4J8XB

X-ray structure of ncp145 with bound chlorido(eta-6-p-cymene)(n-fluorophenyl-2-pyridinecarbothioamide)ruthenium(ii)
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
82
structure length
82
Chain Sequence
VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords Histone H3.2
publication title Novel metal(II) arene 2-pyridinecarbothioamides: a rationale to orally active organometallic anticancer agents
doi rcsb
source organism Xenopus laevis
total genus 27
structure length 82
sequence length 82
chains with identical sequence F
ec nomenclature
pdb deposition date 2013-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4j8xB00
1P3PD 4H9QA 3RELD 4WU8B 4ZUXD 3AZIA 4QLCD 2YFVA 3MGQD 5B31D 5AVBB 3AZLA 4ZBJC 3AZJA 5E5AB 2BYMB 3X1TC 5CPJC 3W99D 4Z66D 3VH5T 3WTPD 4XZQB 2F8NH 3B0DC 3X1SA 5B24B 5B1LD 1TAFA 3UT9B 1KX5C 3KUYD 4G91C 5JRGC 3WAAD 3AZHA 3W96C 1KX4B 1AOID 3B6GC 4XUJB 4J8VD 1N1JA 1TZYA 3NQUA 1H3OB 3LZ0B 3W97D 4KHAA 3V9RA 3AZKC 3X1TA 2NZDB 3C1CC 5BNXA 3MGSC 2PYOB 5B32B 5AV6C 4KGCC 3UTBB 3AZID 4WU9A 5F99D 2FJ7B 3B6GA 3TU4B 1P3LC 3AZLD 1P3OC 5B40A 2CV5C 1P3FB 2F8NA 3KXBB 3MGPD 2YFWB 3AV1B 5AV5A 3MNNC 5DNNC 5AV6A 4KGCA 3NQJB 3AZNC 3AV2C 1P3IC 4R8PB 3LJAC 3VH6A 4KUDB 5GT3A 5AVCB 1P3OA 1HQ3B 3X1TD 5CPJD 4JJNB 5B1MC 5AV8B 4X23B 3MNNA 5DNNA 3AZNA 3AV2A 4UUZB 5JRGD 3UTAA 3X1VA 1F66C 4CAYB 3W96D 3B6GD 3LELB 4G92B 5GXQB 4LD9A 1KU5A 4J8WC 4EO5B 3X1UB 3AZKD 3AZEB 3O62A 3C1CD 3MGSD 4HGAC 3KWQB 5CP6C 3MGRA 5AV6D 2HIOB 4KGCD 4J8XB 2F8NK 4YM6B 1P3GA 1P3AB 5DNMA 3WA9C 1S32B 5CHLB 1P3LD 4J8WA 5B33C 3LZ1C 5B2IB 1P3OD 1EQZB 1M1AA 2CV5D 3AZFB 3R45B 3WKJC 3B0CW 5B32G 1P3BC 3MNND 3C1BA 5DNND 5CPKB 3AZND 1P3MA 5KDMB 5BO0B 3AV2D 1P3ID 1ID3B 1ZLAC 3AZGC 3WA9A 5BS7A 1P3KC 1M19B 4ZUXA 5B33A 5G49B 5B0ZB 1BH8B 3MGQA 3WKJA 1P3PB 5B0YC 3O62D 5B1MD 2AROC 3A6NC 3AFAB 3RELB 4J8UC 1ULYA 5GT0B 2IO5C 2F8NG 4Z66A 4QLCB 3AZGA 3MVDC 3WTPA 5B31B 3REKC 1F66D 3KUYA 1P3KA 3W98C 4J8WD 3VH6T 3W99B 1M1AD 4J8VA 5B0YA 4Z5TB 3W97A 5B1LB 3A6NA 1P34C 3AZMC 4J8UA 3WAAB 1WWSA 4CSRA 5CP6D 5AY8B 5B2JB 1AOIB 3REKA 5AV9B 3WA9D 1B67A 5B33D 5F99A 5AVBC 4H9OB 3WKJD 4H9QB 5E5AC 1P3BD 3AZMA 2HUEB 3AZIB 5B24C 2YFVB 3MGPA 3UT9C 3AZGD 1ZLAD 3AZLB 1P3KD 3WTPE 4AWLB 3AZJB 4XUJC 3LZ0C 5B0YD 3X1SB 1TAFB 3A6ND 2NZDC 4J8UD 3AZHB 5CPJA 2PYOC 3REIC 3MVDD 2BYKA 3REKD 3UTBC 1N1JB 1TZYB 3NQUB 1KX5A 5JRGA 4ZBJB 5BT1C 4KHAB 3V9RB 3W98D 3X1TB 3W96A 3TU4C 5BNXB 1P34D 1P3FC 5FUGA 3AZMD 3KXBC 3AZKA 5B31G 3C1CA 4H9RA 4WU9B 3B6FC 3REIA 3AV1C 3B6GB 3MGSA 1JFIA 3REHC 5B40B 4R8PC 2F8NB 5AVBD 5CPIC 4YS3C 1P3LA 5AV5B 5E5AD 1HQ3C 5AV6B 4KGCB 2CV5A 5AV8C 3B6FA 5B24D 4DRAA 1BH9A 1KX5D 5GT3B 1P3IA 1P3OB 3REHA 3LELC 4G92C 4XUJD 5GXQC 5CPIA 1KX3C 3LZ0D 3LJAA 4YS3A 4H9PA 3MNNB 4EO5C 5DNNB 3AZNB 3X1UC 3AZEC 3UTAB 3AV2B 2NZDD 3X1VB 3KWQC 5B1MA 3REID 2LY8A 2HIOC 4J8XC 3UTBD 1M18C 2NQBC 4LD9B 5GSUC 1P3AC 5BT1D 4NE6A 1F66A 3O62B 3TU4D 1KX3A 3REJC 5B2IC 1EQZC 3MGRB 3AN2C 1P3FD 3AZFC 1P3GB 3B6FD 5DNMB 3AV1D 1U35C 3B0CT 5CPKC 1M18A 1ID3C 2NQBA 5CP6A 4J8WB 5GSUA 3AYWC 3REHD 1M1AB 1R4VA 4R8PD 4DRBA 5CPID 3REJA 4HGAB 3LJAD 4YS3D 3C1BB 3AN2A 1HQ3D 3LZ1A 1P3MB 5AV8D 3AFAC 1U35A 3WA9B 4WNNA 5GT0C 1P3BA 4ZUXB 4WV4B 5B33B 3AYWA 1ZLAA 3MGQB 3LELD 3WKJB 5GXQD 5JA4A 1KX3D 3W99C 3X1UD 3AZED 4Z5TC 4Z66B 5BNVA 3AZGB 3WTPB 3KWQD 2AROA 5B2JC 5AY8C 3KUYB 2HIOD 1P3KB 4J8XD 1M18D 2NQBD 5GSUD 1P3AD 5AV9C 3MVDA 4J8VB 5B0YB 4H9NA 4WU8C 3A6NB 3REJD 3W97B 3W98A 5B2ID 4J8UB 1EQZD 4CSRB 3AN2D 3LZ1D 3AZFD 3B0BA 3REKB 5C3IB 1Q9CA 1U35D 1P34A 5CPKD 1ID3D 3AYWD 5F99B 4XZQC 1B6WA 3AZJC 4WU8A 3AZMB 1KX4C 5AVBA 3X1SC 3MGPB 3AFAD 3KSYA 5E5AA 2AROD 3AZHC 5GT0D 2BYMA 4H9SC 2JSSA 4XZQA 5B24A 5B32C 3UT9A 1TZYC 1KX4A 3VH5W 2FJ7C 4XUJA 5CPJB 1H3OA 4Z5TD 3LZ0A 2BYKB 3B0DB 1A7WA 5B2JD 1KX5B 5AY8D 2NZDA 4G91B 5JRGB 4H9SA 4WU9C 4Z2MH 2PYOA 3W96B 5B32A 5AV9D 3UTBA 4WU8D 5B40C 5FUGB 2FJ7A 3AZKB 3C1CB 3TU4A 4H9RB 3REIB 5AV5C 3MGSB 4KUDC 5AVCC 1JFIB 1P3FA 3KXBA 4JJNC 4X23C 4XZQD 2YFWA 3AV1A 3UT9D 3NQJA 5GT3C 3AZJD 1P3LB 1KX4D 2CV5B 4R8PA 3B6FB 2RVQC 3X1SD 4KUDA 5AVCA 1BH9B 4NFTA 3UTAC 1HQ3A 3AZHD 3X1VC 1F1EA 1P3IB 4JJNA 4NE3A 5AV8A 3REHB 4X23A 2PYOD 5B32D 1HTAA 1TZYD 5CPIB 4LD9C 4UUZA 3LJAB 4YS3B 4H9PB 4YM6C 4CAYA 2FJ7D 3O62C 3LELA 5GXQA 1S32C 5B1MB 3MGRC 3X1UA 3AZEA 1P3GC 4WU9D 5DNMC 3KXBD 1F66B 3KWQA 1KX3B 2HIOA 1WWIA 4J8XA 4YM6A 1P3AA 5B40D 1M1AC 2F8ND 1S32A 1M19C 5AV5D 3C1BC 4KUDD 5AVCD 3VH5A 5B2IA 1P3MC 5CP6B 5B0ZC 1M18B 1EQZA 2NQBB 4E45A 3AZFA 5GSUB 3R45A 1P3PC 4JJND 4X23D 3RELC 5BS7C 5CPKA 4ZUXC 3REJB 1ID3A 5KDMA 5GT3D 5BO0A 4QLCC 3AN2B 3MGQC 3LZ1B 5B31C 2RVQD 1M19A 1U35B 4WNNB 1P3BB 5G49A 5B0ZA 3UTAD 1BH8A 4Z66C 3X1VD 3AYWB 3WTPC 1P3PA 1ZLAB 5B1LC 4E44A 3AFAA 3RELA 3KUYC 3WAAC 5JA4B 5GT0A 4LD9D 4QLCA 1AOIC 4YM6D 4M6BA 5B31A 4J8VC 5BNVB 3W97C 1S32D 2AROB 2CWEA 3MGRD 3W99A 2IO5B 5C3IC 4WZSB 1P3GD 4Z5TA 5DNMD 5B1LA 3MVDB 3WAAA 5B2JA 5AY8A 4H9NB 2HUEC 3VH6W 3AZIC 3W98B 4Z2MG 5F99C 1AOIA 5AV9A 1BFMA 3AZLC 4NE5A 4AWLC 1M19D 1P34B 3C1BD 1P3MD 5B0ZD 2L5AA 4H9OA 3MGPC
