4H9NA

Complex structure 1 of daxx/h3.3(sub5)/h4
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
98
structure length
98
Chain Sequence
KPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEAAEAFLVALFEDTNLCTIHAKRVTIFPKDIQLARRIRGER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.3
publication title DAXX chaperone envelops an H3.3/H4 dimer dictating H3.3-specific read out
rcsb
source organism Homo sapiens
molecule tags Dna binding protein/apoptosis
total genus 28
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2012-09-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4h9nA00
5AVCA 3VH6W 3AZID 5CPJD 3REHD 1BFMA 3KWQC 5B33B 5B32D 3LZ0C 5AV8C 3UTBD 2PYOC 3AZEB 3RELD 3UT9D 3C1BB 3AZMA 3WKJB 1H3OB 5B31G 1P3BC 1KU5A 3LJAB 4ZBJB 1Q9CA 2FJ7B 3C1BC 3REJD 1P3KA 3AZFB 1HQ3B 4J8XB 3X1VB 4Z2MH 1TZYA 4R8PB 1P3MA 1ZLAA 4YS3A 4H9SC 4G91B 1P3AB 5B40A 3AN2C 4JJNA 4Z66B 5AY8B 4WU9B 3C1CC 4QLCD 3WTPE 1P3IC 3WTPD 1HQ3C 3UTAB 3X1VC 1P3LB 1AOID 5JRGA 1BH8A 3REKA 5AVCC 1P3AC 1KX3D 4UUZB 3MGRB 2HIOB 3AZKC 5BNXA 3TU4A 3AZMC 1KX4B 1P3LC 2YFWA 4H9OA 2IO5B 5CPIA 1F1EA 5GT3B 5B2IA 3MGQD 3W98A 5FUGA 5GXQB 3REIC 1P34D 2NZDB 1ZLAC 1TZYC 3AYWB 3A6ND 4KUDC 2HUEC 5GT3C 5CPKD 4WU8B 5B40C 3NQJB 3AZJB 2NQBD 3B6FB 2F8NB 3WA9D 4CSRB 5GXQC 1M1AA 4J8VB 3B6GA 5B0ZB 5JRGC 1P3FA 2AROA 5BT1C 4CAYA 4DRAA 3X1UB 3AZJC 4XZQD 5B1MD 5B31B 5CP6A 3TU4C 1EQZB 5B0ZC 3AZLB 5DNMA 4ZUXD 3AZIB 3REHB 1U35D 4Z5TD 1EQZC 3W98C 5GSUA 3LZ1C 3RELB 3AZHA 3KUYA 1JFIA 4WNNA 1M1AC 3REJB 4H9QB 3B6GC 3X1SA 2AROC 3AZGD 3VH5W 5E5AA 5G49A 5AV9A 3MGPD 1F66B 4KHAB 5CP6C 4QLCB 3AZNC 3WTPB 5DNMC 1AOIB 1ID3A 1KX3B 2CV5C 5GSUC 3X1TD 3VH6A 5AV8D 1P3PA 1P3OA 3W96B 2F8NK 1B67A 4LD9B 5B2JA 4KGCA 3V9RB 5GT0A 1M19D 3AZHC 3MVDA 4XUJA 5B24D 3MGQB 1N1JB 2BYKA 3B0CW 4J8UA 1P34B 3WAAA 2JSSA 3W96C 3X1SC 4LD9C 3A6NB 5B0YA 3VH5T 5E5AC 3MNND 5AV9C 2NQBB 3WA9B 3NQUB 1P3GD 3KWQA 4J8WA 4XZQB 4AWLB 5B1MB 2YFVB 1P3PC 3LELB 1P3OC 5B33A 5B2JC 4ZUXB 4KGCC 4NFTA 3AZEA 4Z5TB 3AFAD 3C1BA 1M18D 3WKJA 1H3OA 3B0CT 4J8UC 3LELC 3WAAC 3LJAA 5B0YC 1P3KD 1ZLAD 1P3MD 2FJ7A 4E44A 3W99B 4YS3D 3AZFA 1HQ3A 4J8XA 3R45A 5B40D 3X1VA 4YM6D 5AV5B 4R8PA 4JJND 1P3AA 5C3IB 4EO5B 1KX5B 3W99C 4WV4B 4WU9A 4H9RB 4J8WC 3REKD 3AZKA 3UTAA 1P3LA 5AV5C 4H9NB 5AVBD 5C3IC 4UUZA 4NE3A 5B33C 3TU4D 3MGRA 3AZEC 3AV1D 1TAFB 5B32G 3MGSB 3REIA 5CPID 1KX4A 3WKJC 1BH9B 5B1LB 3X1TB 5B2ID 4KUDA 5GT3A 1R4VA 3LJAC 4ZBJC 4DRBA 2FJ7C 1M19B 5AV6B 5GXQA 2NZDA 5KDMB 3AZFC 5B24B 4J8XC 5B1LC 5F99D 4R8PC 5DNND 4G91C 4WU8A 3NQJA 3AZJA 1M1AD 3B6FA 4Z66C 2F8NA 5AY8C 4WU9C 5AV6C 1P3FD 3W97B 3UTAC 4J8VA 5B0ZA 3VH5A 2RVQD 1P3GB 3X1UA 3MGRC 2HIOC 5B31A 3W97C 1KX4C 1EQZA 3LZ1A 3AZLA 2IO5C 3REHA 2NZDC 3RELA 3AFAB 1M18B 3AYWC 2LY8A 3KUYD 4WU8C 3B6FC 1P3KB 1P3MB 3O62B 4J8VC 3AZNA 5E5AD 5AV9D 3KXBD 4YM6B 4JJNB 5JA4B 2BYMA 5CPJB 3X1UC 5B32B 2L5AA 5B31C 1F66A 4KHAA 3UTBB 4QLCA 2CV5A 1ID3D 3AZLC 3WTPA 4Z2MG 3UT9B 1AOIA 3AZIC 5CPJC 3REHC 5AVBB 3KSYA 5B32C 5BS7C 3UTBC 1S32D 3AV1B 3RELC 3AV2D 5CPIB 5GT0D 3W96A 3MVDD 4LD9A 4X23D 4XUJD 3V9RA 3MGQA 1N1JA 3REJC 5BNVA 1P34A 5F99B 5DNNB 2NQBA 1F66C 1P3FB 4QLCC 3WA9A 3KWQD 3WTPC 3LZ0D 1AOIC 2PYOD 1KX3C 4XZQA 1P3BD 4HGAB 2YFVA 3LELA 5BO0B 4ZUXA 3C1BD 5CPKB 2F8NH 4Z5TA 3MGQC 4HGAC 3AN2D 1P34C 3C1CD 5CHLB 3A6NC 1P3ID 1HQ3D 3X1VD 3W99A 2NQBC 5AVCD 1P3AD 3WA9C 5AV5A 4H9PB 3AZKD 3KXBB 1KX5A 3AZMD 3UTAD 1P3LD 4H9RA 1U35B 4XZQC 4AWLC 5B1MC 1ID3B 4H9NA 4ZUXC 3REID 1TZYD 1U35C 4Z5TC 4KUDD 3MGSA 5GT3D 1BH9A 1S32B 5B1LA 3X1TA 3AV2B 3MVDB 5GXQD 3AZGB 4X23B 2NZDD 4XUJB 4Z66A 1M19A 5AY8A 5JRGD 5AV6A 5BT1D 3MGPB 5B24A 3AZJD 2F8ND 4G92B 1KX5C 4EO5C 5B0ZD 2HIOA 3W97A 3MGPC 3LZ0B 5AV8B 2PYOB 1EQZD 3W98D 3LZ1D 1B6WA 3MGSC 1P3BB 3AYWA 3X1TC 3B6GD 1M19C 3MNNB 2AROD 4CSRA 5B24C 3AFAA 1M18A 3AN2B 5CP6D 3C1CB 1P3IB 3AZND 5DNMD 3R45B 3MNNC 4NE5A 3O62A 1ULYA 5AVCB 4YM6A 3B0DB 5JA4A 1F66D 3AZIA 3AZKB 5GSUD 5CPJA 2CV5D 1P3GC 3AZMB 5B32A 5BS7A 3UTBA 4M6BA 3VH6T 3UT9A 3AZHD 3B0DC 5AVBA 3REIB 1ZLAB 3X1SD 1TZYB 3W96D 4LD9D 3AV1A 3AFAC 2HUEB 4H9QA 3REJA 4YS3B 1M18C 4KUDB 5B40B 1P3KC 1P3MC 5JRGB 1BH8B 3O62C 3REKB 4YS3C 5F99A 4YM6C 4JJNC 5DNNA 1KX3A 5BNXB 3TU4B 1P3PD 1P3OD 3REKC 2YFWB 4H9OB 5B2JD 3UT9C 4KGCD 4WZSB 5B2IB 1WWSA 5AVBC 3W98B 5FUGB 3LZ1B 3LELD 4J8UD 3WAAD 3AV1C 5B0YD 5CPIC 5B2IC 5BO0A 3A6NA 5CPKA 1M1AB 3B6GB 2AROB 1A7WA 3NQUA 3W99D 4CAYB 5F99C 5DNNC 4J8WD 5CP6B 5AV5D 3AZNB 5DNMB 5B1MA 1P3FC 1KX5D 5B33D 1HTAA 2BYMB 4H9PA 4E45A 3AZED 3KXBA 3WKJD 2RVQC 2CV5B 5GSUB 1U35A 3LJAD 2FJ7D 3AZHB 3KUYB 1JFIB 3MGSD 4WNNB 3AZFD 4J8XD 5CPKC 5B1LD 4R8PD 2CWEA 3X1SB 1S32A 3AV2A 4Z66D 5AY8D 5E5AB 5AV6D 5G49B 5AV9B 4WU9D 3KUYC 3AZGA 4X23A 5BNVB 3MGPA 3MGRD 2HIOD 3KXBC 3W97D 1KX4D 1TAFA 1P3PB 1P3OB 1ID3C 3B0BA 5B2JB 4KGCB 3LZ0A 5AV8A 5GT0B 2PYOA 3AYWD 2BYKB 4J8UB 3WAAB 5KDMA 1P3BA 4WU8D 1S32C 5B0YB 3AV2C 3B6FD 5GT0C 4NE6A 3MVDC 3AZGC 4X23C 1WWIA 4XUJC 4J8VD 3MNNA 4H9SA 3X1UD 3KWQB 3AN2A 4G92C 5B31D 3C1CA 3O62D 4J8WB 1P3IA 3AZLD 1P3GA 2F8NG
