4H9NA

Complex structure 1 of daxx/h3.3(sub5)/h4
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
98
structure length
98
Chain Sequence
KPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEAAEAFLVALFEDTNLCTIHAKRVTIFPKDIQLARRIRGER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein/apoptosis
molecule keywords Histone H3.3
publication title DAXX chaperone envelops an H3.3/H4 dimer dictating H3.3-specific read out
rcsb
source organism Homo sapiens
total genus 28
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2012-09-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4h9nA00
3REHA 3WTPE 3LELB 5AV5C 1KU5A 5GT0B 4KUDA 5AY8A 1M18B 1P3BC 3C1BA 3AZNC 5DNND 3R45B 4M6BA 5CPJA 4H9QA 4H9RA 5AV5D 3AFAC 1S32B 4J8XC 1EQZD 3B6FA 3AZGA 3W99A 1P3BD 3AZFA 1BH9B 3UT9C 5B40C 3AZND 3W98B 3AZLA 4DRAA 4H9SA 4KHAA 4E44A 5GSUA 3LJAB 3C1CC 4ZUXA 3AFAD 2AROB 4Z5TC 4J8XD 2NZDB 5C3IC 5GT3B 3UT9D 5B40D 5AV8A 1P3KA 5CPKC 3AZHC 4J8UA 3LZ0C 4YM6B 3MNNC 3C1CD 3C1BD 4Z5TD 4ZBJB 5GXQA 3B0CW 5G49B 2BYKA 3X1TC 5B0ZB 3KWQC 4J8WC 1M1AA 5CPKD 4G91B 3B6GB 3W97C 3AZHD 3AZKC 3LZ0D 5B32B 3REIA 3MNND 3AZEC 3B0BA 3NQJB 4AWLB 3X1TD 4WU9D 3KWQD 4J8WD 4J8VB 3RELA 5AV9B 1KX5C 1P3LA 3W97D 4ZUXD 4H9NA 4JJNA 3AZKD 3AV2A 4Z66C 3AZIB 4QLCA 1AOIC 3AZED 5JA4A 5AV6B 1P3KD 2CV5A 3X1VB 3MGSC 1P3IC 1P34A 5B31A 3KUYA 1KX5D 4X23B 3REKC 2NQBA 3UTAA 3X1SA 4Z66D 3WTPB 2HIOC 1AOID 5BNXA 5B33C 5B2IA 3O62A 3AN2B 4LD9C 5AVBB 3MGSD 3WAAB 1P3ID 3WKJC 3REKD 2YFWB 2HUEB 3KXBA 2HIOD 5B33D 1P3FC 5FUGB 3REJB 2AROC 5F99B 5B1MB 1P3MB 4LD9D 4HGAB 5B2JC 3WKJD 5B1LB 5B0YC 3MGRC 5DNMB 3MGPB 1M19C 5CPIB 5JRGB 3UTBB 4KGCB 1HQ3C 5AVCC 1P3FD 1KX3B 3B0DB 3REHB 5BNVA 2PYOC 5B2JD 5B31G 3A6NC 3X1SD 5AV5A 5B0YD 3MGRD 1HTAA 1EQZA 5AY8B 3W96B 4KUDB 3MVDC 1P3BA 1M19D 3AZNA 1WWSA 3X1UC 1HQ3D 2LY8A 5AVCD 5CPJB 4H9QB 2PYOD 1ID3C 4H9RB 3A6ND 3AFAA 4J8XA 4R8PC 5B24C 4H9OA 3AZGB 3B6FB 3W99B 3AZFB 3MVDD 4E45A 3UT9A 5B40A 3X1UD 1U35C 4XUJC 1ID3D 5GSUB 3TU4C 3C1CA 5BO0A 4Z5TA 4R8PD 5B24D 4X23C 5AV8B 3AZJC 5CPKA 1U35D 4XUJD 3AZHA 4J8UB 3TU4D 3LZ0A 4XZQB 4YS3C 3MNNA 5AVBC 2BYKB 1TZYC 3X1TA 1M1AB 4X23D 4WU9A 3KWQA 4J8WA 1P3PC 1P3AC 3AZJD 3W97A 3REIB 1P3OB 3AZKA 3VH5W 4YS3D 1F66C 1P3GC 3AZEA 5CP6C 5AVBD 1TZYD 4EO5B 3VH6T 3RELB 1P3PD 1P3AD 5DNMC 1P3LB 1KX5A 2YFVA 4H9NB 4JJNB 3AZMC 3AV2B 3WA9C 1KX3C 1F66D 4QLCB 4Z66A 1P3GD 5JA4B 1N1JA 3VH5A 1AOIA 5CP6D 2CV5B 3LZ1C 3W96C 3AV1C 2IO5C 3MGSA 4NE3A 3KUYB 4G92B 1P34B 1P3IA 3REKA 2NQBB 3UTAB 1ZLAC 3AZMD 3R45A 4WU8C 3WA9D 4H9PA 3MGQC 2HIOA 5BNXB 5B2IB 5B33A 4NFTA 3O62B 3LZ1D 1TAFB 1A7WA 3AYWC 4WZSB 1KX4B 3AV1D 3W96D 4DRBA 4LD9A 2F8ND 2FJ7C 3WKJA 1BH9A 2F8NH 3KXBB 1ZLAD 4WU8D 3LELC 4CAYA 3MGQD 5GT0C 1P3FA 1M18C 3AYWD 2AROA 5B2JA 2FJ7D 5B0YA 3MGRA 5BS7C 1BFMA 3LELD 1M19A 5DNNB 1S32C 1HQ3A 5GT0D 4UUZB 4XZQC 5AVCA 1M18D 5BNVB 2PYOA 3W98C 3A6NA 5AV5B 1EQZB 1P3BB 3LJAC 3MVDA 3AZNB 3X1UA 4CSRA 1P3OC 1S32D 2NZDC 4XZQD 5GT3C 5KDMA 1ID3A 5E5AB 3W98D 4J8XB 4H9OB 4R8PA 5B24A 3B0CT 3LJAD 3UT9B 5B40B 4YM6C 1B6WA 2AROD 4ZBJC 2NZDD 1U35A 4XUJA 5GT3D 5B0ZC 3TU4A 3C1CB 5BO0B 4G91C 3C1BB 4Z5TB 3B6GC 5C3IB 5B32C 4YM6D 4X23A 5CPKB 3AZJA 4AWLC 5B0ZD 3AZHB 4J8VC 3LZ0B 3MNNB 5AV9C 4YS3A 1KX4C 3B6GD 3NQUA 1R4VA 3KSYA 1B67A 5AVBA 1JFIA 3X1TB 1TZYA 2BYMA 3AZLB 5B32D 3KWQB 4J8WB 4WU9B 3AZIC 1P3PA 1P3AA 5B32G 2RVQC 4KHAB 5AV6C 1BH8A 3W97B 4ZUXB 4J8VD 3AZKB 3X1VC 5AV9D 1F66A 3AZEB 1P3GA 5CP6A 1P3KB 1H3OA 3AZID 3WTPC 2RVQD 5DNMA 5AV6D 3AN2C 2YFVB 5DNNC 5GXQB 3AZMA 3X1VD 3WA9A 4Z66B 3WAAC 1KX3A 1N1JB 4NE5A 1AOIB 2HUEC 1EQZC 3LZ1A 3W96A 3WTPD 3V9RA 3MGSB 3AV1A 2F8NA 1P3IB 3REKB 4Z2MG 4Z2MH 3AN2D 3REJC 5F99C 5B1MC 1P3MC 4WU8A 4HGAC 1ZLAA 4H9PB 3WAAD 2HIOB 3MGQA 5E5AC 5B1LC 5B33B 3MGPC 3AYWA 4LD9B 5CPIC 5JRGC 3UTBC 2FJ7A 4WNNA 4KGCC 3WKJB 1F1EA 3B0DC 3REHC 3REJD 5F99D 5B1MD 1P3MD 1ULYA 4CAYB 3LELA 5E5AD 5B1LD 4KUDC 5AY8C 5GT0A 5DNMD 1P3FB 3MGPD 3C1BC 5B31B 1M18A 5CPID 5JRGD 5B2JB 3UTBD 4KGCD 3X1SB 5CPJC 5B0YB 3MGRB 1KX3D 3REHD 5BS7A 1M19B 1HQ3B 1S32A 4KUDD 5AVCB 3B6FC 5AY8D 3W99C 4XZQA 5BT1C 3AZGC 3AZFC 2PYOB 2F8NG 3W98A 2L5AA 3A6NB 3AZLC 4WU9C 5CPJD 4H9SC 5GSUC 3MVDB 3LJAA 4ZUXC 3X1UB 4CSRB 1P3OA 3B6FD 2NZDA 3W99D 5BT1D 3AZGD 5KDMB 3AZFD 4NE6A 5GT3A 1ID3B 5AV8C 1P3KC 5CHLB 3AZLD 4R8PB 5B24B 5GSUD 4J8UC 4YM6A 5GXQC 1U35B 4XUJB 5G49A 1M1AC 5B0ZA 3TU4B 5AV8D 3VH5T 3B6GA 4J8UD 3REIC 5B32A 5GXQD 3AZJB 3NQJA 1WWIA 4EO5C 1M1AD 2F8NK 3AFAB 3RELC 4J8VA 4YS3B 5AV9A 3NQUB 1TAFA 1KX4A 1P3LC 1JFIB 1TZYB 2BYMB 4JJNC 3REID 3AV2C 1P3OD 4QLCC 1P3AB 3AZIA 1P3PB 5AV6A 1BH8B 2CV5C 3RELD 3X1VA 1F66B 4G92C 5B31C 3KUYC 1P34C 1P3GB 2CWEA 1P3LD 5CP6B 2NQBC 4JJND 1H3OB 3UTAC 3AV2D 3X1SC 4QLCD 3WTPA 5B2IC 3O62C 3VH6W 2CV5D 1Q9CA 3AN2A 5DNNA 3AZMB 2JSSA 3WA9B 4UUZA 1P34D 5B31D 3KUYD 3WAAA 2NQBD 2YFWA 3KXBC 3UTAD 3LZ1B 3AV1B 2IO5B 3V9RB 2F8NB 5B2ID 3O62D 5FUGA 4WV4B 3REJA 1KX4D 5F99A 5B1MA 4WU8B 3VH6A 1P3MA 1ZLAB 3MGQB 5E5AA 5B1LA 3KXBD 3MGPA 3AYWB 1KX5B 5CPIA 5JRGA 2FJ7B 4WNNB 3UTBA 4KGCA