chains in the Genus database with same CATH superfamily
1P3PD 4H9QA 3RELD 2ZY5A 4WU8B 4ZUXD 3AZIA 2JCHA 4QLCD 2YFVA 3MGQD 5B31D 5AVBB 3AZLA 4ZBJC 3AZJA 5E5AB 2BYMB 3X1TC 5CPJC 3W99D 1T3UA 4Z66D 3VH5T 3WTPD 4XZQB 2F8NH 3B0DC 3X1SA 5B24B 5B1LD 1TAFA 3UT9B 1KX5C 2Y2PA 3KUYD 4G91C 4UPKA 5JRGC 3WAAD 3AZHA 3W96C 1KX4B 1AOID 3B6GC 4XUJB 4J8VD 1N1JA 1TZYA 1H3OB 3NQUA 3LZ0B 3W97D 4KHAA 3V9RA 3AZKC 2FFFB 3X1TA 2NZDB 2Y2HA 3C1CC 5BNXA 3MGSC 2PYOB 5B32B 5AV6C 4KGCC 3UTBB 3AZID 1Z2CB 5F99D 4WU9A 2FJ7B 3B6GA 2Y2MA 3TU4B 1P3LC 3AZLD 1P3OC 5B40A 2CV5C 1P3FB 2F8NA 3KXBB 3MGPD 2YFWB 3AV1B 5AV5A 3MNNC 5DNNC 5AV6A 4KGCA 3NQJB 3AZNC 3AV2C 1P3IC 2Y2QA 4R8PB 3LJAC 3VH6A 4KUDB 5GT3A 5AVCB 1P3OA 1HQ3B 3X1TD 5CPJD 2Y2NA 4JJNB 5B1MC 5AV8B 4X23B 3MNNA 5DNNA 3AZNA 3AV2A 4UUZB 5JRGD 3UTAA 3X1VA 1F66C 4CAYB 3W96D 3B6GD 3LELB 4G92B 5GXQB 4LD9A 1KU5A 4J8WC 4EO5B 3X1UB 3AZKD 3AZEB 3O62A 3C1CD 3MGSD 4HGAC 3KWQB 5CP6C 3MGRA 5AV6D 2HIOB 4KGCD 4J8XB 2F8NK 4YM6B 1P3GA 1P3AB 5DNMA 3WA9C 1S32B 3EPKA 5CHLB 1P3LD 4J8WA 5B33C 3LZ1C 5B2IB 1P3OD 1EQZB 1M1AA 2CV5D 3AZFB 3R45B 3WKJC 3B0CW 5B32G 1P3BC 3MNND 3C1BA 5DNND 5CPKB 3AZND 1P3MA 5KDMB 5BO0B 3AV2D 1P3ID 1ID3B 1ZLAC 3AZGC 3WA9A 2BG1A 5BS7A 1P3KC 1M19B 4ZUXA 5B33A 5G49B 5B0ZB 1BH8B 3MGQA 3WKJA 2VQRA 5B0YC 3O62D 1P3PB 5B1MD 2AROC 3A6NC 3AFAB 3RELB 4J8UC 1ULYA 5GT0B 2IO5C 2F8NG 4Z66A 4QLCB 3AZGA 3MVDC 3WTPA 2DF4C 5B31B 3REKC 1F66D 3KUYA 1P3KA 3W98C 4J8WD 3VH6T 3W99B 1M1AD 4J8VA 5B0YA 4Z5TB 3W97A 5B1LB 3A6NA 1P34C 3AZMC 4J8UA 3WAAB 1WWSA 4CSRA 5CP6D 5AY8B 5B2JB 1AOIB 3REKA 2ZY2A 5AV9B 3WA9D 3EPLA 1B67A 5B33D 5F99A 5AVBC 2G5IC 4H9OB 3WKJD 4H9QB 5E5AC 1P3BD 3AZMA 2HUEB 3AZIB 5B24C 2YFVB 3MGPA 3UT9C 3AZGD 1ZLAD 3AZLB 1P3KD 3WTPE 4AWLB 4DQYB 3AZJB 4XUJC 3EPHA 3LZ0C 5B0YD 3X1SB 1TAFB 3A6ND 3F6TA 2NZDC 4J8UD 3AZHB 3FDDA 5CPJA 2ZM5A 2PYOC 3REIC 3MVDD 2BYKA 3REKD 3UTBC 1N1JB 1TZYB 3NQUB 1KX5A 5JRGA 4ZBJB 5BT1C 4KHAB 3V9RB 3W98D 3X1TB 3W96A 3TU4C 5BNXB 1P34D 1P3FC 5FUGA 3AZMD 3KXBC 3AZKA 5B31G 3C1CA 4H9RA 4WU9B 3B6FC 3REIA 3AV1C 3B6GB 3MGSA 2Y2JA 1JFIA 3REHC 5B40B 4R8PC 2F8NB 3KFUG 5AVBD 5CPIC 4YS3C 1P3LA 5E5AD 5AV5B 1HQ3C 2Y2GA 5AV6B 4KGCB 2CV5A 5AV8C 3B6FA 5B24D 4DRAA 1BH9A 1KX5D 5GT3B 1P3IA 1P3OB 3REHA 3LELC 4G92C 4XUJD 5GXQC 5CPIA 1KX3C 3LZ0D 3LJAA 1W2EA 4H9PA 4YS3A 3MNNB 4EO5C 5DNNB 3AZNB 3X1UC 3AZEC 3UTAB 3AV2B 2NZDD 2DQNC 3X1VB 3KWQC 5B1MA 3REID 2LY8A 2HIOC 4J8XC 3UTBD 1M18C 2NQBC 4LD9B 5GSUC 1P3AC 5BT1D 4NE6A 1F66A 3O62B 3TU4D 3H0RC 1KX3A 3REJC 5B2IC 1EQZC 3MGRB 3AN2C 1P3FD 3AZFC 3AL0C 1P3GB 3B6FD 5DNMB 3AV1D 1U35C 3A1IA 3B0CT 5CPKC 1M18A 1ID3C 2NQBA 5CP6A 4J8WB 2UWXA 5GSUA 3AYWC 3REHD 1M1AB 1R4VA 4R8PD 4DRBA 5CPID 3REJA 4HGAB 3LJAD 4YS3D 3C1BB 3AN2A 1HQ3D 2ZY4A 3LZ1A 1P3MB 5AV8D 3AFAC 2ZY3A 1U35A 3WA9B 4WNNA 5GT0C 1P3BA 4ZUXB 4WV4B 5B33B 3AYWA 1ZLAA 3MGQB 3LELD 3H0LC 3WKJB 5GXQD 5JA4A 1KX3D 3W99C 3X1UD 2W8SA 3AZED 4Z5TC 4Z66B 5BNVA 3AZGB 3IP4C 3WTPB 3KWQD 2AROA 5B2JC 5AY8C 3KUYB 2HIOD 1P3KB 4J8XD 1M18D 2NQBD 5GSUD 1P3AD 2Y2KA 5AV9C 3P5JB 3MVDA 4J8VB 5B0YB 4H9NA 4WU8C 3A6NB 3REJD 3W97B 3W98A 2XD1A 3A1KA 5B2ID 4J8UB 1EQZD 4CSRB 3AN2D 3LZ1D 3AZFD 3B0BA 3REKB 5C3IB 1Q9CA 1U35D 1PZRA 1P34A 5CPKD 1ID3D 3AYWD 5F99B 4XZQC 1B6WA 2Y2OA 3AZJC 2RIQA 4WU8A 3AZMB 1KX4C 2F2AC 5AVBA 3X1SC 3MGPB 3AFAD 3KSYA 5E5AA 2AROD 3H0MC 5GT0D 2BYMA 3AZHC 4H9SC 2JSSA 4XZQA 5B24A 5B32C 3UT9A 1TZYC 1KX4A 3VH5W 2FJ7C 4XUJA 5CPJB 2Y2LA 1H3OA 4Z5TD 3LZ0A 2BYKB 3B0DB 1A7WA 5B2JD 1KX5B 5AY8D 2NZDA 4G91B 5JRGB 4H9SA 4WU9C 4Z2MH 2PYOA 3W96B 5B32A 5AV9D 3UTBA 4WU8D 5B40C 5FUGB 2FJ7A 3AZKB 3C1CB 3TU4A 4H9RB 3REIB 5AV5C 3MGSB 4KUDC 5AVCC 1JFIB 1P3FA 3KXBA 4JJNC 4X23C 4XZQD 2YFWA 3AV1A 3UT9D 3NQJA 5GT3C 3AZJD 1P3LB 1KX4D 2CV5B 4R8PA 3B6FB 2RVQC 3X1SD 4KUDA 5AVCA 1BH9B 4NFTA 3UTAC 1HQ3A 3AZHD 3X1VC 1F1EA 1P3IB 4JJNA 4NE3A 5AV8A 