chains in the Genus database with same CATH superfamily
5AVCA 3VH6W 3AZID 5CPJD 3REHD 1BFMA 3KWQC 5B33B 2ZY2A 5B32D 5AV8C 3LZ0C 3EPHA 3UTBD 2PYOC 3AZEB 3RELD 3UT9D 3C1BB 3AZMA 3AL0C 3WKJB 1H3OB 5B31G 1P3BC 1KU5A 3LJAB 4ZBJB 1Q9CA 2FJ7B 3C1BC 3REJD 1P3KA 3AZFB 1HQ3B 4J8XB 3X1VB 4Z2MH 1TZYA 4R8PB 1P3MA 1ZLAA 4YS3A 2Y2QA 4H9SC 4G91B 1P3AB 5B40A 3AN2C 4JJNA 4Z66B 5AY8B 4WU9B 3C1CC 4QLCD 3WTPE 1P3IC 2Y2GA 3WTPD 1HQ3C 3UTAB 3X1VC 1P3LB 1AOID 5JRGA 1BH8A 3REKA 2ZY5A 5AVCC 1P3AC 1KX3D 4UUZB 3MGRB 2HIOB 3AZKC 5BNXA 3TU4A 3AZMC 1KX4B 1P3LC 2YFWA 4H9OA 2IO5B 5CPIA 1F1EA 5GT3B 5B2IA 3MGQD 3W98A 5FUGA 5GXQB 3REIC 1P34D 2NZDB 1ZLAC 1TZYC 3AYWB 3A6ND 4KUDC 2HUEC 5GT3C 5CPKD 4WU8B 5B40C 3NQJB 3AZJB 2NQBD 3B6FB 2F8NB 3WA9D 4CSRB 5GXQC 1M1AA 4J8VB 3B6GA 5B0ZB 5JRGC 1P3FA 2AROA 5BT1C 4CAYA 4DRAA 3X1UB 3AZJC 4XZQD 5B1MD 5B31B 5CP6A 3TU4C 1EQZB 5B0ZC 3AZLB 5DNMA 4ZUXD 3AZIB 3REHB 1U35D 4Z5TD 1EQZC 3W98C 5GSUA 3LZ1C 3RELB 3AZHA 3KUYA 1JFIA 4WNNA 3EPLA 1M1AC 3REJB 4H9QB 3B6GC 3X1SA 2AROC 3FDDA 3AZGD 3VH5W 5E5AA 5G49A 5AV9A 3MGPD 1F66B 4KHAB 5CP6C 4QLCB 3AZNC 3WTPB 5DNMC 1AOIB 3H0RC 1ID3A 1KX3B 2CV5C 5GSUC 3X1TD 3VH6A 5AV8D 1P3PA 1P3OA 3W96B 3A1IA 1B67A 4UPKA 2F8NK 5B2JA 4KGCA 4LD9B 3V9RB 5GT0A 1M19D 3AZHC 3MVDA 2XD5A 4XUJA 5B24D 3MGQB 1N1JB 2BYKA 3B0CW 4J8UA 1P34B 3WAAA 2JSSA 3W96C 3X1SC 4LD9C 3A6NB 5B0YA 3VH5T 5E5AC 3MNND 5AV9C 2NQBB 3WA9B 3NQUB 1P3GD 3KWQA 4J8WA 4XZQB 4AWLB 5B1MB 2YFVB 1P3PC 3LELB 1P3OC 5B33A 5B2JC 4ZUXB 4KGCC 4NFTA 3AZEA 4Z5TB 3AFAD 3C1BA 1M18D 3WKJA 1H3OA 3B0CT 4J8UC 3LELC 3WAAC 3LJAA 5B0YC 1P3KD 1ZLAD 1P3MD 2FJ7A 4E44A 3W99B 4YS3D 3AZFA 1HQ3A 4J8XA 3R45A 5B40D 3X1VA 4YM6D 5AV5B 4R8PA 4JJND 3EPKA 1P3AA 5C3IB 4EO5B 1KX5B 3W99C 4WV4B 4WU9A 4H9RB 4J8WC 3REKD 3AZKA 3UTAA 1P3LA 5AV5C 4H9NB 5AVBD 5C3IC 4UUZA 4NE3A 5B33C 3TU4D 3MGRA 3AZEC 3AV1D 1TAFB 5B32G 3MGSB 3REIA 3EPJA 5CPID 1KX4A 1BH9B 3WKJC 5B1LB 3X1TB 5B2ID 4KUDA 5GT3A 1R4VA 3LJAC 4ZBJC 3IP4C 4DRBA 2FJ7C 1M19B 5AV6B 5GXQA 2NZDA 5KDMB 3AZFC 5B24B 4J8XC 5B1LC 5F99D 4R8PC 5DNND 4G91C 4WU8A 3NQJA 3AZJA 1M1AD 3B6FA 4Z66C 2F8NA 1W2EA 5AY8C 5AV6C 4WU9C 1P3FD 3W97B 3UTAC 4J8VA 5B0ZA 3VH5A 2RVQD 1P3GB 2Y2HA 3X1UA 3MGRC 2HIOC 5B31A 3W97C 1KX4C 1EQZA 3LZ1A 3AZLA 2IO5C 3REHA 2NZDC 3RELA 3AFAB 1M18B 3AYWC 2LY8A 3KUYD 2ZY3A 4WU8C 3B6FC 1P3KB 1P3MB 2Y2LA 3O62B 4J8VC 3AZNA 5E5AD 5AV9D 3KXBD 4YM6B 4JJNB 5JA4B 2BYMA 5CPJB 3X1UC 5B32B 2L5AA 5B31C 1F66A 4KHAA 2DF4C 3UTBB 4QLCA 2CV5A 1ID3D 3AZLC 3WTPA 4Z2MG 3UT9B 1AOIA 3AZIC 5CPJC 3REHC 5AVBB 3KSYA 5B32C 5BS7C 3UTBC 1S32D 3AV1B 3RELC 3AV2D 5CPIB 5GT0D 3H0MC 3W96A 3MVDD 4LD9A 4X23D 4XUJD 3V9RA 3MGQA 1N1JA 3REJC 5BNVA 1P34A 5F99B 5DNNB 2NQBA 1F66C 1P3FB 4QLCC 3WA9A 3KWQD 3WTPC 3LZ0D 1AOIC 2PYOD 1KX3C 4XZQA 1P3BD 4HGAB 2YFVA 3LELA 2DQNC 5BO0B 4ZUXA 3C1BD 5CPKB 2F8NH 4Z5TA 3MGQC 4HGAC 3AN2D 1P34C 3C1CD 5CHLB 3A6NC 1P3ID 1HQ3D 3X1VD 3W99A 2NQBC 5AVCD 1P3AD 3WA9C 5AV5A 4H9PB 3AZKD 3KXBB 1KX5A 3AZMD 3UTAD 2Y2IA 1P3LD 2F2AC 4H9RA 1U35B 4XZQC 4AWLC 5B1MC 1ID3B 4H9NA 4ZUXC 3REID 2UWXA 1TZYD 1U35C 4Z5TC 4KUDD 3MGSA 5GT3D 1BH9A 1S32B 5B1LA 3X1TA 3AV2B 3P5JB 3MVDB 5GXQD 3AZGB 4X23B 2NZDD 4XUJB 2Y2PA 4Z66A 1M19A 5AY8A 5JRGD 2Y2MA 5AV6A 5BT1D 3MGPB 5B24A 2RIQA 3AZJD 2F8ND 4G92B 1KX5C 4EO5C 5B0ZD 2HIOA 3W97A 3MGPC 2JCHA 3LZ0B 5AV8B 2G5HC 2PYOB 1EQZD 3W98D 3LZ1D 1B6WA 2Y2NA 3H0LC 3MGSC 2XD1A 1P3BB 3KFUG 3AYWA 3X1TC 3B6GD 1M19C 3MNNB 2AROD 4CSRA 5B24C 3AFAA 1M18A 3AN2B 5CP6D 3C1CB 1P3IB 3AZND 5DNMD 3R45B 3MNNC 4NE5A 3O62A 1ULYA 5AVCB 4YM6A 3B0DB 5JA4A 1F66D 3AZIA 3AZKB 5GSUD 5CPJA 2CV5D 1P3GC 3AZMB 5B32A 5BS7A 2ZM5A 3UTBA 4M6BA 3VH6T 3UT9A 3AZHD 3B0DC 5AVBA 3REIB 1ZLAB 3X1SD 1TZYB 3W96D 4LD9D 2W8SA 3AV1A 3AFAC 2HUEB 4H9QA 3REJA 4YS3B 1M18C 2VQRA 4KUDB 5B40B 1P3KC 1P3MC 5JRGB 1BH8B 3O62C 3REKB 4YS3C 5F99A 2Y2KA 4YM6C 5DNNA 4JJNC 2Y2JA 1PZRA 5BNXB 3TU4B 1P3PD 1KX3A 