4H9NA

Complex structure 1 of daxx/h3.3(sub5)/h4
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
98
structure length
98
Chain Sequence
KPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEAAEAFLVALFEDTNLCTIHAKRVTIFPKDIQLARRIRGER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title DAXX chaperone envelops an H3.3/H4 dimer dictating H3.3-specific read out
rcsb
source organism Homo sapiens
molecule tags Dna binding protein/apoptosis
molecule keywords Histone H3.3
total genus 28
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2012-09-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4h9nA00
4XZQB 5KDMA 3AYWB 4KHAA 3UTBC 1U35A 3R45A 3WKJC 3VH5W 5GXQA 2CWEA 5BO0A 4R8PC 4CSRB 3X1TA 3AZJA 1P3OA 4CAYA 4Z2MG 5AVCB 3WTPC 3C1BB 3X1VB 3V9RA 1HQ3B 2JSSA 4H9RA 5B2ID 4X23B 3AZEC 5DNMA 3X1SC 3AV1C 5JA4B 3WTPA 3REKD 3AZKC 5B40C 1S32D 5F99A 5B0ZA 5FUGA 5GXQC 4J8VD 5AV9C 5GSUC 2RVQC 4ZBJB 5AV8D 2PYOD 3WAAD 3B0BA 5BT1C 5AV6D 3UTBA 3WKJB 3B0DB 5AV8C 2PYOC 5JRGB 5FUGB 4J8WB 5CPJA 2NQBC 2F8ND 4KUDC 2NQBD 3B6FB 5B0YA 3X1VC 4WU9A 4G91C 3REID 3TU4A 1H3OA 5B1LA 3X1UC 1BFMA 4DRBA 1KX3C 1P3MD 3MGPD 3MGQB 1HTAA 3LJAD 4KHAB 3AZMC 1P3PA 1N1JB 3AZHB 5AY8C 5GXQB 1F1EA 5CPID 1AOIB 4WZSB 5CPJB 3AZFC 1ZLAA 3AZMA 5B1MB 1P3AA 1KX5D 3AYWA 3WA9A 3W97A 5JRGC 1KX3A 1EQZB 3B6GD 3O62D 5B1LB 5B24B 4ZUXD 3C1CA 3TU4B 3B6FC 5B32C 3VH6A 4J8UC 4H9PA 3KUYB 5CP6C 4J8UD 5GT0A 4Z66D 3AZJD 1P3OD 5BS7A 3REJB 4NFTA 3AZMB 4M6BA 4LD9A 5AY8A 3AZHC 1TAFB 1P34A 5CPKD 5B0ZC 5F99C 5JRGA 3REHB 3W97C 1P3PC 5BT1D 1AOIC 1P3BD 3AZED 2AROB 3AZFA 3NQJB 3W99C 5B1MC 4YM6C 3AZIB 4NE5A 3REKC 3AZKD 4H9PB 5B1LC 1S32A 1P3FC 2CV5C 3TU4C 3AZLA 3B0CW 3AV2B 1P3LC 5B0YC 5B32B 4G92B 3MGQA 3RELD 4YS3A 3AZLB 3AV2A 3X1UA 3REJC 4WU9D 1U35C 3O62B 5B40A 3MNND 5B1LD 5GSUD 5DNND 2RVQD 3WAAC 3W97B 3VH6T 1P3PB 4H9SA 5B33D 1P3MA 4EO5C 3W99B 3A6NC 4XUJC 1KX4B 4Z5TC 1M18B 1M1AC 5B2JB 5C3IB 5E5AC 1P3LB 3UTAA 4WV4B 1ZLAD 3AZMD 3KXBC 3X1SA 5DNMC 1M19C 3AFAB 3AZJC 1P3OC 1R4VA 4Z5TA 1KX3D 1TZYC 3VH6W 5BNXA 3A6NA 1F66A 3WTPD 3LELA 3MGSC 2AROD 1P3MC 4NE6A 3AZID 4J8VA 5CPKC 1U35B 3O62C 5AV6A 4E44A 3UTBD 3REJA 3X1VD 4EO5B 5GT3D 5AV6B 4XUJB 3MGRC 1KX4C 4Z5TB 4KGCB 3W96B 5JRGD 4J8WD 3AN2A 1P3IA 5E5AB 4WU9B 5DNMB 3C1CB 5DNNB 2FJ7C 5B31D 2NZDC 1P3PD 4YM6A 3MGSB 4YS3B 4DRAA 1P3MB 3LZ0A 5CPIA 3LZ1D 3MGQD 4J8XA 3LJAB 3RELA 1P3KD 5B33C 5AV5B 3X1UD 2F8NB 1P3AD 1KX5A 3W98C 3B6FD 3MGPC 1ZLAB 3REIB 5DNNA 5B40D 3MNNA 2HIOB 5B31G 1P3GB 4KGCC 1EQZD 3MVDD 5B33A 4HGAC 5AVBB 3RELC 4Z66A 5GT0D 3C1CC 1P3KC 3KWQA 5B2JA 1P3AC 2NZDA 2L5AA 3WTPE 5B1MD 1ID3C 3X1SD 3UT9B 3LJAC 1P3BA 3B6GB 4Z5TD 4XZQC 3AZFD 3MVDC 3VH5T 5B24A 3LELD 2AROA 1B6WA 4H9QB 3KWQB 4LD9D 4AWLC 3C1BC 4YS3D 3AZGC 3REJD 3X1VA 4WU8C 3AV2D 3C1BD 5B32D 1M18A 1P3KB 3REHD 3KUYA 1P3AB 4J8WA 3AZEB 5GSUA 3UT9C 5AVCA 3AZKB 5B40B 3W98D 5CHLB 5B31A 2YFVB 3MVDB 3LZ0B 5AV9B 1S32B 4YM6D 5GSUB 2F8NH 4J8VB 3MGRD 3B0DC 5AV8B 2PYOB 4J8XD 2BYKB 4J8WC 5AV5A 3UTAD 4H9SC 3WKJD 1N1JA 1KX4D 1TAFA 4JJNA 5B2IC 3AZNB 3V9RB 4G91B 3A6ND 1F66D 3W96A 4R8PA 3X1TC 1WWSA 3AZIA 1KX3B 2HUEB 4H9OA 2IO5B 1EQZA 3MGQC 1WWIA 1BH8B 4WU8A 3KWQD 3AZGA 5B2JD 1TZYD 4XZQA 1S32C 5GT3A 3UTBB 5CPIB 5B1MA 3AN2D 1P3ID 2LY8A 5B31C 4R8PB 5B24C 1KX5B 3AFAA 4XUJD 5AVCC 3WTPB 5JA4A 4QLCA 1HQ3D 4ZUXB 5B24D 3AZHA 1P34C 1M19D 4H9NB 5B2IB 1HQ3C 3AZNC 4H9OB 2HIOA 1P3GA 3KUYC 1M1AD 4X23C 3LZ0D 2HUEC 4NE3A 3LZ1A 4UUZB 4Z66B 1P3KA 1BH9B 3AV1B 3C1BA 5GT3B 5B32A 3B6FA 5BNVA 1JFIA 3REHA 5B0ZB 5F99B 3REHC 3MNNC 4KGCA 4ZBJC 5CPIC 2AROC 3MVDA 5B31B 3W98A 1KX5C 2NQBB 2CV5B 4KUDB 2F8NG 3VH5A 4ZUXC 1P34B 5B0YB 4G92C 1BH9A 3LZ1B 3NQUA 2NZDD 4QLCC 5AV5D 3X1UB 1P3FD 1KX4A 4Z66C 3NQUB 2YFWA 4JJND 3AN2B 1P3IB 5GT3C 4R8PD 1AOID 5AY8B 5G49B 3MNNB 2YFWB 5CPJC 3AZFB 2BYMA 3R45B 4X23A 2F8NK 5G49A 1EQZC 5AV9A 1M1AB 1TZYA 4XZQD 1Q9CA 5C3IC 4J8XC 1M18D 5AVBA 4JJNC 3KXBB 3KUYD 4J8UB 1P3LD 3LZ1C 3AV1A 3AFAC 3AZJB 1P3OB 4QLCB 5CP6B 1F66C 3AFAD 1KU5A 4XUJA 1ID3D 5AVCD 1HQ3A 3AZNA 1M19A 5CPKB 3AN2C 1P3IC 3UTAC 4E45A 5E5AA 3MGRA 1M1AA 4KUDD 3WKJA 4YM6B 3AZIC 4WNNB 5AV6C 3MGRB 3REKB 3W96C 1P3FB 4J8XB 3AV2C 4KGCD 3W96D 4JJNB 3AZLC 2CV5A 1F66B 4H9QA 3NQJA 3WA9B 5B2IA 4YS3C 3AZGD 4WU8D 3MGSD 3UTAB 2FJ7D 5B33B 5AV5C 3WAAB 3KSYA 1P3FA 3REKA 3MGPB 3KXBD 3REIC 3W99A 5BNXB 3A6NB 4QLCD 3WAAA 3AZHD 1AOIA 4H9RB 1M18C 5B2JC 5CP6A 4LD9B 3UT9A 2HIOD 4HGAB 5AVBC 5CPJD 1P3GD 4H9NA 1M19B 5GT0B 1TZYB 3TU4D 3WA9C 1U35D 1P3LA 3MGPA 3AV1D 5GXQD 3B6GC 5BNVB 3X1TD 1JFIB 3LJAA 5BO0B 1P3BC 4WNNA 1ID3A 3LELB 3KWQC 5E5AD 1H3OB 3AYWD 3WA9D 4AWLB 5DNMD 4LD9C 4WU8B 3AZGB 3B6GA 4ZUXA 3C1CD 4WU9C 4UUZA 5BS7C 5DNNC 5GT0C 2FJ7B 5F99D 5B0ZD 2NZDB 2BYKA 4J8UA 5AV8A 2PYOA 1P3BB 2YFVA 2CV5D 2F8NA 1B67A 3AYWC 4X23D 3LZ0C 1A7WA 2NQBA 5AY8D 1P34D 3W98B 5B0YD 3B0CT 4J8VC 2BYMB 5CPKA 1ZLAC 5AV9D 3REIA 3LELC 3MGSA 3AZEA 2FJ7A 2HIOC 5AVBD 5KDMB 1P3GC 1BH8A 3AZKA 3RELB 3KXBA 5B32G 3AZLD 3W99D 4CAYB 4CSRA 3AZND 3X1TB 4Z2MH 5CP6D 2IO5C 3X1SB 3UT9D 1ULYA 1ID3B 4KUDA 3W97D 3O62A