3REHB 4X23A 2PYOD 5B32D 1HTAA 1TZYD 5CPIB 4LD9C 4UUZA 3LJAB 4YS3B 4H9PB 4YM6C 4CAYA 2FJ7D 3O62C 3LELA 5GXQA 1S32C 5B1MB 3MGRC 3X1UA 3AZEA 1P3GC 4WU9D 5DNMC 3KXBD 1F66B 3KWQA 1KX3B 2HIOA 1WWIA 4J8XA 4YM6A 1P3AA 5B40D 1M1AC 2F8ND 1S32A 1M19C 5AV5D 3C1BC 2G5HC 4KUDD 5AVCD 3VH5A 5B2IA 1P3MC 5CP6B 5B0ZC 1M18B 1EQZA 2NQBB 4E45A 3AZFA 5GSUB 3R45A 4WJ3C 1P3PC 4JJND 4X23D 3RELC 5BS7C 3EG5B 5CPKA 4ZUXC 3REJB 1ID3A 5KDMA 5GT3D 5BO0A 4QLCC 3AN2B 3MGQC 3LZ1B 5B31C 2RVQD 2JE5A 1M19A 1U35B 4WNNB 1P3BB 5G49A 5B0ZA 3UTAD 1BH8A 4Z66C 3X1VD 3AYWB 3WTPC 1P3PA 1ZLAB 5B1LC 4E44A 3AFAA 3RELA 2XD5A 3KUYC 3WAAC 5JA4B 5GT0A 4LD9D 4QLCA 1AOIC 4YM6D 4M6BA 5B31A 4J8VC 5BNVB 3W97C 1S32D 2AROB 2CWEA 3MGRD 3W99A 2IO5B 5C3IC 4WZSB 3EPJA 1P3GD 4Z5TA 5DNMD 5B1LA 3MVDB 3WAAA 5B2JA 5AY8A 4H9NB 2HUEC 3VH6W 3AZIC 3W98B 4Z2MG 5F99C 1AOIA 2J8PA 5AV9A 2Y2IA 1BFMA 3AZLC 4NE5A 4AWLC 1M19D 1P34B 3C1BD 1P3MD 5B0ZD 2L5AA 4H9OA 3MGPC
chains in the Genus database with same CATH topology
1P3PD 4H9QA 3RELD 2ZY5A 4WU8B 4ZUXD 3AZIA 2JCHA 4QLCD 2YFVA 3MGQD 5B31D 5AVBB 3AZLA 4ZBJC 3AZJA 5E5AB 2BYMB 3X1TC 5CPJC 3W99D 1T3UA 4Z66D 3VH5T 3WTPD 4XZQB 2F8NH 3B0DC 3X1SA 5B24B 5B1LD 1TAFA 3UT9B 1KX5C 2Y2PA 3KUYD 4G91C 4UPKA 5JRGC 3WAAD 3AZHA 3W96C 1KX4B 1AOID 3B6GC 4XUJB 4J8VD 1N1JA 1TZYA 1H3OB 3NQUA 3LZ0B 3W97D 4KHAA 3V9RA 3AZKC 2FFFB 3X1TA 2NZDB 2Y2HA 3C1CC 5BNXA 3MGSC 2PYOB 5B32B 5AV6C 4KGCC 3UTBB 3AZID 1Z2CB 5F99D 4WU9A 2FJ7B 3B6GA 2Y2MA 3TU4B 1P3LC 3AZLD 1P3OC 5B40A 2CV5C 1P3FB 2F8NA 3KXBB 3MGPD 2YFWB 3AV1B 5AV5A 3MNNC 5DNNC 5AV6A 4KGCA 3NQJB 3AZNC 3AV2C 1P3IC 2Y2QA 4R8PB 3LJAC 3VH6A 4KUDB 5GT3A 5AVCB 1P3OA 1HQ3B 3X1TD 5CPJD 2Y2NA 4JJNB 5B1MC 5AV8B 4X23B 3MNNA 5DNNA 3AZNA 3AV2A 4UUZB 5JRGD 3UTAA 3X1VA 1F66C 4CAYB 3W96D 3B6GD 3LELB 4G92B 5GXQB 4LD9A 1KU5A 4J8WC 4EO5B 3X1UB 3AZKD 3AZEB 3O62A 3C1CD 3MGSD 4HGAC 3KWQB 5CP6C 3MGRA 5AV6D 2HIOB 4KGCD 4J8XB 2F8NK 4YM6B 1P3GA 1P3AB 5DNMA 3WA9C 1S32B 3EPKA 5CHLB 1P3LD 4J8WA 5B33C 3LZ1C 5B2IB 1P3OD 1EQZB 1M1AA 2CV5D 3AZFB 3R45B 3WKJC 3B0CW 5B32G 1P3BC 3MNND 3C1BA 5DNND 5CPKB 3AZND 1P3MA 5KDMB 5BO0B 3AV2D 1P3ID 1ID3B 1ZLAC 3AZGC 3WA9A 2BG1A 5BS7A 1P3KC 1M19B 4ZUXA 5B33A 5G49B 5B0ZB 1BH8B 3MGQA 3WKJA 2VQRA 5B0YC 3O62D 1P3PB 5B1MD 2AROC 3A6NC 3AFAB 3RELB 4J8UC 1ULYA 5GT0B 2IO5C 2F8NG 4Z66A 4QLCB 3AZGA 3MVDC 3WTPA 2DF4C 5B31B 3REKC 1F66D 3KUYA 1P3KA 3W98C 4J8WD 3VH6T 3W99B 1M1AD 4J8VA 5B0YA 4Z5TB 3W97A 5B1LB 3A6NA 1P34C 3AZMC 4J8UA 3WAAB 1WWSA 4CSRA 5CP6D 5AY8B 5B2JB 1AOIB 3REKA 2ZY2A 5AV9B 3WA9D 3EPLA 1B67A 5B33D 5F99A 5AVBC 2G5IC 4H9OB 3WKJD 4H9QB 5E5AC 1P3BD 3AZMA 2HUEB 3AZIB 5B24C 2YFVB 3MGPA 3UT9C 3AZGD 1ZLAD 3AZLB 1P3KD 3WTPE 4AWLB 4DQYB 3AZJB 4XUJC 3EPHA 3LZ0C 5B0YD 3X1SB 1TAFB 3A6ND 3F6TA 2NZDC 4J8UD 3AZHB 3FDDA 5CPJA 2ZM5A 2PYOC 3REIC 3MVDD 2BYKA 3REKD 3UTBC 1N1JB 1TZYB 3NQUB 1KX5A 5JRGA 4ZBJB 5BT1C 4KHAB 3V9RB 3W98D 3X1TB 3W96A 3TU4C 5BNXB 1P34D 1P3FC 5FUGA 3AZMD 3KXBC 3AZKA 5B31G 3C1CA 4H9RA 4WU9B 3B6FC 3REIA 3AV1C 3B6GB 3MGSA 2Y2JA 1JFIA 3REHC 5B40B 4R8PC 2F8NB 3KFUG 5AVBD 5CPIC 4YS3C 1P3LA 5E5AD 5AV5B 1HQ3C 2Y2GA 5AV6B 4KGCB 2CV5A 5AV8C 3B6FA 5B24D 4DRAA 1BH9A 1KX5D 5GT3B 1P3IA 1P3OB 3REHA 3LELC 4G92C 4XUJD 5GXQC 5CPIA 1KX3C 3LZ0D 3LJAA 1W2EA 4H9PA 4YS3A 3MNNB 4EO5C 5DNNB 3AZNB 3X1UC 3AZEC 3UTAB 3AV2B 2NZDD 2DQNC 3X1VB 3KWQC 5B1MA 3REID 2LY8A 2HIOC 4J8XC 3UTBD 1M18C 2NQBC 4LD9B 5GSUC 1P3AC 5BT1D 4NE6A 1F66A 3O62B 3TU4D 3H0RC 1KX3A 3REJC 5B2IC 1EQZC 3MGRB 3AN2C 1P3FD 3AZFC 3AL0C 1P3GB 3B6FD 5DNMB 3AV1D 1U35C 3A1IA 3B0CT 5CPKC 1M18A 1ID3C 2NQBA 5CP6A 4J8WB 2UWXA 5GSUA 3AYWC 3REHD 1M1AB 1R4VA 4R8PD 4DRBA 5CPID 3REJA 4HGAB 3LJAD 4YS3D 3C1BB 3AN2A 1HQ3D 2ZY4A 3LZ1A 1P3MB 5AV8D 3AFAC 2ZY3A 1U35A 3WA9B 4WNNA 5GT0C 1P3BA 4ZUXB 4WV4B 5B33B 3AYWA 1ZLAA 3MGQB 3LELD 3H0LC 3WKJB 5GXQD 5JA4A 1KX3D 3W99C 3X1UD 2W8SA 3AZED 4Z5TC 4Z66B 5BNVA 3AZGB 3IP4C 3WTPB 3KWQD 2AROA 5B2JC 5AY8C 3KUYB 2HIOD 1P3KB 4J8XD 1M18D 2NQBD 5GSUD 1P3AD 2Y2KA 5AV9C 3P5JB 3MVDA 4J8VB 5B0YB 4H9NA 4WU8C 3A6NB 3REJD 3W97B 3W98A 2XD1A 3A1KA 5B2ID 4J8UB 1EQZD 4CSRB 3AN2D 3LZ1D 3AZFD 3B0BA 3REKB 5C3IB 1Q9CA 1U35D 1PZRA 1P34A 5CPKD 1ID3D 3AYWD 5F99B 4XZQC 1B6WA 2Y2OA 3AZJC 2RIQA 4WU8A 3AZMB 1KX4C 2F2AC 5AVBA 3X1SC 3MGPB 3AFAD 3KSYA 5E5AA 2AROD 3H0MC 5GT0D 2BYMA 3AZHC 4H9SC 2JSSA 4XZQA 5B24A 5B32C 3UT9A 1TZYC 1KX4A 3VH5W 2FJ7C 4XUJA 5CPJB 2Y2LA 1H3OA 4Z5TD 3LZ0A 2BYKB 3B0DB 1A7WA 5B2JD 1KX5B 5AY8D 2NZDA 4G91B 5JRGB 4H9SA 