1P3OD 1T3UA 3REKC 2YFWB 4H9OB 5B2JD 3UT9C 4KGCD 2Y2OA 4WZSB 5B2IB 2FFFB 1WWSA 5AVBC 3W98B 5FUGB 3LZ1B 3LELD 4J8UD 3WAAD 3AV1C 5B0YD 5CPIC 5B2IC 5BO0A 3A6NA 5CPKA 1M1AB 3B6GB 2AROB 1A7WA 3NQUA 3W99D 4CAYB 5F99C 5DNNC 4J8WD 5CP6B 5AV5D 4DQYB 3AZNB 5DNMB 5B1MA 1P3FC 1KX5D 5B33D 1HTAA 2BYMB 4H9PA 4E45A 3AZED 3KXBA 2BG1A 3WKJD 2RVQC 2CV5B 5GSUB 2G5IC 1U35A 3LJAD 2FJ7D 3AZHB 3KUYB 1JFIB 3MGSD 4WNNB 3AZFD 4J8XD 5CPKC 5B1LD 4R8PD 2J8PA 1Z2CB 2CWEA 3X1SB 1S32A 3AV2A 4Z66D 5AY8D 5E5AB 5AV6D 5G49B 5AV9B 4WU9D 3KUYC 3AZGA 4X23A 2JE5A 5BNVB 3MGPA 3EG5B 3MGRD 2HIOD 3F6TA 3KXBC 1KX4D 3W97D 1TAFA 1P3PB 1P3OB 1ID3C 3B0BA 5B2JB 4KGCB 3LZ0A 5AV8A 5GT0B 2PYOA 3AYWD 2BYKB 2ZY4A 4J8UB 3WAAB 5KDMA 1P3BA 4WU8D 1S32C 5B0YB 3AV2C 3B6FD 5GT0C 4NE6A 3MVDC 3AZGC 4X23C 1WWIA 4XUJC 4J8VD 3MNNA 4WJ3C 4H9SA 3X1UD 3KWQB 3AN2A 3A1KA 4G92C 5B31D 3C1CA 3O62D 4J8WB 1P3IA 3AZLD 1P3GA 2F8NG
chains in the Genus database with same CATH topology
5AVCA 3VH6W 3AZID 5CPJD 3REHD 1BFMA 3KWQC 5B33B 2ZY2A 5B32D 5AV8C 3LZ0C 3EPHA 3UTBD 2PYOC 3AZEB 3RELD 3UT9D 3C1BB 3AZMA 3AL0C 3WKJB 1H3OB 5B31G 1P3BC 1KU5A 3LJAB 4ZBJB 1Q9CA 2FJ7B 3C1BC 3REJD 1P3KA 3AZFB 1HQ3B 4J8XB 3X1VB 4Z2MH 1TZYA 4R8PB 1P3MA 1ZLAA 4YS3A 2Y2QA 4H9SC 4G91B 1P3AB 5B40A 3AN2C 4JJNA 4Z66B 5AY8B 4WU9B 3C1CC 4QLCD 3WTPE 1P3IC 2Y2GA 3WTPD 1HQ3C 3UTAB 3X1VC 1P3LB 1AOID 5JRGA 1BH8A 3REKA 2ZY5A 5AVCC 1P3AC 1KX3D 4UUZB 3MGRB 2HIOB 3AZKC 5BNXA 3TU4A 3AZMC 1KX4B 1P3LC 2YFWA 4H9OA 2IO5B 5CPIA 1F1EA 5GT3B 5B2IA 3MGQD 3W98A 5FUGA 5GXQB 3REIC 1P34D 2NZDB 1ZLAC 1TZYC 3AYWB 3A6ND 4KUDC 2HUEC 5GT3C 5CPKD 4WU8B 5B40C 3NQJB 3AZJB 2NQBD 3B6FB 2F8NB 3WA9D 4CSRB 5GXQC 1M1AA 4J8VB 3B6GA 5B0ZB 5JRGC 1P3FA 2AROA 5BT1C 4CAYA 4DRAA 3X1UB 3AZJC 4XZQD 5B1MD 5B31B 5CP6A 3TU4C 1EQZB 5B0ZC 3AZLB 5DNMA 4ZUXD 3AZIB 3REHB 1U35D 4Z5TD 1EQZC 3W98C 5GSUA 3LZ1C 3RELB 3AZHA 3KUYA 1JFIA 4WNNA 3EPLA 1M1AC 3REJB 4H9QB 3B6GC 3X1SA 2AROC 3FDDA 3AZGD 3VH5W 5E5AA 5G49A 5AV9A 3MGPD 1F66B 4KHAB 5CP6C 4QLCB 3AZNC 3WTPB 5DNMC 1AOIB 3H0RC 1ID3A 1KX3B 2CV5C 5GSUC 3X1TD 3VH6A 5AV8D 1P3PA 1P3OA 3W96B 3A1IA 1B67A 4UPKA 2F8NK 5B2JA 4KGCA 4LD9B 3V9RB 5GT0A 1M19D 3AZHC 3MVDA 2XD5A 4XUJA 5B24D 3MGQB 1N1JB 2BYKA 3B0CW 4J8UA 1P34B 3WAAA 2JSSA 3W96C 3X1SC 4LD9C 3A6NB 5B0YA 3VH5T 5E5AC 3MNND 5AV9C 2NQBB 3WA9B 3NQUB 1P3GD 3KWQA 4J8WA 4XZQB 4AWLB 5B1MB 2YFVB 1P3PC 3LELB 1P3OC 5B33A 5B2JC 4ZUXB 4KGCC 4NFTA 3AZEA 4Z5TB 3AFAD 3C1BA 1M18D 3WKJA 1H3OA 3B0CT 4J8UC 3LELC 3WAAC 3LJAA 5B0YC 1P3KD 1ZLAD 1P3MD 2FJ7A 4E44A 3W99B 4YS3D 3AZFA 1HQ3A 4J8XA 3R45A 5B40D 3X1VA 4YM6D 5AV5B 4R8PA 4JJND 3EPKA 1P3AA 5C3IB 4EO5B 1KX5B 3W99C 4WV4B 4WU9A 4H9RB 4J8WC 3REKD 3AZKA 3UTAA 1P3LA 5AV5C 4H9NB 5AVBD 5C3IC 4UUZA 4NE3A 5B33C 3TU4D 3MGRA 3AZEC 3AV1D 1TAFB 5B32G 3MGSB 3REIA 3EPJA 5CPID 1KX4A 1BH9B 3WKJC 5B1LB 3X1TB 5B2ID 4KUDA 5GT3A 1R4VA 3LJAC 4ZBJC 3IP4C 4DRBA 2FJ7C 1M19B 5AV6B 5GXQA 2NZDA 5KDMB 3AZFC 5B24B 4J8XC 5B1LC 5F99D 4R8PC 5DNND 4G91C 4WU8A 3NQJA 3AZJA 1M1AD 3B6FA 4Z66C 2F8NA 1W2EA 5AY8C 5AV6C 4WU9C 1P3FD 3W97B 3UTAC 4J8VA 5B0ZA 3VH5A 2RVQD 1P3GB 2Y2HA 3X1UA 3MGRC 2HIOC 5B31A 3W97C 1KX4C 1EQZA 3LZ1A 3AZLA 2IO5C 3REHA 2NZDC 3RELA 3AFAB 1M18B 3AYWC 2LY8A 3KUYD 2ZY3A 4WU8C 3B6FC 1P3KB 1P3MB 2Y2LA 3O62B 4J8VC 3AZNA 5E5AD 5AV9D 3KXBD 4YM6B 4JJNB 5JA4B 2BYMA 5CPJB 3X1UC 5B32B 2L5AA 5B31C 1F66A 4KHAA 2DF4C 3UTBB 4QLCA 2CV5A 1ID3D 3AZLC 3WTPA 4Z2MG 3UT9B 1AOIA 3AZIC 5CPJC 3REHC 5AVBB 3KSYA 5B32C 5BS7C 3UTBC 1S32D 3AV1B 3RELC 3AV2D 5CPIB 5GT0D 3H0MC 3W96A 3MVDD 4LD9A 4X23D 4XUJD 3V9RA 3MGQA 1N1JA 3REJC 5BNVA 1P34A 5F99B 5DNNB 2NQBA 1F66C 1P3FB 4QLCC 3WA9A 3KWQD 3WTPC 3LZ0D 1AOIC 2PYOD 1KX3C 4XZQA 1P3BD 4HGAB 2YFVA 3LELA 2DQNC 5BO0B 4ZUXA 3C1BD 5CPKB 2F8NH 4Z5TA 3MGQC 4HGAC 3AN2D 1P34C 3C1CD 5CHLB 3A6NC 1P3ID 1HQ3D 3X1VD 3W99A 2NQBC 5AVCD 1P3AD 3WA9C 5AV5A 4H9PB 3AZKD 3KXBB 1KX5A 3AZMD 3UTAD 2Y2IA 1P3LD 2F2AC 4H9RA 1U35B 4XZQC 4AWLC 5B1MC 1ID3B 4H9NA 4ZUXC 3REID 2UWXA 1TZYD 1U35C 4Z5TC 4KUDD 3MGSA 5GT3D 1BH9A 1S32B 5B1LA 3X1TA 3AV2B 3P5JB 3MVDB 5GXQD 3AZGB 4X23B 2NZDD 4XUJB 2Y2PA 4Z66A 1M19A 5AY8A 5JRGD 2Y2MA 5AV6A 5BT1D 3MGPB 5B24A 2RIQA 3AZJD 2F8ND 4G92B 1KX5C 4EO5C 5B0ZD 2HIOA 3W97A 3MGPC 2JCHA 3LZ0B 5AV8B 2G5HC 2PYOB 1EQZD 3W98D 3LZ1D 1B6WA 2Y2NA 3H0LC 3MGSC 2XD1A 1P3BB 3KFUG 3AYWA 3X1TC 3B6GD 1M19C 3MNNB 2AROD 4CSRA 5B24C 3AFAA 1M18A 3AN2B 5CP6D 3C1CB 1P3IB 3AZND 5DNMD 3R45B 3MNNC 4NE5A 3O62A 1ULYA 5AVCB 4YM6A 3B0DB 