chains in the Genus database with same CATH superfamily
4XZQB 5KDMA 3AYWB 4KHAA 3UTBC 1U35A 2XD5A 3R45A 3WKJC 3VH5W 3EPJA 5GXQA 2CWEA 5BO0A 4R8PC 4CSRB 3X1TA 3AZJA 1P3OA 4CAYA 4Z2MG 5AVCB 3WTPC 3C1BB 3X1VB 3V9RA 1HQ3B 2JSSA 4H9RA 5B2ID 4X23B 3AZEC 5DNMA 3X1SC 2DQNC 3AV1C 5JA4B 3WTPA 3REKD 3AZKC 5B40C 1S32D 5F99A 5B0ZA 1PZRA 5FUGA 2Y2HA 5GXQC 4J8VD 5AV9C 5GSUC 2RVQC 4ZBJB 5AV8D 2PYOD 3WAAD 3B0BA 5BT1C 5AV6D 3UTBA 3WKJB 3B0DB 5AV8C 2PYOC 5JRGB 5FUGB 4J8WB 5CPJA 2NQBC 2F8ND 4KUDC 2NQBD 3B6FB 5B0YA 3X1VC 4WU9A 4G91C 3REID 3TU4A 1H3OA 5B1LA 3X1UC 1BFMA 4DRBA 1KX3C 1P3MD 3MGPD 3MGQB 1HTAA 3LJAD 4KHAB 3AZMC 1P3PA 1N1JB 3AZHB 5AY8C 3H0MC 1F1EA 5GXQB 5CPID 1AOIB 4WZSB 5CPJB 3AZFC 1ZLAA 3AZMA 5B1MB 1P3AA 1KX5D 3AYWA 3WA9A 3W97A 5JRGC 1KX3A 1EQZB 3B6GD 5B1LB 5B24B 3O62D 4ZUXD 3C1CA 3TU4B 3B6FC 5B32C 3VH6A 4J8UC 4H9PA 3KUYB 5CP6C 4J8UD 5GT0A 4Z66D 3AZJD 1P3OD 5BS7A 3IP4C 3REJB 4NFTA 3AZMB 4M6BA 4LD9A 5AY8A 3AZHC 1TAFB 1P34A 5CPKD 5B0ZC 5F99C 5JRGA 3REHB 3W97C 1P3PC 5BT1D 1AOIC 1P3BD 3AZED 2AROB 2Y2JA 3AZFA 3NQJB 3W99C 5B1MC 4YM6C 3AZIB 4NE5A 3KFUG 3REKC 3AZKD 4H9PB 5B1LC 1S32A 3EPHA 1P3FC 2CV5C 3TU4C 3AZLA 3B0CW 3AV2B 1P3LC 5B0YC 5B32B 4G92B 3FDDA 3MGQA 3RELD 4YS3A 3AZLB 3AV2A 3X1UA 3H0RC 3REJC 4WU9D 1U35C 3EPLA 5B1LD 5B40A 5DNND 3MNND 5GSUD 3O62B 2RVQD 3WAAC 3W97B 3VH6T 1P3PB 4H9SA 5B33D 1P3MA 4EO5C 2Y2GA 3W99B 3A6NC 4XUJC 1KX4B 4Z5TC 1M18B 1M1AC 5B2JB 5C3IB 5E5AC 1P3LB 2XD1A 3UTAA 4WV4B 2FFFB 3AZMD 3KXBC 1ZLAD 3X1SA 5DNMC 1M19C 3AFAB 3AZJC 1P3OC 1R4VA 4Z5TA 1KX3D 1TZYC 3VH6W 5BNXA 3A6NA 1F66A 3WTPD 2ZM5A 3LELA 3MGSC 2AROD 1P3MC 4NE6A 3AZID 4J8VA 5CPKC 1U35B 3O62C 2ZY2A 5AV6A 4E44A 3UTBD 2JCHA 3REJA 3X1VD 4EO5B 5GT3D 5AV6B 4XUJB 3MGRC 1KX4C 4Z5TB 4KGCB 3W96B 5JRGD 4J8WD 3AN2A 2Y2PA 5E5AB 1P3IA 4WU9B 5DNMB 3C1CB 5DNNB 2FJ7C 5B31D 2NZDC 1P3PD 4YM6A 3MGSB 4YS3B 4DRAA 3A1KA 1P3MB 3LZ0A 5CPIA 3LZ1D 3MGQD 4J8XA 3LJAB 3RELA 1P3KD 4WJ3C 5B33C 3X1UD 5AV5B 2Y2KA 2F8NB 1P3AD 1KX5A 3W98C 1W2EA 3B6FD 3MGPC 1ZLAB 3REIB 5DNNA 5B40D 3MNNA 2HIOB 5B31G 1P3GB 2JE5A 4KGCC 1EQZD 3MVDD 5B33A 4HGAC 5AVBB 3RELC 4Z66A 5GT0D 3EG5B 3C1CC 1P3KC 3KWQA 5B2JA 1P3AC 2NZDA 3A1IA 2L5AA 3WTPE 5B1MD 1ID3C 3X1SD 3UT9B 3LJAC 1P3BA 3B6GB 4Z5TD 4XZQC 3AZFD 3MVDC 3VH5T 5B24A 3LELD 2AROA 1B6WA 4H9QB 3KWQB 4LD9D 4AWLC 3C1BC 4YS3D 3AZGC 3REJD 3X1VA 4WU8C 3AV2D 2ZY3A 3C1BD 5B32D 1M18A 1P3KB 3REHD 3KUYA 1P3AB 4J8WA 3AZEB 5GSUA 3UT9C 5AVCA 3AZKB 5B40B 3W98D 5CHLB 5B31A 2YFVB 3MVDB 3LZ0B 5AV9B 1S32B 4YM6D 5GSUB 2Y2NA 2F8NH 4J8VB 3MGRD 3B0DC 5AV8B 2PYOB 4J8XD 2BYKB 4J8WC 5AV5A 3UTAD 4H9SC 3WKJD 1N1JA 1KX4D 1TAFA 1T3UA 4JJNA 5B2IC 2VQRA 3V9RB 4G91B 3AZNB 3A6ND 1F66D 2UWXA 3W96A 4R8PA 3X1TC 1WWSA 3AZIA 1KX3B 2HUEB 4H9OA 2IO5B 1EQZA 2BG1A 3MGQC 1WWIA 1BH8B 4WU8A 3KWQD 3AZGA 5B2JD 1TZYD 4XZQA 2Y2MA 1S32C 5GT3A 3UTBB 5CPIB 5B1MA 3AN2D 1P3ID 2LY8A 5B31C 4R8PB 5B24C 4UPKA 1KX5B 3AFAA 4XUJD 5AVCC 3WTPB 5JA4A 4QLCA 1HQ3D 4ZUXB 5B24D 3AZHA 1P34C 1M19D 3H0LC 4H9NB 1HQ3C 5B2IB 3AZNC 4H9OB 2HIOA 1P3GA 3KUYC 3EPKA 4DQYB 4X23C 3LZ0D 1M1AD 2HUEC 4NE3A 3LZ1A 4UUZB 4Z66B 1P3KA 1BH9B 3F6TA 3AV1B 2Y2OA 3C1BA 5GT3B 5B32A 2ZY4A 3B6FA 5BNVA 1JFIA 2DF4C 3REHA 5B0ZB 5F99B 3REHC 3MNNC 4KGCA 2J8PA 4ZBJC 5CPIC 2AROC 3MVDA 5B31B 3W98A 1KX5C 2NQBB 2CV5B 4KUDB 2F8NG 3VH5A 4ZUXC 1P34B 5B0YB 4G92C 1BH9A 3LZ1B 3NQUA 2NZDD 2Y2LA 4QLCC 5AV5D 3X1UB 3P5JB 1P3FD 1KX4A 2G5IC 4Z66C 3NQUB 2YFWA 4JJND 3AN2B 1P3IB 5GT3C 4R8PD 1AOID 5AY8B 5G49B 3MNNB 2YFWB 5CPJC 3AZFB 2BYMA 3R45B 4X23A 2F8NK 5G49A 1EQZC 5AV9A 1M1AB 1TZYA 4XZQD 1Q9CA 5C3IC 4J8XC 2F2AC 1M18D 5AVBA 4JJNC 3KXBB 3KUYD 4J8UB 1P3LD 3LZ1C 3AV1A 3AFAC 3AZJB 1P3OB 4QLCB 5CP6B 1F66C 3AFAD 1KU5A 4XUJA 1ID3D 5AVCD 1HQ3A 3AZNA 1M19A 5CPKB 3AN2C 1P3IC 3UTAC 4E45A 5E5AA 3MGRA 1M1AA 4KUDD 3WKJA 4YM6B 3AZIC 4WNNB 5AV6C 3MGRB 3REKB 3W96C 1P3FB 4J8XB 3AV2C 4KGCD 3W96D 