4WU9C 4Z2MH 2PYOA 3W96B 5B32A 5AV9D 3UTBA 4WU8D 5B40C 5FUGB 2FJ7A 3AZKB 3C1CB 3TU4A 4H9RB 3REIB 5AV5C 3MGSB 4KUDC 5AVCC 1JFIB 1P3FA 3KXBA 4JJNC 4X23C 4XZQD 2YFWA 3AV1A 3UT9D 3NQJA 5GT3C 3AZJD 1P3LB 1KX4D 2CV5B 4R8PA 3B6FB 2RVQC 3X1SD 4KUDA 5AVCA 1BH9B 4NFTA 3UTAC 1HQ3A 3AZHD 3X1VC 1F1EA 1P3IB 4JJNA 4NE3A 5AV8A 3REHB 4X23A 2PYOD 5B32D 1HTAA 1TZYD 5CPIB 4LD9C 4UUZA 3LJAB 4YS3B 4H9PB 4YM6C 4CAYA 2FJ7D 3O62C 3LELA 5GXQA 1S32C 5B1MB 3MGRC 3X1UA 3AZEA 1P3GC 4WU9D 5DNMC 3KXBD 1F66B 3KWQA 1KX3B 2HIOA 1WWIA 4J8XA 4YM6A 1P3AA 5B40D 1M1AC 2F8ND 1S32A 1M19C 5AV5D 3C1BC 2G5HC 4KUDD 5AVCD 3VH5A 5B2IA 1P3MC 5CP6B 5B0ZC 1M18B 1EQZA 2NQBB 4E45A 3AZFA 5GSUB 3R45A 4WJ3C 1P3PC 4JJND 4X23D 3RELC 5BS7C 3EG5B 5CPKA 4ZUXC 3REJB 1ID3A 5KDMA 5GT3D 5BO0A 4QLCC 3AN2B 3MGQC 3LZ1B 5B31C 2RVQD 2JE5A 1M19A 1U35B 4WNNB 1P3BB 5G49A 5B0ZA 3UTAD 1BH8A 4Z66C 3X1VD 3AYWB 3WTPC 1P3PA 1ZLAB 5B1LC 4E44A 3AFAA 3RELA 2XD5A 3KUYC 3WAAC 5JA4B 5GT0A 4LD9D 4QLCA 1AOIC 4YM6D 4M6BA 5B31A 4J8VC 5BNVB 3W97C 1S32D 2AROB 2CWEA 3MGRD 3W99A 2IO5B 5C3IC 4WZSB 3EPJA 1P3GD 4Z5TA 5DNMD 5B1LA 3MVDB 3WAAA 5B2JA 5AY8A 4H9NB 2HUEC 3VH6W 3AZIC 3W98B 4Z2MG 5F99C 1AOIA 2J8PA 5AV9A 2Y2IA 1BFMA 3AZLC 4NE5A 4AWLC 1M19D 1P34B 3C1BD 1P3MD 5B0ZD 2L5AA 4H9OA 3MGPC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1P3P D;  4H9Q A;  3REL D;  4WU8 B;  4ZUX D;  3AZI A;  4QLC D;  2YFV A;  3MGQ D;  5B31 D;  5AVB B;  3AZL A;  4ZBJ C;  3AZJ A;  5E5A B;  2BYM B;  3X1T C;  5CPJ C;  3W99 D;  4Z66 D;  3VH5 T;  3WTP D;  4XZQ B;  2F8N H;  3B0D C;  3X1S A;  5B24 B;  5B1L D;  1TAF A;  3UT9 B;  1KX5 C;  3KUY D;  4G91 C;  5JRG C;  3WAA D;  3AZH A;  3W96 C;  1KX4 B;  1AOI D;  3B6G C;  4XUJ B;  4J8V D;  1N1J A;  1TZY A;  3NQU A;  1H3O B;  3LZ0 B;  3W97 D;  4KHA A;  3V9R A;  3AZK C;  3X1T A;  2NZD B;  3C1C C;  5BNX A;  3MGS C;  2PYO B;  5B32 B;  5AV6 C;  4KGC C;  3UTB B;  3AZI D;  4WU9 A;  5F99 D;  2FJ7 B;  3B6G A;  3TU4 B;  1P3L C;  3AZL D;  1P3O C;  5B40 A;  2CV5 C;  1P3F B;  2F8N A;  3KXB B;  3MGP D;  2YFW B;  3AV1 B;  5AV5 A;  3MNN C;  5DNN C;  5AV6 A;  4KGC A;  3NQJ B;  3AZN C;  3AV2 C;  1P3I C;  4R8P B;  3LJA C;  3VH6 A;  4KUD B;  5GT3 A;  5AVC B;  1P3O A;  1HQ3 B;  3X1T D;  5CPJ D;  4JJN B;  5B1M C;  5AV8 B;  4X23 B;  3MNN A;  5DNN A;  3AZN A;  3AV2 A;  4UUZ B;  5JRG D;  3UTA A;  3X1V A;  1F66 C;  4CAY B;  3W96 D;  3B6G D;  3LEL B;  4G92 B;  5GXQ B;  4LD9 A;  1KU5 A;  4J8W C;  4EO5 B;  3X1U B;  3AZK D;  3AZE B;  3O62 A;  3C1C D;  3MGS D;  4HGA C;  3KWQ B;  5CP6 C;  3MGR A;  5AV6 D;  2HIO B;  4KGC D;  4J8X B;  2F8N K;  4YM6 B;  1P3G A;  1P3A B;  5DNM A;  3WA9 C;  1S32 B;  5CHL B;  1P3L D;  4J8W A;  5B33 C;  3LZ1 C;  5B2I B;  1P3O D;  1EQZ B;  1M1A A;  2CV5 D;  3AZF B;  3R45 B;  3WKJ C;  3B0C W;  5B32 G;  1P3B C;  3MNN D;  3C1B A;  5DNN D;  5CPK B;  3AZN D;  1P3M A;  5KDM B;  5BO0 B;  3AV2 D;  1P3I D;  1ID3 B;  1ZLA C;  3AZG C;  3WA9 A;  5BS7 A;  1P3K C;  1M19 B;  4ZUX A;  5B33 A;  5G49 B;  5B0Z B;  1BH8 B;  3MGQ A;  3WKJ A;  1P3P B;  5B0Y C;  3O62 D;  5B1M D;  2ARO C;  3A6N C;  3AFA B;  3REL B;  4J8U C;  1ULY A;  5GT0 B;  2IO5 C;  2F8N G;  4Z66 A;  4QLC B;  3AZG A;  3MVD C;  3WTP A;  5B31 B;  3REK C;  1F66 D;  3KUY A;  1P3K A;  3W98 C;  4J8W D;  3VH6 T;  3W99 B;  1M1A D;  4J8V A;  5B0Y A;  4Z5T B;  3W97 A;  5B1L B;  3A6N A;  1P34 C;  3AZM C;  4J8U A;  3WAA B;  1WWS A;  4CSR A;  5CP6 D;  5AY8 B;  5B2J B;  1AOI B;  3REK A;  5AV9 B;  3WA9 D;  1B67 A;  5B33 D;  5F99 A;  5AVB C;  4H9O B;  3WKJ D;  4H9Q B;  5E5A C;  1P3B D;  3AZM A;  2HUE B;  3AZI B;  5B24 C;  2YFV B;  3MGP A;  3UT9 C;  3AZG D;  1ZLA D;  3AZL B;  1P3K D;  3WTP E;  4AWL B;  3AZJ B;  4XUJ C;  3LZ0 C;  5B0Y D;  3X1S B;  1TAF B;  3A6N D;  2NZD C;  4J8U D;  3AZH B;  5CPJ A;  2PYO C;  3REI C;  3MVD D;  2BYK A;  3REK D;  3UTB C;  1N1J B;  1TZY B;  3NQU B;  1KX5 A;  5JRG A;  4ZBJ B;  5BT1 C;  4KHA B;  3V9R B;  3W98 D;  3X1T B;  3W96 A;  3TU4 C;  5BNX B;  1P34 D;  1P3F C;  5FUG A;  3AZM D;  3KXB C;  3AZK A;  5B31 G;  3C1C A;  4H9R A;  4WU9 B;  3B6F C;  3REI A;  3AV1 C;  3B6G B;  3MGS A;  1JFI A;  3REH C;  5B40 B;  4R8P C;  2F8N B;  5AVB D;  5CPI C;  4YS3 C;  1P3L A;  5AV5 B;  5E5A D;  1HQ3 C;  5AV6 B;  4KGC B;  2CV5 A;  5AV8 C;  3B6F A;  5B24 D;  4DRA A;  1BH9 A;  1KX5 D;  5GT3 B;  1P3I A;  1P3O B;  3REH A;  3LEL C;  4G92 C;  4XUJ D;  5GXQ C;  5CPI A;  1KX3 C;  3LZ0 D;  3LJA A;  4YS3 A;  