chains in the Genus database with same CATH superfamily
3REHA 3WTPE 3LELB 5AV5C 1KU5A 5GT0B 4DQYB 4KUDA 5AY8A 1M18B 1P3BC 3C1BA 3AZNC 5DNND 3R45B 4M6BA 5CPJA 4H9QA 4H9RA 5AV5D 3AFAC 1S32B 4J8XC 1EQZD 3B6FA 3AZGA 3W99A 1P3BD 3AZFA 1BH9B 3UT9C 5B40C 3AZND 3W98B 3AZLA 4DRAA 4H9SA 4KHAA 4E44A 5GSUA 3LJAB 1T3UA 3C1CC 4ZUXA 3AFAD 2AROB 4Z5TC 4J8XD 2NZDB 5C3IC 5GT3B 3UT9D 5B40D 5AV8A 1P3KA 5CPKC 3AZHC 4J8UA 3LZ0C 4YM6B 3MNNC 3C1CD 3C1BD 4Z5TD 4ZBJB 5GXQA 3B0CW 5G49B 2BYKA 3X1TC 5B0ZB 3KWQC 4J8WC 1M1AA 5CPKD 3EPLA 4G91B 3B6GB 3W97C 3AZHD 3AZKC 3LZ0D 5B32B 3REIA 3MNND 3EPKA 3AZEC 3B0BA 3NQJB 4AWLB 3X1TD 4WU9D 3KWQD 4J8WD 4J8VB 3RELA 4UPKA 5AV9B 1KX5C 1P3LA 3W97D 4ZUXD 4H9NA 4JJNA 3AZKD 3AV2A 4Z66C 3AZIB 4QLCA 1AOIC 3AZED 5JA4A 5AV6B 1P3KD 2CV5A 3X1VB 2J8PA 3MGSC 1P3IC 1P34A 5B31A 3KUYA 1KX5D 4X23B 3REKC 2NQBA 3UTAA 3X1SA 4Z66D 3WTPB 2HIOC 1AOID 5BNXA 5B33C 5B2IA 3O62A 3AN2B 4LD9C 3A1IA 5AVBB 3MGSD 3WAAB 1P3ID 3WKJC 3REKD 2YFWB 2HUEB 3KXBA 2HIOD 5B33D 3H0LC 1P3FC 5FUGB 3REJB 2AROC 2ZY2A 5B1MB 5F99B 1P3MB 4LD9D 4HGAB 5B2JC 2Y2GA 3WKJD 5B1LB 2Y2IA 5B0YC 3MGRC 5DNMB 3MGPB 1M19C 5CPIB 5JRGB 3UTBB 4KGCB 1HQ3C 5AVCC 2G5IC 1P3FD 1KX3B 3B0DB 3REHB 5BNVA 2PYOC 5B2JD 5B31G 3A6NC 2ZM5A 3X1SD 5AV5A 5B0YD 3MGRD 1HTAA 1EQZA 5AY8B 3W96B 4KUDB 3MVDC 1P3BA 1M19D 3AZNA 1WWSA 3X1UC 2RIQA 1HQ3D 2LY8A 5AVCD 5CPJB 4H9QB 2PYOD 1ID3C 4H9RB 3A6ND 3AFAA 4J8XA 4R8PC 5B24C 4H9OA 3AZGB 3B6FB 3W99B 3AZFB 3MVDD 4E45A 3UT9A 5B40A 3X1UD 2ZY3A 1U35C 4XUJC 1ID3D 5GSUB 2W8SA 3TU4C 2XD1A 3C1CA 5BO0A 4Z5TA 4R8PD 5B24D 4X23C 5AV8B 3AZJC 5CPKA 1U35D 4XUJD 3AZHA 4J8UB 3TU4D 3LZ0A 4XZQB 4YS3C 3MNNA 5AVBC 2BYKB 1TZYC 3X1TA 1M1AB 4X23D 3EPJA 3KWQA 4J8WA 4WU9A 1P3PC 1P3AC 3AZJD 3W97A 3REIB 1P3OB 3AZKA 3VH5W 4YS3D 1F66C 1P3GC 3AZEA 5CP6C 5AVBD 1TZYD 4EO5B 3VH6T 3RELB 1P3PD 1P3AD 5DNMC 1P3LB 1KX5A 2YFVA 4H9NB 4JJNB 3EPHA 3AZMC 3AV2B 3WA9C 1KX3C 1F66D 4QLCB 4Z66A 1P3GD 5JA4B 1N1JA 3VH5A 1AOIA 5CP6D 3H0MC 2CV5B 2XD5A 3FDDA 3LZ1C 2Y2PA 3W96C 3AV1C 2IO5C 3MGSA 4NE3A 3KUYB 4G92B 1P34B 1P3IA 2DQNC 3REKA 2NQBB 3UTAB 1ZLAC 3AZMD 3R45A 4WU8C 3WA9D 4H9PA 3MGQC 2HIOA 5BNXB 5B2IB 5B33A 4NFTA 3O62B 3F6TA 1TAFB 1A7WA 3LZ1D 4WZSB 3AYWC 3AV1D 1KX4B 4DRBA 3W96D 2F8ND 2FJ7C 4LD9A 3WKJA 1BH9A 2F8NH 3KXBB 2VQRA 4WU8D 1ZLAD 2Y2MA 3LELC 4CAYA 3MGQD 5GT0C 1P3FA 1M18C 3AYWD 2AROA 2ZY4A 2Y2HA 5B2JA 2FJ7D 5B0YA 3MGRA 5BS7C 1BFMA 1W2EA 3LELD 1M19A 5DNNB 1S32C 1HQ3A 5GT0D 4UUZB 4XZQC 5AVCA 1M18D 5BNVB 2PYOA 3W98C 2Y2KA 3A6NA 5AV5B 1EQZB 1P3BB 3LJAC 3MVDA 3AZNB 3X1UA 4CSRA 1P3OC 1S32D 2NZDC 4XZQD 5GT3C 5KDMA 1ID3A 5E5AB 3W98D 2BG1A 4J8XB 4H9OB 4R8PA 5B24A 3B0CT 3LJAD 3UT9B 5B40B 4YM6C 1B6WA 2AROD 2JCHA 4ZBJC 2NZDD 1U35A 4XUJA 5GT3D 5B0ZC 2Y2JA 3TU4A 3C1CB 5BO0B 4G91C 3C1BB 2Y2QA 4Z5TB 3B6GC 3P5JB 5C3IB 5B32C 4YM6D 4X23A 5CPKB 3AZJA 4AWLC 1Z2CB 5B0ZD 3AZHB 4J8VC 3LZ0B 3MNNB 5AV9C 4YS3A 1KX4C 3B6GD 3NQUA 1R4VA 3KSYA 1B67A 5AVBA 1JFIA 3X1TB 1TZYA 2BYMA 3AZLB 5B32D 3KWQB 4J8WB 4WU9B 3AZIC 1P3PA 1P3AA 5B32G 2RVQC 4KHAB 5AV6C 1BH8A 3W97B 4ZUXB 4J8VD 3AZKB 3X1VC 5AV9D 1F66A 3AZEB 1P3GA 5CP6A 1P3KB 1H3OA 3A1KA 3AZID 3WTPC 2RVQD 2Y2OA 5DNMA 5AV6D 3AN2C 2YFVB 5DNNC 5GXQB 3AZMA 3X1VD 3WA9A 4Z66B 3WAAC 1KX3A 1N1JB 4NE5A 1AOIB 2HUEC 1EQZC 3LZ1A 3W96A 3WTPD 3V9RA 3MGSB 3AV1A 2F8NA 1P3IB 3REKB 4Z2MG 4Z2MH 3AN2D 3REJC 5F99C 5B1MC 1P3MC 4WU8A 4HGAC 1ZLAA 4H9PB 3WAAD 2HIOB 3MGQA 5E5AC 5B1LC 5B33B 1PZRA 3MGPC 3AYWA 4LD9B 5CPIC 5JRGC 3UTBC 2FJ7A 4WNNA 4KGCC 3WKJB 1F1EA 3B0DC 3REHC 3REJD 5F99D 5B1MD 1P3MD 1ULYA 4CAYB 3LELA 5E5AD 5B1LD 3AL0C 4KUDC 5AY8C 5GT0A 5DNMD 1P3FB 3MGPD 3C1BC 5B31B 1M18A 5CPID 5JRGD 5B2JB 3UTBD 4KGCD 3X1SB 5CPJC 2Y2LA 3H0RC 5B0YB 3MGRB 3REHD 1KX3D 5BS7A 1M19B 1HQ3B 2F2AC 1S32A 5AVCB 3B6FC 5AY8D 3W99C 4XZQA 5BT1C 3AZGC 4KUDD 3AZFC 2PYOB 2F8NG 3W98A 2L5AA 3A6NB 3AZLC 4WU9C 5CPJD 4H9SC 5GSUC 3MVDB 3LJAA 4ZUXC 