5JA4A 1F66D 3AZIA 3AZKB 5GSUD 5CPJA 2CV5D 1P3GC 3AZMB 5B32A 5BS7A 2ZM5A 3UTBA 4M6BA 3VH6T 3UT9A 3AZHD 3B0DC 5AVBA 3REIB 1ZLAB 3X1SD 1TZYB 3W96D 4LD9D 2W8SA 3AV1A 3AFAC 2HUEB 4H9QA 3REJA 4YS3B 1M18C 2VQRA 4KUDB 5B40B 1P3KC 1P3MC 5JRGB 1BH8B 3O62C 3REKB 4YS3C 5F99A 2Y2KA 4YM6C 5DNNA 4JJNC 2Y2JA 1PZRA 5BNXB 3TU4B 1P3PD 1KX3A 1P3OD 1T3UA 3REKC 2YFWB 4H9OB 5B2JD 3UT9C 4KGCD 2Y2OA 4WZSB 5B2IB 2FFFB 1WWSA 5AVBC 3W98B 5FUGB 3LZ1B 3LELD 4J8UD 3WAAD 3AV1C 5B0YD 5CPIC 5B2IC 5BO0A 3A6NA 5CPKA 1M1AB 3B6GB 2AROB 1A7WA 3NQUA 3W99D 4CAYB 5F99C 5DNNC 4J8WD 5CP6B 5AV5D 4DQYB 3AZNB 5DNMB 5B1MA 1P3FC 1KX5D 5B33D 1HTAA 2BYMB 4H9PA 4E45A 3AZED 3KXBA 2BG1A 3WKJD 2RVQC 2CV5B 5GSUB 2G5IC 1U35A 3LJAD 2FJ7D 3AZHB 3KUYB 1JFIB 3MGSD 4WNNB 3AZFD 4J8XD 5CPKC 5B1LD 4R8PD 2J8PA 1Z2CB 2CWEA 3X1SB 1S32A 3AV2A 4Z66D 5AY8D 5E5AB 5AV6D 5G49B 5AV9B 4WU9D 3KUYC 3AZGA 4X23A 2JE5A 5BNVB 3MGPA 3EG5B 3MGRD 2HIOD 3F6TA 3KXBC 1KX4D 3W97D 1TAFA 1P3PB 1P3OB 1ID3C 3B0BA 5B2JB 4KGCB 3LZ0A 5AV8A 5GT0B 2PYOA 3AYWD 2BYKB 2ZY4A 4J8UB 3WAAB 5KDMA 1P3BA 4WU8D 1S32C 5B0YB 3AV2C 3B6FD 5GT0C 4NE6A 3MVDC 3AZGC 4X23C 1WWIA 4XUJC 4J8VD 3MNNA 4WJ3C 4H9SA 3X1UD 3KWQB 3AN2A 3A1KA 4G92C 5B31D 3C1CA 3O62D 4J8WB 1P3IA 3AZLD 1P3GA 2F8NG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AVC A;  3VH6 W;  3AZI D;  5CPJ D;  3REH D;  1BFM A;  3KWQ C;  5B33 B;  5B32 D;  3LZ0 C;  5AV8 C;  3UTB D;  2PYO C;  3AZE B;  3REL D;  3UT9 D;  3C1B B;  3AZM A;  3WKJ B;  1H3O B;  5B31 G;  1P3B C;  1KU5 A;  3LJA B;  4ZBJ B;  1Q9C A;  2FJ7 B;  3C1B C;  3REJ D;  1P3K A;  3AZF B;  1HQ3 B;  4J8X B;  3X1V B;  4Z2M H;  1TZY A;  4R8P B;  1P3M A;  1ZLA A;  4YS3 A;  4H9S C;  4G91 B;  1P3A B;  5B40 A;  3AN2 C;  4JJN A;  4Z66 B;  5AY8 B;  4WU9 B;  3C1C C;  4QLC D;  3WTP E;  1P3I C;  3WTP D;  1HQ3 C;  3UTA B;  3X1V C;  1P3L B;  1AOI D;  5JRG A;  1BH8 A;  3REK A;  5AVC C;  1P3A C;  1KX3 D;  4UUZ B;  3MGR B;  2HIO B;  3AZK C;  5BNX A;  3TU4 A;  3AZM C;  1KX4 B;  1P3L C;  2YFW A;  4H9O A;  2IO5 B;  5CPI A;  1F1E A;  5GT3 B;  5B2I A;  3MGQ D;  3W98 A;  5FUG A;  5GXQ B;  3REI C;  1P34 D;  2NZD B;  1ZLA C;  1TZY C;  3AYW B;  3A6N D;  4KUD C;  2HUE C;  5GT3 C;  5CPK D;  4WU8 B;  5B40 C;  3NQJ B;  3AZJ B;  2NQB D;  3B6F B;  2F8N B;  3WA9 D;  4CSR B;  5GXQ C;  1M1A A;  4J8V B;  3B6G A;  5B0Z B;  5JRG C;  1P3F A;  2ARO A;  5BT1 C;  4CAY A;  4DRA A;  3X1U B;  3AZJ C;  4XZQ D;  5B1M D;  5B31 B;  5CP6 A;  3TU4 C;  1EQZ B;  5B0Z C;  3AZL B;  5DNM A;  4ZUX D;  3AZI B;  3REH B;  1U35 D;  4Z5T D;  1EQZ C;  3W98 C;  5GSU A;  3LZ1 C;  3REL B;  3AZH A;  3KUY A;  1JFI A;  4WNN A;  1M1A C;  3REJ B;  4H9Q B;  3B6G C;  3X1S A;  2ARO C;  3AZG D;  3VH5 W;  5E5A A;  5G49 A;  5AV9 A;  3MGP D;  1F66 B;  4KHA B;  5CP6 C;  4QLC B;  3AZN C;  3WTP B;  5DNM C;  1AOI B;  1ID3 A;  1KX3 B;  2CV5 C;  5GSU C;  3X1T D;  3VH6 A;  5AV8 D;  1P3P A;  1P3O A;  3W96 B;  2F8N K;  1B67 A;  4LD9 B;  5B2J A;  4KGC A;  3V9R B;  5GT0 A;  1M19 D;  3AZH C;  3MVD A;  4XUJ A;  5B24 D;  3MGQ B;  1N1J B;  2BYK A;  3B0C W;  4J8U A;  1P34 B;  3WAA A;  2JSS A;  3W96 C;  3X1S C;  4LD9 C;  3A6N B;  5B0Y A;  3VH5 T;  5E5A C;  3MNN D;  5AV9 C;  2NQB B;  3WA9 B;  3NQU B;  1P3G D;  3KWQ A;  4J8W A;  4XZQ B;  4AWL B;  5B1M B;  2YFV B;  1P3P C;  3LEL B;  1P3O C;  5B33 A;  5B2J C;  4ZUX B;  4KGC C;  4NFT A;  3AZE A;  4Z5T B;  3AFA D;  3C1B A;  1M18 D;  3WKJ A;  1H3O A;  3B0C T;  4J8U C;  3LEL C;  3WAA C;  3LJA A;  5B0Y C;  1P3K D;  1ZLA D;  1P3M D;  2FJ7 A;  4E44 A;  3W99 B;  4YS3 D;  3AZF A;  1HQ3 A;  4J8X A;  3R45 A;  5B40 D;  3X1V A;  4YM6 D;  5AV5 B;  4R8P A;  4JJN D;  1P3A A;  5C3I B;  4EO5 B;  1KX5 B;  3W99 C;  4WV4 B;  4WU9 A;  4H9R B;  4J8W C;  3REK D;  3AZK A;  3UTA A;  1P3L A;  5AV5 C;  4H9N B;  5AVB D;  5C3I C;  4UUZ A;  4NE3 A;  5B33 C;  3TU4 D;  3MGR A;  3AZE C;  3AV1 D;  1TAF B;  5B32 G;  3MGS B;  3REI A;  5CPI D;  1KX4 A;  3WKJ C;  1BH9 B;  5B1L B;  3X1T B;  5B2I D;  4KUD A;  5GT3 A;  1R4V A;  3LJA C;  4ZBJ C;  4DRB A;  2FJ7 C;  1M19 B;  5AV6 B;  5GXQ A;  2NZD A;  5KDM B;  3AZF C;  5B24 B;  4J8X C;  5B1L C;  5F99 D;  4R8P C;  5DNN D;  4G91 C;  4WU8 A;  3NQJ A;  3AZJ A;  1M1A D;  3B6F A;  4Z66 C;  2F8N A;  5AY8 C;  4WU9 C;  5AV6 C;  1P3F D;  3W97 B;  3UTA C;  4J8V A;  5B0Z A;  3VH5 A;  2RVQ D;  1P3G B;  3X1U A;  3MGR C;  2HIO C;  5B31 A;  3W97 C;  1KX4 C;  1EQZ A;  3LZ1 A;  3AZL A;  2IO5 C;  3REH A;  2NZD