4H9P A;  3MNN B;  4EO5 C;  5DNN B;  3AZN B;  3X1U C;  3AZE C;  3UTA B;  3AV2 B;  2NZD D;  3X1V B;  3KWQ C;  5B1M A;  3REI D;  2LY8 A;  2HIO C;  4J8X C;  3UTB D;  1M18 C;  2NQB C;  4LD9 B;  5GSU C;  1P3A C;  5BT1 D;  4NE6 A;  1F66 A;  3O62 B;  3TU4 D;  1KX3 A;  3REJ C;  5B2I C;  1EQZ C;  3MGR B;  3AN2 C;  1P3F D;  3AZF C;  1P3G B;  3B6F D;  5DNM B;  3AV1 D;  1U35 C;  3B0C T;  5CPK C;  1M18 A;  1ID3 C;  2NQB A;  5CP6 A;  4J8W B;  5GSU A;  3AYW C;  3REH D;  1M1A B;  1R4V A;  4R8P D;  4DRB A;  5CPI D;  3REJ A;  4HGA B;  3LJA D;  4YS3 D;  3C1B B;  3AN2 A;  1HQ3 D;  3LZ1 A;  1P3M B;  5AV8 D;  3AFA C;  1U35 A;  3WA9 B;  4WNN A;  5GT0 C;  1P3B A;  4ZUX B;  4WV4 B;  5B33 B;  3AYW A;  1ZLA A;  3MGQ B;  3LEL D;  3WKJ B;  5GXQ D;  5JA4 A;  1KX3 D;  3W99 C;  3X1U D;  3AZE D;  4Z5T C;  4Z66 B;  5BNV A;  3AZG B;  3WTP B;  3KWQ D;  2ARO A;  5B2J C;  5AY8 C;  3KUY B;  2HIO D;  1P3K B;  4J8X D;  1M18 D;  2NQB D;  5GSU D;  1P3A D;  5AV9 C;  3MVD A;  4J8V B;  5B0Y B;  4H9N A;  4WU8 C;  3A6N B;  3REJ D;  3W97 B;  3W98 A;  5B2I D;  4J8U B;  1EQZ D;  4CSR B;  3AN2 D;  3LZ1 D;  3AZF D;  3B0B A;  3REK B;  5C3I B;  1Q9C A;  1U35 D;  1P34 A;  5CPK D;  1ID3 D;  3AYW D;  5F99 B;  4XZQ C;  1B6W A;  3AZJ C;  4WU8 A;  3AZM B;  1KX4 C;  5AVB A;  3X1S C;  3MGP B;  3AFA D;  3KSY A;  5E5A A;  2ARO D;  3AZH C;  5GT0 D;  2BYM A;  4H9S C;  2JSS A;  4XZQ A;  5B24 A;  5B32 C;  3UT9 A;  1TZY C;  1KX4 A;  3VH5 W;  2FJ7 C;  4XUJ A;  5CPJ B;  1H3O A;  4Z5T D;  3LZ0 A;  2BYK B;  3B0D B;  1A7W A;  5B2J D;  1KX5 B;  5AY8 D;  2NZD A;  4G91 B;  5JRG B;  4H9S A;  4WU9 C;  4Z2M H;  2PYO A;  3W96 B;  5B32 A;  5AV9 D;  3UTB A;  4WU8 D;  5B40 C;  5FUG B;  2FJ7 A;  3AZK B;  3C1C B;  3TU4 A;  4H9R B;  3REI B;  5AV5 C;  3MGS B;  4KUD C;  5AVC C;  1JFI B;  1P3F A;  3KXB A;  4JJN C;  4X23 C;  4XZQ D;  2YFW A;  3AV1 A;  3UT9 D;  3NQJ A;  5GT3 C;  3AZJ D;  1P3L B;  1KX4 D;  2CV5 B;  4R8P A;  3B6F B;  2RVQ C;  3X1S D;  4KUD A;  5AVC A;  1BH9 B;  4NFT A;  3UTA C;  1HQ3 A;  3AZH D;  3X1V C;  1F1E A;  1P3I B;  4JJN A;  4NE3 A;  5AV8 A;  3REH B;  4X23 A;  2PYO D;  5B32 D;  1HTA A;  1TZY D;  5CPI B;  4LD9 C;  4UUZ A;  3LJA B;  4YS3 B;  4H9P B;  4YM6 C;  4CAY A;  2FJ7 D;  3O62 C;  3LEL A;  5GXQ A;  1S32 C;  5B1M B;  3MGR C;  3X1U A;  3AZE A;  1P3G C;  4WU9 D;  5DNM C;  3KXB D;  1F66 B;  3KWQ A;  1KX3 B;  2HIO A;  1WWI A;  4J8X A;  4YM6 A;  1P3A A;  5B40 D;  1M1A C;  2F8N D;  1S32 A;  1M19 C;  5AV5 D;  3C1B C;  4KUD D;  5AVC D;  3VH5 A;  5B2I A;  1P3M C;  5CP6 B;  5B0Z C;  1M18 B;  1EQZ A;  2NQB B;  4E45 A;  3AZF A;  5GSU B;  3R45 A;  1P3P C;  4JJN D;  4X23 D;  3REL C;  5BS7 C;  5CPK A;  4ZUX C;  3REJ B;  1ID3 A;  5KDM A;  5GT3 D;  5BO0 A;  4QLC C;  3AN2 B;  3MGQ C;  3LZ1 B;  5B31 C;  2RVQ D;  1M19 A;  1U35 B;  4WNN B;  1P3B B;  5G49 A;  5B0Z A;  3UTA D;  1BH8 A;  4Z66 C;  3X1V D;  3AYW B;  3WTP C;  1P3P A;  1ZLA B;  5B1L C;  4E44 A;  3AFA A;  3REL A;  3KUY C;  3WAA C;  5JA4 B;  5GT0 A;  4LD9 D;  4QLC A;  1AOI C;  4YM6 D;  4M6B A;  5B31 A;  4J8V C;  5BNV B;  3W97 C;  1S32 D;  2ARO B;  2CWE A;  3MGR D;  3W99 A;  2IO5 B;  5C3I C;  4WZS B;  1P3G D;  4Z5T A;  5DNM D;  5B1L A;  3MVD B;  3WAA A;  5B2J A;  5AY8 A;  4H9N B;  2HUE C;  3VH6 W;  3AZI C;  3W98 B;  4Z2M G;  5F99 C;  1AOI A;  5AV9 A;  1BFM A;  3AZL C;  4NE5 A;  4AWL C;  1M19 D;  1P34 B;  3C1B D;  1P3M D;  5B0Z D;  2L5A A;  4H9O A;  3MGP C; 
#chains in the Genus database with same CATH topology
 1P3P D;  4H9Q A;  3REL D;  2ZY5 A;  4WU8 B;  4ZUX D;  3AZI A;  2JCH A;  4QLC D;  2YFV A;  3MGQ D;  5B31 D;  5AVB B;  3AZL A;  4ZBJ C;  3AZJ A;  5E5A B;  2BYM B;  3X1T C;  5CPJ C;  3W99 D;  1T3U A;  4Z66 D;  3VH5 T;  3WTP D;  4XZQ B;  2F8N H;  3B0D C;  3X1S A;  5B24 B;  5B1L D;  1TAF A;  3UT9 B;  1KX5 C;  2Y2P A;  3KUY D;  4G91 C;  4UPK A;  5JRG C;  3WAA D;  3AZH A;  3W96 C;  1KX4 B;  1AOI D;  3B6G C;  4XUJ B;  4J8V D;  1N1J A;  1TZY A;  1H3O B;  3NQU A;  3LZ0 B;  3W97 D;  4KHA A;  3V9R A;  3AZK C;  2FFF B;  3X1T A;  2NZD B;  2Y2H A;  3C1C C;  5BNX A;  3MGS C;  2PYO B;  5B32 B;  5AV6 C;  4KGC C;  3UTB B;  3AZI D;  1Z2C B;  5F99 D;  4WU9 A;  2FJ7 B;  3B6G A;  2Y2M A;  3TU4 B;  1P3L C;  3AZL D;  1P3O C;  5B40 A;  2CV5 C;  1P3F B;  2F8N A;  3KXB B;  3MGP D;  2YFW B;  3AV1 B;  5AV5 A;  3MNN C;  5DNN C;  5AV6 A;  4KGC A;  3NQJ B;  3AZN C;  3AV2 C;  1P3I C;  2Y2Q A;  4R8P B;  3LJA C;  3VH6 