3X1UB 4CSRB 4WJ3C 1P3OA 3B6FD 2NZDA 3W99D 5BT1D 3AZGD 5KDMB 3AZFD 4NE6A 5GT3A 2Y2NA 1ID3B 5AV8C 1P3KC 5CHLB 3AZLD 4R8PB 5B24B 5GSUD 4J8UC 2G5HC 4YM6A 5GXQC 1U35B 4XUJB 5G49A 1M1AC 5B0ZA 3TU4B 5AV8D 3VH5T 2DF4C 3KFUG 3B6GA 4J8UD 3EG5B 3REIC 5B32A 5GXQD 3AZJB 3NQJA 1WWIA 4EO5C 2JE5A 1M1AD 2F8NK 3AFAB 3RELC 4J8VA 4YS3B 5AV9A 3NQUB 1TAFA 1KX4A 1P3LC 1JFIB 1TZYB 2BYMB 4JJNC 3REID 3AV2C 1P3OD 2ZY5A 4QLCC 1P3AB 3AZIA 1P3PB 5AV6A 1BH8B 2UWXA 2CV5C 3RELD 3X1VA 1F66B 4G92C 5B31C 3KUYC 1P34C 1P3GB 3IP4C 2CWEA 1P3LD 5CP6B 2NQBC 4JJND 1H3OB 3UTAC 3AV2D 3X1SC 4QLCD 3WTPA 5B2IC 3O62C 3VH6W 2CV5D 1Q9CA 3AN2A 5DNNA 3AZMB 2JSSA 3WA9B 4UUZA 1P34D 5B31D 3KUYD 3WAAA 2NQBD 2YFWA 3KXBC 3UTAD 2FFFB 3LZ1B 3AV1B 2IO5B 3V9RB 2F8NB 5B2ID 3O62D 5FUGA 4WV4B 3REJA 1KX4D 5F99A 5B1MA 4WU8B 3VH6A 1P3MA 1ZLAB 3MGQB 5E5AA 5B1LA 3KXBD 3MGPA 3AYWB 1KX5B 5CPIA 5JRGA 2FJ7B 4WNNB 3UTBA 4KGCA
chains in the Genus database with same CATH topology
3REHA 3WTPE 3LELB 5AV5C 1KU5A 5GT0B 4DQYB 4KUDA 5AY8A 1M18B 1P3BC 3C1BA 3AZNC 5DNND 3R45B 4M6BA 5CPJA 4H9QA 4H9RA 5AV5D 3AFAC 1S32B 4J8XC 1EQZD 3B6FA 3AZGA 3W99A 1P3BD 3AZFA 1BH9B 3UT9C 5B40C 3AZND 3W98B 3AZLA 4DRAA 4H9SA 4KHAA 4E44A 5GSUA 3LJAB 1T3UA 3C1CC 4ZUXA 3AFAD 2AROB 4Z5TC 4J8XD 2NZDB 5C3IC 5GT3B 3UT9D 5B40D 5AV8A 1P3KA 5CPKC 3AZHC 4J8UA 3LZ0C 4YM6B 3MNNC 3C1CD 3C1BD 4Z5TD 4ZBJB 5GXQA 3B0CW 5G49B 2BYKA 3X1TC 5B0ZB 3KWQC 4J8WC 1M1AA 5CPKD 3EPLA 4G91B 3B6GB 3W97C 3AZHD 3AZKC 3LZ0D 5B32B 3REIA 3MNND 3EPKA 3AZEC 3B0BA 3NQJB 4AWLB 3X1TD 4WU9D 3KWQD 4J8WD 4J8VB 3RELA 4UPKA 5AV9B 1KX5C 1P3LA 3W97D 4ZUXD 4H9NA 4JJNA 3AZKD 3AV2A 4Z66C 3AZIB 4QLCA 1AOIC 3AZED 5JA4A 5AV6B 1P3KD 2CV5A 3X1VB 2J8PA 3MGSC 1P3IC 1P34A 5B31A 3KUYA 1KX5D 4X23B 3REKC 2NQBA 3UTAA 3X1SA 4Z66D 3WTPB 2HIOC 1AOID 5BNXA 5B33C 5B2IA 3O62A 3AN2B 4LD9C 3A1IA 5AVBB 3MGSD 3WAAB 1P3ID 3WKJC 3REKD 2YFWB 2HUEB 3KXBA 2HIOD 5B33D 3H0LC 1P3FC 5FUGB 3REJB 2AROC 2ZY2A 5B1MB 5F99B 1P3MB 4LD9D 4HGAB 5B2JC 2Y2GA 3WKJD 5B1LB 2Y2IA 5B0YC 3MGRC 5DNMB 3MGPB 1M19C 5CPIB 5JRGB 3UTBB 4KGCB 1HQ3C 5AVCC 2G5IC 1P3FD 1KX3B 3B0DB 3REHB 5BNVA 2PYOC 5B2JD 5B31G 3A6NC 2ZM5A 3X1SD 5AV5A 5B0YD 3MGRD 1HTAA 1EQZA 5AY8B 3W96B 4KUDB 3MVDC 1P3BA 1M19D 3AZNA 1WWSA 3X1UC 2RIQA 1HQ3D 2LY8A 5AVCD 5CPJB 4H9QB 2PYOD 1ID3C 4H9RB 3A6ND 3AFAA 4J8XA 4R8PC 5B24C 4H9OA 3AZGB 3B6FB 3W99B 3AZFB 3MVDD 4E45A 3UT9A 5B40A 3X1UD 2ZY3A 1U35C 4XUJC 1ID3D 5GSUB 2W8SA 3TU4C 2XD1A 3C1CA 5BO0A 4Z5TA 4R8PD 5B24D 4X23C 5AV8B 3AZJC 5CPKA 1U35D 4XUJD 3AZHA 4J8UB 3TU4D 3LZ0A 4XZQB 4YS3C 3MNNA 5AVBC 2BYKB 1TZYC 3X1TA 1M1AB 4X23D 3EPJA 3KWQA 4J8WA 4WU9A 1P3PC 1P3AC 3AZJD 3W97A 3REIB 1P3OB 3AZKA 3VH5W 4YS3D 1F66C 1P3GC 3AZEA 5CP6C 5AVBD 1TZYD 4EO5B 3VH6T 3RELB 1P3PD 1P3AD 5DNMC 1P3LB 1KX5A 2YFVA 4H9NB 4JJNB 3EPHA 3AZMC 3AV2B 3WA9C 1KX3C 1F66D 4QLCB 4Z66A 1P3GD 5JA4B 1N1JA 3VH5A 1AOIA 5CP6D 3H0MC 2CV5B 2XD5A 3FDDA 3LZ1C 2Y2PA 3W96C 3AV1C 2IO5C 3MGSA 4NE3A 3KUYB 4G92B 1P34B 1P3IA 2DQNC 3REKA 2NQBB 3UTAB 1ZLAC 3AZMD 3R45A 4WU8C 3WA9D 4H9PA 3MGQC 2HIOA 5BNXB 5B2IB 5B33A 4NFTA 3O62B 3F6TA 1TAFB 1A7WA 3LZ1D 4WZSB 3AYWC 3AV1D 1KX4B 4DRBA 3W96D 2F8ND 2FJ7C 4LD9A 3WKJA 1BH9A 2F8NH 3KXBB 2VQRA 4WU8D 1ZLAD 2Y2MA 3LELC 4CAYA 3MGQD 5GT0C 1P3FA 1M18C 3AYWD 2AROA 2ZY4A 2Y2HA 5B2JA 2FJ7D 5B0YA 3MGRA 5BS7C 1BFMA 1W2EA 3LELD 1M19A 5DNNB 1S32C 1HQ3A 5GT0D 4UUZB 4XZQC 5AVCA 1M18D 5BNVB 2PYOA 3W98C 2Y2KA 3A6NA 5AV5B 1EQZB 1P3BB 3LJAC 3MVDA 3AZNB 3X1UA 4CSRA 1P3OC 1S32D 2NZDC 4XZQD 5GT3C 5KDMA 1ID3A 5E5AB 3W98D 2BG1A 4J8XB 4H9OB 4R8PA 5B24A 3B0CT 3LJAD 3UT9B 5B40B 4YM6C 1B6WA 2AROD 2JCHA 4ZBJC 2NZDD 1U35A 4XUJA 5GT3D 5B0ZC 2Y2JA 3TU4A 3C1CB 5BO0B 4G91C 3C1BB 2Y2QA 4Z5TB 3B6GC 3P5JB 5C3IB 5B32C 4YM6D 4X23A 5CPKB 3AZJA 4AWLC 1Z2CB 5B0ZD 3AZHB 4J8VC 3LZ0B 3MNNB 5AV9C 4YS3A 1KX4C 3B6GD 3NQUA 1R4VA 3KSYA 1B67A 5AVBA 1JFIA 3X1TB 1TZYA 2BYMA 3AZLB 5B32D 3KWQB 4J8WB 4WU9B 3AZIC 1P3PA 1P3AA 5B32G 2RVQC 4KHAB 5AV6C 1BH8A 3W97B 4ZUXB 4J8VD 3AZKB 3X1VC 5AV9D 1F66A 3AZEB 1P3GA 5CP6A 1P3KB 1H3OA 3A1KA 3AZID 3WTPC 2RVQD 2Y2OA 5DNMA 5AV6D 3AN2C 2YFVB 5DNNC 5GXQB 3AZMA 3X1VD 3WA9A 4Z66B 3WAAC 1KX3A 1N1JB 4NE5A 1AOIB 2HUEC 1EQZC 3LZ1A 3W96A 3WTPD 3V9RA 3MGSB 3AV1A 2F8NA 1P3IB 3REKB 4Z2MG 4Z2MH 3AN2D 3REJC 5F99C 5B1MC 1P3MC 4WU8A 4HGAC 1ZLAA 4H9PB 3WAAD 2HIOB 3MGQA 5E5AC 5B1LC 5B33B 1PZRA 3MGPC 3AYWA 4LD9B 5CPIC 5JRGC 3UTBC 2FJ7A 4WNNA 4KGCC 3WKJB 1F1EA 3B0DC 3REHC 3REJD 5F99D 5B1MD 1P3MD 1ULYA 