4JJNB 3AZLC 2CV5A 1F66B 4H9QA 3NQJA 3WA9B 5B2IA 4YS3C 3AZGD 4WU8D 2RIQA 3MGSD 3UTAB 2FJ7D 5B33B 5AV5C 3WAAB 3KSYA 1P3FA 3REKA 3MGPB 3KXBD 3REIC 3W99A 5BNXB 3A6NB 4QLCD 3WAAA 3AZHD 1AOIA 4H9RB 1M18C 5B2JC 5CP6A 4LD9B 3UT9A 2HIOD 4HGAB 5AVBC 5CPJD 1P3GD 4H9NA 1M19B 5GT0B 1TZYB 3TU4D 3WA9C 1U35D 1P3LA 3MGPA 3AV1D 5GXQD 3B6GC 5BNVB 3X1TD 1JFIB 3LJAA 5BO0B 1P3BC 4WNNA 1ID3A 3AL0C 3LELB 3KWQC 5E5AD 1H3OB 3AYWD 3WA9D 4AWLB 5DNMD 4LD9C 4WU8B 3AZGB 3B6GA 2ZY5A 1Z2CB 4ZUXA 3C1CD 4WU9C 4UUZA 5BS7C 5DNNC 5GT0C 2FJ7B 5F99D 5B0ZD 2NZDB 2BYKA 4J8UA 5AV8A 2PYOA 1P3BB 2YFVA 2CV5D 2F8NA 1B67A 3AYWC 4X23D 3LZ0C 1A7WA 2NQBA 5AY8D 1P34D 3W98B 5B0YD 3B0CT 4J8VC 2BYMB 5CPKA 1ZLAC 5AV9D 3REIA 3LELC 3MGSA 3AZEA 2FJ7A 2HIOC 5AVBD 5KDMB 1P3GC 1BH8A 3AZKA 3RELB 3KXBA 5B32G 3AZLD 3W99D 4CAYB 2Y2IA 2Y2QA 4CSRA 3AZND 3X1TB 4Z2MH 5CP6D 2IO5C 3X1SB 3UT9D 2W8SA 1ULYA 1ID3B 2G5HC 4KUDA 3W97D 3O62A
chains in the Genus database with same CATH topology
4XZQB 5KDMA 3AYWB 4KHAA 3UTBC 1U35A 2XD5A 3R45A 3WKJC 3VH5W 3EPJA 5GXQA 2CWEA 5BO0A 4R8PC 4CSRB 3X1TA 3AZJA 1P3OA 4CAYA 4Z2MG 5AVCB 3WTPC 3C1BB 3X1VB 3V9RA 1HQ3B 2JSSA 4H9RA 5B2ID 4X23B 3AZEC 5DNMA 3X1SC 2DQNC 3AV1C 5JA4B 3WTPA 3REKD 3AZKC 5B40C 1S32D 5F99A 5B0ZA 1PZRA 5FUGA 2Y2HA 5GXQC 4J8VD 5AV9C 5GSUC 2RVQC 4ZBJB 5AV8D 2PYOD 3WAAD 3B0BA 5BT1C 5AV6D 3UTBA 3WKJB 3B0DB 5AV8C 2PYOC 5JRGB 5FUGB 4J8WB 5CPJA 2NQBC 2F8ND 4KUDC 2NQBD 3B6FB 5B0YA 3X1VC 4WU9A 4G91C 3REID 3TU4A 1H3OA 5B1LA 3X1UC 1BFMA 4DRBA 1KX3C 1P3MD 3MGPD 3MGQB 1HTAA 3LJAD 4KHAB 3AZMC 1P3PA 1N1JB 3AZHB 5AY8C 3H0MC 1F1EA 5GXQB 5CPID 1AOIB 4WZSB 5CPJB 3AZFC 1ZLAA 3AZMA 5B1MB 1P3AA 1KX5D 3AYWA 3WA9A 3W97A 5JRGC 1KX3A 1EQZB 3B6GD 5B1LB 5B24B 3O62D 4ZUXD 3C1CA 3TU4B 3B6FC 5B32C 3VH6A 4J8UC 4H9PA 3KUYB 5CP6C 4J8UD 5GT0A 4Z66D 3AZJD 1P3OD 5BS7A 3IP4C 3REJB 4NFTA 3AZMB 4M6BA 4LD9A 5AY8A 3AZHC 1TAFB 1P34A 5CPKD 5B0ZC 5F99C 5JRGA 3REHB 3W97C 1P3PC 5BT1D 1AOIC 1P3BD 3AZED 2AROB 2Y2JA 3AZFA 3NQJB 3W99C 5B1MC 4YM6C 3AZIB 4NE5A 3KFUG 3REKC 3AZKD 4H9PB 5B1LC 1S32A 3EPHA 1P3FC 2CV5C 3TU4C 3AZLA 3B0CW 3AV2B 1P3LC 5B0YC 5B32B 4G92B 3FDDA 3MGQA 3RELD 4YS3A 3AZLB 3AV2A 3X1UA 3H0RC 3REJC 4WU9D 1U35C 3EPLA 5B1LD 5B40A 5DNND 3MNND 5GSUD 3O62B 2RVQD 3WAAC 3W97B 3VH6T 1P3PB 4H9SA 5B33D 1P3MA 4EO5C 2Y2GA 3W99B 3A6NC 4XUJC 1KX4B 4Z5TC 1M18B 1M1AC 5B2JB 5C3IB 5E5AC 1P3LB 2XD1A 3UTAA 4WV4B 2FFFB 3AZMD 3KXBC 1ZLAD 3X1SA 5DNMC 1M19C 3AFAB 3AZJC 1P3OC 1R4VA 4Z5TA 1KX3D 1TZYC 3VH6W 5BNXA 3A6NA 1F66A 3WTPD 2ZM5A 3LELA 3MGSC 2AROD 1P3MC 4NE6A 3AZID 4J8VA 5CPKC 1U35B 3O62C 2ZY2A 5AV6A 4E44A 3UTBD 2JCHA 3REJA 3X1VD 4EO5B 5GT3D 5AV6B 4XUJB 3MGRC 1KX4C 4Z5TB 4KGCB 3W96B 5JRGD 4J8WD 3AN2A 2Y2PA 5E5AB 1P3IA 4WU9B 5DNMB 3C1CB 5DNNB 2FJ7C 5B31D 2NZDC 1P3PD 4YM6A 3MGSB 4YS3B 4DRAA 3A1KA 1P3MB 3LZ0A 5CPIA 3LZ1D 3MGQD 4J8XA 3LJAB 3RELA 1P3KD 4WJ3C 5B33C 3X1UD 5AV5B 2Y2KA 2F8NB 1P3AD 1KX5A 3W98C 1W2EA 3B6FD 3MGPC 1ZLAB 3REIB 5DNNA 5B40D 3MNNA 2HIOB 5B31G 1P3GB 2JE5A 4KGCC 1EQZD 3MVDD 5B33A 4HGAC 5AVBB 3RELC 4Z66A 5GT0D 3EG5B 3C1CC 1P3KC 3KWQA 5B2JA 1P3AC 2NZDA 3A1IA 2L5AA 3WTPE 5B1MD 1ID3C 3X1SD 3UT9B 3LJAC 1P3BA 3B6GB 4Z5TD 4XZQC 3AZFD 3MVDC 3VH5T 5B24A 3LELD 2AROA 1B6WA 4H9QB 3KWQB 4LD9D 4AWLC 3C1BC 4YS3D 3AZGC 3REJD 3X1VA 4WU8C 3AV2D 2ZY3A 3C1BD 5B32D 1M18A 1P3KB 3REHD 3KUYA 1P3AB 4J8WA 3AZEB 5GSUA 3UT9C 5AVCA 3AZKB 5B40B 3W98D 5CHLB 5B31A 2YFVB 3MVDB 3LZ0B 5AV9B 1S32B 4YM6D 5GSUB 2Y2NA 2F8NH 4J8VB 3MGRD 3B0DC 5AV8B 2PYOB 4J8XD 2BYKB 4J8WC 5AV5A 3UTAD 4H9SC 3WKJD 1N1JA 1KX4D 1TAFA 1T3UA 4JJNA 5B2IC 2VQRA 3V9RB 4G91B 3AZNB 3A6ND 1F66D 2UWXA 3W96A 4R8PA 3X1TC 1WWSA 3AZIA 1KX3B 2HUEB 4H9OA 2IO5B 1EQZA 2BG1A 3MGQC 1WWIA 1BH8B 4WU8A 3KWQD 3AZGA 5B2JD 1TZYD 4XZQA 2Y2MA 1S32C 5GT3A 3UTBB 5CPIB 5B1MA 3AN2D 1P3ID 2LY8A 5B31C 4R8PB 5B24C 4UPKA 1KX5B 3AFAA 4XUJD 5AVCC 3WTPB 5JA4A 4QLCA 1HQ3D 4ZUXB 5B24D 3AZHA 1P34C 1M19D 3H0LC 4H9NB 1HQ3C 5B2IB 3AZNC 4H9OB 2HIOA 1P3GA 3KUYC 3EPKA 4DQYB 4X23C 3LZ0D 1M1AD 2HUEC 4NE3A 3LZ1A 4UUZB 4Z66B 1P3KA 1BH9B 3F6TA 3AV1B 2Y2OA 3C1BA 5GT3B 5B32A 2ZY4A 3B6FA 5BNVA 1JFIA 2DF4C 3REHA 5B0ZB 5F99B 3REHC 3MNNC 4KGCA 2J8PA 4ZBJC 5CPIC 2AROC 3MVDA 5B31B 3W98A 1KX5C 2NQBB 2CV5B 4KUDB 2F8NG 3VH5A 4ZUXC 1P34B 5B0YB 4G92C 1BH9A 3LZ1B 3NQUA 2NZDD 2Y2LA 4QLCC 5AV5D 3X1UB 3P5JB 1P3FD 1KX4A 2G5IC 4Z66C 3NQUB 2YFWA 4JJND 3AN2B 1P3IB 5GT3C 4R8PD 1AOID 5AY8B 5G49B 3MNNB 2YFWB 5CPJC 3AZFB 2BYMA 3R45B 4X23A 2F8NK 5G49A 1EQZC 