  3WA9 D;  2Y2O A;  5BT1 C;  5CP6 B;  4HGA B;  4KGC A;  4Z2M G;  1HQ3 C;  5JRG D;  3KXB B;  3MVD D;  3W97 A;  3AV2 D;  3W98 B;  5F99 D;  1HQ3 A;  2HUE C;  1ZLA A;  3REI D;  4E44 A;  1HTA A;  4ZBJ C;  4Z2M H;  4WU8 B;  5C3I C;  3UT9 C;  2ZY4 A;  5B0Z D;  3AFA D;  5B33 B;  1BH9 A;  1WWS A;  1M18 B;  3C1B B;  3NQJ B;  2JE5 A;  3LJA D;  2LY8 A;  5DNM A;  5B2J A;  1P3O D;  1P3F D;  1TZY C;  4ZUX D;  3AV1 B;  3X1U A;  3AZI A;  5DNN B;  5GXQ A;  3A6N C;  4KGC B;  4J8V C;  3W97 B;  3B6G A;  2ZY2 A;  5B40 A;  1P3B D;  4J8U C;  1ZLA B;  2PYO C;  3KUY A;  2JSS A;  2IO5 C;  3WKJ D;  4AWL B;  5AY8 D;  3WTP E;  3MVD A;  3AV2 A;  4Z5T D;  5GT3 C;  1P3G A;  2YFV A;  1BH9 B;  4Z66 D;  5B0Z A;  3AFA A;  5DNM B;  5B2J B;  4H9O B;  4WU9 C;  2HIO A;  4WU9 A;  4J8X C;  3AZI B;  2L5A A;  3R45 A;  5B1L C;  5GXQ B;  4J8W C;  2ZY5 A;  4E45 A;  1P3O A;  3B6G B;  5B40 B;  3VH5 A;  2XD1 A;  3KUY B;  3KWQ D;  4KUD D;  4LD9 C;  3MVD B;  5GT0 A;  3AV2 B;  1KX3 D;  1P3G B;  2YFV B;  3X1S D;  3UTA D;  3AZE D;  1F66 D;  3MGS C;  5B0Z B;  3AFA B;  2HIO B;  3WTP A;  5GSU D;  1P34 C;  3W99 D;  3R45 B;  3VH6 T;  3REJ D;  4DQY B;  1ID3 D;  2NQB A;  1P3O B;  1M1A D;  4H9R A;  4R8P A;  2UWX A;  5CP6 D;  3LZ1 A;  1U35 C;  1EQZ A;  5AV9 C;  5AV8 A;  2Y2J A;  5B2I D;  3AZJ D;  2NZD A;  2F8N K;  3AZH A;  5GT0 B;  4WU8 D;  3UTB C;  2Y2Q A;  2Y2N A;  3C1C C;  1TAF A;  4H9S A;  4QLC A;  2RVQ D;  1M18 D;  3C1B D;  3AZG A;  5B1M C;  3WTP B;  5B0Y C;  3MGQ D;  3REL C;  3AZE A;  4NE5 A;  4YM6 C;  5AV5 A;  2ARO A;  3MNN A;  3AZF C;  1KX5 A;  5DNN D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...