C;  3REL A;  3AFA B;  1M18 B;  3AYW C;  2LY8 A;  3KUY D;  4WU8 C;  3B6F C;  1P3K B;  1P3M B;  3O62 B;  4J8V C;  3AZN A;  5E5A D;  5AV9 D;  3KXB D;  4YM6 B;  4JJN B;  5JA4 B;  2BYM A;  5CPJ B;  3X1U C;  5B32 B;  2L5A A;  5B31 C;  1F66 A;  4KHA A;  3UTB B;  4QLC A;  2CV5 A;  1ID3 D;  3AZL C;  3WTP A;  4Z2M G;  3UT9 B;  1AOI A;  3AZI C;  5CPJ C;  3REH C;  5AVB B;  3KSY A;  5B32 C;  5BS7 C;  3UTB C;  1S32 D;  3AV1 B;  3REL C;  3AV2 D;  5CPI B;  5GT0 D;  3W96 A;  3MVD D;  4LD9 A;  4X23 D;  4XUJ D;  3V9R A;  3MGQ A;  1N1J A;  3REJ C;  5BNV A;  1P34 A;  5F99 B;  5DNN B;  2NQB A;  1F66 C;  1P3F B;  4QLC C;  3WA9 A;  3KWQ D;  3WTP C;  3LZ0 D;  1AOI C;  2PYO D;  1KX3 C;  4XZQ A;  1P3B D;  4HGA B;  2YFV A;  3LEL A;  5BO0 B;  4ZUX A;  3C1B D;  5CPK B;  2F8N H;  4Z5T A;  3MGQ C;  4HGA C;  3AN2 D;  1P34 C;  3C1C D;  5CHL B;  3A6N C;  1P3I D;  1HQ3 D;  3X1V D;  3W99 A;  2NQB C;  5AVC D;  1P3A D;  3WA9 C;  5AV5 A;  4H9P B;  3AZK D;  3KXB B;  1KX5 A;  3AZM D;  3UTA D;  1P3L D;  4H9R A;  1U35 B;  4XZQ C;  4AWL C;  5B1M C;  1ID3 B;  4H9N A;  4ZUX C;  3REI D;  1TZY D;  1U35 C;  4Z5T C;  4KUD D;  3MGS A;  5GT3 D;  1BH9 A;  1S32 B;  5B1L A;  3X1T A;  3AV2 B;  3MVD B;  5GXQ D;  3AZG B;  4X23 B;  2NZD D;  4XUJ B;  4Z66 A;  1M19 A;  5AY8 A;  5JRG D;  5AV6 A;  5BT1 D;  3MGP B;  5B24 A;  3AZJ D;  2F8N D;  4G92 B;  1KX5 C;  4EO5 C;  5B0Z D;  2HIO A;  3W97 A;  3MGP C;  3LZ0 B;  5AV8 B;  2PYO B;  1EQZ D;  3W98 D;  3LZ1 D;  1B6W A;  3MGS C;  1P3B B;  3AYW A;  3X1T C;  3B6G D;  1M19 C;  3MNN B;  2ARO D;  4CSR A;  5B24 C;  3AFA A;  1M18 A;  3AN2 B;  5CP6 D;  3C1C B;  1P3I B;  3AZN D;  5DNM D;  3R45 B;  3MNN C;  4NE5 A;  3O62 A;  1ULY A;  5AVC B;  4YM6 A;  3B0D B;  5JA4 A;  1F66 D;  3AZI A;  3AZK B;  5GSU D;  5CPJ A;  2CV5 D;  1P3G C;  3AZM B;  5B32 A;  5BS7 A;  3UTB A;  4M6B A;  3VH6 T;  3UT9 A;  3AZH D;  3B0D C;  5AVB A;  3REI B;  1ZLA B;  3X1S D;  1TZY B;  3W96 D;  4LD9 D;  3AV1 A;  3AFA C;  2HUE B;  4H9Q A;  3REJ A;  4YS3 B;  1M18 C;  4KUD B;  5B40 B;  1P3K C;  1P3M C;  5JRG B;  1BH8 B;  3O62 C;  3REK B;  4YS3 C;  5F99 A;  4YM6 C;  4JJN C;  5DNN A;  1KX3 A;  5BNX B;  3TU4 B;  1P3P D;  1P3O D;  3REK C;  2YFW B;  4H9O B;  5B2J D;  3UT9 C;  4KGC D;  4WZS B;  5B2I B;  1WWS A;  5AVB C;  3W98 B;  5FUG B;  3LZ1 B;  3LEL D;  4J8U D;  3WAA D;  3AV1 C;  5B0Y D;  5CPI C;  5B2I C;  5BO0 A;  3A6N A;  5CPK A;  1M1A B;  3B6G B;  2ARO B;  1A7W A;  3NQU A;  3W99 D;  4CAY B;  5F99 C;  5DNN C;  4J8W D;  5CP6 B;  5AV5 D;  3AZN B;  5DNM B;  5B1M A;  1P3F C;  1KX5 D;  5B33 D;  1HTA A;  2BYM B;  4H9P A;  4E45 A;  3AZE D;  3KXB A;  3WKJ D;  2RVQ C;  2CV5 B;  5GSU B;  1U35 A;  3LJA D;  2FJ7 D;  3AZH B;  3KUY B;  1JFI B;  3MGS D;  4WNN B;  3AZF D;  4J8X D;  5CPK C;  5B1L D;  4R8P D;  2CWE A;  3X1S B;  1S32 A;  3AV2 A;  4Z66 D;  5AY8 D;  5E5A B;  5AV6 D;  5G49 B;  5AV9 B;  4WU9 D;  3KUY C;  3AZG A;  4X23 A;  5BNV B;  3MGP A;  3MGR D;  2HIO D;  3KXB C;  3W97 D;  1KX4 D;  1TAF A;  1P3P B;  1P3O B;  1ID3 C;  3B0B A;  5B2J B;  4KGC B;  3LZ0 A;  5AV8 A;  5GT0 B;  2PYO A;  3AYW D;  2BYK B;  4J8U B;  3WAA B;  5KDM A;  1P3B A;  4WU8 D;  1S32 C;  5B0Y B;  3AV2 C;  3B6F D;  5GT0 C;  4NE6 A;  3MVD C;  3AZG C;  4X23 C;  1WWI A;  4XUJ C;  4J8V D;  3MNN A;  4H9S A;  3X1U D;  3KWQ B;  3AN2 A;  4G92 C;  5B31 D;  3C1C A;  3O62 D;  4J8W B;  1P3I A;  3AZL D;  1P3G A;  2F8N G; 
#chains in the Genus database with same CATH topology
 5AVC A;  3VH6 W;  3AZI D;  5CPJ D;  3REH D;  1BFM A;  3KWQ C;  5B33 B;  2ZY2 A;  5B32 D;  5AV8 C;  3LZ0 C;  3EPH A;  3UTB D;  2PYO C;  3AZE B;  3REL D;  3UT9 D;  3C1B B;  3AZM A;  3AL0 C;  3WKJ B;  1H3O B;  5B31 G;  1P3B C;  1KU5 A;  3LJA B;  4ZBJ B;  1Q9C A;  2FJ7 B;  3C1B C;  3REJ D;  1P3K A;  3AZF B;  1HQ3 B;  4J8X B;  3X1V B;  4Z2M H;  1TZY A;  4R8P B;  1P3M A;  1ZLA A;  4YS3 A;  2Y2Q A;  4H9S C;  4G91 B;  1P3A B;  5B40 A;  3AN2 C;  4JJN A;  4Z66 B;  5AY8 B;  4WU9 B;  3C1C C;  4QLC D;  3WTP E;  1P3I C;  2Y2G A;  3WTP D;  1HQ3 C;  3UTA B;  3X1V C;  1P3L B;  1AOI D;  5JRG A;  1BH8 A;  3REK A;  2ZY5 A;  5AVC C;  1P3A C;  1KX3 D;  4UUZ B;  3MGR B;  2HIO B;  3AZK C;  5BNX A;  3TU4 A;  3AZM C;  1KX4 B;  1P3L C;  2YFW A;  4H9O A;  2IO5 B;  5CPI A;  1F1E A;  5GT3 B;  5B2I A;  3MGQ D;  3W98 A;  5FUG A;  5GXQ B;  3REI C;  1P34 D;  2NZD B;  1ZLA C;  1TZY C;  3AYW B;  3A6N D;  4KUD C;  2HUE C;  5GT3 C;  5CPK