5AV9A 1M1AB 1TZYA 4XZQD 1Q9CA 5C3IC 4J8XC 2F2AC 1M18D 5AVBA 4JJNC 3KXBB 3KUYD 4J8UB 1P3LD 3LZ1C 3AV1A 3AFAC 3AZJB 1P3OB 4QLCB 5CP6B 1F66C 3AFAD 1KU5A 4XUJA 1ID3D 5AVCD 1HQ3A 3AZNA 1M19A 5CPKB 3AN2C 1P3IC 3UTAC 4E45A 5E5AA 3MGRA 1M1AA 4KUDD 3WKJA 4YM6B 3AZIC 4WNNB 5AV6C 3MGRB 3REKB 3W96C 1P3FB 4J8XB 3AV2C 4KGCD 3W96D 4JJNB 3AZLC 2CV5A 1F66B 4H9QA 3NQJA 3WA9B 5B2IA 4YS3C 3AZGD 4WU8D 2RIQA 3MGSD 3UTAB 2FJ7D 5B33B 5AV5C 3WAAB 3KSYA 1P3FA 3REKA 3MGPB 3KXBD 3REIC 3W99A 5BNXB 3A6NB 4QLCD 3WAAA 3AZHD 1AOIA 4H9RB 1M18C 5B2JC 5CP6A 4LD9B 3UT9A 2HIOD 4HGAB 5AVBC 5CPJD 1P3GD 4H9NA 1M19B 5GT0B 1TZYB 3TU4D 3WA9C 1U35D 1P3LA 3MGPA 3AV1D 5GXQD 3B6GC 5BNVB 3X1TD 1JFIB 3LJAA 5BO0B 1P3BC 4WNNA 1ID3A 3AL0C 3LELB 3KWQC 5E5AD 1H3OB 3AYWD 3WA9D 4AWLB 5DNMD 4LD9C 4WU8B 3AZGB 3B6GA 2ZY5A 1Z2CB 4ZUXA 3C1CD 4WU9C 4UUZA 5BS7C 5DNNC 5GT0C 2FJ7B 5F99D 5B0ZD 2NZDB 2BYKA 4J8UA 5AV8A 2PYOA 1P3BB 2YFVA 2CV5D 2F8NA 1B67A 3AYWC 4X23D 3LZ0C 1A7WA 2NQBA 5AY8D 1P34D 3W98B 5B0YD 3B0CT 4J8VC 2BYMB 5CPKA 1ZLAC 5AV9D 3REIA 3LELC 3MGSA 3AZEA 2FJ7A 2HIOC 5AVBD 5KDMB 1P3GC 1BH8A 3AZKA 3RELB 3KXBA 5B32G 3AZLD 3W99D 4CAYB 2Y2IA 2Y2QA 4CSRA 3AZND 3X1TB 4Z2MH 5CP6D 2IO5C 3X1SB 3UT9D 2W8SA 1ULYA 1ID3B 2G5HC 4KUDA 3W97D 3O62A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XZQ B;  5KDM A;  3AYW B;  4KHA A;  3UTB C;  1U35 A;  3R45 A;  3WKJ C;  3VH5 W;  5GXQ A;  2CWE A;  5BO0 A;  4R8P C;  4CSR B;  3X1T A;  3AZJ A;  1P3O A;  4CAY A;  4Z2M G;  5AVC B;  3WTP C;  3C1B B;  3X1V B;  3V9R A;  1HQ3 B;  2JSS A;  4H9R A;  5B2I D;  4X23 B;  3AZE C;  5DNM A;  3X1S C;  3AV1 C;  5JA4 B;  3WTP A;  3REK D;  3AZK C;  5B40 C;  1S32 D;  5F99 A;  5B0Z A;  5FUG A;  5GXQ C;  4J8V D;  5AV9 C;  5GSU C;  2RVQ C;  4ZBJ B;  5AV8 D;  2PYO D;  3WAA D;  3B0B A;  5BT1 C;  5AV6 D;  3UTB A;  3WKJ B;  3B0D B;  5AV8 C;  2PYO C;  5JRG B;  5FUG B;  4J8W B;  5CPJ A;  2NQB C;  2F8N D;  4KUD C;  2NQB D;  3B6F B;  5B0Y A;  3X1V C;  4WU9 A;  4G91 C;  3REI D;  3TU4 A;  1H3O A;  5B1L A;  3X1U C;  1BFM A;  4DRB A;  1KX3 C;  1P3M D;  3MGP D;  3MGQ B;  1HTA A;  3LJA D;  4KHA B;  3AZM C;  1P3P A;  1N1J B;  3AZH B;  5AY8 C;  5GXQ B;  1F1E A;  5CPI D;  1AOI B;  4WZS B;  5CPJ B;  3AZF C;  1ZLA A;  3AZM A;  5B1M B;  1P3A A;  1KX5 D;  3AYW A;  3WA9 A;  3W97 A;  5JRG C;  1KX3 A;  1EQZ B;  3B6G D;  3O62 D;  5B1L B;  5B24 B;  4ZUX D;  3C1C A;  3TU4 B;  3B6F C;  5B32 C;  3VH6 A;  4J8U C;  4H9P A;  3KUY B;  5CP6 C;  4J8U D;  5GT0 A;  4Z66 D;  3AZJ D;  1P3O D;  5BS7 A;  3REJ B;  4NFT A;  3AZM B;  4M6B A;  4LD9 A;  5AY8 A;  3AZH C;  1TAF B;  1P34 A;  5CPK D;  5B0Z C;  5F99 C;  5JRG A;  3REH B;  3W97 C;  1P3P C;  5BT1 D;  1AOI C;  1P3B D;  3AZE D;  2ARO B;  3AZF A;  3NQJ B;  3W99 C;  5B1M C;  4YM6 C;  3AZI B;  4NE5 A;  3REK C;  3AZK D;  4H9P B;  5B1L C;  1S32 A;  1P3F C;  2CV5 C;  3TU4 C;  3AZL A;  3B0C W;  3AV2 B;  1P3L C;  5B0Y C;  5B32 B;  4G92 B;  3MGQ A;  3REL D;  4YS3 A;  3AZL B;  3AV2 A;  3X1U A;  3REJ C;  4WU9 D;  1U35 C;  3O62 B;  5B40 A;  3MNN D;  5B1L D;  5GSU D;  5DNN D;  2RVQ D;  3WAA C;  3W97 B;  3VH6 T;  1P3P B;  4H9S A;  5B33 D;  1P3M A;  4EO5 C;  3W99 B;  3A6N C;  4XUJ C;  1KX4 B;  4Z5T C;  1M18 B;  1M1A C;  5B2J B;  5C3I B;  5E5A C;  1P3L B;  3UTA A;  4WV4 B;  1ZLA D;  3AZM D;  3KXB C;  3X1S A;  5DNM C;  1M19 C;  3AFA B;  3AZJ C;  1P3O C;  1R4V A;  4Z5T A;  1KX3 D;  1TZY C;  3VH6 W;  5BNX A;  3A6N A;  1F66 A;  3WTP D;  3LEL A;  3MGS C;  2ARO D;  1P3M C;  4NE6 A;  3AZI D;  4J8V A;  5CPK C;  1U35 B;  3O62 C;  5AV6 A;  4E44 A;  3UTB D;  3REJ A;  3X1V D;  4EO5 B;  5GT3 D;  5AV6 B;  4XUJ B;  3MGR C;  1KX4 C;  4Z5T B;  4KGC B;  3W96 B;  5JRG D;  4J8W D;  3AN2 A;  1P3I A;  5E5A B;  4WU9 B;  5DNM B;  3C1C B;  5DNN B;  2FJ7 C;  5B31 D;  2NZD C;  1P3P D;  4YM6 A;  3MGS B;  4YS3 B;  4DRA A;  1P3M B;  3LZ0 A;  5CPI A;  3LZ1 D;  3MGQ D;  4J8X A;  3LJA B;  3REL A;  1P3K D;  5B33 C;  5AV5 B;  3X1U D;  2F8N B;  1P3A D;  1KX5 A;  3W98 C;  3B6F D;  3MGP C;  1ZLA B;  3REI B;  5DNN A;  5B40 D;  3MNN A;  2HIO B;  5B31 G;  1P3G B;  4KGC C;  1EQZ D;  3MVD D;  5B33 A;  4HGA C;  5AVB B;  3REL C;  4Z66 A;  5GT0 D;  3C1C C;  1P3K C;  3KWQ A;  5B2J A;  1P3A C;  2NZD A;  2L5A A;  3WTP E;  5B1M D;  1ID3 C;  3X1S D;  3UT9 B;  3LJA C;  1P3B A;  3B6G B;  4Z5T D;  4XZQ C;  3AZF D;  3MVD C;  3VH5 T;  5B24 A;  3LEL D;  2ARO A;  1B6W A;  4H9Q B;  3KWQ B;  4LD9 D;  4AWL C;  3C1B