A;  4KUD B;  5GT3 A;  5AVC B;  1P3O A;  1HQ3 B;  3X1T D;  5CPJ D;  2Y2N A;  4JJN B;  5B1M C;  5AV8 B;  4X23 B;  3MNN A;  5DNN A;  3AZN A;  3AV2 A;  4UUZ B;  5JRG D;  3UTA A;  3X1V A;  1F66 C;  4CAY B;  3W96 D;  3B6G D;  3LEL B;  4G92 B;  5GXQ B;  4LD9 A;  1KU5 A;  4J8W C;  4EO5 B;  3X1U B;  3AZK D;  3AZE B;  3O62 A;  3C1C D;  3MGS D;  4HGA C;  3KWQ B;  5CP6 C;  3MGR A;  5AV6 D;  2HIO B;  4KGC D;  4J8X B;  2F8N K;  4YM6 B;  1P3G A;  1P3A B;  5DNM A;  3WA9 C;  1S32 B;  3EPK A;  5CHL B;  1P3L D;  4J8W A;  5B33 C;  3LZ1 C;  5B2I B;  1P3O D;  1EQZ B;  1M1A A;  2CV5 D;  3AZF B;  3R45 B;  3WKJ C;  3B0C W;  5B32 G;  1P3B C;  3MNN D;  3C1B A;  5DNN D;  5CPK B;  3AZN D;  1P3M A;  5KDM B;  5BO0 B;  3AV2 D;  1P3I D;  1ID3 B;  1ZLA C;  3AZG C;  3WA9 A;  2BG1 A;  5BS7 A;  1P3K C;  1M19 B;  4ZUX A;  5B33 A;  5G49 B;  5B0Z B;  1BH8 B;  3MGQ A;  3WKJ A;  2VQR A;  5B0Y C;  3O62 D;  1P3P B;  5B1M D;  2ARO C;  3A6N C;  3AFA B;  3REL B;  4J8U C;  1ULY A;  5GT0 B;  2IO5 C;  2F8N G;  4Z66 A;  4QLC B;  3AZG A;  3MVD C;  3WTP A;  2DF4 C;  5B31 B;  3REK C;  1F66 D;  3KUY A;  1P3K A;  3W98 C;  4J8W D;  3VH6 T;  3W99 B;  1M1A D;  4J8V A;  5B0Y A;  4Z5T B;  3W97 A;  5B1L B;  3A6N A;  1P34 C;  3AZM C;  4J8U A;  3WAA B;  1WWS A;  4CSR A;  5CP6 D;  5AY8 B;  5B2J B;  1AOI B;  3REK A;  2ZY2 A;  5AV9 B;  3WA9 D;  3EPL A;  1B67 A;  5B33 D;  5F99 A;  5AVB C;  2G5I C;  4H9O B;  3WKJ D;  4H9Q B;  5E5A C;  1P3B D;  3AZM A;  2HUE B;  3AZI B;  5B24 C;  2YFV B;  3MGP A;  3UT9 C;  3AZG D;  1ZLA D;  3AZL B;  1P3K D;  3WTP E;  4AWL B;  4DQY B;  3AZJ B;  4XUJ C;  3EPH A;  3LZ0 C;  5B0Y D;  3X1S B;  1TAF B;  3A6N D;  3F6T A;  2NZD C;  4J8U D;  3AZH B;  3FDD A;  5CPJ A;  2ZM5 A;  2PYO C;  3REI C;  3MVD D;  2BYK A;  3REK D;  3UTB C;  1N1J B;  1TZY B;  3NQU B;  1KX5 A;  5JRG A;  4ZBJ B;  5BT1 C;  4KHA B;  3V9R B;  3W98 D;  3X1T B;  3W96 A;  3TU4 C;  5BNX B;  1P34 D;  1P3F C;  5FUG A;  3AZM D;  3KXB C;  3AZK A;  5B31 G;  3C1C A;  4H9R A;  4WU9 B;  3B6F C;  3REI A;  3AV1 C;  3B6G B;  3MGS A;  2Y2J A;  1JFI A;  3REH C;  5B40 B;  4R8P C;  2F8N B;  3KFU G;  5AVB D;  5CPI C;  4YS3 C;  1P3L A;  5E5A D;  5AV5 B;  1HQ3 C;  2Y2G A;  5AV6 B;  4KGC B;  2CV5 A;  5AV8 C;  3B6F A;  5B24 D;  4DRA A;  1BH9 A;  1KX5 D;  5GT3 B;  1P3I A;  1P3O B;  3REH A;  3LEL C;  4G92 C;  4XUJ D;  5GXQ C;  5CPI A;  1KX3 C;  3LZ0 D;  3LJA A;  1W2E A;  4H9P A;  4YS3 A;  3MNN B;  4EO5 C;  5DNN B;  3AZN B;  3X1U C;  3AZE C;  3UTA B;  3AV2 B;  2NZD D;  2DQN C;  3X1V B;  3KWQ C;  5B1M A;  3REI D;  2LY8 A;  2HIO C;  4J8X C;  3UTB D;  1M18 C;  2NQB C;  4LD9 B;  5GSU C;  1P3A C;  5BT1 D;  4NE6 A;  1F66 A;  3O62 B;  3TU4 D;  3H0R C;  1KX3 A;  3REJ C;  5B2I C;  1EQZ C;  3MGR B;  3AN2 C;  1P3F D;  3AZF C;  3AL0 C;  1P3G B;  3B6F D;  5DNM B;  3AV1 D;  1U35 C;  3A1I A;  3B0C T;  5CPK C;  1M18 A;  1ID3 C;  2NQB A;  5CP6 A;  4J8W B;  2UWX A;  5GSU A;  3AYW C;  3REH D;  1M1A B;  1R4V A;  4R8P D;  4DRB A;  5CPI D;  3REJ A;  4HGA B;  3LJA D;  4YS3 D;  3C1B B;  3AN2 A;  1HQ3 D;  2ZY4 A;  3LZ1 A;  1P3M B;  5AV8 D;  3AFA C;  2ZY3 A;  1U35 A;  3WA9 B;  4WNN A;  5GT0 C;  1P3B A;  4ZUX B;  4WV4 B;  5B33 B;  3AYW A;  1ZLA A;  3MGQ B;  3LEL D;  3H0L C;  3WKJ B;  5GXQ D;  5JA4 A;  1KX3 D;  3W99 C;  3X1U D;  2W8S A;  3AZE D;  4Z5T C;  4Z66 B;  5BNV A;  3AZG B;  3IP4 C;  3WTP B;  3KWQ D;  2ARO A;  5B2J C;  5AY8 C;  3KUY B;  2HIO D;  1P3K B;  4J8X D;  1M18 D;  2NQB D;  5GSU D;  1P3A D;  2Y2K A;  5AV9 C;  3P5J B;  3MVD A;  4J8V B;  5B0Y B;  4H9N A;  4WU8 C;  3A6N B;  3REJ D;  3W97 B;  3W98 A;  2XD1 A;  3A1K A;  5B2I D;  4J8U B;  1EQZ D;  4CSR B;  3AN2 D;  3LZ1 D;  3AZF D;  3B0B A;  3REK B;  5C3I B;  1Q9C A;  1U35 D;  1PZR A;  1P34 A;  5CPK D;  1ID3 D;  3AYW D;  5F99 B;  4XZQ C;  1B6W A;  2Y2O A;  3AZJ C;  2RIQ A;  4WU8 A;  3AZM B;  1KX4 C;  2F2A C;  5AVB A;  3X1S C;  3MGP B;  3AFA D;  3KSY A;  5E5A A;  2ARO D;  3H0M C;  5GT0 D;  2BYM A;  3AZH C;  4H9S C;  2JSS A;  4XZQ A;  5B24 A;  5B32 C;  3UT9 A;  1TZY C;  1KX4 A;  3VH5 W;  2FJ7 C;  4XUJ A;  5CPJ B;  2Y2L A;  1H3O A;  4Z5T D;  3LZ0 A;  2BYK B;  3B0D B;  1A7W A;  5B2J D;  1KX5 B;  5AY8 D;  2NZD A;  4G91 B;  5JRG B;  4H9S A;  4WU9 C;  4Z2M H;  2PYO A;  3W96 B;  5B32 A;  5AV9 D;  3UTB A;  4WU8 D;  5B40 C;  5FUG B;  2FJ7 A;  3AZK B;  3C1C B;  3TU4 A;  4H9R B;  3REI B;  5AV5 C;  3MGS B;  4KUD C;  5AVC C;  1JFI B;  1P3F A;  3KXB