D;  4WU8 B;  5B40 C;  3NQJ B;  3AZJ B;  2NQB D;  3B6F B;  2F8N B;  3WA9 D;  4CSR B;  5GXQ C;  1M1A A;  4J8V B;  3B6G A;  5B0Z B;  5JRG C;  1P3F A;  2ARO A;  5BT1 C;  4CAY A;  4DRA A;  3X1U B;  3AZJ C;  4XZQ D;  5B1M D;  5B31 B;  5CP6 A;  3TU4 C;  1EQZ B;  5B0Z C;  3AZL B;  5DNM A;  4ZUX D;  3AZI B;  3REH B;  1U35 D;  4Z5T D;  1EQZ C;  3W98 C;  5GSU A;  3LZ1 C;  3REL B;  3AZH A;  3KUY A;  1JFI A;  4WNN A;  3EPL A;  1M1A C;  3REJ B;  4H9Q B;  3B6G C;  3X1S A;  2ARO C;  3FDD A;  3AZG D;  3VH5 W;  5E5A A;  5G49 A;  5AV9 A;  3MGP D;  1F66 B;  4KHA B;  5CP6 C;  4QLC B;  3AZN C;  3WTP B;  5DNM C;  1AOI B;  3H0R C;  1ID3 A;  1KX3 B;  2CV5 C;  5GSU C;  3X1T D;  3VH6 A;  5AV8 D;  1P3P A;  1P3O A;  3W96 B;  3A1I A;  1B67 A;  4UPK A;  2F8N K;  5B2J A;  4KGC A;  4LD9 B;  3V9R B;  5GT0 A;  1M19 D;  3AZH C;  3MVD A;  2XD5 A;  4XUJ A;  5B24 D;  3MGQ B;  1N1J B;  2BYK A;  3B0C W;  4J8U A;  1P34 B;  3WAA A;  2JSS A;  3W96 C;  3X1S C;  4LD9 C;  3A6N B;  5B0Y A;  3VH5 T;  5E5A C;  3MNN D;  5AV9 C;  2NQB B;  3WA9 B;  3NQU B;  1P3G D;  3KWQ A;  4J8W A;  4XZQ B;  4AWL B;  5B1M B;  2YFV B;  1P3P C;  3LEL B;  1P3O C;  5B33 A;  5B2J C;  4ZUX B;  4KGC C;  4NFT A;  3AZE A;  4Z5T B;  3AFA D;  3C1B A;  1M18 D;  3WKJ A;  1H3O A;  3B0C T;  4J8U C;  3LEL C;  3WAA C;  3LJA A;  5B0Y C;  1P3K D;  1ZLA D;  1P3M D;  2FJ7 A;  4E44 A;  3W99 B;  4YS3 D;  3AZF A;  1HQ3 A;  4J8X A;  3R45 A;  5B40 D;  3X1V A;  4YM6 D;  5AV5 B;  4R8P A;  4JJN D;  3EPK A;  1P3A A;  5C3I B;  4EO5 B;  1KX5 B;  3W99 C;  4WV4 B;  4WU9 A;  4H9R B;  4J8W C;  3REK D;  3AZK A;  3UTA A;  1P3L A;  5AV5 C;  4H9N B;  5AVB D;  5C3I C;  4UUZ A;  4NE3 A;  5B33 C;  3TU4 D;  3MGR A;  3AZE C;  3AV1 D;  1TAF B;  5B32 G;  3MGS B;  3REI A;  3EPJ A;  5CPI D;  1KX4 A;  1BH9 B;  3WKJ C;  5B1L B;  3X1T B;  5B2I D;  4KUD A;  5GT3 A;  1R4V A;  3LJA C;  4ZBJ C;  3IP4 C;  4DRB A;  2FJ7 C;  1M19 B;  5AV6 B;  5GXQ A;  2NZD A;  5KDM B;  3AZF C;  5B24 B;  4J8X C;  5B1L C;  5F99 D;  4R8P C;  5DNN D;  4G91 C;  4WU8 A;  3NQJ A;  3AZJ A;  1M1A D;  3B6F A;  4Z66 C;  2F8N A;  1W2E A;  5AY8 C;  5AV6 C;  4WU9 C;  1P3F D;  3W97 B;  3UTA C;  4J8V A;  5B0Z A;  3VH5 A;  2RVQ D;  1P3G B;  2Y2H A;  3X1U A;  3MGR C;  2HIO C;  5B31 A;  3W97 C;  1KX4 C;  1EQZ A;  3LZ1 A;  3AZL A;  2IO5 C;  3REH A;  2NZD C;  3REL A;  3AFA B;  1M18 B;  3AYW C;  2LY8 A;  3KUY D;  2ZY3 A;  4WU8 C;  3B6F C;  1P3K B;  1P3M B;  2Y2L A;  3O62 B;  4J8V C;  3AZN A;  5E5A D;  5AV9 D;  3KXB D;  4YM6 B;  4JJN B;  5JA4 B;  2BYM A;  5CPJ B;  3X1U C;  5B32 B;  2L5A A;  5B31 C;  1F66 A;  4KHA A;  2DF4 C;  3UTB B;  4QLC A;  2CV5 A;  1ID3 D;  3AZL C;  3WTP A;  4Z2M G;  3UT9 B;  1AOI A;  3AZI C;  5CPJ C;  3REH C;  5AVB B;  3KSY A;  5B32 C;  5BS7 C;  3UTB C;  1S32 D;  3AV1 B;  3REL C;  3AV2 D;  5CPI B;  5GT0 D;  3H0M C;  3W96 A;  3MVD D;  4LD9 A;  4X23 D;  4XUJ D;  3V9R A;  3MGQ A;  1N1J A;  3REJ C;  5BNV A;  1P34 A;  5F99 B;  5DNN B;  2NQB A;  1F66 C;  1P3F B;  4QLC C;  3WA9 A;  3KWQ D;  3WTP C;  3LZ0 D;  1AOI C;  2PYO D;  1KX3 C;  4XZQ A;  1P3B D;  4HGA B;  2YFV A;  3LEL A;  2DQN C;  5BO0 B;  4ZUX A;  3C1B D;  5CPK B;  2F8N H;  4Z5T A;  3MGQ C;  4HGA C;  3AN2 D;  1P34 C;  3C1C D;  5CHL B;  3A6N C;  1P3I D;  1HQ3 D;  3X1V D;  3W99 A;  2NQB C;  5AVC D;  1P3A D;  3WA9 C;  5AV5 A;  4H9P B;  3AZK D;  3KXB B;  1KX5 A;  3AZM D;  3UTA D;  2Y2I A;  1P3L D;  2F2A C;  4H9R A;  1U35 B;  4XZQ C;  4AWL C;  5B1M C;  1ID3 B;  4H9N A;  4ZUX C;  3REI D;  2UWX A;  1TZY D;  1U35 C;  4Z5T C;  4KUD D;  3MGS A;  5GT3 D;  1BH9 A;  1S32 B;  5B1L A;  3X1T A;  3AV2 B;  3P5J B;  3MVD B;  5GXQ D;  3AZG B;  4X23 B;  2NZD D;  4XUJ B;  2Y2P A;  4Z66 A;  1M19 A;  5AY8 A;  5JRG D;  2Y2M A;  5AV6 A;  5BT1 D;  3MGP B;  5B24 A;  2RIQ A;  3AZJ D;  2F8N D;  4G92 B;  1KX5 C;  4EO5 C;  5B0Z D;  2HIO A;  3W97 A;  3MGP C;  2JCH A;  3LZ0 B;  5AV8 B;  2G5H C;  2PYO B;  1EQZ D;  3W98 D;  3LZ1 D;  1B6W A;  2Y2N A;  3H0L C;  3MGS C;  2XD1 A;  1P3B B;  3KFU G;  3AYW A;  3X1T C;  3B6G D;  1M19 C;  3MNN B;  2ARO D;  4CSR A;  5B24 C;  3AFA A;  1M18 A;  3AN2 B;  5CP6 D;  3C1C B;  1P3I B;  3AZN D;  5DNM D;  3R45 B;  3MNN C;  4NE5 A;  3O62 A;  1ULY A;  5AVC B;  4YM6 A;  3B0D B;  5JA4 A;  1F66 D;  3AZI A;  3AZK B;  5GSU D;  5CPJ A;  2CV5 D;  1P3G C;  3AZM B;  5B32 A;  5BS7 A;  2ZM5 A;  3UTB A;  4M6B A;  3VH6 T;  3UT9 A;  3AZH D;  3B0D C;  5AVB A;  3REI