4CAYB 3LELA 5E5AD 5B1LD 3AL0C 4KUDC 5AY8C 5GT0A 5DNMD 1P3FB 3MGPD 3C1BC 5B31B 1M18A 5CPID 5JRGD 5B2JB 3UTBD 4KGCD 3X1SB 5CPJC 2Y2LA 3H0RC 5B0YB 3MGRB 3REHD 1KX3D 5BS7A 1M19B 1HQ3B 2F2AC 1S32A 5AVCB 3B6FC 5AY8D 3W99C 4XZQA 5BT1C 3AZGC 4KUDD 3AZFC 2PYOB 2F8NG 3W98A 2L5AA 3A6NB 3AZLC 4WU9C 5CPJD 4H9SC 5GSUC 3MVDB 3LJAA 4ZUXC 3X1UB 4CSRB 4WJ3C 1P3OA 3B6FD 2NZDA 3W99D 5BT1D 3AZGD 5KDMB 3AZFD 4NE6A 5GT3A 2Y2NA 1ID3B 5AV8C 1P3KC 5CHLB 3AZLD 4R8PB 5B24B 5GSUD 4J8UC 2G5HC 4YM6A 5GXQC 1U35B 4XUJB 5G49A 1M1AC 5B0ZA 3TU4B 5AV8D 3VH5T 2DF4C 3KFUG 3B6GA 4J8UD 3EG5B 3REIC 5B32A 5GXQD 3AZJB 3NQJA 1WWIA 4EO5C 2JE5A 1M1AD 2F8NK 3AFAB 3RELC 4J8VA 4YS3B 5AV9A 3NQUB 1TAFA 1KX4A 1P3LC 1JFIB 1TZYB 2BYMB 4JJNC 3REID 3AV2C 1P3OD 2ZY5A 4QLCC 1P3AB 3AZIA 1P3PB 5AV6A 1BH8B 2UWXA 2CV5C 3RELD 3X1VA 1F66B 4G92C 5B31C 3KUYC 1P34C 1P3GB 3IP4C 2CWEA 1P3LD 5CP6B 2NQBC 4JJND 1H3OB 3UTAC 3AV2D 3X1SC 4QLCD 3WTPA 5B2IC 3O62C 3VH6W 2CV5D 1Q9CA 3AN2A 5DNNA 3AZMB 2JSSA 3WA9B 4UUZA 1P34D 5B31D 3KUYD 3WAAA 2NQBD 2YFWA 3KXBC 3UTAD 2FFFB 3LZ1B 3AV1B 2IO5B 3V9RB 2F8NB 5B2ID 3O62D 5FUGA 4WV4B 3REJA 1KX4D 5F99A 5B1MA 4WU8B 3VH6A 1P3MA 1ZLAB 3MGQB 5E5AA 5B1LA 3KXBD 3MGPA 3AYWB 1KX5B 5CPIA 5JRGA 2FJ7B 4WNNB 3UTBA 4KGCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3REH A;  3WTP E;  3LEL B;  5AV5 C;  1KU5 A;  5GT0 B;  4KUD A;  5AY8 A;  1M18 B;  1P3B C;  3C1B A;  3AZN C;  5DNN D;  3R45 B;  4M6B A;  5CPJ A;  4H9Q A;  4H9R A;  5AV5 D;  3AFA C;  1S32 B;  4J8X C;  1EQZ D;  3B6F A;  3AZG A;  3W99 A;  1P3B D;  3AZF A;  1BH9 B;  3UT9 C;  5B40 C;  3AZN D;  3W98 B;  3AZL A;  4DRA A;  4H9S A;  4KHA A;  4E44 A;  5GSU A;  3LJA B;  3C1C C;  4ZUX A;  3AFA D;  2ARO B;  4Z5T C;  4J8X D;  2NZD B;  5C3I C;  5GT3 B;  3UT9 D;  5B40 D;  5AV8 A;  1P3K A;  5CPK C;  3AZH C;  4J8U A;  3LZ0 C;  4YM6 B;  3MNN C;  3C1C D;  3C1B D;  4Z5T D;  4ZBJ B;  5GXQ A;  3B0C W;  5G49 B;  2BYK A;  3X1T C;  5B0Z B;  3KWQ C;  4J8W C;  1M1A A;  5CPK D;  4G91 B;  3B6G B;  3W97 C;  3AZH D;  3AZK C;  3LZ0 D;  5B32 B;  3REI A;  3MNN D;  3AZE C;  3B0B A;  3NQJ B;  4AWL B;  3X1T D;  4WU9 D;  3KWQ D;  4J8W D;  4J8V B;  3REL A;  5AV9 B;  1KX5 C;  1P3L A;  3W97 D;  4ZUX D;  4H9N A;  4JJN A;  3AZK D;  3AV2 A;  4Z66 C;  3AZI B;  4QLC A;  1AOI C;  3AZE D;  5JA4 A;  5AV6 B;  1P3K D;  2CV5 A;  3X1V B;  3MGS C;  1P3I C;  1P34 A;  5B31 A;  3KUY A;  1KX5 D;  4X23 B;  3REK C;  2NQB A;  3UTA A;  3X1S A;  4Z66 D;  3WTP B;  2HIO C;  1AOI D;  5BNX A;  5B33 C;  5B2I A;  3O62 A;  3AN2 B;  4LD9 C;  5AVB B;  3MGS D;  3WAA B;  1P3I D;  3WKJ C;  3REK D;  2YFW B;  2HUE B;  3KXB A;  2HIO D;  5B33 D;  1P3F C;  5FUG B;  3REJ B;  2ARO C;  5F99 B;  5B1M B;  1P3M B;  4LD9 D;  4HGA B;  5B2J C;  3WKJ D;  5B1L B;  5B0Y C;  3MGR C;  5DNM B;  3MGP B;  1M19 C;  5CPI B;  5JRG B;  3UTB B;  4KGC B;  1HQ3 C;  5AVC C;  1P3F D;  1KX3 B;  3B0D B;  3REH B;  5BNV A;  2PYO C;  5B2J D;  5B31 G;  3A6N C;  3X1S D;  5AV5 A;  5B0Y D;  3MGR D;  1HTA A;  1EQZ A;  5AY8 B;  3W96 B;  4KUD B;  3MVD C;  1P3B A;  1M19 D;  3AZN A;  1WWS A;  3X1U C;  1HQ3 D;  2LY8 A;  5AVC D;  5CPJ B;  4H9Q B;  2PYO D;  1ID3 C;  4H9R B;  3A6N D;  3AFA A;  4J8X A;  4R8P C;  5B24 C;  4H9O A;  3AZG B;  3B6F B;  3W99 B;  3AZF B;  3MVD D;  4E45 A;  3UT9 A;  5B40 A;  3X1U D;  1U35 C;  4XUJ C;  1ID3 D;  5GSU B;  3TU4 C;  3C1C A;  5BO0 A;  4Z5T A;  4R8P D;  5B24 D;  4X23 C;  5AV8 B;  3AZJ C;  5CPK A;  1U35 D;  4XUJ D;  3AZH A;  4J8U B;  3TU4 D;  3LZ0 A;  4XZQ B;  4YS3 C;  3MNN A;  5AVB C;  2BYK B;  1TZY C;  3X1T A;  1M1A B;  4X23 D;  4WU9 A;  3KWQ A;  4J8W A;  1P3P C;  1P3A C;  3AZJ D;  3W97 A;  3REI B;  1P3O B;  3AZK A;  3VH5 W;  4YS3 D;  1F66 C;  1P3G C;  3AZE A;  5CP6 C;  5AVB D;  1TZY D;  4EO5 B;  3VH6 T;  3REL B;  1P3P D;  1P3A D;  5DNM C;  1P3L B;  1KX5 A;  2YFV A;  4H9N B;  4JJN B;  3AZM C;  3AV2 B;  3WA9 C;  1KX3 C;  1F66 D;  4QLC B;  4Z66 A;  1P3G D;  5JA4 B;  1N1J A;  3VH5 A;  1AOI A;  5CP6 D;  2CV5 B;  3LZ1 C;  3W96 C;  3AV1 C;  2IO5 C;  3MGS A;  4NE3 A;  3KUY B;  4G92 B;  1P34 B;  1P3I A;  3REK A;  2NQB B;  3UTA B;  1ZLA C;  3AZM D;  3R45 A;  4WU8 C;  3WA9 D;  4H9P A;  3MGQ C;  2HIO A;  5BNX B;  5B2I B;  5B33 A;  4NFT A;  3O62 B;  3LZ1 D;  1TAF B;  1A7W A;  3AYW C;  4WZS B;  1KX4 B;  3AV1 D;  3W96 D;  4DRB A;  4LD9 A;  2F8N D;  2FJ7 C;  3WKJ A;  1BH9 A;  2F8N H;  3KXB B;  1ZLA D;  4WU8 D;  3LEL C;  4CAY A;  3MGQ D;  5GT0 