C;  4YS3 D;  3AZG C;  3REJ D;  3X1V A;  4WU8 C;  3AV2 D;  3C1B D;  5B32 D;  1M18 A;  1P3K B;  3REH D;  3KUY A;  1P3A B;  4J8W A;  3AZE B;  5GSU A;  3UT9 C;  5AVC A;  3AZK B;  5B40 B;  3W98 D;  5CHL B;  5B31 A;  2YFV B;  3MVD B;  3LZ0 B;  5AV9 B;  1S32 B;  4YM6 D;  5GSU B;  2F8N H;  4J8V B;  3MGR D;  3B0D C;  5AV8 B;  2PYO B;  4J8X D;  2BYK B;  4J8W C;  5AV5 A;  3UTA D;  4H9S C;  3WKJ D;  1N1J A;  1KX4 D;  1TAF A;  4JJN A;  5B2I C;  3AZN B;  3V9R B;  4G91 B;  3A6N D;  1F66 D;  3W96 A;  4R8P A;  3X1T C;  1WWS A;  3AZI A;  1KX3 B;  2HUE B;  4H9O A;  2IO5 B;  1EQZ A;  3MGQ C;  1WWI A;  1BH8 B;  4WU8 A;  3KWQ D;  3AZG A;  5B2J D;  1TZY D;  4XZQ A;  1S32 C;  5GT3 A;  3UTB B;  5CPI B;  5B1M A;  3AN2 D;  1P3I D;  2LY8 A;  5B31 C;  4R8P B;  5B24 C;  1KX5 B;  3AFA A;  4XUJ D;  5AVC C;  3WTP B;  5JA4 A;  4QLC A;  1HQ3 D;  4ZUX B;  5B24 D;  3AZH A;  1P34 C;  1M19 D;  4H9N B;  5B2I B;  1HQ3 C;  3AZN C;  4H9O B;  2HIO A;  1P3G A;  3KUY C;  1M1A D;  4X23 C;  3LZ0 D;  2HUE C;  4NE3 A;  3LZ1 A;  4UUZ B;  4Z66 B;  1P3K A;  1BH9 B;  3AV1 B;  3C1B A;  5GT3 B;  5B32 A;  3B6F A;  5BNV A;  1JFI A;  3REH A;  5B0Z B;  5F99 B;  3REH C;  3MNN C;  4KGC A;  4ZBJ C;  5CPI C;  2ARO C;  3MVD A;  5B31 B;  3W98 A;  1KX5 C;  2NQB B;  2CV5 B;  4KUD B;  2F8N G;  3VH5 A;  4ZUX C;  1P34 B;  5B0Y B;  4G92 C;  1BH9 A;  3LZ1 B;  3NQU A;  2NZD D;  4QLC C;  5AV5 D;  3X1U B;  1P3F D;  1KX4 A;  4Z66 C;  3NQU B;  2YFW A;  4JJN D;  3AN2 B;  1P3I B;  5GT3 C;  4R8P D;  1AOI D;  5AY8 B;  5G49 B;  3MNN B;  2YFW B;  5CPJ C;  3AZF B;  2BYM A;  3R45 B;  4X23 A;  2F8N K;  5G49 A;  1EQZ C;  5AV9 A;  1M1A B;  1TZY A;  4XZQ D;  1Q9C A;  5C3I C;  4J8X C;  1M18 D;  5AVB A;  4JJN C;  3KXB B;  3KUY D;  4J8U B;  1P3L D;  3LZ1 C;  3AV1 A;  3AFA C;  3AZJ B;  1P3O B;  4QLC B;  5CP6 B;  1F66 C;  3AFA D;  1KU5 A;  4XUJ A;  1ID3 D;  5AVC D;  1HQ3 A;  3AZN A;  1M19 A;  5CPK B;  3AN2 C;  1P3I C;  3UTA C;  4E45 A;  5E5A A;  3MGR A;  1M1A A;  4KUD D;  3WKJ A;  4YM6 B;  3AZI C;  4WNN B;  5AV6 C;  3MGR B;  3REK B;  3W96 C;  1P3F B;  4J8X B;  3AV2 C;  4KGC D;  3W96 D;  4JJN B;  3AZL C;  2CV5 A;  1F66 B;  4H9Q A;  3NQJ A;  3WA9 B;  5B2I A;  4YS3 C;  3AZG D;  4WU8 D;  3MGS D;  3UTA B;  2FJ7 D;  5B33 B;  5AV5 C;  3WAA B;  3KSY A;  1P3F A;  3REK A;  3MGP B;  3KXB D;  3REI C;  3W99 A;  5BNX B;  3A6N B;  4QLC D;  3WAA A;  3AZH D;  1AOI A;  4H9R B;  1M18 C;  5B2J C;  5CP6 A;  4LD9 B;  3UT9 A;  2HIO D;  4HGA B;  5AVB C;  5CPJ D;  1P3G D;  4H9N A;  1M19 B;  5GT0 B;  1TZY B;  3TU4 D;  3WA9 C;  1U35 D;  1P3L A;  3MGP A;  3AV1 D;  5GXQ D;  3B6G C;  5BNV B;  3X1T D;  1JFI B;  3LJA A;  5BO0 B;  1P3B C;  4WNN A;  1ID3 A;  3LEL B;  3KWQ C;  5E5A D;  1H3O B;  3AYW D;  3WA9 D;  4AWL B;  5DNM D;  4LD9 C;  4WU8 B;  3AZG B;  3B6G A;  4ZUX A;  3C1C D;  4WU9 C;  4UUZ A;  5BS7 C;  5DNN C;  5GT0 C;  2FJ7 B;  5F99 D;  5B0Z D;  2NZD B;  2BYK A;  4J8U A;  5AV8 A;  2PYO A;  1P3B B;  2YFV A;  2CV5 D;  2F8N A;  1B67 A;  3AYW C;  4X23 D;  3LZ0 C;  1A7W A;  2NQB A;  5AY8 D;  1P34 D;  3W98 B;  5B0Y D;  3B0C T;  4J8V C;  2BYM B;  5CPK A;  1ZLA C;  5AV9 D;  3REI A;  3LEL C;  3MGS A;  3AZE A;  2FJ7 A;  2HIO C;  5AVB D;  5KDM B;  1P3G C;  1BH8 A;  3AZK A;  3REL B;  3KXB A;  5B32 G;  3AZL D;  3W99 D;  4CAY B;  4CSR A;  3AZN D;  3X1T B;  4Z2M H;  5CP6 D;  2IO5 C;  3X1S B;  3UT9 D;  1ULY A;  1ID3 B;  4KUD A;  3W97 D;  3O62 A; 
#chains in the Genus database with same CATH topology
 4XZQ B;  5KDM A;  3AYW B;  4KHA A;  3UTB C;  1U35 A;  2XD5 A;  3R45 A;  3WKJ C;  3VH5 W;  3EPJ A;  5GXQ A;  2CWE A;  5BO0 A;  4R8P C;  4CSR B;  3X1T A;  3AZJ A;  1P3O A;  4CAY A;  4Z2M G;  5AVC B;  3WTP C;  3C1B B;  3X1V B;  3V9R A;  1HQ3 B;  2JSS A;  4H9R A;  5B2I D;  4X23 B;  3AZE C;  5DNM A;  3X1S C;  2DQN C;  3AV1 C;  5JA4 B;  3WTP A;  3REK D;  3AZK C;  5B40 C;  1S32 D;  5F99 A;  5B0Z A;  1PZR A;  5FUG A;  2Y2H A;  5GXQ C;  4J8V D;  5AV9 C;  5GSU C;  2RVQ C;  4ZBJ B;  5AV8 D;  2PYO D;  3WAA D;  3B0B A;  5BT1 C;  5AV6 D;  3UTB A;  3WKJ B;  3B0D B;  5AV8 C;  2PYO C;  5JRG B;  5FUG B;  4J8W B;  5CPJ A;  2NQB C;  2F8N D;  4KUD C;  2NQB D;  3B6F B;  5B0Y A;  3X1V C;  4WU9 A;  4G91 C;  3REI D;  3TU4 A;  1H3O A;  5B1L A;  3X1U C;  1BFM A;  4DRB A;  1KX3 C;  1P3M D;  3MGP D;  3MGQ B;  1HTA A;  3LJA D;  4KHA B;  3AZM C;  1P3P A;  1N1J B;  3AZH B;  5AY8 C;  3H0M C;  1F1E A;  5GXQ B;  5CPI D;  1AOI B;  