B;  1ZLA B;  3X1S D;  1TZY B;  3W96 D;  4LD9 D;  2W8S A;  3AV1 A;  3AFA C;  2HUE B;  4H9Q A;  3REJ A;  4YS3 B;  1M18 C;  2VQR A;  4KUD B;  5B40 B;  1P3K C;  1P3M C;  5JRG B;  1BH8 B;  3O62 C;  3REK B;  4YS3 C;  5F99 A;  2Y2K A;  4YM6 C;  5DNN A;  4JJN C;  2Y2J A;  1PZR A;  5BNX B;  3TU4 B;  1P3P D;  1KX3 A;  1P3O D;  1T3U A;  3REK C;  2YFW B;  4H9O B;  5B2J D;  3UT9 C;  4KGC D;  2Y2O A;  4WZS B;  5B2I B;  2FFF B;  1WWS A;  5AVB C;  3W98 B;  5FUG B;  3LZ1 B;  3LEL D;  4J8U D;  3WAA D;  3AV1 C;  5B0Y D;  5CPI C;  5B2I C;  5BO0 A;  3A6N A;  5CPK A;  1M1A B;  3B6G B;  2ARO B;  1A7W A;  3NQU A;  3W99 D;  4CAY B;  5F99 C;  5DNN C;  4J8W D;  5CP6 B;  5AV5 D;  4DQY B;  3AZN B;  5DNM B;  5B1M A;  1P3F C;  1KX5 D;  5B33 D;  1HTA A;  2BYM B;  4H9P A;  4E45 A;  3AZE D;  3KXB A;  2BG1 A;  3WKJ D;  2RVQ C;  2CV5 B;  5GSU B;  2G5I C;  1U35 A;  3LJA D;  2FJ7 D;  3AZH B;  3KUY B;  1JFI B;  3MGS D;  4WNN B;  3AZF D;  4J8X D;  5CPK C;  5B1L D;  4R8P D;  2J8P A;  1Z2C B;  2CWE A;  3X1S B;  1S32 A;  3AV2 A;  4Z66 D;  5AY8 D;  5E5A B;  5AV6 D;  5G49 B;  5AV9 B;  4WU9 D;  3KUY C;  3AZG A;  4X23 A;  2JE5 A;  5BNV B;  3MGP A;  3EG5 B;  3MGR D;  2HIO D;  3F6T A;  3KXB C;  1KX4 D;  3W97 D;  1TAF A;  1P3P B;  1P3O B;  1ID3 C;  3B0B A;  5B2J B;  4KGC B;  3LZ0 A;  5AV8 A;  5GT0 B;  2PYO A;  3AYW D;  2BYK B;  2ZY4 A;  4J8U B;  3WAA B;  5KDM A;  1P3B A;  4WU8 D;  1S32 C;  5B0Y B;  3AV2 C;  3B6F D;  5GT0 C;  4NE6 A;  3MVD C;  3AZG C;  4X23 C;  1WWI A;  4XUJ C;  4J8V D;  3MNN A;  4WJ3 C;  4H9S A;  3X1U D;  3KWQ B;  3AN2 A;  3A1K A;  4G92 C;  5B31 D;  3C1C A;  3O62 D;  4J8W B;  1P3I A;  3AZL D;  1P3G A;  2F8N G; 
#chains in the Genus database with same CATH homology
 5AVC A;  3VH6 W;  3AZI D;  5CPJ D;  3REH D;  1BFM A;  3KWQ C;  5B33 B;  2ZY2 A;  5B32 D;  5AV8 C;  3LZ0 C;  3EPH A;  3UTB D;  2PYO C;  3AZE B;  3REL D;  3UT9 D;  3C1B B;  3AZM A;  3AL0 C;  3WKJ B;  1H3O B;  5B31 G;  1P3B C;  1KU5 A;  3LJA B;  4ZBJ B;  1Q9C A;  2FJ7 B;  3C1B C;  3REJ D;  1P3K A;  3AZF B;  1HQ3 B;  4J8X B;  3X1V B;  4Z2M H;  1TZY A;  4R8P B;  1P3M A;  1ZLA A;  4YS3 A;  2Y2Q A;  4H9S C;  4G91 B;  1P3A B;  5B40 A;  3AN2 C;  4JJN A;  4Z66 B;  5AY8 B;  4WU9 B;  3C1C C;  4QLC D;  3WTP E;  1P3I C;  2Y2G A;  3WTP D;  1HQ3 C;  3UTA B;  3X1V C;  1P3L B;  1AOI D;  5JRG A;  1BH8 A;  3REK A;  2ZY5 A;  5AVC C;  1P3A C;  1KX3 D;  4UUZ B;  3MGR B;  2HIO B;  3AZK C;  5BNX A;  3TU4 A;  3AZM C;  1KX4 B;  1P3L C;  2YFW A;  4H9O A;  2IO5 B;  5CPI A;  1F1E A;  5GT3 B;  5B2I A;  3MGQ D;  3W98 A;  5FUG A;  5GXQ B;  3REI C;  1P34 D;  2NZD B;  1ZLA C;  1TZY C;  3AYW B;  3A6N D;  4KUD C;  2HUE C;  5GT3 C;  5CPK D;  4WU8 B;  5B40 C;  3NQJ B;  3AZJ B;  2NQB D;  3B6F B;  2F8N B;  3WA9 D;  4CSR B;  5GXQ C;  1M1A A;  4J8V B;  3B6G A;  5B0Z B;  5JRG C;  1P3F A;  2ARO A;  5BT1 C;  4CAY A;  4DRA A;  3X1U B;  3AZJ C;  4XZQ D;  5B1M D;  5B31 B;  5CP6 A;  3TU4 C;  1EQZ B;  5B0Z C;  3AZL B;  5DNM A;  4ZUX D;  3AZI B;  3REH B;  1U35 D;  4Z5T D;  1EQZ C;  3W98 C;  5GSU A;  3LZ1 C;  3REL B;  3AZH A;  3KUY A;  1JFI A;  4WNN A;  3EPL A;  1M1A C;  3REJ B;  4H9Q B;  3B6G C;  3X1S A;  2ARO C;  3FDD A;  3AZG D;  3VH5 W;  5E5A A;  5G49 A;  5AV9 A;  3MGP D;  1F66 B;  4KHA B;  5CP6 C;  4QLC B;  3AZN C;  3WTP B;  5DNM C;  1AOI B;  3H0R C;  1ID3 A;  1KX3 B;  2CV5 C;  5GSU C;  3X1T D;  3VH6 A;  5AV8 D;  1P3P A;  1P3O A;  3W96 B;  3A1I A;  1B67 A;  4UPK A;  2F8N K;  5B2J A;  4KGC A;  4LD9 B;  3V9R B;  5GT0 A;  1M19 D;  3AZH C;  3MVD A;  2XD5 A;  4XUJ A;  5B24 D;  3MGQ B;  1N1J B;  2BYK A;  3B0C W;  4J8U A;  1P34 B;  3WAA A;  2JSS A;  3W96 C;  3X1S C;  4LD9 C;  3A6N B;  5B0Y A;  3VH5 T;  5E5A C;  3MNN D;  5AV9 C;  2NQB B;  3WA9 B;  3NQU B;  1P3G D;  3KWQ A;  4J8W A;  4XZQ B;  4AWL B;  5B1M B;  2YFV B;  1P3P C;  3LEL B;  1P3O C;  5B33 A;  5B2J C;  4ZUX B;  4KGC C;  4NFT A;  3AZE A;  4Z5T B;  3AFA D;  3C1B A;  1M18 D;  3WKJ A;  1H3O A;  3B0C T;  4J8U C;  3LEL C;  3WAA C;  3LJA A;  5B0Y C;  1P3K D;  1ZLA D;  1P3M D;  2FJ7 A;  4E44 A;  3W99 B;  4YS3 D;  3AZF A;  1HQ3 A;  4J8X A;  3R45 A;  5B40 D;  3X1V A;  4YM6 D;  5AV5 B;  4R8P A;  4JJN D;  3EPK A;  1P3A A;  5C3I B;  4EO5 B;  1KX5 B;  3W99 C;  4WV4 B;  4WU9 A;  4H9R B;  4J8W C;  3REK D;  3AZK A;  3UTA A;  1P3L A;  5AV5 C;  4H9N B;  5AVB D;  5C3I C;  4UUZ A;  4NE3 A;  5B33 C;  3TU4 D;  3MGR A;  3AZE C;  3AV1 D;  1TAF