C;  1P3F A;  1M18 C;  3AYW D;  2ARO A;  5B2J A;  2FJ7 D;  5B0Y A;  3MGR A;  5BS7 C;  1BFM A;  3LEL D;  1M19 A;  5DNN B;  1S32 C;  1HQ3 A;  5GT0 D;  4UUZ B;  4XZQ C;  5AVC A;  1M18 D;  5BNV B;  2PYO A;  3W98 C;  3A6N A;  5AV5 B;  1EQZ B;  1P3B B;  3LJA C;  3MVD A;  3AZN B;  3X1U A;  4CSR A;  1P3O C;  1S32 D;  2NZD C;  4XZQ D;  5GT3 C;  5KDM A;  1ID3 A;  5E5A B;  3W98 D;  4J8X B;  4H9O B;  4R8P A;  5B24 A;  3B0C T;  3LJA D;  3UT9 B;  5B40 B;  4YM6 C;  1B6W A;  2ARO D;  4ZBJ C;  2NZD D;  1U35 A;  4XUJ A;  5GT3 D;  5B0Z C;  3TU4 A;  3C1C B;  5BO0 B;  4G91 C;  3C1B B;  4Z5T B;  3B6G C;  5C3I B;  5B32 C;  4YM6 D;  4X23 A;  5CPK B;  3AZJ A;  4AWL C;  5B0Z D;  3AZH B;  4J8V C;  3LZ0 B;  3MNN B;  5AV9 C;  4YS3 A;  1KX4 C;  3B6G D;  3NQU A;  1R4V A;  3KSY A;  1B67 A;  5AVB A;  1JFI A;  3X1T B;  1TZY A;  2BYM A;  3AZL B;  5B32 D;  3KWQ B;  4J8W B;  4WU9 B;  3AZI C;  1P3P A;  1P3A A;  5B32 G;  2RVQ C;  4KHA B;  5AV6 C;  1BH8 A;  3W97 B;  4ZUX B;  4J8V D;  3AZK B;  3X1V C;  5AV9 D;  1F66 A;  3AZE B;  1P3G A;  5CP6 A;  1P3K B;  1H3O A;  3AZI D;  3WTP C;  2RVQ D;  5DNM A;  5AV6 D;  3AN2 C;  2YFV B;  5DNN C;  5GXQ B;  3AZM A;  3X1V D;  3WA9 A;  4Z66 B;  3WAA C;  1KX3 A;  1N1J B;  4NE5 A;  1AOI B;  2HUE C;  1EQZ C;  3LZ1 A;  3W96 A;  3WTP D;  3V9R A;  3MGS B;  3AV1 A;  2F8N A;  1P3I B;  3REK B;  4Z2M G;  4Z2M H;  3AN2 D;  3REJ C;  5F99 C;  5B1M C;  1P3M C;  4WU8 A;  4HGA C;  1ZLA A;  4H9P B;  3WAA D;  2HIO B;  3MGQ A;  5E5A C;  5B1L C;  5B33 B;  3MGP C;  3AYW A;  4LD9 B;  5CPI C;  5JRG C;  3UTB C;  2FJ7 A;  4WNN A;  4KGC C;  3WKJ B;  1F1E A;  3B0D C;  3REH C;  3REJ D;  5F99 D;  5B1M D;  1P3M D;  1ULY A;  4CAY B;  3LEL A;  5E5A D;  5B1L D;  4KUD C;  5AY8 C;  5GT0 A;  5DNM D;  1P3F B;  3MGP D;  3C1B C;  5B31 B;  1M18 A;  5CPI D;  5JRG D;  5B2J B;  3UTB D;  4KGC D;  3X1S B;  5CPJ C;  5B0Y B;  3MGR B;  1KX3 D;  3REH D;  5BS7 A;  1M19 B;  1HQ3 B;  1S32 A;  4KUD D;  5AVC B;  3B6F C;  5AY8 D;  3W99 C;  4XZQ A;  5BT1 C;  3AZG C;  3AZF C;  2PYO B;  2F8N G;  3W98 A;  2L5A A;  3A6N B;  3AZL C;  4WU9 C;  5CPJ D;  4H9S C;  5GSU C;  3MVD B;  3LJA A;  4ZUX C;  3X1U B;  4CSR B;  1P3O A;  3B6F D;  2NZD A;  3W99 D;  5BT1 D;  3AZG D;  5KDM B;  3AZF D;  4NE6 A;  5GT3 A;  1ID3 B;  5AV8 C;  1P3K C;  5CHL B;  3AZL D;  4R8P B;  5B24 B;  5GSU D;  4J8U C;  4YM6 A;  5GXQ C;  1U35 B;  4XUJ B;  5G49 A;  1M1A C;  5B0Z A;  3TU4 B;  5AV8 D;  3VH5 T;  3B6G A;  4J8U D;  3REI C;  5B32 A;  5GXQ D;  3AZJ B;  3NQJ A;  1WWI A;  4EO5 C;  1M1A D;  2F8N K;  3AFA B;  3REL C;  4J8V A;  4YS3 B;  5AV9 A;  3NQU B;  1TAF A;  1KX4 A;  1P3L C;  1JFI B;  1TZY B;  2BYM B;  4JJN C;  3REI D;  3AV2 C;  1P3O D;  4QLC C;  1P3A B;  3AZI A;  1P3P B;  5AV6 A;  1BH8 B;  2CV5 C;  3REL D;  3X1V A;  1F66 B;  4G92 C;  5B31 C;  3KUY C;  1P34 C;  1P3G B;  2CWE A;  1P3L D;  5CP6 B;  2NQB C;  4JJN D;  1H3O B;  3UTA C;  3AV2 D;  3X1S C;  4QLC D;  3WTP A;  5B2I C;  3O62 C;  3VH6 W;  2CV5 D;  1Q9C A;  3AN2 A;  5DNN A;  3AZM B;  2JSS A;  3WA9 B;  4UUZ A;  1P34 D;  5B31 D;  3KUY D;  3WAA A;  2NQB D;  2YFW A;  3KXB C;  3UTA D;  3LZ1 B;  3AV1 B;  2IO5 B;  3V9R B;  2F8N B;  5B2I D;  3O62 D;  5FUG A;  4WV4 B;  3REJ A;  1KX4 D;  5F99 A;  5B1M A;  4WU8 B;  3VH6 A;  1P3M A;  1ZLA B;  3MGQ B;  5E5A A;  5B1L A;  3KXB D;  3MGP A;  3AYW B;  1KX5 B;  5CPI A;  5JRG A;  2FJ7 B;  4WNN B;  3UTB A;  4KGC A; 
#chains in the Genus database with same CATH topology
 3REH A;  3WTP E;  3LEL B;  5AV5 C;  1KU5 A;  5GT0 B;  4DQY B;  4KUD A;  5AY8 A;  1M18 B;  1P3B C;  3C1B A;  3AZN C;  5DNN D;  3R45 B;  4M6B A;  5CPJ A;  4H9Q A;  4H9R A;  5AV5 D;  3AFA C;  1S32 B;  4J8X C;  1EQZ D;  3B6F A;  3AZG A;  3W99 A;  1P3B D;  3AZF A;  1BH9 B;  3UT9 C;  5B40 C;  3AZN D;  3W98 B;  3AZL A;  4DRA A;  4H9S A;  4KHA A;  4E44 A;  5GSU A;  3LJA B;  1T3U A;  3C1C C;  4ZUX A;  3AFA D;  2ARO B;  4Z5T C;  4J8X D;  2NZD B;  5C3I C;  5GT3 B;  3UT9 D;  5B40 D;  5AV8 A;  1P3K A;  5CPK C;  3AZH C;  4J8U A;  3LZ0 C;  4YM6 B;  3MNN C;  3C1C D;  3C1B D;  4Z5T D;  4ZBJ B;  5GXQ A;  3B0C W;  5G49 B;  2BYK A;  3X1T C;  5B0Z B;  3KWQ C;  4J8W C;  1M1A A;  5CPK D;  3EPL A;  4G91 B;  3B6G B;  3W97 C;  3AZH D;  3AZK C;  3LZ0 D;  5B32 B;  3REI A;  3MNN D;  3EPK A;  3AZE C;  3B0B A;  3NQJ B;  4AWL B;  3X1T D;  4WU9 D;  3KWQ D;  4J8W D;  4J8V B;  3REL A;  4UPK A;  5AV9 B;  1KX5 C;  1P3L A;  3W97 D;  4ZUX