4WZS B;  5CPJ B;  3AZF C;  1ZLA A;  3AZM A;  5B1M B;  1P3A A;  1KX5 D;  3AYW A;  3WA9 A;  3W97 A;  5JRG C;  1KX3 A;  1EQZ B;  3B6G D;  5B1L B;  5B24 B;  3O62 D;  4ZUX D;  3C1C A;  3TU4 B;  3B6F C;  5B32 C;  3VH6 A;  4J8U C;  4H9P A;  3KUY B;  5CP6 C;  4J8U D;  5GT0 A;  4Z66 D;  3AZJ D;  1P3O D;  5BS7 A;  3IP4 C;  3REJ B;  4NFT A;  3AZM B;  4M6B A;  4LD9 A;  5AY8 A;  3AZH C;  1TAF B;  1P34 A;  5CPK D;  5B0Z C;  5F99 C;  5JRG A;  3REH B;  3W97 C;  1P3P C;  5BT1 D;  1AOI C;  1P3B D;  3AZE D;  2ARO B;  2Y2J A;  3AZF A;  3NQJ B;  3W99 C;  5B1M C;  4YM6 C;  3AZI B;  4NE5 A;  3KFU G;  3REK C;  3AZK D;  4H9P B;  5B1L C;  1S32 A;  3EPH A;  1P3F C;  2CV5 C;  3TU4 C;  3AZL A;  3B0C W;  3AV2 B;  1P3L C;  5B0Y C;  5B32 B;  4G92 B;  3FDD A;  3MGQ A;  3REL D;  4YS3 A;  3AZL B;  3AV2 A;  3X1U A;  3H0R C;  3REJ C;  4WU9 D;  1U35 C;  3EPL A;  5B1L D;  5B40 A;  5DNN D;  3MNN D;  5GSU D;  3O62 B;  2RVQ D;  3WAA C;  3W97 B;  3VH6 T;  1P3P B;  4H9S A;  5B33 D;  1P3M A;  4EO5 C;  2Y2G A;  3W99 B;  3A6N C;  4XUJ C;  1KX4 B;  4Z5T C;  1M18 B;  1M1A C;  5B2J B;  5C3I B;  5E5A C;  1P3L B;  2XD1 A;  3UTA A;  4WV4 B;  2FFF B;  3AZM D;  3KXB C;  1ZLA D;  3X1S A;  5DNM C;  1M19 C;  3AFA B;  3AZJ C;  1P3O C;  1R4V A;  4Z5T A;  1KX3 D;  1TZY C;  3VH6 W;  5BNX A;  3A6N A;  1F66 A;  3WTP D;  2ZM5 A;  3LEL A;  3MGS C;  2ARO D;  1P3M C;  4NE6 A;  3AZI D;  4J8V A;  5CPK C;  1U35 B;  3O62 C;  2ZY2 A;  5AV6 A;  4E44 A;  3UTB D;  2JCH A;  3REJ A;  3X1V D;  4EO5 B;  5GT3 D;  5AV6 B;  4XUJ B;  3MGR C;  1KX4 C;  4Z5T B;  4KGC B;  3W96 B;  5JRG D;  4J8W D;  3AN2 A;  2Y2P A;  5E5A B;  1P3I A;  4WU9 B;  5DNM B;  3C1C B;  5DNN B;  2FJ7 C;  5B31 D;  2NZD C;  1P3P D;  4YM6 A;  3MGS B;  4YS3 B;  4DRA A;  3A1K A;  1P3M B;  3LZ0 A;  5CPI A;  3LZ1 D;  3MGQ D;  4J8X A;  3LJA B;  3REL A;  1P3K D;  4WJ3 C;  5B33 C;  3X1U D;  5AV5 B;  2Y2K A;  2F8N B;  1P3A D;  1KX5 A;  3W98 C;  1W2E A;  3B6F D;  3MGP C;  1ZLA B;  3REI B;  5DNN A;  5B40 D;  3MNN A;  2HIO B;  5B31 G;  1P3G B;  2JE5 A;  4KGC C;  1EQZ D;  3MVD D;  5B33 A;  4HGA C;  5AVB B;  3REL C;  4Z66 A;  5GT0 D;  3EG5 B;  3C1C C;  1P3K C;  3KWQ A;  5B2J A;  1P3A C;  2NZD A;  3A1I A;  2L5A A;  3WTP E;  5B1M D;  1ID3 C;  3X1S D;  3UT9 B;  3LJA C;  1P3B A;  3B6G B;  4Z5T D;  4XZQ C;  3AZF D;  3MVD C;  3VH5 T;  5B24 A;  3LEL D;  2ARO A;  1B6W A;  4H9Q B;  3KWQ B;  4LD9 D;  4AWL C;  3C1B C;  4YS3 D;  3AZG C;  3REJ D;  3X1V A;  4WU8 C;  3AV2 D;  2ZY3 A;  3C1B D;  5B32 D;  1M18 A;  1P3K B;  3REH D;  3KUY A;  1P3A B;  4J8W A;  3AZE B;  5GSU A;  3UT9 C;  5AVC A;  3AZK B;  5B40 B;  3W98 D;  5CHL B;  5B31 A;  2YFV B;  3MVD B;  3LZ0 B;  5AV9 B;  1S32 B;  4YM6 D;  5GSU B;  2Y2N A;  2F8N H;  4J8V B;  3MGR D;  3B0D C;  5AV8 B;  2PYO B;  4J8X D;  2BYK B;  4J8W C;  5AV5 A;  3UTA D;  4H9S C;  3WKJ D;  1N1J A;  1KX4 D;  1TAF A;  1T3U A;  4JJN A;  5B2I C;  2VQR A;  3V9R B;  4G91 B;  3AZN B;  3A6N D;  1F66 D;  2UWX A;  3W96 A;  4R8P A;  3X1T C;  1WWS A;  3AZI A;  1KX3 B;  2HUE B;  4H9O A;  2IO5 B;  1EQZ A;  2BG1 A;  3MGQ C;  1WWI A;  1BH8 B;  4WU8 A;  3KWQ D;  3AZG A;  5B2J D;  1TZY D;  4XZQ A;  2Y2M A;  1S32 C;  5GT3 A;  3UTB B;  5CPI B;  5B1M A;  3AN2 D;  1P3I D;  2LY8 A;  5B31 C;  4R8P B;  5B24 C;  4UPK A;  1KX5 B;  3AFA A;  4XUJ D;  5AVC C;  3WTP B;  5JA4 A;  4QLC A;  1HQ3 D;  4ZUX B;  5B24 D;  3AZH A;  1P34 C;  1M19 D;  3H0L C;  4H9N B;  1HQ3 C;  5B2I B;  3AZN C;  4H9O B;  2HIO A;  1P3G A;  3KUY C;  3EPK A;  4DQY B;  4X23 C;  3LZ0 D;  1M1A D;  2HUE C;  4NE3 A;  3LZ1 A;  4UUZ B;  4Z66 B;  1P3K A;  1BH9 B;  3F6T A;  3AV1 B;  2Y2O A;  3C1B A;  5GT3 B;  5B32 A;  2ZY4 A;  3B6F A;  5BNV A;  1JFI A;  2DF4 C;  3REH A;  5B0Z B;  5F99 B;  3REH C;  3MNN C;  4KGC A;  2J8P A;  4ZBJ C;  5CPI C;  2ARO C;  3MVD A;  5B31 B;  3W98 A;  1KX5 C;  2NQB B;  2CV5 B;  4KUD B;  2F8N G;  3VH5 A;  4ZUX C;  1P34 B;  5B0Y B;  4G92 C;  1BH9 A;  3LZ1 B;  3NQU A;  2NZD D;  2Y2L A;  4QLC C;  5AV5 D;  3X1U B;  3P5J B;  1P3F D;  1KX4 A;  2G5I C;  4Z66 C;  3NQU B;  2YFW A;  4JJN D;  3AN2 B;  1P3I B;  5GT3 C;  4R8P D;  1AOI D;  5AY8 B;  5G49 B;  3MNN B;  2YFW B;  5CPJ C;  3AZF B;  2BYM A;  3R45 B;  4X23 A;  2F8N K;  5G49 A;  1EQZ C;  5AV9 A;  1M1A B;  1TZY A;  4XZQ D;  1Q9C A;  5C3I C;  4J8X C;  2F2A C;  1M18 D;  5AVB A;  4JJN C;  3KXB B;  3KUY D;  4J8U B;  1P3L D;  3LZ1 C;  3AV1 A;  3AFA C;  3AZJ B;  1P3O B;  