B;  5B32 G;  3MGS B;  3REI A;  3EPJ A;  5CPI D;  1KX4 A;  1BH9 B;  3WKJ C;  5B1L B;  3X1T B;  5B2I D;  4KUD A;  5GT3 A;  1R4V A;  3LJA C;  4ZBJ C;  3IP4 C;  4DRB A;  2FJ7 C;  1M19 B;  5AV6 B;  5GXQ A;  2NZD A;  5KDM B;  3AZF C;  5B24 B;  4J8X C;  5B1L C;  5F99 D;  4R8P C;  5DNN D;  4G91 C;  4WU8 A;  3NQJ A;  3AZJ A;  1M1A D;  3B6F A;  4Z66 C;  2F8N A;  1W2E A;  5AY8 C;  5AV6 C;  4WU9 C;  1P3F D;  3W97 B;  3UTA C;  4J8V A;  5B0Z A;  3VH5 A;  2RVQ D;  1P3G B;  2Y2H A;  3X1U A;  3MGR C;  2HIO C;  5B31 A;  3W97 C;  1KX4 C;  1EQZ A;  3LZ1 A;  3AZL A;  2IO5 C;  3REH A;  2NZD C;  3REL A;  3AFA B;  1M18 B;  3AYW C;  2LY8 A;  3KUY D;  2ZY3 A;  4WU8 C;  3B6F C;  1P3K B;  1P3M B;  2Y2L A;  3O62 B;  4J8V C;  3AZN A;  5E5A D;  5AV9 D;  3KXB D;  4YM6 B;  4JJN B;  5JA4 B;  2BYM A;  5CPJ B;  3X1U C;  5B32 B;  2L5A A;  5B31 C;  1F66 A;  4KHA A;  2DF4 C;  3UTB B;  4QLC A;  2CV5 A;  1ID3 D;  3AZL C;  3WTP A;  4Z2M G;  3UT9 B;  1AOI A;  3AZI C;  5CPJ C;  3REH C;  5AVB B;  3KSY A;  5B32 C;  5BS7 C;  3UTB C;  1S32 D;  3AV1 B;  3REL C;  3AV2 D;  5CPI B;  5GT0 D;  3H0M C;  3W96 A;  3MVD D;  4LD9 A;  4X23 D;  4XUJ D;  3V9R A;  3MGQ A;  1N1J A;  3REJ C;  5BNV A;  1P34 A;  5F99 B;  5DNN B;  2NQB A;  1F66 C;  1P3F B;  4QLC C;  3WA9 A;  3KWQ D;  3WTP C;  3LZ0 D;  1AOI C;  2PYO D;  1KX3 C;  4XZQ A;  1P3B D;  4HGA B;  2YFV A;  3LEL A;  2DQN C;  5BO0 B;  4ZUX A;  3C1B D;  5CPK B;  2F8N H;  4Z5T A;  3MGQ C;  4HGA C;  3AN2 D;  1P34 C;  3C1C D;  5CHL B;  3A6N C;  1P3I D;  1HQ3 D;  3X1V D;  3W99 A;  2NQB C;  5AVC D;  1P3A D;  3WA9 C;  5AV5 A;  4H9P B;  3AZK D;  3KXB B;  1KX5 A;  3AZM D;  3UTA D;  2Y2I A;  1P3L D;  2F2A C;  4H9R A;  1U35 B;  4XZQ C;  4AWL C;  5B1M C;  1ID3 B;  4H9N A;  4ZUX C;  3REI D;  2UWX A;  1TZY D;  1U35 C;  4Z5T C;  4KUD D;  3MGS A;  5GT3 D;  1BH9 A;  1S32 B;  5B1L A;  3X1T A;  3AV2 B;  3P5J B;  3MVD B;  5GXQ D;  3AZG B;  4X23 B;  2NZD D;  4XUJ B;  2Y2P A;  4Z66 A;  1M19 A;  5AY8 A;  5JRG D;  2Y2M A;  5AV6 A;  5BT1 D;  3MGP B;  5B24 A;  2RIQ A;  3AZJ D;  2F8N D;  4G92 B;  1KX5 C;  4EO5 C;  5B0Z D;  2HIO A;  3W97 A;  3MGP C;  2JCH A;  3LZ0 B;  5AV8 B;  2G5H C;  2PYO B;  1EQZ D;  3W98 D;  3LZ1 D;  1B6W A;  2Y2N A;  3H0L C;  3MGS C;  2XD1 A;  1P3B B;  3KFU G;  3AYW A;  3X1T C;  3B6G D;  1M19 C;  3MNN B;  2ARO D;  4CSR A;  5B24 C;  3AFA A;  1M18 A;  3AN2 B;  5CP6 D;  3C1C B;  1P3I B;  3AZN D;  5DNM D;  3R45 B;  3MNN C;  4NE5 A;  3O62 A;  1ULY A;  5AVC B;  4YM6 A;  3B0D B;  5JA4 A;  1F66 D;  3AZI A;  3AZK B;  5GSU D;  5CPJ A;  2CV5 D;  1P3G C;  3AZM B;  5B32 A;  5BS7 A;  2ZM5 A;  3UTB A;  4M6B A;  3VH6 T;  3UT9 A;  3AZH D;  3B0D C;  5AVB A;  3REI B;  1ZLA B;  3X1S D;  1TZY B;  3W96 D;  4LD9 D;  2W8S A;  3AV1 A;  3AFA C;  2HUE B;  4H9Q A;  3REJ A;  4YS3 B;  1M18 C;  2VQR A;  4KUD B;  5B40 B;  1P3K C;  1P3M C;  5JRG B;  1BH8 B;  3O62 C;  3REK B;  4YS3 C;  5F99 A;  2Y2K A;  4YM6 C;  5DNN A;  4JJN C;  2Y2J A;  1PZR A;  5BNX B;  3TU4 B;  1P3P D;  1KX3 A;  1P3O D;  1T3U A;  3REK C;  2YFW B;  4H9O B;  5B2J D;  3UT9 C;  4KGC D;  2Y2O A;  4WZS B;  5B2I B;  2FFF B;  1WWS A;  5AVB C;  3W98 B;  5FUG B;  3LZ1 B;  3LEL D;  4J8U D;  3WAA D;  3AV1 C;  5B0Y D;  5CPI C;  5B2I C;  5BO0 A;  3A6N A;  5CPK A;  1M1A B;  3B6G B;  2ARO B;  1A7W A;  3NQU A;  3W99 D;  4CAY B;  5F99 C;  5DNN C;  4J8W D;  5CP6 B;  5AV5 D;  4DQY B;  3AZN B;  5DNM B;  5B1M A;  1P3F C;  1KX5 D;  5B33 D;  1HTA A;  2BYM B;  4H9P A;  4E45 A;  3AZE D;  3KXB A;  2BG1 A;  3WKJ D;  2RVQ C;  2CV5 B;  5GSU B;  2G5I C;  1U35 A;  3LJA D;  2FJ7 D;  3AZH B;  3KUY B;  1JFI B;  3MGS D;  4WNN B;  3AZF D;  4J8X D;  5CPK C;  5B1L D;  4R8P D;  2J8P A;  1Z2C B;  2CWE A;  3X1S B;  1S32 A;  3AV2 A;  4Z66 D;  5AY8 D;  5E5A B;  5AV6 D;  5G49 B;  5AV9 B;  4WU9 D;  3KUY C;  3AZG A;  4X23 A;  2JE5 A;  5BNV B;  3MGP A;  3EG5 B;  3MGR D;  2HIO D;  3F6T A;  3KXB C;  1KX4 D;  3W97 D;  1TAF A;  1P3P B;  1P3O B;  1ID3 C;  3B0B A;  5B2J B;  4KGC B;  3LZ0 A;  5AV8 A;  5GT0 B;  2PYO A;  3AYW D;  2BYK B;  2ZY4 A;  4J8U B;  3WAA B;  5KDM A;  1P3B A;  4WU8 D;  1S32 C;  5B0Y B;  3AV2 C;  3B6F D;  5GT0 C;  4NE6 A;  3MVD C;  3AZG C;  4X23 C;  1WWI A;  4XUJ C;  4J8V D;  3MNN A;  4WJ3 C;  4H9S A;  3X1U D;  3KWQ B;  3AN2 A;  3A1K A;  4G92 C;  5B31 D;  3C1C A;  3O62 D;  4J8W B;  1P3I A;  3AZL D;  1P3G A;  2F8N G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...