D;  4H9N A;  4JJN A;  3AZK D;  3AV2 A;  4Z66 C;  3AZI B;  4QLC A;  1AOI C;  3AZE D;  5JA4 A;  5AV6 B;  1P3K D;  2CV5 A;  3X1V B;  2J8P A;  3MGS C;  1P3I C;  1P34 A;  5B31 A;  3KUY A;  1KX5 D;  4X23 B;  3REK C;  2NQB A;  3UTA A;  3X1S A;  4Z66 D;  3WTP B;  2HIO C;  1AOI D;  5BNX A;  5B33 C;  5B2I A;  3O62 A;  3AN2 B;  4LD9 C;  3A1I A;  5AVB B;  3MGS D;  3WAA B;  1P3I D;  3WKJ C;  3REK D;  2YFW B;  2HUE B;  3KXB A;  2HIO D;  5B33 D;  3H0L C;  1P3F C;  5FUG B;  3REJ B;  2ARO C;  2ZY2 A;  5B1M B;  5F99 B;  1P3M B;  4LD9 D;  4HGA B;  5B2J C;  2Y2G A;  3WKJ D;  5B1L B;  2Y2I A;  5B0Y C;  3MGR C;  5DNM B;  3MGP B;  1M19 C;  5CPI B;  5JRG B;  3UTB B;  4KGC B;  1HQ3 C;  5AVC C;  2G5I C;  1P3F D;  1KX3 B;  3B0D B;  3REH B;  5BNV A;  2PYO C;  5B2J D;  5B31 G;  3A6N C;  2ZM5 A;  3X1S D;  5AV5 A;  5B0Y D;  3MGR D;  1HTA A;  1EQZ A;  5AY8 B;  3W96 B;  4KUD B;  3MVD C;  1P3B A;  1M19 D;  3AZN A;  1WWS A;  3X1U C;  2RIQ A;  1HQ3 D;  2LY8 A;  5AVC D;  5CPJ B;  4H9Q B;  2PYO D;  1ID3 C;  4H9R B;  3A6N D;  3AFA A;  4J8X A;  4R8P C;  5B24 C;  4H9O A;  3AZG B;  3B6F B;  3W99 B;  3AZF B;  3MVD D;  4E45 A;  3UT9 A;  5B40 A;  3X1U D;  2ZY3 A;  1U35 C;  4XUJ C;  1ID3 D;  5GSU B;  2W8S A;  3TU4 C;  2XD1 A;  3C1C A;  5BO0 A;  4Z5T A;  4R8P D;  5B24 D;  4X23 C;  5AV8 B;  3AZJ C;  5CPK A;  1U35 D;  4XUJ D;  3AZH A;  4J8U B;  3TU4 D;  3LZ0 A;  4XZQ B;  4YS3 C;  3MNN A;  5AVB C;  2BYK B;  1TZY C;  3X1T A;  1M1A B;  4X23 D;  3EPJ A;  3KWQ A;  4J8W A;  4WU9 A;  1P3P C;  1P3A C;  3AZJ D;  3W97 A;  3REI B;  1P3O B;  3AZK A;  3VH5 W;  4YS3 D;  1F66 C;  1P3G C;  3AZE A;  5CP6 C;  5AVB D;  1TZY D;  4EO5 B;  3VH6 T;  3REL B;  1P3P D;  1P3A D;  5DNM C;  1P3L B;  1KX5 A;  2YFV A;  4H9N B;  4JJN B;  3EPH A;  3AZM C;  3AV2 B;  3WA9 C;  1KX3 C;  1F66 D;  4QLC B;  4Z66 A;  1P3G D;  5JA4 B;  1N1J A;  3VH5 A;  1AOI A;  5CP6 D;  3H0M C;  2CV5 B;  2XD5 A;  3FDD A;  3LZ1 C;  2Y2P A;  3W96 C;  3AV1 C;  2IO5 C;  3MGS A;  4NE3 A;  3KUY B;  4G92 B;  1P34 B;  1P3I A;  2DQN C;  3REK A;  2NQB B;  3UTA B;  1ZLA C;  3AZM D;  3R45 A;  4WU8 C;  3WA9 D;  4H9P A;  3MGQ C;  2HIO A;  5BNX B;  5B2I B;  5B33 A;  4NFT A;  3O62 B;  3F6T A;  1TAF B;  1A7W A;  3LZ1 D;  4WZS B;  3AYW C;  3AV1 D;  1KX4 B;  4DRB A;  3W96 D;  2F8N D;  2FJ7 C;  4LD9 A;  3WKJ A;  1BH9 A;  2F8N H;  3KXB B;  2VQR A;  4WU8 D;  1ZLA D;  2Y2M A;  3LEL C;  4CAY A;  3MGQ D;  5GT0 C;  1P3F A;  1M18 C;  3AYW D;  2ARO A;  2ZY4 A;  2Y2H A;  5B2J A;  2FJ7 D;  5B0Y A;  3MGR A;  5BS7 C;  1BFM A;  1W2E A;  3LEL D;  1M19 A;  5DNN B;  1S32 C;  1HQ3 A;  5GT0 D;  4UUZ B;  4XZQ C;  5AVC A;  1M18 D;  5BNV B;  2PYO A;  3W98 C;  2Y2K A;  3A6N A;  5AV5 B;  1EQZ B;  1P3B B;  3LJA C;  3MVD A;  3AZN B;  3X1U A;  4CSR A;  1P3O C;  1S32 D;  2NZD C;  4XZQ D;  5GT3 C;  5KDM A;  1ID3 A;  5E5A B;  3W98 D;  2BG1 A;  4J8X B;  4H9O B;  4R8P A;  5B24 A;  3B0C T;  3LJA D;  3UT9 B;  5B40 B;  4YM6 C;  1B6W A;  2ARO D;  2JCH A;  4ZBJ C;  2NZD D;  1U35 A;  4XUJ A;  5GT3 D;  5B0Z C;  2Y2J A;  3TU4 A;  3C1C B;  5BO0 B;  4G91 C;  3C1B B;  2Y2Q A;  4Z5T B;  3B6G C;  3P5J B;  5C3I B;  5B32 C;  4YM6 D;  4X23 A;  5CPK B;  3AZJ A;  4AWL C;  1Z2C B;  5B0Z D;  3AZH B;  4J8V C;  3LZ0 B;  3MNN B;  5AV9 C;  4YS3 A;  1KX4 C;  3B6G D;  3NQU A;  1R4V A;  3KSY A;  1B67 A;  5AVB A;  1JFI A;  3X1T B;  1TZY A;  2BYM A;  3AZL B;  5B32 D;  3KWQ B;  4J8W B;  4WU9 B;  3AZI C;  1P3P A;  1P3A A;  5B32 G;  2RVQ C;  4KHA B;  5AV6 C;  1BH8 A;  3W97 B;  4ZUX B;  4J8V D;  3AZK B;  3X1V C;  5AV9 D;  1F66 A;  3AZE B;  1P3G A;  5CP6 A;  1P3K B;  1H3O A;  3A1K A;  3AZI D;  3WTP C;  2RVQ D;  2Y2O A;  5DNM A;  5AV6 D;  3AN2 C;  2YFV B;  5DNN C;  5GXQ B;  3AZM A;  3X1V D;  3WA9 A;  4Z66 B;  3WAA C;  1KX3 A;  1N1J B;  4NE5 A;  1AOI B;  2HUE C;  1EQZ C;  3LZ1 A;  3W96 A;  3WTP D;  3V9R A;  3MGS B;  3AV1 A;  2F8N A;  1P3I B;  3REK B;  4Z2M G;  4Z2M H;  3AN2 D;  3REJ C;  5F99 C;  5B1M C;  1P3M C;  4WU8 A;  4HGA C;  1ZLA A;  4H9P B;  3WAA D;  2HIO B;  3MGQ A;  5E5A C;  5B1L C;  5B33 B;  1PZR A;  3MGP C;  3AYW A;  4LD9 B;  5CPI C;  5JRG C;  3UTB C;  2FJ7 A;  4WNN A;  4KGC C;  3WKJ B;  1F1E A;  3B0D C;  3REH C;  3REJ D;  5F99 D;  5B1M D;  1P3M D;  1ULY A;  4CAY B;  3LEL A;  5E5A D;  5B1L D;  3AL0 C;  4KUD C;  5AY8 C;  5GT0 A;  5DNM D;  1P3F B;  3MGP D;  3C1B C;  5B31 B;  1M18 A;  5CPI D;  5JRG D;  5B2J B;  3UTB D;  4KGC D;  3X1S