4QLC B;  5CP6 B;  1F66 C;  3AFA D;  1KU5 A;  4XUJ A;  1ID3 D;  5AVC D;  1HQ3 A;  3AZN A;  1M19 A;  5CPK B;  3AN2 C;  1P3I C;  3UTA C;  4E45 A;  5E5A A;  3MGR A;  1M1A A;  4KUD D;  3WKJ A;  4YM6 B;  3AZI C;  4WNN B;  5AV6 C;  3MGR B;  3REK B;  3W96 C;  1P3F B;  4J8X B;  3AV2 C;  4KGC D;  3W96 D;  4JJN B;  3AZL C;  2CV5 A;  1F66 B;  4H9Q A;  3NQJ A;  3WA9 B;  5B2I A;  4YS3 C;  3AZG D;  4WU8 D;  2RIQ A;  3MGS D;  3UTA B;  2FJ7 D;  5B33 B;  5AV5 C;  3WAA B;  3KSY A;  1P3F A;  3REK A;  3MGP B;  3KXB D;  3REI C;  3W99 A;  5BNX B;  3A6N B;  4QLC D;  3WAA A;  3AZH D;  1AOI A;  4H9R B;  1M18 C;  5B2J C;  5CP6 A;  4LD9 B;  3UT9 A;  2HIO D;  4HGA B;  5AVB C;  5CPJ D;  1P3G D;  4H9N A;  1M19 B;  5GT0 B;  1TZY B;  3TU4 D;  3WA9 C;  1U35 D;  1P3L A;  3MGP A;  3AV1 D;  5GXQ D;  3B6G C;  5BNV B;  3X1T D;  1JFI B;  3LJA A;  5BO0 B;  1P3B C;  4WNN A;  1ID3 A;  3AL0 C;  3LEL B;  3KWQ C;  5E5A D;  1H3O B;  3AYW D;  3WA9 D;  4AWL B;  5DNM D;  4LD9 C;  4WU8 B;  3AZG B;  3B6G A;  2ZY5 A;  1Z2C B;  4ZUX A;  3C1C D;  4WU9 C;  4UUZ A;  5BS7 C;  5DNN C;  5GT0 C;  2FJ7 B;  5F99 D;  5B0Z D;  2NZD B;  2BYK A;  4J8U A;  5AV8 A;  2PYO A;  1P3B B;  2YFV A;  2CV5 D;  2F8N A;  1B67 A;  3AYW C;  4X23 D;  3LZ0 C;  1A7W A;  2NQB A;  5AY8 D;  1P34 D;  3W98 B;  5B0Y D;  3B0C T;  4J8V C;  2BYM B;  5CPK A;  1ZLA C;  5AV9 D;  3REI A;  3LEL C;  3MGS A;  3AZE A;  2FJ7 A;  2HIO C;  5AVB D;  5KDM B;  1P3G C;  1BH8 A;  3AZK A;  3REL B;  3KXB A;  5B32 G;  3AZL D;  3W99 D;  4CAY B;  2Y2I A;  2Y2Q A;  4CSR A;  3AZN D;  3X1T B;  4Z2M H;  5CP6 D;  2IO5 C;  3X1S B;  3UT9 D;  2W8S A;  1ULY A;  1ID3 B;  2G5H C;  4KUD A;  3W97 D;  3O62 A; 
#chains in the Genus database with same CATH homology
 4XZQ B;  5KDM A;  3AYW B;  4KHA A;  3UTB C;  1U35 A;  2XD5 A;  3R45 A;  3WKJ C;  3VH5 W;  3EPJ A;  5GXQ A;  2CWE A;  5BO0 A;  4R8P C;  4CSR B;  3X1T A;  3AZJ A;  1P3O A;  4CAY A;  4Z2M G;  5AVC B;  3WTP C;  3C1B B;  3X1V B;  3V9R A;  1HQ3 B;  2JSS A;  4H9R A;  5B2I D;  4X23 B;  3AZE C;  5DNM A;  3X1S C;  2DQN C;  3AV1 C;  5JA4 B;  3WTP A;  3REK D;  3AZK C;  5B40 C;  1S32 D;  5F99 A;  5B0Z A;  1PZR A;  5FUG A;  2Y2H A;  5GXQ C;  4J8V D;  5AV9 C;  5GSU C;  2RVQ C;  4ZBJ B;  5AV8 D;  2PYO D;  3WAA D;  3B0B A;  5BT1 C;  5AV6 D;  3UTB A;  3WKJ B;  3B0D B;  5AV8 C;  2PYO C;  5JRG B;  5FUG B;  4J8W B;  5CPJ A;  2NQB C;  2F8N D;  4KUD C;  2NQB D;  3B6F B;  5B0Y A;  3X1V C;  4WU9 A;  4G91 C;  3REI D;  3TU4 A;  1H3O A;  5B1L A;  3X1U C;  1BFM A;  4DRB A;  1KX3 C;  1P3M D;  3MGP D;  3MGQ B;  1HTA A;  3LJA D;  4KHA B;  3AZM C;  1P3P A;  1N1J B;  3AZH B;  5AY8 C;  3H0M C;  1F1E A;  5GXQ B;  5CPI D;  1AOI B;  4WZS B;  5CPJ B;  3AZF C;  1ZLA A;  3AZM A;  5B1M B;  1P3A A;  1KX5 D;  3AYW A;  3WA9 A;  3W97 A;  5JRG C;  1KX3 A;  1EQZ B;  3B6G D;  5B1L B;  5B24 B;  3O62 D;  4ZUX D;  3C1C A;  3TU4 B;  3B6F C;  5B32 C;  3VH6 A;  4J8U C;  4H9P A;  3KUY B;  5CP6 C;  4J8U D;  5GT0 A;  4Z66 D;  3AZJ D;  1P3O D;  5BS7 A;  3IP4 C;  3REJ B;  4NFT A;  3AZM B;  4M6B A;  4LD9 A;  5AY8 A;  3AZH C;  1TAF B;  1P34 A;  5CPK D;  5B0Z C;  5F99 C;  5JRG A;  3REH B;  3W97 C;  1P3P C;  5BT1 D;  1AOI C;  1P3B D;  3AZE D;  2ARO B;  2Y2J A;  3AZF A;  3NQJ B;  3W99 C;  5B1M C;  4YM6 C;  3AZI B;  4NE5 A;  3KFU G;  3REK C;  3AZK D;  4H9P B;  5B1L C;  1S32 A;  3EPH A;  1P3F C;  2CV5 C;  3TU4 C;  3AZL A;  3B0C W;  3AV2 B;  1P3L C;  5B0Y C;  5B32 B;  4G92 B;  3FDD A;  3MGQ A;  3REL D;  4YS3 A;  3AZL B;  3AV2 A;  3X1U A;  3H0R C;  3REJ C;  4WU9 D;  1U35 C;  3EPL A;  5B1L D;  5B40 A;  5DNN D;  3MNN D;  5GSU D;  3O62 B;  2RVQ D;  3WAA C;  3W97 B;  3VH6 T;  1P3P B;  4H9S A;  5B33 D;  1P3M A;  4EO5 C;  2Y2G A;  3W99 B;  3A6N C;  4XUJ C;  1KX4 B;  4Z5T C;  1M18 B;  1M1A C;  5B2J B;  5C3I B;  5E5A C;  1P3L B;  2XD1 A;  3UTA A;  4WV4 B;  2FFF B;  3AZM D;  3KXB C;  1ZLA D;  3X1S A;  5DNM C;  1M19 C;  3AFA B;  3AZJ C;  1P3O C;  1R4V A;  4Z5T A;  1KX3 D;  1TZY C;  3VH6 W;  5BNX A;  3A6N A;  1F66 A;  3WTP D;  2ZM5 A;  3LEL A;  3MGS C;  2ARO D;  1P3M C;  4NE6 A;  3AZI D;  4J8V A;  5CPK C;  1U35 B;  3O62 C;  2ZY2 A;  5AV6 A;  4E44 A;  3UTB D;  2JCH A;  3REJ A;  3X1V D;  4EO5 B;  5GT3 D;  5AV6 B;  4XUJ B;  3MGR C;  1KX4 C;  4Z5T B;  4KGC B;  3W96 B;  5JRG D;  4J8W D;  3AN2 A;  2Y2P A;  5E5A B;  1P3I A;  4WU9 B;  5DNM B;  3C1C B;  5DNN B;  2FJ7 C;  5B31 D;  2NZD C;  1P3P D;  4YM6 A;  3MGS