A;  4JJN C;  4X23 C;  4XZQ D;  2YFW A;  3AV1 A;  3UT9 D;  3NQJ A;  5GT3 C;  3AZJ D;  1P3L B;  1KX4 D;  2CV5 B;  4R8P A;  3B6F B;  2RVQ C;  3X1S D;  4KUD A;  5AVC A;  1BH9 B;  4NFT A;  3UTA C;  1HQ3 A;  3AZH D;  3X1V C;  1F1E A;  1P3I B;  4JJN A;  4NE3 A;  5AV8 A;  3REH B;  4X23 A;  2PYO D;  5B32 D;  1HTA A;  1TZY D;  5CPI B;  4LD9 C;  4UUZ A;  3LJA B;  4YS3 B;  4H9P B;  4YM6 C;  4CAY A;  2FJ7 D;  3O62 C;  3LEL A;  5GXQ A;  1S32 C;  5B1M B;  3MGR C;  3X1U A;  3AZE A;  1P3G C;  4WU9 D;  5DNM C;  3KXB D;  1F66 B;  3KWQ A;  1KX3 B;  2HIO A;  1WWI A;  4J8X A;  4YM6 A;  1P3A A;  5B40 D;  1M1A C;  2F8N D;  1S32 A;  1M19 C;  5AV5 D;  3C1B C;  2G5H C;  4KUD D;  5AVC D;  3VH5 A;  5B2I A;  1P3M C;  5CP6 B;  5B0Z C;  1M18 B;  1EQZ A;  2NQB B;  4E45 A;  3AZF A;  5GSU B;  3R45 A;  4WJ3 C;  1P3P C;  4JJN D;  4X23 D;  3REL C;  5BS7 C;  3EG5 B;  5CPK A;  4ZUX C;  3REJ B;  1ID3 A;  5KDM A;  5GT3 D;  5BO0 A;  4QLC C;  3AN2 B;  3MGQ C;  3LZ1 B;  5B31 C;  2RVQ D;  2JE5 A;  1M19 A;  1U35 B;  4WNN B;  1P3B B;  5G49 A;  5B0Z A;  3UTA D;  1BH8 A;  4Z66 C;  3X1V D;  3AYW B;  3WTP C;  1P3P A;  1ZLA B;  5B1L C;  4E44 A;  3AFA A;  3REL A;  2XD5 A;  3KUY C;  3WAA C;  5JA4 B;  5GT0 A;  4LD9 D;  4QLC A;  1AOI C;  4YM6 D;  4M6B A;  5B31 A;  4J8V C;  5BNV B;  3W97 C;  1S32 D;  2ARO B;  2CWE A;  3MGR D;  3W99 A;  2IO5 B;  5C3I C;  4WZS B;  3EPJ A;  1P3G D;  4Z5T A;  5DNM D;  5B1L A;  3MVD B;  3WAA A;  5B2J A;  5AY8 A;  4H9N B;  2HUE C;  3VH6 W;  3AZI C;  3W98 B;  4Z2M G;  5F99 C;  1AOI A;  2J8P A;  5AV9 A;  2Y2I A;  1BFM A;  3AZL C;  4NE5 A;  4AWL C;  1M19 D;  1P34 B;  3C1B D;  1P3M D;  5B0Z D;  2L5A A;  4H9O A;  3MGP C; 
#chains in the Genus database with same CATH homology
 1P3P D;  4H9Q A;  3REL D;  2ZY5 A;  4WU8 B;  4ZUX D;  3AZI A;  2JCH A;  4QLC D;  2YFV A;  3MGQ D;  5B31 D;  5AVB B;  3AZL A;  4ZBJ C;  3AZJ A;  5E5A B;  2BYM B;  3X1T C;  5CPJ C;  3W99 D;  1T3U A;  4Z66 D;  3VH5 T;  3WTP D;  4XZQ B;  2F8N H;  3B0D C;  3X1S A;  5B24 B;  5B1L D;  1TAF A;  3UT9 B;  1KX5 C;  2Y2P A;  3KUY D;  4G91 C;  4UPK A;  5JRG C;  3WAA D;  3AZH A;  3W96 C;  1KX4 B;  1AOI D;  3B6G C;  4XUJ B;  4J8V D;  1N1J A;  1TZY A;  1H3O B;  3NQU A;  3LZ0 B;  3W97 D;  4KHA A;  3V9R A;  3AZK C;  2FFF B;  3X1T A;  2NZD B;  2Y2H A;  3C1C C;  5BNX A;  3MGS C;  2PYO B;  5B32 B;  5AV6 C;  4KGC C;  3UTB B;  3AZI D;  1Z2C B;  5F99 D;  4WU9 A;  2FJ7 B;  3B6G A;  2Y2M A;  3TU4 B;  1P3L C;  3AZL D;  1P3O C;  5B40 A;  2CV5 C;  1P3F B;  2F8N A;  3KXB B;  3MGP D;  2YFW B;  3AV1 B;  5AV5 A;  3MNN C;  5DNN C;  5AV6 A;  4KGC A;  3NQJ B;  3AZN C;  3AV2 C;  1P3I C;  2Y2Q A;  4R8P B;  3LJA C;  3VH6 A;  4KUD B;  5GT3 A;  5AVC B;  1P3O A;  1HQ3 B;  3X1T D;  5CPJ D;  2Y2N A;  4JJN B;  5B1M C;  5AV8 B;  4X23 B;  3MNN A;  5DNN A;  3AZN A;  3AV2 A;  4UUZ B;  5JRG D;  3UTA A;  3X1V A;  1F66 C;  4CAY B;  3W96 D;  3B6G D;  3LEL B;  4G92 B;  5GXQ B;  4LD9 A;  1KU5 A;  4J8W C;  4EO5 B;  3X1U B;  3AZK D;  3AZE B;  3O62 A;  3C1C D;  3MGS D;  4HGA C;  3KWQ B;  5CP6 C;  3MGR A;  5AV6 D;  2HIO B;  4KGC D;  4J8X B;  2F8N K;  4YM6 B;  1P3G A;  1P3A B;  5DNM A;  3WA9 C;  1S32 B;  3EPK A;  5CHL B;  1P3L D;  4J8W A;  5B33 C;  3LZ1 C;  5B2I B;  1P3O D;  1EQZ B;  1M1A A;  2CV5 D;  3AZF B;  3R45 B;  3WKJ C;  3B0C W;  5B32 G;  1P3B C;  3MNN D;  3C1B A;  5DNN D;  5CPK B;  3AZN D;  1P3M A;  5KDM B;  5BO0 B;  3AV2 D;  1P3I D;  1ID3 B;  1ZLA C;  3AZG C;  3WA9 A;  2BG1 A;  5BS7 A;  1P3K C;  1M19 B;  4ZUX A;  5B33 A;  5G49 B;  5B0Z B;  1BH8 B;  3MGQ A;  3WKJ A;  2VQR A;  5B0Y C;  3O62 D;  1P3P B;  5B1M D;  2ARO C;  3A6N C;  3AFA B;  3REL B;  4J8U C;  1ULY A;  5GT0 B;  2IO5 C;  2F8N G;  4Z66 A;  4QLC B;  3AZG A;  3MVD C;  3WTP A;  2DF4 C;  5B31 B;  3REK C;  1F66 D;  3KUY A;  1P3K A;  3W98 C;  4J8W D;  3VH6 T;  3W99 B;  1M1A D;  4J8V A;  5B0Y A;  4Z5T B;  3W97 A;  5B1L B;  3A6N A;  1P34 C;  3AZM C;  4J8U A;  3WAA B;  1WWS A;  4CSR A;  5CP6 D;  5AY8 B;  5B2J B;  1AOI B;  3REK A;  2ZY2 A;  5AV9 B;  3WA9 D;  3EPL A;  1B67 A;  5B33 D;  5F99 A;  5AVB C;  2G5I C;  4H9O B;  3WKJ D;  4H9Q B;  5E5A C;  1P3B D;  3AZM A;  2HUE B;  3AZI B;  5B24 C;  2YFV B;  3MGP A;  3UT9 C;  3AZG D;  1ZLA D;  3AZL B;  1P3K D;  3WTP E;  4AWL B;  4DQY B;  3AZJ B;  4XUJ C;  3EPH A;  3LZ0 C;  5B0Y D;  3X1S B;  1TAF B;  3A6N D;  3F6T A;  2NZD C;  4J8U D;  3AZH B;  3FDD A;  5CPJ A;  2ZM5 A;  2PYO C;  