B;  5CPJ C;  2Y2L A;  3H0R C;  5B0Y B;  3MGR B;  3REH D;  1KX3 D;  5BS7 A;  1M19 B;  1HQ3 B;  2F2A C;  1S32 A;  5AVC B;  3B6F C;  5AY8 D;  3W99 C;  4XZQ A;  5BT1 C;  3AZG C;  4KUD D;  3AZF C;  2PYO B;  2F8N G;  3W98 A;  2L5A A;  3A6N B;  3AZL C;  4WU9 C;  5CPJ D;  4H9S C;  5GSU C;  3MVD B;  3LJA A;  4ZUX C;  3X1U B;  4CSR B;  4WJ3 C;  1P3O A;  3B6F D;  2NZD A;  3W99 D;  5BT1 D;  3AZG D;  5KDM B;  3AZF D;  4NE6 A;  5GT3 A;  2Y2N A;  1ID3 B;  5AV8 C;  1P3K C;  5CHL B;  3AZL D;  4R8P B;  5B24 B;  5GSU D;  4J8U C;  2G5H C;  4YM6 A;  5GXQ C;  1U35 B;  4XUJ B;  5G49 A;  1M1A C;  5B0Z A;  3TU4 B;  5AV8 D;  3VH5 T;  2DF4 C;  3KFU G;  3B6G A;  4J8U D;  3EG5 B;  3REI C;  5B32 A;  5GXQ D;  3AZJ B;  3NQJ A;  1WWI A;  4EO5 C;  2JE5 A;  1M1A D;  2F8N K;  3AFA B;  3REL C;  4J8V A;  4YS3 B;  5AV9 A;  3NQU B;  1TAF A;  1KX4 A;  1P3L C;  1JFI B;  1TZY B;  2BYM B;  4JJN C;  3REI D;  3AV2 C;  1P3O D;  2ZY5 A;  4QLC C;  1P3A B;  3AZI A;  1P3P B;  5AV6 A;  1BH8 B;  2UWX A;  2CV5 C;  3REL D;  3X1V A;  1F66 B;  4G92 C;  5B31 C;  3KUY C;  1P34 C;  1P3G B;  3IP4 C;  2CWE A;  1P3L D;  5CP6 B;  2NQB C;  4JJN D;  1H3O B;  3UTA C;  3AV2 D;  3X1S C;  4QLC D;  3WTP A;  5B2I C;  3O62 C;  3VH6 W;  2CV5 D;  1Q9C A;  3AN2 A;  5DNN A;  3AZM B;  2JSS A;  3WA9 B;  4UUZ A;  1P34 D;  5B31 D;  3KUY D;  3WAA A;  2NQB D;  2YFW A;  3KXB C;  3UTA D;  2FFF B;  3LZ1 B;  3AV1 B;  2IO5 B;  3V9R B;  2F8N B;  5B2I D;  3O62 D;  5FUG A;  4WV4 B;  3REJ A;  1KX4 D;  5F99 A;  5B1M A;  4WU8 B;  3VH6 A;  1P3M A;  1ZLA B;  3MGQ B;  5E5A A;  5B1L A;  3KXB D;  3MGP A;  3AYW B;  1KX5 B;  5CPI A;  5JRG A;  2FJ7 B;  4WNN B;  3UTB A;  4KGC A; 
#chains in the Genus database with same CATH homology
 3REH A;  3WTP E;  3LEL B;  5AV5 C;  1KU5 A;  5GT0 B;  4DQY B;  4KUD A;  5AY8 A;  1M18 B;  1P3B C;  3C1B A;  3AZN C;  5DNN D;  3R45 B;  4M6B A;  5CPJ A;  4H9Q A;  4H9R A;  5AV5 D;  3AFA C;  1S32 B;  4J8X C;  1EQZ D;  3B6F A;  3AZG A;  3W99 A;  1P3B D;  3AZF A;  1BH9 B;  3UT9 C;  5B40 C;  3AZN D;  3W98 B;  3AZL A;  4DRA A;  4H9S A;  4KHA A;  4E44 A;  5GSU A;  3LJA B;  1T3U A;  3C1C C;  4ZUX A;  3AFA D;  2ARO B;  4Z5T C;  4J8X D;  2NZD B;  5C3I C;  5GT3 B;  3UT9 D;  5B40 D;  5AV8 A;  1P3K A;  5CPK C;  3AZH C;  4J8U A;  3LZ0 C;  4YM6 B;  3MNN C;  3C1C D;  3C1B D;  4Z5T D;  4ZBJ B;  5GXQ A;  3B0C W;  5G49 B;  2BYK A;  3X1T C;  5B0Z B;  3KWQ C;  4J8W C;  1M1A A;  5CPK D;  3EPL A;  4G91 B;  3B6G B;  3W97 C;  3AZH D;  3AZK C;  3LZ0 D;  5B32 B;  3REI A;  3MNN D;  3EPK A;  3AZE C;  3B0B A;  3NQJ B;  4AWL B;  3X1T D;  4WU9 D;  3KWQ D;  4J8W D;  4J8V B;  3REL A;  4UPK A;  5AV9 B;  1KX5 C;  1P3L A;  3W97 D;  4ZUX D;  4H9N A;  4JJN A;  3AZK D;  3AV2 A;  4Z66 C;  3AZI B;  4QLC A;  1AOI C;  3AZE D;  5JA4 A;  5AV6 B;  1P3K D;  2CV5 A;  3X1V B;  2J8P A;  3MGS C;  1P3I C;  1P34 A;  5B31 A;  3KUY A;  1KX5 D;  4X23 B;  3REK C;  2NQB A;  3UTA A;  3X1S A;  4Z66 D;  3WTP B;  2HIO C;  1AOI D;  5BNX A;  5B33 C;  5B2I A;  3O62 A;  3AN2 B;  4LD9 C;  3A1I A;  5AVB B;  3MGS D;  3WAA B;  1P3I D;  3WKJ C;  3REK D;  2YFW B;  2HUE B;  3KXB A;  2HIO D;  5B33 D;  3H0L C;  1P3F C;  5FUG B;  3REJ B;  2ARO C;  2ZY2 A;  5B1M B;  5F99 B;  1P3M B;  4LD9 D;  4HGA B;  5B2J C;  2Y2G A;  3WKJ D;  5B1L B;  2Y2I A;  5B0Y C;  3MGR C;  5DNM B;  3MGP B;  1M19 C;  5CPI B;  5JRG B;  3UTB B;  4KGC B;  1HQ3 C;  5AVC C;  2G5I C;  1P3F D;  1KX3 B;  3B0D B;  3REH B;  5BNV A;  2PYO C;  5B2J D;  5B31 G;  3A6N C;  2ZM5 A;  3X1S D;  5AV5 A;  5B0Y D;  3MGR D;  1HTA A;  1EQZ A;  5AY8 B;  3W96 B;  4KUD B;  3MVD C;  1P3B A;  1M19 D;  3AZN A;  1WWS A;  3X1U C;  2RIQ A;  1HQ3 D;  2LY8 A;  5AVC D;  5CPJ B;  4H9Q B;  2PYO D;  1ID3 C;  4H9R B;  3A6N D;  3AFA A;  4J8X A;  4R8P C;  5B24 C;  4H9O A;  3AZG B;  3B6F B;  3W99 B;  3AZF B;  3MVD D;  4E45 A;  3UT9 A;  5B40 A;  3X1U D;  2ZY3 A;  1U35 C;  4XUJ C;  1ID3 D;  5GSU B;  2W8S A;  3TU4 C;  2XD1 A;  3C1C A;  5BO0 A;  4Z5T A;  4R8P D;  5B24 D;  4X23 C;  5AV8 B;  3AZJ C;  5CPK A;  1U35 D;  4XUJ D;  3AZH A;  4J8U B;  3TU4 D;  3LZ0 A;  4XZQ B;  4YS3 C;  3MNN A;  5AVB C;  2BYK B;  1TZY C;  3X1T A;  1M1A B;  4X23 D;  3EPJ A;  3KWQ A;  4J8W A;  4WU9 A;  1P3P C;  1P3A C;  3AZJ D;  3W97 A;  3REI B;  1P3O B;  3AZK A;  3VH5 W;  4YS3 D;  1F66 C;  1P3G C;  3AZE A;  5CP6 C;  5AVB D;  1TZY D;  4EO5 B;  3VH6 T;  3REL B;  1P3P D;  1P3A D;  5DNM C;  1P3L B;  1KX5 