B;  4YS3 B;  4DRA A;  3A1K A;  1P3M B;  3LZ0 A;  5CPI A;  3LZ1 D;  3MGQ D;  4J8X A;  3LJA B;  3REL A;  1P3K D;  4WJ3 C;  5B33 C;  3X1U D;  5AV5 B;  2Y2K A;  2F8N B;  1P3A D;  1KX5 A;  3W98 C;  1W2E A;  3B6F D;  3MGP C;  1ZLA B;  3REI B;  5DNN A;  5B40 D;  3MNN A;  2HIO B;  5B31 G;  1P3G B;  2JE5 A;  4KGC C;  1EQZ D;  3MVD D;  5B33 A;  4HGA C;  5AVB B;  3REL C;  4Z66 A;  5GT0 D;  3EG5 B;  3C1C C;  1P3K C;  3KWQ A;  5B2J A;  1P3A C;  2NZD A;  3A1I A;  2L5A A;  3WTP E;  5B1M D;  1ID3 C;  3X1S D;  3UT9 B;  3LJA C;  1P3B A;  3B6G B;  4Z5T D;  4XZQ C;  3AZF D;  3MVD C;  3VH5 T;  5B24 A;  3LEL D;  2ARO A;  1B6W A;  4H9Q B;  3KWQ B;  4LD9 D;  4AWL C;  3C1B C;  4YS3 D;  3AZG C;  3REJ D;  3X1V A;  4WU8 C;  3AV2 D;  2ZY3 A;  3C1B D;  5B32 D;  1M18 A;  1P3K B;  3REH D;  3KUY A;  1P3A B;  4J8W A;  3AZE B;  5GSU A;  3UT9 C;  5AVC A;  3AZK B;  5B40 B;  3W98 D;  5CHL B;  5B31 A;  2YFV B;  3MVD B;  3LZ0 B;  5AV9 B;  1S32 B;  4YM6 D;  5GSU B;  2Y2N A;  2F8N H;  4J8V B;  3MGR D;  3B0D C;  5AV8 B;  2PYO B;  4J8X D;  2BYK B;  4J8W C;  5AV5 A;  3UTA D;  4H9S C;  3WKJ D;  1N1J A;  1KX4 D;  1TAF A;  1T3U A;  4JJN A;  5B2I C;  2VQR A;  3V9R B;  4G91 B;  3AZN B;  3A6N D;  1F66 D;  2UWX A;  3W96 A;  4R8P A;  3X1T C;  1WWS A;  3AZI A;  1KX3 B;  2HUE B;  4H9O A;  2IO5 B;  1EQZ A;  2BG1 A;  3MGQ C;  1WWI A;  1BH8 B;  4WU8 A;  3KWQ D;  3AZG A;  5B2J D;  1TZY D;  4XZQ A;  2Y2M A;  1S32 C;  5GT3 A;  3UTB B;  5CPI B;  5B1M A;  3AN2 D;  1P3I D;  2LY8 A;  5B31 C;  4R8P B;  5B24 C;  4UPK A;  1KX5 B;  3AFA A;  4XUJ D;  5AVC C;  3WTP B;  5JA4 A;  4QLC A;  1HQ3 D;  4ZUX B;  5B24 D;  3AZH A;  1P34 C;  1M19 D;  3H0L C;  4H9N B;  1HQ3 C;  5B2I B;  3AZN C;  4H9O B;  2HIO A;  1P3G A;  3KUY C;  3EPK A;  4DQY B;  4X23 C;  3LZ0 D;  1M1A D;  2HUE C;  4NE3 A;  3LZ1 A;  4UUZ B;  4Z66 B;  1P3K A;  1BH9 B;  3F6T A;  3AV1 B;  2Y2O A;  3C1B A;  5GT3 B;  5B32 A;  2ZY4 A;  3B6F A;  5BNV A;  1JFI A;  2DF4 C;  3REH A;  5B0Z B;  5F99 B;  3REH C;  3MNN C;  4KGC A;  2J8P A;  4ZBJ C;  5CPI C;  2ARO C;  3MVD A;  5B31 B;  3W98 A;  1KX5 C;  2NQB B;  2CV5 B;  4KUD B;  2F8N G;  3VH5 A;  4ZUX C;  1P34 B;  5B0Y B;  4G92 C;  1BH9 A;  3LZ1 B;  3NQU A;  2NZD D;  2Y2L A;  4QLC C;  5AV5 D;  3X1U B;  3P5J B;  1P3F D;  1KX4 A;  2G5I C;  4Z66 C;  3NQU B;  2YFW A;  4JJN D;  3AN2 B;  1P3I B;  5GT3 C;  4R8P D;  1AOI D;  5AY8 B;  5G49 B;  3MNN B;  2YFW B;  5CPJ C;  3AZF B;  2BYM A;  3R45 B;  4X23 A;  2F8N K;  5G49 A;  1EQZ C;  5AV9 A;  1M1A B;  1TZY A;  4XZQ D;  1Q9C A;  5C3I C;  4J8X C;  2F2A C;  1M18 D;  5AVB A;  4JJN C;  3KXB B;  3KUY D;  4J8U B;  1P3L D;  3LZ1 C;  3AV1 A;  3AFA C;  3AZJ B;  1P3O B;  4QLC B;  5CP6 B;  1F66 C;  3AFA D;  1KU5 A;  4XUJ A;  1ID3 D;  5AVC D;  1HQ3 A;  3AZN A;  1M19 A;  5CPK B;  3AN2 C;  1P3I C;  3UTA C;  4E45 A;  5E5A A;  3MGR A;  1M1A A;  4KUD D;  3WKJ A;  4YM6 B;  3AZI C;  4WNN B;  5AV6 C;  3MGR B;  3REK B;  3W96 C;  1P3F B;  4J8X B;  3AV2 C;  4KGC D;  3W96 D;  4JJN B;  3AZL C;  2CV5 A;  1F66 B;  4H9Q A;  3NQJ A;  3WA9 B;  5B2I A;  4YS3 C;  3AZG D;  4WU8 D;  2RIQ A;  3MGS D;  3UTA B;  2FJ7 D;  5B33 B;  5AV5 C;  3WAA B;  3KSY A;  1P3F A;  3REK A;  3MGP B;  3KXB D;  3REI C;  3W99 A;  5BNX B;  3A6N B;  4QLC D;  3WAA A;  3AZH D;  1AOI A;  4H9R B;  1M18 C;  5B2J C;  5CP6 A;  4LD9 B;  3UT9 A;  2HIO D;  4HGA B;  5AVB C;  5CPJ D;  1P3G D;  4H9N A;  1M19 B;  5GT0 B;  1TZY B;  3TU4 D;  3WA9 C;  1U35 D;  1P3L A;  3MGP A;  3AV1 D;  5GXQ D;  3B6G C;  5BNV B;  3X1T D;  1JFI B;  3LJA A;  5BO0 B;  1P3B C;  4WNN A;  1ID3 A;  3AL0 C;  3LEL B;  3KWQ C;  5E5A D;  1H3O B;  3AYW D;  3WA9 D;  4AWL B;  5DNM D;  4LD9 C;  4WU8 B;  3AZG B;  3B6G A;  2ZY5 A;  1Z2C B;  4ZUX A;  3C1C D;  4WU9 C;  4UUZ A;  5BS7 C;  5DNN C;  5GT0 C;  2FJ7 B;  5F99 D;  5B0Z D;  2NZD B;  2BYK A;  4J8U A;  5AV8 A;  2PYO A;  1P3B B;  2YFV A;  2CV5 D;  2F8N A;  1B67 A;  3AYW C;  4X23 D;  3LZ0 C;  1A7W A;  2NQB A;  5AY8 D;  1P34 D;  3W98 B;  5B0Y D;  3B0C T;  4J8V C;  2BYM B;  5CPK A;  1ZLA C;  5AV9 D;  3REI A;  3LEL C;  3MGS A;  3AZE A;  2FJ7 A;  2HIO C;  5AVB D;  5KDM B;  1P3G C;  1BH8 A;  3AZK A;  3REL B;  3KXB A;  5B32 G;  3AZL D;  3W99 D;  4CAY B;  2Y2I A;  2Y2Q A;  4CSR A;  3AZN D;  3X1T B;  4Z2M H;  5CP6 D;  2IO5 C;  3X1S B;  3UT9 D;  2W8S A;  1ULY A;  1ID3 B;  2G5H C;  4KUD A;  3W97 D;  3O62 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...