3REI C;  3MVD D;  2BYK A;  3REK D;  3UTB C;  1N1J B;  1TZY B;  3NQU B;  1KX5 A;  5JRG A;  4ZBJ B;  5BT1 C;  4KHA B;  3V9R B;  3W98 D;  3X1T B;  3W96 A;  3TU4 C;  5BNX B;  1P34 D;  1P3F C;  5FUG A;  3AZM D;  3KXB C;  3AZK A;  5B31 G;  3C1C A;  4H9R A;  4WU9 B;  3B6F C;  3REI A;  3AV1 C;  3B6G B;  3MGS A;  2Y2J A;  1JFI A;  3REH C;  5B40 B;  4R8P C;  2F8N B;  3KFU G;  5AVB D;  5CPI C;  4YS3 C;  1P3L A;  5E5A D;  5AV5 B;  1HQ3 C;  2Y2G A;  5AV6 B;  4KGC B;  2CV5 A;  5AV8 C;  3B6F A;  5B24 D;  4DRA A;  1BH9 A;  1KX5 D;  5GT3 B;  1P3I A;  1P3O B;  3REH A;  3LEL C;  4G92 C;  4XUJ D;  5GXQ C;  5CPI A;  1KX3 C;  3LZ0 D;  3LJA A;  1W2E A;  4H9P A;  4YS3 A;  3MNN B;  4EO5 C;  5DNN B;  3AZN B;  3X1U C;  3AZE C;  3UTA B;  3AV2 B;  2NZD D;  2DQN C;  3X1V B;  3KWQ C;  5B1M A;  3REI D;  2LY8 A;  2HIO C;  4J8X C;  3UTB D;  1M18 C;  2NQB C;  4LD9 B;  5GSU C;  1P3A C;  5BT1 D;  4NE6 A;  1F66 A;  3O62 B;  3TU4 D;  3H0R C;  1KX3 A;  3REJ C;  5B2I C;  1EQZ C;  3MGR B;  3AN2 C;  1P3F D;  3AZF C;  3AL0 C;  1P3G B;  3B6F D;  5DNM B;  3AV1 D;  1U35 C;  3A1I A;  3B0C T;  5CPK C;  1M18 A;  1ID3 C;  2NQB A;  5CP6 A;  4J8W B;  2UWX A;  5GSU A;  3AYW C;  3REH D;  1M1A B;  1R4V A;  4R8P D;  4DRB A;  5CPI D;  3REJ A;  4HGA B;  3LJA D;  4YS3 D;  3C1B B;  3AN2 A;  1HQ3 D;  2ZY4 A;  3LZ1 A;  1P3M B;  5AV8 D;  3AFA C;  2ZY3 A;  1U35 A;  3WA9 B;  4WNN A;  5GT0 C;  1P3B A;  4ZUX B;  4WV4 B;  5B33 B;  3AYW A;  1ZLA A;  3MGQ B;  3LEL D;  3H0L C;  3WKJ B;  5GXQ D;  5JA4 A;  1KX3 D;  3W99 C;  3X1U D;  2W8S A;  3AZE D;  4Z5T C;  4Z66 B;  5BNV A;  3AZG B;  3IP4 C;  3WTP B;  3KWQ D;  2ARO A;  5B2J C;  5AY8 C;  3KUY B;  2HIO D;  1P3K B;  4J8X D;  1M18 D;  2NQB D;  5GSU D;  1P3A D;  2Y2K A;  5AV9 C;  3P5J B;  3MVD A;  4J8V B;  5B0Y B;  4H9N A;  4WU8 C;  3A6N B;  3REJ D;  3W97 B;  3W98 A;  2XD1 A;  3A1K A;  5B2I D;  4J8U B;  1EQZ D;  4CSR B;  3AN2 D;  3LZ1 D;  3AZF D;  3B0B A;  3REK B;  5C3I B;  1Q9C A;  1U35 D;  1PZR A;  1P34 A;  5CPK D;  1ID3 D;  3AYW D;  5F99 B;  4XZQ C;  1B6W A;  2Y2O A;  3AZJ C;  2RIQ A;  4WU8 A;  3AZM B;  1KX4 C;  2F2A C;  5AVB A;  3X1S C;  3MGP B;  3AFA D;  3KSY A;  5E5A A;  2ARO D;  3H0M C;  5GT0 D;  2BYM A;  3AZH C;  4H9S C;  2JSS A;  4XZQ A;  5B24 A;  5B32 C;  3UT9 A;  1TZY C;  1KX4 A;  3VH5 W;  2FJ7 C;  4XUJ A;  5CPJ B;  2Y2L A;  1H3O A;  4Z5T D;  3LZ0 A;  2BYK B;  3B0D B;  1A7W A;  5B2J D;  1KX5 B;  5AY8 D;  2NZD A;  4G91 B;  5JRG B;  4H9S A;  4WU9 C;  4Z2M H;  2PYO A;  3W96 B;  5B32 A;  5AV9 D;  3UTB A;  4WU8 D;  5B40 C;  5FUG B;  2FJ7 A;  3AZK B;  3C1C B;  3TU4 A;  4H9R B;  3REI B;  5AV5 C;  3MGS B;  4KUD C;  5AVC C;  1JFI B;  1P3F A;  3KXB A;  4JJN C;  4X23 C;  4XZQ D;  2YFW A;  3AV1 A;  3UT9 D;  3NQJ A;  5GT3 C;  3AZJ D;  1P3L B;  1KX4 D;  2CV5 B;  4R8P A;  3B6F B;  2RVQ C;  3X1S D;  4KUD A;  5AVC A;  1BH9 B;  4NFT A;  3UTA C;  1HQ3 A;  3AZH D;  3X1V C;  1F1E A;  1P3I B;  4JJN A;  4NE3 A;  5AV8 A;  3REH B;  4X23 A;  2PYO D;  5B32 D;  1HTA A;  1TZY D;  5CPI B;  4LD9 C;  4UUZ A;  3LJA B;  4YS3 B;  4H9P B;  4YM6 C;  4CAY A;  2FJ7 D;  3O62 C;  3LEL A;  5GXQ A;  1S32 C;  5B1M B;  3MGR C;  3X1U A;  3AZE A;  1P3G C;  4WU9 D;  5DNM C;  3KXB D;  1F66 B;  3KWQ A;  1KX3 B;  2HIO A;  1WWI A;  4J8X A;  4YM6 A;  1P3A A;  5B40 D;  1M1A C;  2F8N D;  1S32 A;  1M19 C;  5AV5 D;  3C1B C;  2G5H C;  4KUD D;  5AVC D;  3VH5 A;  5B2I A;  1P3M C;  5CP6 B;  5B0Z C;  1M18 B;  1EQZ A;  2NQB B;  4E45 A;  3AZF A;  5GSU B;  3R45 A;  4WJ3 C;  1P3P C;  4JJN D;  4X23 D;  3REL C;  5BS7 C;  3EG5 B;  5CPK A;  4ZUX C;  3REJ B;  1ID3 A;  5KDM A;  5GT3 D;  5BO0 A;  4QLC C;  3AN2 B;  3MGQ C;  3LZ1 B;  5B31 C;  2RVQ D;  2JE5 A;  1M19 A;  1U35 B;  4WNN B;  1P3B B;  5G49 A;  5B0Z A;  3UTA D;  1BH8 A;  4Z66 C;  3X1V D;  3AYW B;  3WTP C;  1P3P A;  1ZLA B;  5B1L C;  4E44 A;  3AFA A;  3REL A;  2XD5 A;  3KUY C;  3WAA C;  5JA4 B;  5GT0 A;  4LD9 D;  4QLC A;  1AOI C;  4YM6 D;  4M6B A;  5B31 A;  4J8V C;  5BNV B;  3W97 C;  1S32 D;  2ARO B;  2CWE A;  3MGR D;  3W99 A;  2IO5 B;  5C3I C;  4WZS B;  3EPJ A;  1P3G D;  4Z5T A;  5DNM D;  5B1L A;  3MVD B;  3WAA A;  5B2J A;  5AY8 A;  4H9N B;  2HUE C;  3VH6 W;  3AZI C;  3W98 B;  4Z2M G;  5F99 C;  1AOI A;  2J8P A;  5AV9 A;  2Y2I A;  1BFM A;  3AZL C;  4NE5 A;  4AWL C;  1M19 D;  1P34 B;  3C1B D;  1P3M D;  5B0Z D;  2L5A A;  4H9O A;  3MGP C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...