A;  2YFV A;  4H9N B;  4JJN B;  3EPH A;  3AZM C;  3AV2 B;  3WA9 C;  1KX3 C;  1F66 D;  4QLC B;  4Z66 A;  1P3G D;  5JA4 B;  1N1J A;  3VH5 A;  1AOI A;  5CP6 D;  3H0M C;  2CV5 B;  2XD5 A;  3FDD A;  3LZ1 C;  2Y2P A;  3W96 C;  3AV1 C;  2IO5 C;  3MGS A;  4NE3 A;  3KUY B;  4G92 B;  1P34 B;  1P3I A;  2DQN C;  3REK A;  2NQB B;  3UTA B;  1ZLA C;  3AZM D;  3R45 A;  4WU8 C;  3WA9 D;  4H9P A;  3MGQ C;  2HIO A;  5BNX B;  5B2I B;  5B33 A;  4NFT A;  3O62 B;  3F6T A;  1TAF B;  1A7W A;  3LZ1 D;  4WZS B;  3AYW C;  3AV1 D;  1KX4 B;  4DRB A;  3W96 D;  2F8N D;  2FJ7 C;  4LD9 A;  3WKJ A;  1BH9 A;  2F8N H;  3KXB B;  2VQR A;  4WU8 D;  1ZLA D;  2Y2M A;  3LEL C;  4CAY A;  3MGQ D;  5GT0 C;  1P3F A;  1M18 C;  3AYW D;  2ARO A;  2ZY4 A;  2Y2H A;  5B2J A;  2FJ7 D;  5B0Y A;  3MGR A;  5BS7 C;  1BFM A;  1W2E A;  3LEL D;  1M19 A;  5DNN B;  1S32 C;  1HQ3 A;  5GT0 D;  4UUZ B;  4XZQ C;  5AVC A;  1M18 D;  5BNV B;  2PYO A;  3W98 C;  2Y2K A;  3A6N A;  5AV5 B;  1EQZ B;  1P3B B;  3LJA C;  3MVD A;  3AZN B;  3X1U A;  4CSR A;  1P3O C;  1S32 D;  2NZD C;  4XZQ D;  5GT3 C;  5KDM A;  1ID3 A;  5E5A B;  3W98 D;  2BG1 A;  4J8X B;  4H9O B;  4R8P A;  5B24 A;  3B0C T;  3LJA D;  3UT9 B;  5B40 B;  4YM6 C;  1B6W A;  2ARO D;  2JCH A;  4ZBJ C;  2NZD D;  1U35 A;  4XUJ A;  5GT3 D;  5B0Z C;  2Y2J A;  3TU4 A;  3C1C B;  5BO0 B;  4G91 C;  3C1B B;  2Y2Q A;  4Z5T B;  3B6G C;  3P5J B;  5C3I B;  5B32 C;  4YM6 D;  4X23 A;  5CPK B;  3AZJ A;  4AWL C;  1Z2C B;  5B0Z D;  3AZH B;  4J8V C;  3LZ0 B;  3MNN B;  5AV9 C;  4YS3 A;  1KX4 C;  3B6G D;  3NQU A;  1R4V A;  3KSY A;  1B67 A;  5AVB A;  1JFI A;  3X1T B;  1TZY A;  2BYM A;  3AZL B;  5B32 D;  3KWQ B;  4J8W B;  4WU9 B;  3AZI C;  1P3P A;  1P3A A;  5B32 G;  2RVQ C;  4KHA B;  5AV6 C;  1BH8 A;  3W97 B;  4ZUX B;  4J8V D;  3AZK B;  3X1V C;  5AV9 D;  1F66 A;  3AZE B;  1P3G A;  5CP6 A;  1P3K B;  1H3O A;  3A1K A;  3AZI D;  3WTP C;  2RVQ D;  2Y2O A;  5DNM A;  5AV6 D;  3AN2 C;  2YFV B;  5DNN C;  5GXQ B;  3AZM A;  3X1V D;  3WA9 A;  4Z66 B;  3WAA C;  1KX3 A;  1N1J B;  4NE5 A;  1AOI B;  2HUE C;  1EQZ C;  3LZ1 A;  3W96 A;  3WTP D;  3V9R A;  3MGS B;  3AV1 A;  2F8N A;  1P3I B;  3REK B;  4Z2M G;  4Z2M H;  3AN2 D;  3REJ C;  5F99 C;  5B1M C;  1P3M C;  4WU8 A;  4HGA C;  1ZLA A;  4H9P B;  3WAA D;  2HIO B;  3MGQ A;  5E5A C;  5B1L C;  5B33 B;  1PZR A;  3MGP C;  3AYW A;  4LD9 B;  5CPI C;  5JRG C;  3UTB C;  2FJ7 A;  4WNN A;  4KGC C;  3WKJ B;  1F1E A;  3B0D C;  3REH C;  3REJ D;  5F99 D;  5B1M D;  1P3M D;  1ULY A;  4CAY B;  3LEL A;  5E5A D;  5B1L D;  3AL0 C;  4KUD C;  5AY8 C;  5GT0 A;  5DNM D;  1P3F B;  3MGP D;  3C1B C;  5B31 B;  1M18 A;  5CPI D;  5JRG D;  5B2J B;  3UTB D;  4KGC D;  3X1S B;  5CPJ C;  2Y2L A;  3H0R C;  5B0Y B;  3MGR B;  3REH D;  1KX3 D;  5BS7 A;  1M19 B;  1HQ3 B;  2F2A C;  1S32 A;  5AVC B;  3B6F C;  5AY8 D;  3W99 C;  4XZQ A;  5BT1 C;  3AZG C;  4KUD D;  3AZF C;  2PYO B;  2F8N G;  3W98 A;  2L5A A;  3A6N B;  3AZL C;  4WU9 C;  5CPJ D;  4H9S C;  5GSU C;  3MVD B;  3LJA A;  4ZUX C;  3X1U B;  4CSR B;  4WJ3 C;  1P3O A;  3B6F D;  2NZD A;  3W99 D;  5BT1 D;  3AZG D;  5KDM B;  3AZF D;  4NE6 A;  5GT3 A;  2Y2N A;  1ID3 B;  5AV8 C;  1P3K C;  5CHL B;  3AZL D;  4R8P B;  5B24 B;  5GSU D;  4J8U C;  2G5H C;  4YM6 A;  5GXQ C;  1U35 B;  4XUJ B;  5G49 A;  1M1A C;  5B0Z A;  3TU4 B;  5AV8 D;  3VH5 T;  2DF4 C;  3KFU G;  3B6G A;  4J8U D;  3EG5 B;  3REI C;  5B32 A;  5GXQ D;  3AZJ B;  3NQJ A;  1WWI A;  4EO5 C;  2JE5 A;  1M1A D;  2F8N K;  3AFA B;  3REL C;  4J8V A;  4YS3 B;  5AV9 A;  3NQU B;  1TAF A;  1KX4 A;  1P3L C;  1JFI B;  1TZY B;  2BYM B;  4JJN C;  3REI D;  3AV2 C;  1P3O D;  2ZY5 A;  4QLC C;  1P3A B;  3AZI A;  1P3P B;  5AV6 A;  1BH8 B;  2UWX A;  2CV5 C;  3REL D;  3X1V A;  1F66 B;  4G92 C;  5B31 C;  3KUY C;  1P34 C;  1P3G B;  3IP4 C;  2CWE A;  1P3L D;  5CP6 B;  2NQB C;  4JJN D;  1H3O B;  3UTA C;  3AV2 D;  3X1S C;  4QLC D;  3WTP A;  5B2I C;  3O62 C;  3VH6 W;  2CV5 D;  1Q9C A;  3AN2 A;  5DNN A;  3AZM B;  2JSS A;  3WA9 B;  4UUZ A;  1P34 D;  5B31 D;  3KUY D;  3WAA A;  2NQB D;  2YFW A;  3KXB C;  3UTA D;  2FFF B;  3LZ1 B;  3AV1 B;  2IO5 B;  3V9R B;  2F8N B;  5B2I D;  3O62 D;  5FUG A;  4WV4 B;  3REJ A;  1KX4 D;  5F99 A;  5B1M A;  4WU8 B;  3VH6 A;  1P3M A;  1ZLA B;  3MGQ B;  5E5A A;  5B1L A;  3KXB D;  3MGP A;  3AYW B;  1KX5 B;  5CPI A;  5JRG A;  2FJ7 B;  4WNN B;  3UTB A;  4KGC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...